(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE65

MICSR_1.PE65         Location/Qualifiers
FT   CDS_pept        123994..125280
FT                   /codon_start=1
FT                   /gene_family="HOG000062589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636070"
FT                   /orf_name="MICPUN_56637"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61616.1"
FT                   /db_xref="HOGENOM:HBG485380"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199AC2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U2"
FT                   /transl_table=1
FT                   /translation="MVAIEEGLTRINSAPYEALLPRPDSPPLRKADPNKATVAKWSETA
FT                   DIFEYGAAANPDMAPIPVLVHPPSLHEEGETRIIPFDINDCLDIETACTSPNLMASFVR
FT                   VRVGESIETKANATSQAFYVIRGTGSTSSEHGTVSWGDGDLFVVPVTEGALKHTCVEAE
FT                   KGGAALYWIHDEPLMDYLGVKPNGKKFEPTFFSREKMLAQVQEISHQQTEGERNRLGVL
FT                   LGNKACDQTKTLTHVLWSLLNSIPAKTVQRPHRHNSVALDLAVAASPNVYTLMGKEIDA
FT                   NGDIIDPIRCDWTPGGVFITPPGWWHSHHNESDEVAWVLPMQDAGLYTHQRTLDIRFVD
FT                   DELELHKAGKIRGSAFAVTNKQYMHMVECGATVPHTRVAGMKRVWSLQEVEEEDPSSSG
FT                   DAAAPKKKTVKKVASYSRLPAMKASSVEP"
     atggtcgcca tcgaggaagg actcacccgg atcaacagcg ccccgtatga ggcgctcctg        60
     ccccgcccgg actccccgcc gttgagaaag gctgacccca acaaggccac cgtcgctaag       120
     tggtccgaga cggccgacat cttcgagtac ggcgccgcgg ccaacccgga catggccccg       180
     atccccgtcc tcgtccaccc cccctcgctg cacgaggagg gcgagacgcg catcatcccc       240
     ttcgacatca acgactgcct cgacatcgag accgcgtgca catcccccaa cctcatggcc       300
     tccttcgtcc gcgtccgcgt cggcgagtcc atcgagacca aggccaacgc cacctctcaa       360
     gccttctacg tcatccgcgg cacgggctcc acctcctccg agcacggcac cgtctcgtgg       420
     ggcgacggcg acctcttcgt cgtccccgtc accgagggcg ccctcaagca cacctgcgtg       480
     gaagccgaaa agggcggcgc cgcgctctac tggatccacg acgaacccct catggactac       540
     ctcggggtca aacccaatgg aaagaaattc gaacccacct ttttctcgcg cgagaagatg       600
     ctcgcgcagg tgcaggagat ctcgcaccag cagaccgagg gcgagcgcaa ccgactcggc       660
     gtcctcctcg gtaacaaggc gtgcgatcag accaagactt tgacgcacgt cctctggtcc       720
     ctcctcaact ccatcccggc caagactgtg cagagacccc acaggcacaa ctcggtggcg       780
     ctggatttgg ccgtcgccgc gtcgcccaac gtctacacgc tgatgggcaa ggagatcgac       840
     gcgaacggcg acatcatcga cccgatccgg tgcgactgga cccccggcgg cgtcttcatc       900
     accccgcccg ggtggtggca ctcgcaccac aacgagtcgg acgaggtcgc gtgggtgctc       960
     cccatgcagg acgccggctt gtacacgcac cagaggacgc tcgacatccg gttcgtggac      1020
     gacgagctgg agctgcacaa ggctggcaag atccggggca gcgcgttcgc ggtgacgaac      1080
     aagcagtaca tgcacatggt ggagtgcggc gcgaccgtcc cgcacacgag agtcgcgggg      1140
     atgaagcggg tgtggagctt gcaggaggtg gaggaggagg acccgtcatc ctccggcgac      1200
     gccgcggcgc ccaagaagaa gaccgtcaag aaagtcgcca gctatagcag gcttcccgcg      1260
     atgaaggctt cgtccgtgga gccgtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page