(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE85

MICSR_1.PE85         Location/Qualifiers
FT   CDS_pept        complement(<159790..160146)
FT                   /codon_start=1
FT                   /gene_family="HOG000198753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636090"
FT                   /orf_name="MICPUN_80006"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO62072.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG241590"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="UniParc:UPI000199A642"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W2"
FT                   /transl_table=1
FT                   /translation="MLLTGPNMGGKSTLLRQAALAVVAAHVGCRVPASACELHVVDAVY
FT                   CRVGAGDGIRSGVSTFFAEMSETAAALNAATDKSLLVIDELGRGTSTADGYAIAYAVAS
FT                   AVAERGSRCLFATHY"
     atgctcctca ccgggcccaa catgggcggc aagtcgacgc tgcttcggca agccgcgctc        60
     gccgtcgtcg ccgcgcacgt cgggtgtcgc gttcccgcgt ccgcgtgcga gctgcacgtc       120
     gtcgacgcgg tgtactgccg cgtgggcgct ggggacggga tccggtcggg ggtttccacc       180
     tttttcgcgg agatgtctga gacggcagct gctctcaacg ccgcgaccga caaaagtttg       240
     ctcgtcatcg acgagttggg tcgcgggact tcgacggcgg acgggtacgc catcgcgtac       300
     gccgtcgcgt ccgcggtggc ggagcgtggg agcaggtgtt tgttcgccac gcactac          357
//

If you have problems or comments...

PBIL Back to PBIL home page