(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE80

MICSR_1.PE80         Location/Qualifiers
FT   CDS_pept        151072..151671
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636085"
FT                   /orf_name="MICPUN_56653"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61623.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199ACA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V7"
FT                   /transl_table=1
FT                   /translation="MGIRIEWSSPCGGCQKTLTKGSNAKKCGKCNSVWYCSKECQTLDW
FT                   KRPNKQGHKHRCAALAEADKLRGAGNPRSQKAFEAHDSKPMMDRFHEILQRKIQPGERA
FT                   YEVMSKMLEDGVAKGARAIMMIHEEVLGNGTIEFTVVPEAQVEVMLEDDAAFSRHALMV
FT                   RTYDPEKQFVICYETSQPERHIVFRVMAEDILNRRS"
     atgggcatcc gcatagaatg gagctcccct tgtgggggtt gccaaaagac gctgaccaaa        60
     gggagcaatg caaagaagtg cggcaaatgc aacagcgtgt ggtactgctc gaaggagtgt       120
     caaaccctgg actggaagcg tccgaacaag cagggacaca aacaccggtg cgcggcttta       180
     gccgaggcgg ataagttgcg cggggcgggg aatccccggt cgcagaaggc tttcgaagcg       240
     catgactcga agcccatgat ggataggttc cacgagattc tccagaggaa gatacaaccc       300
     ggggagcgag cgtacgaggt gatgtccaag atgttggagg acggcgtcgc gaaaggcgcg       360
     cgcgcgataa tgatgatcca cgaggaggtt ctggggaacg gcacgatcga attcaccgtc       420
     gttcccgagg cacaggtgga ggtgatgctc gaggacgacg cggcattttc gcgccacgcg       480
     ctgatggttc gcacctacga cccagagaag cagttcgtga tttgctacga gacgagccag       540
     ccggagaggc acatcgtgtt ccgcgtgatg gccgaggaca ttctcaatcg tcggtcctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page