(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE73

MICSR_1.PE73         Location/Qualifiers
FT   CDS_pept        136695..137873
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636078"
FT                   /orf_name="MICPUN_56645"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61619.1"
FT                   /db_xref="UniParc:UPI000199ACA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V0"
FT                   /transl_table=1
FT                   /translation="MARGTLRTTPRRANRPVGDEEAATRKMGAMGTGGVSVNARLNLEA
FT                   VERTLAALSGGKENDALGLDTVLVKGLHDMAIDEAIARAGRKASARAGKGIVHNRKGPT
FT                   VSVPDAVKTPAAVRAIVAKALAGKVLSRREQDRLRDELERREGAVPGKPPASSPFTPPP
FT                   PPVNTPVGLARRYPAMTCGDTNESADADASPPFAMTPTLLAEAARLAMRNVGTGKGPSN
FT                   PLGRALAAGERGEPLTSTQRNILDAVEELRAGKIIPDDRMRLLEWAQTDDDDVAVAKGS
FT                   RPMTSPSTVASLCAATFGILPLTPPSDADEDAASSYASDEVFSFDQGKIAGENRVEETS
FT                   PEPWISPVEFNRGKSMTPTLEELARRKEGGEALTEGEDAMVSIFKLASPVAR"
     atggcgagag gtaccctgcg caccacgccg aggcgcgcga accgcccggt cggcgacgag        60
     gaagccgcga cgcgcaagat gggcgccatg gggaccggcg gggtctcggt caacgcgcgg       120
     ctgaatctcg aggcggtgga gcggacgctc gcggcgctca gcggcggcaa ggagaacgac       180
     gcgctcggtc tggacaccgt cctggtgaag ggattacacg atatggccat cgacgaggcc       240
     atcgcgcgcg cggggaggaa ggcatcggcg cgcgcgggca aggggatcgt ccacaaccgg       300
     aagggcccga cggtgtcggt gcccgacgcc gttaagaccc ccgccgcggt ccgcgccatc       360
     gtggccaagg ctctcgccgg aaaggtcctc tcgaggcgcg aacaggatcg actcagggac       420
     gagctcgagc gccgcgaggg ggcggtgccg gggaagcccc ccgcgtcgtc gccgttcacc       480
     ccgcccccac cgcccgtgaa cacccccgtc ggcctcgccc gtcgctaccc agccatgacg       540
     tgtggggaca cgaacgagtc cgcggacgcg gacgcgtcac cgccgttcgc gatgaccccc       600
     acgctcctcg ccgaggctgc gcggctcgcg atgcgcaacg tcgggaccgg gaagggaccg       660
     tcgaacccgc tcggcagagc gctcgccgcg ggggagcgcg gcgagcccct cacctccacg       720
     cagaggaaca tcctggacgc cgtggaggag ctgagggcgg ggaagattat accggatgac       780
     cgcatgcggc tcctggagtg ggcgcagacg gacgacgacg acgtcgccgt cgcgaagggg       840
     tccaggccga tgacgagccc gtcaacggtg gcgtcgctgt gcgccgccac cttcgggatc       900
     ctccctctca cgcccccgag cgacgcggat gaagacgcgg cgtcgtctta cgccagcgac       960
     gaagtcttca gctttgacca ggggaaaatc gcaggggaaa atcgcgtaga ggagacgagc      1020
     ccggagcctt ggatatcgcc ggtggaattc aaccgaggca agtccatgac gcccacgctg      1080
     gaggagctgg cgaggcggaa agagggcggg gaggcgctga cggaggggga ggacgcgatg      1140
     gtgagcatat tcaaactggc ttcgccggtg gcgcgatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page