(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE70

MICSR_1.PE70         Location/Qualifiers
FT   CDS_pept        complement(133147..134469)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636075"
FT                   /orf_name="MICPUN_56642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62065.1"
FT                   /db_xref="UniParc:UPI000199AC9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U7"
FT                   /transl_table=1
FT                   /translation="MRGSASRTVAWAALARSATIDPARIIASAARASAPAHRREDASRS
FT                   RGRWIERRRRHEHPRFSTVGEAFLVAAHAEVLRRAGAEVPANLAQLLAVVTAEGASPLP
FT                   PDARDGLHPLVLPIAKAWRGDRDDDRVVGLLLRPSPSSPRAPLAGPLPVVLAGPGGVRM
FT                   LAKDAASYVHAAIIREDASPASATTTPEPYPVAGAAGAAGRAMYTRGELAASSMPDRPE
FT                   VFILRNVGKFPDDMEAMALRHLRGVEKEGASPSQSAVTSALVTAEWYANDRAFEGWAGP
FT                   QAFNARMLFAMGRADEARDAARVALSTAACWDTVGTERGGAAEMAALAGLDARMGAREL
FT                   REMLETGGEAHKAAAAAMAGRIPENVGASGGPRGEGGMSEETSRGYATRAAAAALDAVA
FT                   LGSEADVARGAGESWENAREEVGSAYGEAGLAGLAAFVLRR"
     atgaggggct cggcgtcgag gaccgtcgcg tgggcggcgc tcgcccggag cgcgacgatc        60
     gaccccgcgc ggatcatcgc ctccgccgcg cgcgcgtcgg cgcccgcgca tcgtcgcgaa       120
     gacgcatcgc ggtcgcgcgg tcgatggatc gagcgacgtc gtcgtcacga gcaccctcgg       180
     ttcagcaccg tcggcgaggc gttcctcgtc gccgcgcacg ccgaggtgct ccgccgcgcc       240
     ggcgccgagg tcccggcgaa cctcgcgcag ctcctcgcgg tcgtcaccgc ggagggcgcc       300
     tcgccgttac ccccggacgc tcgagacgga ctgcacccgc tcgtcctccc gatcgcgaaa       360
     gcgtggcgag gcgatcgcga cgacgatcgg gtcgtggggc tgctgctgcg cccgtcgccg       420
     tcgtcgcccc gtgcgccgct cgcgggtcca cttcccgtgg tcctcgcagg ccccgggggg       480
     gtccgcatgc tcgcgaagga cgcagcatcc tacgtccacg ccgccataat ccgtgaagac       540
     gcttcgccgg cttccgcgac gacgacgccg gagccgtacc cggtggccgg cgcggctggc       600
     gcggcggggc gggcgatgta cacccgcggc gagctcgccg cgtcgtccat gccggaccga       660
     ccggaggttt tcatactacg aaacgtgggc aagttccccg acgacatgga ggccatggcg       720
     ctgcgtcacc tgcgaggagt cgaaaaggag ggcgcgagtc cgtcgcaatc cgccgtcacc       780
     agcgctctgg tcaccgccga gtggtacgcg aacgaccgcg cgttcgaggg atgggccggt       840
     ccgcaggcgt tcaacgcgag gatgttgttc gcgatgggcc gcgcggacga ggcgagggac       900
     gccgcgaggg tcgcgctgtc caccgcggcg tgctgggaca cggtgggcac cgaacgcggc       960
     ggcgccgcgg agatggcggc gctcgccggc ctcgacgcta gaatgggcgc gagggagctc      1020
     cgggagatgc tggagaccgg gggcgaggcg cacaaggcgg cggcggcggc gatggcgggg      1080
     cggatccccg agaacgtagg cgcctcgggg ggtccgcggg gagaaggagg aatgtccgag      1140
     gagacgtcgc gagggtacgc gacgcgcgcg gcggcggcgg cgttggacgc ggtggctctc      1200
     gggtcggagg ctgacgtggc acggggcgcg ggggagtcgt gggagaacgc gagggaggag      1260
     gtggggtcgg cgtacgggga ggctggcctg gcggggttgg cggcgttcgt gcttcgcagg      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page