(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE68

MICSR_1.PE68         Location/Qualifiers
FT   CDS_pept        complement(129992..130489)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636073"
FT                   /orf_name="MICPUN_56640"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62063.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AC2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U5"
FT                   /transl_table=1
FT                   /translation="MKLLDALSGRVTRSARFREYVDQSFAEVDHNANGSLDRAELHLAV
FT                   MLFFDKLNAKVKKRAIPPTKAELMALFDEVDTDESGELSLEEFVAYMERLCAQCTSGLT
FT                   VSLLKSFIAVPFTAIALSVGIKKVAPGMHQKIKEAKGLGSATLSFCASQIVNKVPAFAA
FT                   VP"
     atgaagctcc tcgacgcgct ctccggccgc gtcacgcgca gcgcccgctt ccgcgagtac        60
     gtcgaccaaa gtttcgcgga ggtggatcac aacgccaacg ggtcgctgga ccgggcggag       120
     cttcacctcg ccgtcatgct cttcttcgac aagctcaacg cgaaggttaa gaagcgcgcg       180
     attcccccga cgaaggccga gctcatggct ctgttcgacg aggtggacac cgacgagagc       240
     ggggagctga gcctcgagga gttcgtggcg tacatggaga ggctgtgcgc gcagtgcacg       300
     agcgggctga cggtgtcgct gctcaagtcg ttcatcgcgg tgcccttcac ggcgatcgcg       360
     ctgagcgtcg ggatcaagaa ggtggcgccc gggatgcacc agaagatcaa ggaggcgaag       420
     ggtctggggt ccgcgacgct gtcgttctgc gcgtcgcaga tcgtaaacaa ggtgccggcg       480
     ttcgcggcgg tcccctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page