(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE74

MICSR_1.PE74         Location/Qualifiers
FT   CDS_pept        join(138883..140250,140386..140703,141030..142961)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636079"
FT                   /orf_name="MICPUN_56647"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="protein folding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61620.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199ACA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V1"
FT                   /transl_table=1
FT                   /translation="MNAALSGAALGARLPAIRASKTFGRREGSVSPIQTRISALETAHH
FT                   GRVTESTPPPPPHVEKTVRVGVARVPSDIYAANKVAPDIAAVSRLGAGEISDPRLLLRR
FT                   ALPFVLPDSHPLARVEDSLMEHAGEVKTRGMGSRSISNEALVENLEAQAAPGRGQRASL
FT                   AARRAVATIRSERDALVSFAVAAGNGAVADDIVAELDDVLQSIVDRSEATTTAETTERQ
FT                   SEKKLELDFERALLLVARLQACGADAPAFPVPPRDSPVPGAPPGVVIPRDAMPLNRRAW
FT                   VDLTVRKAKTGEKIVVRVAVDGFNAPYAAGRFMQLAETNGFKRIDRADGFIVAFGEDVG
FT                   TPRHPSASTPLPLEVKLADDGKSEPPLYGVSVDDAGARNARVELPFNAYGTLAMSHSAD
FT                   DVNDGATQFFFLTKESEVTPSGTNVLDGRWSVVGYAVDGAEGLADLNAGDVIESVRETK
FT                   RKKTVDGGLSVPDLALRISRGGFFQVPSIKSRCLGEEARRGTSHGRPERDAPCLSAGTT
FT                   ATGASRRRVARCRARGGWSPACFARISPATPPTSSSRRCAIRTLTATSDVLREPDWGVN
FT                   VDMCDLVNSNFHRYGKDTVKALRLKLQKKTKPQTQYLALVALEMCMKNCGVMFHAKVIE
FT                   KACLDETTKCGAQRGGDARVKQKALALVQEWALQLQLPQYRAAFDELRRKGERFPPTEL
FT                   TSAEVTPMYTPRPNRVDIVEQRLAQMDPADAAAVRAAVAEAEAEVEAEERRMGTRSPRV
FT                   SNGFATSPGGGSTPVGSPPGTRGFRVGSPPGSSARPAAPPRGYEALDEDEPFHGTAERN
FT                   GTAERTYSDGNPYGTAGGGHTSNPTPRSHHAHYPVSHRPELQPPAADASALGDVTSPDA
FT                   VKKLHEDLDVASNTVKVLRDMLGEVDVVTSPEALNDPTIDELSEQCAQMRPRVVSLVQS
FT                   VADESLLMKALSLNDELSEVAQKRDALRAAASADRDTRAAIVASMREEEAAAQRHASAG
FT                   DASGGAPVGNLVDLLGGVSVDPGTDARPGKDKAAPGRAAAAGRAAAADPFGLAAADAPV
FT                   DPFDVSVTVGDGGNVRGRPGASNPLDELLAPPPPPPQVYDPFAASAGVDPASTPPAGGS
FT                   HQPANYYPTVAGTARGGGAVSDPFASANPFASRPPGASPMGAMSVNPLFQAQQQPQQPA
FT                   SSGGMGSLPPAIGASQAPYDPFAASPPPQQRGGSNPFAR"
     atgaacgccg cgttatccgg cgccgccctc ggcgcgcgtc ttcccgcgat tcgcgcgtcg        60
     aaaaccttcg ggcggcgcga ggggtccgtg tcgccaatcc aaactcgaat ctcagccctc       120
     gaaacggcgc atcacggcag ggtcaccgag agcacccctc cgccgccgcc gcatgttgag       180
     aaaaccgtgc gcgtcggcgt cgctcgcgtt ccgtccgaca tctacgccgc gaacaaggtc       240
     gcccccgaca tcgccgccgt ctcgagactc ggcgccggcg agatctcgga tccgaggctg       300
     ctgctgcgca gagcgctgcc gttcgtcctg ccggattcgc acccgctcgc ccgcgtcgag       360
     gactcgctca tggagcacgc cggcgaggtg aaaacccgcg gcatgggctc gcgctccatc       420
     tccaacgagg cgctcgtgga gaacctcgag gcgcaagccg cgccgggccg gggccaaaga       480
     gcctctttag ccgccagacg agccgtcgcg acgatcagat ccgaacgtga cgccctcgtc       540
     tcgttcgccg tcgccgccgg caacggcgcc gtcgccgacg acatcgtcgc cgagctcgac       600
     gacgtcctcc agtccatcgt cgaccggtcc gaggcgacga cgaccgccga gacgaccgag       660
     cgccaatccg agaagaagct cgagctggac tttgagcgcg ctttgctgct cgtcgcgagg       720
     ctgcaggcgt gcggcgccga cgcgcccgcg tttcccgtcc cgccgaggga ctcgcccgtc       780
     cccggcgccc cgcccggcgt cgtcatcccg cgcgacgcga tgcccctcaa ccgccgcgcg       840
     tgggtcgatc tcacggtacg taaggcgaag acgggggaga aaatcgtcgt tcgcgtcgcc       900
     gttgacggct tcaacgcccc ttacgccgcg ggtcggttca tgcagctcgc ggaaaccaac       960
     gggtttaaac gaatcgaccg agccgacggc ttcatcgtgg cgttcggcga ggacgtcggc      1020
     acccctcggc acccctcggc ctcaacgccc ctgccgctcg aggtgaagct cgcggatgac      1080
     ggcaagtcgg agcctccgct ctacggcgtg agcgtcgacg acgccggggc gaggaacgct      1140
     cgcgtcgagc tcccgttcaa cgcgtacggc accctcgcca tgtcgcactc ggcggacgac      1200
     gtcaacgacg gcgcgacgca gttcttcttc ctgacgaagg agagcgaggt gacgcccagc      1260
     gggacaaacg tgctcgacgg tcggtggagc gtggtcgggt acgccgtgga cggcgcggag      1320
     gggctggcgg acttgaacgc gggcgacgtc atcgagtccg tgcgcgagac gaaacgcaaa      1380
     aaaaccgtcg atggcggtct gtcggtgccc gatttggcac tccgaatctc gcgcggtgga      1440
     ttcttccagg tcccttccat caagtcccgg tgcctgggcg aagaggcgcg cagagggacg      1500
     tcgcacggcc gccccgagcg cgacgcaccg tgtctatcgg caggcacaac cgccacaggc      1560
     gcgagccgcc ggagagtcgc gcggtgtcga gcgcggggag gatggtctcc agcctgtttc      1620
     gctcggataa gtccggcaac cccgcctaca tcctcgtcga gaaggtgcgc gatccggacc      1680
     ctgacggcca ccagcgatgt cctcagggag cccgactggg gcgtcaacgt cgacatgtgc      1740
     gacctggtca actccaactt tcaccgctac ggcaaggaca ccgtcaaggc gctgcgattg      1800
     aagctccaga agaagaccaa gccgcagacg cagtacttgg ccctcgtcgc gctggagatg      1860
     tgcatgaaga actgcggggt catgttccac gccaaggtga tcgagaaggc gtgcctggac      1920
     gagaccacga agtgcggcgc gcaacggggg ggcgacgcgc gcgtcaagca gaaggctctc      1980
     gccctcgtcc aggagtgggc gctgcagctc caactgccgc agtacagagc cgcgttcgac      2040
     gaactgcgcc gaaagggcga gcgcttcccg cccacggagc tcacgtccgc cgaggtgacc      2100
     ccgatgtaca ccccgcgccc gaaccgcgtg gacatcgtcg agcagaggct cgcgcagatg      2160
     gaccccgccg acgccgccgc cgtcagagcc gccgtcgccg aggcggaggc ggaggtggaa      2220
     gcggaggagc gccgaatggg gacgcgatcg ccgagggtgt caaacgggtt tgcgacgtcg      2280
     ccgggcggcg ggtcgacgcc cgtggggtcc ccgccgggga cccgggggtt tcgggtggga      2340
     tcgccgcccg gatcgagcgc gcgacccgcc gcgccccccc ggggctacga ggctctcgac      2400
     gaggacgagc ctttccacgg aaccgccgag cggaacggaa ccgccgagcg gacgtactcg      2460
     gacggcaacc cgtacggcac cgccgggggt gggcacacgt caaacccgac gccgcgcagc      2520
     caccacgccc actacccggt gagtcaccgg ccggagctcc aaccgcctgc cgcggatgcg      2580
     tctgcgctgg gcgacgtcac gtcgcccgac gcggtgaaga aacttcacga agatctcgac      2640
     gtggcttcca atacggtgaa ggttctccgg gacatgctcg gagaggtgga cgtggtgacc      2700
     tctcccgagg cgctgaacga cccgacgatc gacgagctct cggagcagtg cgcgcagatg      2760
     cgcccccgcg tcgtctcgct cgtgcagagc gtcgccgacg agtcgctgct gatgaaggcg      2820
     ctgagcctca acgacgagct gtcggaggtt gcgcagaagc gggacgcgct gagggcggcg      2880
     gcgtccgcgg acagggacac gcgcgcggcg atcgtggcgt ccatgcgcga ggaggaggcg      2940
     gcggcgcagc gacacgcgtc ggccggagac gcctccggag gggctccggt tggcaacctc      3000
     gtggatctcc tcggcggagt ctccgtcgac ccgggcaccg acgcccgccc ggggaaggac      3060
     aaggcggcgc cgggacgtgc ggcggcggcg ggacgtgcgg cggcggccga tcccttcggg      3120
     ctggcggcgg ctgacgcgcc ggtcgacccg ttcgacgtgt cggtcacggt gggcgacggc      3180
     ggaaacgtcc gggggagacc gggcgcttcc aaccccttgg acgagctcct cgcgcccccg      3240
     ccgccccccc cgcaggtgta cgacccgttc gccgcctccg ccggcgtcga ccccgcgtcg      3300
     acgccgccgg cgggcggctc gcaccaaccg gcgaactatt accccactgt cgctggaacg      3360
     gcgagggggg gcggtgcggt gtccgatcct ttcgcgagcg ccaacccgtt tgcgagccgt      3420
     ccgccggggg cttcgcccat gggcgccatg agcgtcaacc cgttgtttca ggcgcagcag      3480
     cagccgcagc aaccggcgtc gagcgggggt atgggttcgc tgccgccggc gattggcgcg      3540
     tcgcaggcgc cctacgatcc gttcgccgcg tcgccgccgc cgcagcagcg ggggggaagc      3600
     aaccccttcg cgcgctga                                                    3618
//

If you have problems or comments...

PBIL Back to PBIL home page