(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE84

MICSR_1.PE84         Location/Qualifiers
FT   CDS_pept        157786..159048
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636089"
FT                   /orf_name="MICPUN_56657"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61625.1"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniParc:UPI000199A641"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W1"
FT                   /transl_table=1
FT                   /translation="MELPEDLVERIAETCVRAGGLKEWCRSWRGTCRRFSSLRWFEAVA
FT                   RGGVPLAVVPSDRCPTVQLGVSRARSATEDAVARAAATRRALSRIAGRSEDDDDDDDDD
FT                   DDGWDVLGTGPTVLVTPGVHRENVRLTRTCALIGWGSRGSAVIEGSGWEPALAFAGLGM
FT                   SERGTGDTMGWSVGDTGERSVACNLSIRSRNRAQAFAVAVVNGAPKFVRCDLRGGLLVL
FT                   GWKTSPAALACVVRDGRGCGVKVTDHGEARLDGCVVERCGTHGLLLERGGRAVLAGRTV
FT                   VRDNDLEAVLHTPDTDGVALEGEGVDLGPPAIVRVGVRKYDSDDEEGDSGHVSVVVRPN
FT                   VRRLRVGAETLEHLHGHAPDYAWLKRGGFSFDDDGGDEDYEEEEATGSDYDEEETGSDY
FT                   DFDDDDEGVSASPRINEPYRE"
     atggagctgc ccgaggacct cgtcgagcgc atcgcggaga cgtgcgtgcg cgcggggggt        60
     ctcaaggagt ggtgccgctc ctggcgcggc acgtgtcggc gcttctcgtc gttgcggtgg       120
     ttcgaggcgg tcgcgagggg cggcgtgccg ctggccgtgg ttccgagcga tcggtgtccc       180
     accgtgcagc tcggcgtgag ccgcgcgagg agcgcgacgg aggacgcggt ggcgcgcgcg       240
     gccgcgacgc gacgcgcgct ctcccgcatc gccggaagaa gcgaagacga cgacgacgac       300
     gacgacgacg acgacgacgg gtgggatgtc ctcgggaccg ggccgacggt cctggtcacg       360
     cccggggtgc accgcgagaa cgtgcggctg acgcgaacat gcgcgctcat cgggtggggc       420
     tcgcggggtt ccgccgtcat cgagggcagc ggatgggaac ccgccctcgc gttcgcgggt       480
     ctcggcatgt ccgagcgcgg gacgggcgac acgatgggct ggagcgtcgg cgacaccggc       540
     gagaggtccg tcgcgtgcaa cctatcgatt cgcagtcgta accgcgcgca agccttcgcg       600
     gttgccgtgg tgaacggcgc accgaagttc gtccggtgcg acctgcgcgg cgggcttctc       660
     gtgctcgggt ggaagacgtc ccccgccgcg ctcgcgtgcg tcgttcgcga cggccggggc       720
     tgcggagtca aggtgaccga tcacggcgag gcgaggctcg acggatgcgt cgtggagcga       780
     tgcgggacgc acggcttgct cctcgaacgg ggcggccggg cggtgctcgc cggccgcacg       840
     gtggtcaggg ataacgattt agaggctgtg ctgcacacgc cggacacgga cggcgtcgcg       900
     ctggagggcg agggtgtcga cctcggacct cccgccatcg tccgcgtcgg cgtgcgaaaa       960
     tacgactccg acgacgagga gggagactcg ggtcacgtct cggtggtggt tcggccgaac      1020
     gtgcggaggc tgcgggtcgg ggcggagacg ttggagcacc tgcacggaca cgcgccggat      1080
     tacgcctggc tcaaacgcgg ggggttctcg ttcgacgacg acggcggaga cgaggactac      1140
     gaagaagaag aagcgacggg gtcagactac gacgaagaag agacggggtc agactacgac      1200
     ttcgacgacg acgacgaagg cgtctccgcg tctccgcgta ttaatgaacc atatagggaa      1260
     tag                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page