(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE75

MICSR_1.PE75         Location/Qualifiers
FT   CDS_pept        complement(143046..144416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636080"
FT                   /orf_name="MICPUN_56648"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62067.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V2"
FT                   /transl_table=1
FT                   /translation="MDFDITTARPAGPRPAAPVAAPQQPGGTQAGSAHHHPPGAGGAST
FT                   SPPVAPDDVPASIFITGVSPAVNDGTLREFLECCGPLRSLAQFGDVPLPGQPRQYVATY
FT                   ADVAAAQSSLVLNNMTLVDRPITVVAAERAVGPGGVLDLSKGGSSAVPSGADLLNPLAS
FT                   MEQAVMTGLVEDPLKLWRQAAEKLPSWFPAGYKRCALFVPIPHLINGAMAAAEARIEFE
FT                   KEVRDTAGGHVDDSDVSRTVYAGNVNSSITEDMLADFFSIAGNVTYVKFAGSEFNPSRF
FT                   GFVEFDTKAAAESAKALTGTQVAEMTIKVKHSNNPIVKDRMRNFWGTCRTERRRRMRRE
FT                   RKRFKEKERERLRGGESSSSESESESSSSSSEERRRRRRRRREREERDEKREKKSRDKD
FT                   ADEGGDEKERKSSREKKEDAREKKSDEEEDEKKLREEARRSRKSRRKSEGEGKEDAA"
     atggacttcg acatcaccac cgcgcgcccc gcgggcccgc gccccgccgc cccggtcgcg        60
     gcgccccaac agcccggcgg cacccaggcg ggatcggccc accatcatcc gcccggcgcg       120
     ggcggcgcct cgacgtcccc gccggtcgcc cccgacgacg tccccgcgtc catcttcatc       180
     acgggggtgt ctcccgcggt caacgacggg accctgcgcg agttcctcga gtgctgcggc       240
     ccgctccgat cgcttgcgca gttcggcgac gtccctttgc ccggtcagcc gcgccagtac       300
     gtggccacgt acgccgacgt cgccgccgcg caatcctcct tagtgctcaa caacatgacg       360
     ctcgtggacc gccccatcac ggtggtcgcc gcggagcgcg ccgtcggccc cggcggcgtg       420
     ctcgatctct ccaagggggg cagctcggcg gtgccgtccg gcgcggacct cctcaacccc       480
     ctggcgtcca tggagcaggc ggtgatgacc ggcctcgtcg aggatccgct caagctgtgg       540
     cgccaggctg cggagaagct cccgtcctgg ttcccggcgg ggtacaagcg atgcgccctg       600
     ttcgtcccca tcccgcacct catcaacggc gccatggccg ccgccgaggc gaggatcgag       660
     ttcgagaagg aggtccgcga cacagctggc ggccacgtcg acgacagcga cgtgtcacga       720
     accgtgtacg ccggcaacgt caacagctcg atcaccgagg acatgctcgc ggatttcttc       780
     tccatcgccg gtaacgtcac gtacgtcaag ttcgccggga gcgagttcaa cccgagccga       840
     ttcggtttcg tcgagttcga caccaaggcg gcggcggaat ccgccaaggc gctcacgggc       900
     acgcaagtgg cggagatgac catcaaggtg aagcacagca acaacccgat cgtgaaggac       960
     cggatgcgga acttctgggg gacgtgcagg acggagcgac ggcggcggat gaggagagag      1020
     cggaagcggt tcaaggagaa agaacgggag cggcttcgag ggggcgagag cagctcgtca      1080
     gagtccgaga gcgaatcgtc gagctcgagc agcgaggaga ggcggcgaag gcgaaggcgg      1140
     aggcgggagc gggaggagcg cgacgagaag cgcgagaaga aaagccggga caaggatgcg      1200
     gacgagggcg gcgacgagaa ggagaggaaa tcttctcgcg agaagaagga ggacgcgagg      1260
     gagaaaaagt ctgacgagga ggaggacgag aagaaactca gggaggaggc caggcgctcg      1320
     cggaaatctc gacggaagag cgagggggag ggcaaggagg acgcggcgtg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page