(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE8

MICSR_1.PE8          Location/Qualifiers
FT   CDS_pept        19556..20161
FT                   /codon_start=1
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636013"
FT                   /orf_name="MICPUN_79748"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="ACO61588.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG627112"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AA4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N5"
FT                   /transl_table=1
FT                   /translation="MFQISRLEDANVKILPENLGKPRLEAITQEIESLYIDKVIKDLGL
FT                   VITLYEIVSIEGGTVYPGEGSAHFKVEFRVVVFRPFVGEIIEGTLKKADKTGLYVDIGF
FT                   FSDIFVPEHLMQEPSVFDEDEQLWVWMYEDAKMFMDLEEPVRIRIQGIKFPDQPRTSDE
FT                   LVGRTALEGATPDGTFAPMVVMADINADGLGLISWWKQ"
     atgtttcaga tatccaggct cgaagatgcg aacgtcaaga tcctccccga gaacctcggt        60
     aagcctcggc tggaggcaat cactcaggag atcgagtcgc tgtacataga caaagtcatc       120
     aaggacctcg gcctggtaat cacgctgtac gaaatcgtca gcatcgaggg tgggacggtg       180
     taccctggcg agggaagcgc gcacttcaag gtggagtttc gcgtggttgt cttccgtccg       240
     ttcgtcggcg agatcataga gggcacgctg aagaaggcgg acaagacggg gttgtacgtc       300
     gacatagggt tttttagcga catcttcgtc cccgagcacc ttatgcagga gccctcggtg       360
     ttcgatgagg acgagcaact gtgggtgtgg atgtacgagg acgcgaagat gttcatggac       420
     ctagaggagc cggtcaggat ccgcattcag gggattaagt tcccggacca gccgaggacg       480
     tcagacgagc tggtggggag gaccgcgctc gaaggggcga cgccggatgg gactttcgcg       540
     ccgatggtgg tcatggccga catcaacgcg gatgggttgg gtctcatctc gtggtggaag       600
     cagtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page