(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE69

MICSR_1.PE69         Location/Qualifiers
FT   CDS_pept        complement(130670..132871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636074"
FT                   /orf_name="MICPUN_56641"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62064.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U6"
FT                   /transl_table=1
FT                   /translation="MAAPDAPDESTSRMGPYDVLEQIGKGAFGAAWIIQTRGNDSNPPR
FT                   RFVLKKIPLARLSERQRHLSLQERQLVAALRHPYIVPYHRSWIERSHTVCIVMRHCDGG
FT                   DLASAAWRARRRRERFPEQTLRRWLAQLLSALAYLHSERVIHRDVKCGNVFLASPPGFE
FT                   PGTSHAPTNSTNSWGDVMLGDFGLARVVDANAADDVQATSTVGTPHFMSPEMLRGAKYG
FT                   FAADVWSLGCVMYELTTLRQPFTAFNMEGLRRKILTSPPAAFIQPGKEGEEDASLYGDG
FT                   WRATIRSMLRKAPEERPSASELLRTSDMADAAADADARAREIEAAAAAERREEGRGEEG
FT                   GEDGRGDGAGDAAFLAAPDREPMPAPGGDWSPSADERSQPPGRSSVRRGWADLDPSYMR
FT                   FNPQRKPRPPPRPQSARPARASTGAPRNPDTETGQKQRAAATPATQKTAQKTAGRRPGW
FT                   NASPRVRPASGGPLGRPASAPRTPSSGDRAAARRASGVVVTGRAVTGRAVTGRAASGGG
FT                   ADGSDGFDPYAPVAAEPASALAPKHPADENEAPNNTDETPSKSRDEAPSWTRDEAPSRD
FT                   DVVARARRLLAETSPKLAAPSPIARHDGTDDDADDSRVLRAVAALHARGRHAELARVLS
FT                   NFYPPAEAIPPTPSAPDLEPGQCVMVGASSPTRGTIRYVGAVAFAEGEWVGVEMDDEGV
FT                   GAVTGRAVTGRDGRVGAIQYFACRPGRGVFVPAATLTRA"
     atggcggcgc cggatgcccc ggatgagagc acgtcgcgca tgggcccgta cgatgtcctc        60
     gagcagatcg gcaagggcgc gttcggagcc gcgtggatca tccagacccg cgggaacgac       120
     tcgaaccccc cgcggaggtt cgtgctgaag aagatcccgt tggcgcggct gagcgagcgg       180
     cagaggcacc tcagcctcca ggaacgccag ctcgtcgccg cgctccgcca cccctacatc       240
     gtcccctacc accgcagctg gatcgagcgc tcgcacaccg tgtgcatcgt catgcgccac       300
     tgcgacggcg gcgacctcgc gagcgccgcg tggcgcgcca ggcgccgacg agagcgattc       360
     ccggagcaga cccttcgtcg atggctcgcg cagctcctct ccgcgttggc gtacctccac       420
     tccgagcgcg tcatccaccg cgacgtcaag tgcggcaacg tcttcctcgc gtccccgccc       480
     ggattcgaac ccgggacgtc ccacgccccc accaactcga ccaactcgtg gggggacgtg       540
     atgctcggcg actttggcct cgctcgagtc gtcgacgcca acgcggcgga cgatgtccag       600
     gcgacgtcca ccgtcggaac cccgcacttc atgtcgccgg agatgctgag gggcgccaag       660
     tacggcttcg ccgccgacgt gtggtccctc ggatgcgtga tgtacgagct cacgaccctg       720
     cggcagccgt tcaccgcgtt caacatggag ggactccggc gaaagatcct aacgtcgcca       780
     cccgcggcgt ttatccaacc cgggaaggag ggcgaggagg acgcgtcgct gtacggggac       840
     ggctggaggg cgacgatccg gtcgatgctt cgcaaggcgc ccgaggagcg acccagcgcg       900
     agcgagctgc tgcggacgtc ggacatggcg gacgcggcgg cggatgcgga tgcgcgcgcg       960
     agggagatcg aggcggcggc ggcggcggag aggagggagg aggggagggg ggaggagggg      1020
     ggagaggacg ggcgaggcga cggcgcaggc gacgcggcgt tcctggcggc gccggaccgc      1080
     gagccgatgc ccgcgccggg cggtgactgg tcgccctccg cggatgagcg ctcccaaccc      1140
     cccgggcgct cgtccgttcg caggggttgg gcggatctgg atccgagcta catgcgattt      1200
     aacccgcaga gaaaaccgag gccgccgccc cggccgcagt cggctcgccc cgcgagggcg      1260
     tcgacgggcg cgcctcggaa cccggacacg gagacgggtc aaaaacagcg agcggcggcg      1320
     acgccggcga ctcaaaaaac ggctcaaaaa acggcggggc ggcggcccgg gtggaacgcc      1380
     tcgccgcgcg tgaggcccgc gagcggcggc cccctcgggc gcccggcgag cgccccgagg      1440
     acgccctcgt cgggcgaccg cgcggcggcg aggagagcgt cgggcgtcgt ggtgactggt      1500
     cgggcggtga ctggtcgggc ggtgactggt cgagccgcgt ccggcggcgg cgcggatgga      1560
     agcgacggtt tcgacccgta cgcgccggta gccgccgaac ccgcctccgc gctcgcgccg      1620
     aagcatccgg cggatgagaa cgaggctccg aacaacacgg acgagactcc gagcaagagc      1680
     agggacgaag ctccgagctg gaccagggac gaagctccga gcagggatga cgtcgtggcc      1740
     agggcccggc ggcttctcgc cgagacctca ccgaagctcg ccgcgccgtc gccgatcgcc      1800
     cgacacgacg gcacggacga cgacgcggac gactcgcggg tgctgagggc ggtcgcggcg      1860
     ttacacgcga ggggacggca cgccgagctc gcccgcgtgc tgtcaaactt ttaccctccg      1920
     gcggaggcga tccccccgac gccctcggcg cccgacttgg agccgggtca gtgcgtgatg      1980
     gtgggcgcgt cgagccccac gcgcgggacg attcgatacg tcggcgccgt ggcgttcgcc      2040
     gagggggagt gggtcggcgt ggagatggac gacgaggggg tcggcgcggt gactggtcgg      2100
     gcggtgactg gtcgggacgg ccgcgtgggc gcgatccagt acttcgcgtg ccggccggga      2160
     cgcggggtgt ttgtcccggc ggcgacgctg acccgcgcgt ga                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page