(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE83

MICSR_1.PE83         Location/Qualifiers
FT   CDS_pept        join(155861..156049,156202..157578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636088"
FT                   /orf_name="MICPUN_99274"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61624.1"
FT                   /db_xref="UniParc:UPI000199A640"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W0"
FT                   /transl_table=1
FT                   /translation="MSAVVAGNLLALAGTAKPLKRGRSATRTRRVVSAAANADDARVAD
FT                   VKRAVVATLASAAIALPAIAAPVAEIALTPEEQIAAEVAKFEEQRAKCGTSACRDTVTQ
FT                   WESAAVKKIKKKAGIPLDAPAPKAYPTPKRVAPAPVAETEAAPAPAAAPEATSQPAPRA
FT                   AAGPPVDAKADAKARLAERQAASAAAAEKAAAEKAAKAEALRQAQADAQAERVAAAKAA
FT                   AEAAEAKRAAAAAAKADAKADAKPAPAPAKKAAPAPPPAKKAAPAPAKKTAAKPKSPGV
FT                   FDYVVGDVTVAALGSAAALALVAPSFKDKALAGDASGALEEVKGLVTGANQDAAIGKAC
FT                   LLGGVVAADALIHLPVLGFFLPGPAEFVGTVAATLLAAKYFVTREASYEEDIKDFAASI
FT                   PAGVPDVASTVVEPITKFVGAVKAPDADALVGDFNEWFNGLDDPVEEIAPKAAAFGACV
FT                   AVSYVAHFPVLGLVLPRVLELVGVYVCGGAVARYGEAGTVSLKADLIKVGDDAGAIVKS
FT                   VVSK"
     atgtccgccg tcgtcgccgg aaacctgctc gccctcgcgg gcaccgcgaa gcctctcaag        60
     cgcggcagat ccgccacgcg aacgcgtcgc gtcgtgagcg ccgccgccaa cgccgacgac       120
     gcgcgcgtcg ccgacgtgaa gcgcgccgtc gtcgcgacgc tcgcgtccgc cgccatcgcc       180
     ctccccgcga tcgccgcgcc cgtcgccgag atcgcgctca cccccgagga gcaaatcgcc       240
     gccgaggtgg ccaagttcga ggagcagcgc gccaagtgcg gcacctccgc gtgccgcgac       300
     accgtcaccc agtgggaatc cgccgcggtg aagaagatca agaaaaaggc gggcatcccg       360
     ctcgacgccc ccgcgcccaa ggcgtacccg acaccaaagc gcgtcgcccc ggcgcccgtc       420
     gccgagaccg aggcggcacc cgccccagcc gccgccccgg aggcgaccag ccagcccgcc       480
     cccagggccg ccgcagggcc gcccgtcgac gccaaggctg acgccaaggc tcgactcgcc       540
     gagagacaag ccgcctccgc cgccgccgcg gagaaggcgg ccgcggagaa ggccgccaag       600
     gccgaggcgc tcaggcaggc gcaagccgac gcgcaggcgg agcgcgtcgc cgccgccaag       660
     gctgccgccg aggctgccga ggctaagcgc gccgcggcgg cggcggcaaa ggcggatgca       720
     aaggcggatg ccaagcccgc gcccgcgccc gccaagaagg ccgcgccggc tcccccgccc       780
     gccaagaagg ccgcgccggc ccccgccaag aagactgcgg ccaagcccaa gtcccccggc       840
     gtcttcgact acgtcgtggg cgacgtgacg gtcgcggcgc tcggctccgc ggcggcgctc       900
     gcgctggtcg cgccgtcgtt caaggacaag gctctcgcgg gcgacgcgag cggcgcgctc       960
     gaggaggtca agggcctcgt caccggcgcc aaccaggacg ccgcgatcgg caaggcgtgc      1020
     ctcctcggcg gcgtcgtcgc cgccgacgcc ctcatccacc tcccggtgct cggatttttc      1080
     ctccccggcc ccgccgagtt tgtcggcacc gtcgccgcga cgctcttggc ggccaagtac      1140
     ttcgtcacca gggaggcgag ctacgaggag gacatcaagg acttcgccgc gtccatcccc      1200
     gcgggcgttc ccgacgtcgc ctccacggtc gtcgagccaa tcaccaaatt cgtcggagcc      1260
     gtgaaggcgc ccgacgccga cgcgctcgtc ggagatttca acgagtggtt caacgggttg      1320
     gacgaccccg tcgaggagat cgcgcccaag gcggcggcgt ttggcgcgtg cgtcgccgtg      1380
     tcgtacgtcg cgcacttccc cgtcctcggt ctcgtgctcc cgcgggtgct cgagctcgtc      1440
     ggcgtgtacg tgtgcggcgg ggcggttgcc aggtacggcg aagccgggac cgtttcgctc      1500
     aaggcggatt tgatcaaggt gggcgacgac gcgggcgcca tcgtcaagtc cgtcgtaagc      1560
     aagtga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page