(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE7

MICSR_1.PE7          Location/Qualifiers
FT   CDS_pept        18257..19363
FT                   /codon_start=1
FT                   /gene_family="HOG000243720" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636012"
FT                   /orf_name="MICPUN_79463"
FT                   /product="GHMP kinase"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG316421"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AA4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N4"
FT                   /transl_table=1
FT                   /translation="MTVGHICPDATDDITHRAYARVGLLGNPSDGYFGKCISVSVQNFF
FT                   AEVTLTPNQQMFSSRVTIEPGPSDSTVFESLETLAVTTAKSGYYGGVRLLRALCFKFQE
FT                   YCAERGYDLAERGFTLEYESNIPTQAGLSGSSAIIVAGLKCLMQHYSVYIPLEEQPALV
FT                   LSCEHDLGINAGLQDRVIQCYEGVVYMDFSNEEMVRTQGKGVYTRLPETCLPPLHIVYD
FT                   DNPSDSGKVHADVKQRWERGDADVRSKMSRIAELAERGYKVLSSIGTDKQTGEPMIELG
FT                   MLMNANFNLRKEMFGAEALGARNVEMIDTARGTGSFAKFTGSGGAAVVLCPTNSEEERE
FT                   AMYADCEAKGFKVCPLVVNPGKPSGGAA"
     atgacggtgg gccacatatg ccccgacgcg acggatgaca tcacacatcg cgcatatgcc        60
     agagttggcc tgctcggcaa ccccagcgac ggatacttcg gcaagtgcat ctcggtctcg       120
     gttcaaaact tcttcgcgga ggtgacgttg accccaaatc agcagatgtt cagctcacgc       180
     gtgaccatcg agcccggacc gagcgactcg accgtgttcg agagcctcga aacgttggcg       240
     gtaacaacgg ccaagagcgg ctactacggc ggcgtgcgcc tgctgcgcgc cctgtgcttc       300
     aagttccagg agtactgcgc cgagagggga tacgacctcg ccgagcgcgg cttcacgctt       360
     gagtacgagt ccaacatccc aacacaggcg ggtctgagcg gttccagcgc catcatcgtc       420
     gccggactga agtgcctcat gcagcactac agcgtctata ttccactgga ggaacaaccc       480
     gcgctcgtgc tgtcttgcga gcacgacctg ggtatcaacg cggggcttca ggacagggtg       540
     atccagtgct acgagggcgt cgtgtacatg gacttctcaa acgaggagat ggttcgaacc       600
     cagggcaagg gggtgtacac acgactgccc gagacgtgcc ttccgcccct acacatagtc       660
     tacgacgata accccagcga cagcggcaag gtgcacgccg acgtcaagca gcgatgggaa       720
     cgaggcgacg cggacgtcag gtcgaagatg tccagaatcg cggagctcgc cgagcgcggg       780
     tacaaggttc tgtcgtcgat tggcacagat aagcagacgg gcgagcccat gatcgagctc       840
     ggaatgctga tgaacgccaa tttcaacctg aggaaggaga tgttcggcgc cgaggctctg       900
     ggcgccagga acgttgagat gattgacacc gcgcgaggga cggggtcctt tgccaagttc       960
     accggcagcg gcggcgcagc cgtggtgctg tgccccacga atagcgagga ggagcgagag      1020
     gcgatgtacg cggactgcga ggcgaagggg tttaaggtgt gtccgctcgt ggtgaatcca      1080
     gggaaaccat cgggaggtgc cgcgtag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page