(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE79

MICSR_1.PE79         Location/Qualifiers
FT   CDS_pept        join(complement(150555..150851),complement(150369..150450),
FT                   complement(149716..150212))
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636084"
FT                   /orf_name="MICPUN_107861"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="ACO62069.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199ACA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V6"
FT                   /transl_table=1
FT                   /translation="MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPII
FT                   PSLFTPARIARLTGDPVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLD
FT                   PTDITHMFKITKTIGLCATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADW
FT                   FQVYTQHAYMRPMAAMCMFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLE
FT                   KKVKGKDAGNTFTEQETVRTAIACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIE
FT                   DHLTAISERD"
     atgagcaggg gaagcggcgc gggttacgac cgccacatca ccatcttctc acccgagggg        60
     cggctgtacc aagtcggtgc gtcgcgcccc gaacccgcgt ggcggcgacg cccgaacccc       120
     cctcgcccca tcatcccgtc cctcttcacg cccgcgcgca tcgcgagact gaccggagat       180
     cccgtcccgt ttccaccctc agagtacgcg ttcaaggcga tcaagtcggt cggcgtgacg       240
     tccattggcg tgcggggtaa ggacagcgtg tgcgtcgtca ctcagaagaa gattccggac       300
     aagctcttgg accccacgga catcacccac atgttcaaga tcaccaagac catcgggttg       360
     tgcgccaccg gcaagctacc cgacatccgc aacgtcgtgc agaaggcgcg ccacaccgcg       420
     gcggagtttc gccacgagta cggctacgag attcccgtgg attacctctc gtgcaagctc       480
     gccgactggt tccaggtgta cacccaacac gcgtacatga gaccgatggc ggcgatgtgc       540
     atgttcgtcg gcatcgacga ggaaagaggc ccgagcctgt acaagaacga tcccgccggg       600
     tatttcgtgg gttacaaggc gacgagcgcg ggcgccaagg agcaggaggc gatcaacttc       660
     ctcgagaaga aggtcaaggg gaaagacgcc ggcaacacgt tcacggagca ggagactgtg       720
     cgcaccgcaa tcgcgtgcct gcaaaccgtt ctcggggagg atctgaaggc gcgggagctg       780
     gaggttggca tcgtgacggt ggacgatccg aacttcaggc tgctcagcga gaccgccatc       840
     gaggaccacc tcacggccat ctccgagcgc gactga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page