(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE82

MICSR_1.PE82         Location/Qualifiers
FT   CDS_pept        join(complement(155144..155314),complement(154194..154802))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636087"
FT                   /gene_name="LHCP3"
FT                   /orf_name="MICPUN_90184"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein, chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62071.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199ACAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V9"
FT                   /transl_table=1
FT                   /translation="MALTMSNALVGTGLVAKPAVRSVQARAGLKVFARMTKDRVSLKKD
FT                   TKLGKSRIEIYPEWGEFPSSERTSPLTSLTYDEYKNNVSTEIIHGRFAMLGVTGAWAQE
FT                   NLTGIPWFMAGQECTFDNCSISYLNQSFTPSYDGALLGLIFLEVLLMGYAEGTRTGLIE
FT                   NPFDDVVAGSVFPGGRFDPLNFSDGKEANFFGDDLDTLKIKELKHCRLAMLAWLGILAQ
FT                   SVSTNPEGTEIGPVANWSAHVADVVHCNVVDRSGCVF"
     atggctctca ccatgtccaa cgccctcgtc ggcaccggcc tcgtcgccaa gcccgccgtc        60
     cgctccgtgc aggcgcgcgc gggtctcaag gtcttcgccc gcatgaccaa ggatcgcgtt       120
     tcgctcaaga aggacaccaa gctcggcaag tcccgcatcg agatctaccc ggagtggggc       180
     gagttcccat cctccgagcg cacctccccg ctcacgtcgc tcacctacga cgagtacaag       240
     aacaacgtct ccaccgagat catccacggc cgcttcgcca tgctcggcgt gaccggcgcg       300
     tgggcgcagg agaacctcac cggcatcccc tggttcatgg ctggccagga gtgcaccttt       360
     gacaactgct ccatctctta cctcaaccag tccttcaccc catcctacga cggcgccctc       420
     ctcggcctca tcttcctcga ggtgctgctc atgggctacg ccgagggcac ccgcaccggg       480
     ctcatcgaga accccttcga cgacgtcgtc gcgggctccg tcttccccgg cggacgcttc       540
     gatcccctca acttctccga cggcaaggag gctaactttt tcggcgacga cctcgacacg       600
     ctgaagatca aggagctcaa gcactgccgc ctggcgatgc tcgcgtggct cggcatcctc       660
     gcgcagagcg tgtccaccaa cccggagggt acggagatcg gacccgtcgc caactggtcc       720
     gcgcacgtcg cggacgtcgt tcactgcaac gtggtcgacc gctccggctg cgtcttctaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page