(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE66

MICSR_1.PE66         Location/Qualifiers
FT   CDS_pept        join(complement(127443..127501),complement(125420..127298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636071"
FT                   /orf_name="MICPUN_56638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62062.1"
FT                   /db_xref="UniParc:UPI000199AC2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U3"
FT                   /transl_table=1
FT                   /translation="MAAWEMTKEALRKVCRDNNGYAHAPELNDVLHLHCKGIAEITNLE
FT                   EYTGLKTLYLESNSVDDLEGLLHLDRLRCLYIAKNCLRDLDRAARLVALTTLDVSDNQI
FT                   VTLEGLRDHPSLSTLVAVNNKLREVSAIEALGSCVQLVTVDLSRNKLEDRAVVDFFLSP
FT                   AMSDRIRLLKLQGNPAVSEVPSYRKTLVSGMKRLNYLDDSPVFPKDKRLAAAWLRGGVE
FT                   EEKAERARIFEDERRERERHRAAFDDMVANARREAEEKERAGIRTKRDPYRFMSEEAAE
FT                   EARMLADGMTEWELEEMRANEQLPWQVRERERTLSEKTEADRAPNRAERPDEDDEDDEE
FT                   EGDGVAEVGPPEHVADDDGDERIPVAIPIDDDRPTPGIFVAQVDDDDDPAAPASAPPPP
FT                   PAPTSTTMTDEDREASEASAAEELRRELEKMRAARRGDRHEVVDGATRRRKELERAADS
FT                   ANRSGGRGSGSQRSPVVFGTRAYDQLWAQAKAMGDADGDNGEEVREDDEDSLDKESFKE
FT                   SFKDEDGVQNELDADGANSVNSESVDGTSNYSYGDKENRWERASMASVGATVASTEAGE
FT                   LDGIDEFDETEDETENTEDTEDTDEVNSTDGDDPLDRYTVSTVASGKETGKETGDDGRA
FT                   ANDDELWGLD"
     atggcggcgt gggagatgac caaggaggcg ctccggaagg tatgccgcga caacaacggc        60
     tacgcgcacg cccccgagct caacgacgtg ctccacctgc actgcaaggg catcgcggag       120
     atcacaaacc tcgaggagta caccggcctg aagaccctgt acctcgagag caactccgtc       180
     gacgatctcg agggcctcct ccacctggac cggctgcggt gcctctacat cgcgaagaat       240
     tgcctgcgcg acctcgaccg cgcggcgcga ctcgtcgcgt tgaccaccct ggacgtcagc       300
     gataaccaga tcgtcaccct ggagggcctc agggaccacc cgtcgctctc cacgctcgtc       360
     gcggtgaaca acaagttgag agaggtctcc gccatcgagg ctctcgggtc gtgcgttcaa       420
     ctggtcacgg tggacctctc gcggaacaag ctcgaggacc gcgcggtggt ggactttttc       480
     ctctcccccg cgatgagcga ccggatccgg ctgctgaagc tgcagggcaa ccccgcggtg       540
     agcgaggtgc ccagctatcg caagacgctg gtgtcgggga tgaagcggct caactacctc       600
     gacgactcgc cggtgtttcc aaaggataag cgtctggccg ccgcgtggct gcgaggcggc       660
     gtcgaggagg aaaaggcgga gcgcgcgagg atattcgagg acgagcggag ggaacgcgag       720
     cggcacaggg cggcgttcga cgacatggtg gccaacgcca ggcgcgaggc tgaggagaaa       780
     gagcgagcgg gaatacgaac gaagagggac ccgtacaggt tcatgagcga ggaggctgcg       840
     gaggaggcga ggatgctggc ggacgggatg accgagtggg agctcgagga gatgcgagcg       900
     aacgagcagc tgccgtggca ggtgcgcgaa agagagagga cattaagcga gaaaaccgag       960
     gcggatcgcg cgccgaaccg ggcggagcga cccgacgaag acgacgagga cgacgaggaa      1020
     gaaggggatg gcgtcgcgga ggtcggcccg cccgagcacg tcgcggacga tgacggcgac      1080
     gagcgcatcc cggtcgccat cccgatcgat gacgaccgac ccacgcccgg catcttcgtc      1140
     gcgcaggtgg acgacgacga cgacccggcc gccccggcct ccgctccgcc tccgccgccc      1200
     gccccgacat caacgacgat gaccgacgaa gatcgcgagg cgtcggaggc gtccgccgcg      1260
     gaggagctca ggcgcgagct ggagaagatg cgggcggcga ggcgaggcga ccggcacgaa      1320
     gtagtcgacg gcgcgactcg taggaggaaa gagttggagc gcgccgcgga ttcggctaac      1380
     cgatcgggcg ggcgggggtc gggcagccag aggtccccgg tggtcttcgg gacccgggcg      1440
     tacgaccagc tgtgggcgca ggcgaaggcc atgggcgacg cggacggcga caacggcgag      1500
     gaggtacgcg aggacgacga ggactcgttg gacaaagaat ccttcaaaga atccttcaaa      1560
     gacgaggacg gcgttcaaaa cgagctcgac gcggacgggg ccaactcggt caactcggag      1620
     agcgtcgacg gcacgtccaa ctactcgtac ggggataagg aaaatcggtg ggagcgggcg      1680
     tccatggcgt cggtgggtgc cacggtggcg tccacggagg ctggcgagct cgacggcatc      1740
     gacgaattcg acgaaaccga ggacgagacg gaaaacaccg aggataccga ggatacggat      1800
     gaagttaatt cgacggacgg ggacgacccg ctggacaggt acacggtgag caccgtcgcg      1860
     agcgggaagg agaccgggaa ggagaccggg gacgacggac gcgcggcgaa cgacgacgag      1920
     ctttggggtc tggattga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page