(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE76

MICSR_1.PE76         Location/Qualifiers
FT   CDS_pept        144592..145497
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636081"
FT                   /orf_name="MICPUN_56649"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61621.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V3"
FT                   /transl_table=1
FT                   /translation="MTTGRRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAPPTK
FT                   GPCEHGLKYRSRCKVCSACPHGKWRKRCKECGGSQICEHSRQRSKCKECGGASICEHSR
FT                   QRSTCKKCGGSQICVHGRRRSTCKECGGSAICEHGRQRSTCKECGGSAICEHGRIRFSC
FT                   KECGGGSICEHGRRHSRCKDCGGASICVHGRVRYQCKECGGSAICEHGRIRFSCKECGG
FT                   SAICEHGRVRYQCKECGGSGICQHGRQRSTCKECGGSQVCEHGRRRSECKKCGGSSICE
FT                   HGRQLHRCKECGADEGTRRR"
     atgacgacgg gtcggaggcc aaacgtcagg atcgacatcg aagacgtcgt cgcggatgcc        60
     gaagtcgcgg atgaggtgaa cgatgcgagt ctgacgaaga aggggacgaa acggaagaga       120
     gcccctccca cgaagggccc gtgcgagcac gggctgaagt atcggtcgcg atgcaaggtg       180
     tgcagcgctt gtccgcacgg aaagtggcgc aaacggtgca aggagtgcgg tgggtctcaa       240
     atctgcgagc acagccgtca gcgctctaag tgcaaggagt gcggcggggc atcaatctgc       300
     gagcacagcc gtcagcgctc tacgtgcaag aaatgcggcg ggtctcaaat ctgcgtgcac       360
     ggtcgccggc gctctacttg caaggagtgc ggtgggtctg caatctgcga gcacggtcgt       420
     cagcgctcta cgtgcaagga gtgcggcggg tctgcaatct gcgagcacgg tcgtatccgc       480
     tttagttgca aggagtgcgg tgggggctca atctgcgagc acggccgtcg gcattctcgg       540
     tgcaaggact gcggcggggc atcaatctgc gtgcacggtc gtgtacgcta tcaatgcaag       600
     gagtgcggcg ggtctgcgat ctgcgagcac ggtcgtatcc gctttagttg caaggagtgc       660
     ggagggtctg caatctgcga gcacggtcgt gtacgctatc aatgcaagga gtgcggtggg       720
     tctggaatct gtcagcacgg tcgtcagcgc tctacgtgca aggagtgcgg cgggtctcaa       780
     gtctgtgagc acggtcgtcg gcgctctgag tgcaagaagt gcggtgggtc ctcaatctgc       840
     gagcacggtc gtcagctcca tcggtgcaag gagtgcggcg ccgacgaagg aacgcgaagg       900
     cggtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page