(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE71

MICSR_1.PE71         Location/Qualifiers
FT   CDS_pept        134554..135915
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636076"
FT                   /orf_name="MICPUN_56643"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61618.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AC9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U8"
FT                   /transl_table=1
FT                   /translation="MPSSSPSSSSSSGGTSAKRRRAKYERKFLRAAARGSLRGCKKALK
FT                   RASSRGSGVDAGFLDVTSASDPDGRTALHLACASGDDDLARWLIKRGADVTSTDARGDT
FT                   PAHLAAHRAPDNVAITRRLTRAGASTHARNDAGETPSSIAERAAESRAARMREFDARRE
FT                   ARTRRGRDADDYEGLGRGPSREAIEEMEWREKLRAEAALGDAIDEFGGGTAGIGTADEM
FT                   NAFYASYVDDWDDGSAYAWREEEEAYAEYMRAGMAARRRKRLDDDNDDDDPRRRRRDSA
FT                   AEAQARATRERDEAAQRVLDEERRKDAEWRERTARRATQQASSSVSSSVFTDFATYRRR
FT                   WGIAAAKADRGESIAYADVPWPFDPESRRGEPDERVVRDVLLGPTGAGAVEEGSGSDAA
FT                   RRALRSEMLRWHPDKFFASKVGSRVASEDVERTRLGVNAVAGVIASLFRRSAGS"
     atgccctcct cgtccccgtc ctcgtcctcg tcctccggcg ggacgagcgc gaagaggaga        60
     cgggcgaagt acgagcgcaa gttcctccgc gcggcggcga ggggaagcct ccgcggctgc       120
     aagaaggcgc tgaagcgcgc gtcgtcccgc ggatccggcg ttgatgcggg tttcttggac       180
     gtcacctccg cgtcggatcc cgacggtcgc accgcgctgc acctcgcgtg cgcgtccggc       240
     gacgacgacc tcgcgcgatg gctcatcaag cgcggcgcgg acgtcacctc cacggacgct       300
     cgcggcgata cccccgcgca cctcgccgct caccgcgccc cggacaacgt cgccatcacc       360
     agacgcctga ctcgcgccgg ggcgagcacg cacgcgcgga acgacgcggg agagacccca       420
     tcgtccatcg cggagcgcgc cgcggagtcg cgcgcggcgc gcatgcgcga gttcgacgcg       480
     cggcgcgagg ccaggacccg ccgcgggcgc gacgccgacg actacgaggg actcgggcgc       540
     ggtccatcga gagaggcgat cgaggagatg gagtggcgcg aaaagctccg cgccgaagcc       600
     gcgctgggcg acgccatcga cgagttcggc ggcggcaccg ccgggattgg aaccgcggac       660
     gagatgaacg cgttctacgc gtcgtacgta gacgattggg acgacgggag cgcgtacgcg       720
     tggagggagg aggaggaggc gtacgcggag tacatgcgcg ccgggatggc ggctcggcga       780
     cggaaacggc tcgacgatga taacgacgac gacgacccga ggaggaggag gagggattcg       840
     gcggcggagg cgcaggcgcg cgcgacgcgc gaacgcgacg aggccgcgca gcgcgtcctc       900
     gacgaggagc gccgcaagga cgcggagtgg cgcgagcgga ccgcgcgtag ggcgactcaa       960
     caggcgtcgt ccagcgtctc atcaagcgtc ttcacggatt tcgcgacgta caggcggcga      1020
     tgggggatcg cggcggcgaa ggcggatcgc ggcgagtcga tcgcctacgc cgacgtcccg      1080
     tggccgttcg atcctgagtc gcgtcggggc gaacccgacg agcgcgtcgt tcgcgacgtg      1140
     ctgctgggtc ccaccggtgc gggcgccgtc gaggaaggtt cgggttcgga tgccgccagg      1200
     cgagcgcttc gatcggagat gcttcggtgg cacccggata agtttttcgc ctcaaaggtg      1260
     ggctcgcggg tggcgtcgga ggacgtggag aggacgcggc tcggggtgaa cgcggtggcc      1320
     ggcgtcatcg cgtcgctgtt caggcggtcc gcgggatcgt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page