(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE86

MICSR_1.PE86         Location/Qualifiers
FT   CDS_pept        complement(163903..167667)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636091"
FT                   /orf_name="MICPUN_56659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62073.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199A643"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W3"
FT                   /transl_table=1
FT                   /translation="MRASFFRSRVVGKEKKGRGKGRAESTDEWDARVAEVDALRDSSLG
FT                   CLPRSIFADVVSRLDGPDVARLGMTCRAARAYCSRPAIWRALARAQEAPALVREDLVNR
FT                   DFTWKQLYAWRRHVLWHRARGVDRIAVADHARVLTCDPVEGGGRVRVAYEAPSPQPLAP
FT                   NLLTWSPDASMLVVAQESAEGCKLVLSAPTACLRPKRSNRFASGDRQFQILDRRRRGTG
FT                   HDRGDGYDSEDATMGDEDSTAAAGHGLGTSGRTQTAGRTQQLAGTNAAFFGRGDSGGGQ
FT                   SGGAAWQQLDDEDDSVDANKAKEPRAYPRGIVAPIDRVRSHKLPAMNSVHVPLRNPVFA
FT                   AFTACGTRLLLMNVRRHGEEFALHELDLTVAMASLHGATPGAAGTRGSKFLAKNHQFKN
FT                   HQSLAGTKRRRGDFVAGDDDDAAAAPANVRGVGPDGWLSADARETLTLVESGRELSFSP
FT                   GPSTRDVLSLVNGAAVGKISPANLRAWSGLDRECTARPVAGGARDRVRAARALERDEDV
FT                   RMNERLRKEENETASEASFELDGDELEEERDNRASTGNTHPAWRAGGGADGGAVEGAVW
FT                   GAHAASDDDEGGLREVSSAPESLWWRRSVDAFRGGYSAGVETLRSAAVQLARSLLPAAI
FT                   VHPAGVRRGGSSRRRGGGSVWGAGRGEREEAAMRRAAEVERRSRSGGRAIKRARLTGRA
FT                   AAAGGAAGGGGDRSRAPVVGGFSRLGKAKKGSGPSASVGYVNPFACAIPSVRRARPSDV
FT                   VSFRRDRLHETSLPGLAHIVQWVRPARDVPSVGRGSNLVAGDSPGGDSPGDHGHWLVPV
FT                   SFPDAMPRAVHLALLPAAPTPGPNEIRGTDAQRRESARLAMLGLDASMPRSAASRVAAA
FT                   VERSVIAARSLFSKDARHPSAPVGAPVGTLEDACVVELAPPAAYNELHVVVSTVAAAAP
FT                   GGKIVCWADDGALWARRAVDGPDGNRTWDRATRVLDLRRCGFGADAGLRIDDEGSVAPN
FT                   PVLHQVCAMQWSASGTRLLILVACHFTTTSHVFPMHQWMVWDPPATWLGASDLSLLEDP
FT                   PSATTHGAGCFAASGGGPGAPVFCRCVSRSYDDALAGDFRCSHGRDRYRCEECGGAGVG
FT                   EDAIDPGTLDSIRARVHETGAYGFDPDDVLGVITRGRWHVPTKTFVQDVLPIFEQYSQT
FT                   HSLWAPDEDRVCYPVRSDGSGAGAGVGGGDHVWMTRFPRMPIVHRLASVGGGRNVRQVG
FT                   EHNALPFKHAFVDSAVVVCEGSFCVWSPC"
     atgagggcgt cattcttccg gagtcgggtg gtgggaaagg agaagaaagg gagagggaaa        60
     ggtcgggcgg agagcaccga cgagtgggac gcgcgagtcg ccgaggtcga cgccctgcgg       120
     gactcctcgc tgggatgcct gcccaggagc atcttcgccg acgtggtctc caggctggac       180
     gggccggacg tcgcgcgcct cggcatgacc tgccgcgcgg cgagggcgta ctgctcgagg       240
     ccagccatct ggcgcgcgct cgcgcgcgcg caggaagccc cggcgctggt gcgagaggac       300
     ctcgtcaacc gcgacttcac gtggaaacag ctgtacgcgt ggcgcaggca cgtcctgtgg       360
     caccgcgcgc gcggcgtcga tcgtatcgcc gtcgcggacc acgcgagggt cctcacgtgc       420
     gatcccgttg agggaggcgg ccgcgttcgc gtcgcgtacg aggcgccctc gccgcagccg       480
     ctcgcgccca acctgctcac ctggtcgccg gacgcgtcga tgctcgtcgt cgcgcaggag       540
     agcgccgagg gatgcaaact cgtgctctcc gcgcccaccg cgtgccttcg acctaaacgc       600
     tcgaaccggt ttgcaagcgg agatcgtcaa tttcagatcc tcgatcgtcg tcgtcgggga       660
     accgggcacg accggggcga cgggtacgac tcggaggacg ccacgatggg ggacgaggac       720
     tccaccgcgg cggcggggca cgggctcggg acgtctggcc ggacgcaaac agccggccgg       780
     acgcaacagc tggccgggac aaacgcggcg tttttcggcc gcggcgattc gggcggcggc       840
     caatcgggcg gcgccgcgtg gcagcagctg gacgacgagg acgactccgt ggacgcgaac       900
     aaggcgaagg aaccgcgggc gtacccccgc ggaatcgtcg ccccgataga tcgggttcga       960
     tcgcacaagc tcccggcgat gaattcggtg cacgtgccgc tccggaatcc cgtcttcgcc      1020
     gctttcaccg cgtgcggcac tcggcttctg ctcatgaacg tcaggcggca cggcgaggag      1080
     ttcgcgcttc acgagctgga cctgaccgtc gcgatggcgt cgctgcacgg cgccacgccc      1140
     ggcgccgccg gcacccgcgg ctcgaagttt ctcgcgaaga atcaccaatt caagaatcac      1200
     caatcactgg cgggtaccaa gcgtcgaagg ggagatttcg tcgcgggcga cgacgacgac      1260
     gccgccgccg cccccgcgaa cgttcggggc gtgggcccag acgggtggct cagcgccgac      1320
     gctcgggaga cgctgacgct ggtggagtct ggccgcgagc tctcgttttc gcccggtccg      1380
     agcacccgcg acgtgctgtc cctcgtgaac ggcgccgccg tcggtaaaat ctcgccggcg      1440
     aaccttcgcg cgtggtcggg gctcgatcgc gagtgcaccg cgcgtcccgt cgcgggcggc      1500
     gcacgcgacc gcgtccgagc ggctcgagcc ctcgagcggg acgaagacgt ccgaatgaat      1560
     gagcgcctcc ggaaggagga gaacgagacg gcgtccgagg cttccttcga gctggacggc      1620
     gacgagctcg aggaggagcg cgacaatagg gcgtcgacgg gaaacaccca cccggcgtgg      1680
     cgagccggcg ggggtgccga tgggggtgcc gtcgagggtg ccgtctgggg tgcccacgcg      1740
     gcgtccgacg acgacgaggg cggcttgcgc gaggtatcgt ccgcgcccga gtctctgtgg      1800
     tggcgacgaa gcgtcgacgc gtttcgcggt ggatactccg ccggggttga gacgctgagg      1860
     tctgcggcgg tgcagctggc gcgatcgctg ctcccggccg cgatcgtgca cccggcgggg      1920
     gtccggcggg ggggttcaag ccggcgaagg gggggcggtt ccgtctgggg agccggacgc      1980
     ggggagcggg aggaggcggc gatgcgtcga gcggcggagg tggaacggag gtcgcggtcg      2040
     ggcgggcgag ctatcaagcg agcgaggctc acggggcggg cggcggcggc gggcggcgcg      2100
     gcgggagggg ggggcgatcg atcgcgggcc cccgtggtgg gtggtttttc gaggctcggc      2160
     aaggcgaaga agggatccgg tccgtccgcg tctgtcgggt acgtcaaccc gttcgcctgc      2220
     gcgattccgt ccgttcgccg cgcgaggccg agcgacgtgg tgagctttcg gcgcgatcgg      2280
     ctgcacgaga cgtcgctgcc cgggctcgcg cacatagtcc agtgggtgag gcccgcgcgc      2340
     gacgttccat cggtcggtcg cggttcaaac ctcgtcgccg gtgactcacc gggcggtgac      2400
     tcaccgggcg accacggcca ctggctggtg cccgtgtcgt tcccggacgc gatgccccga      2460
     gcggtgcatc tcgcgctgct tcccgcggcg cccacgccgg gcccgaacga aattcgcggc      2520
     accgacgcgc aacggcgcga gtccgcgagg ctcgcgatgc tcggtctcga cgcttcgatg      2580
     ccgcggtccg cggcgtctcg cgtggcggcc gccgtcgagc gctccgtcat cgccgcgcga      2640
     tcgctgttct cgaaggatgc tcggcacccg tcggcacccg tcggcgcacc cgtcggcacc      2700
     ctcgaggacg cgtgcgtcgt ggaactggcg ccgcccgccg cgtacaacga gctgcacgtc      2760
     gtcgtctcga cggtggcggc ggcggcgccg gggggtaaga tcgtgtgctg ggcggatgac      2820
     ggcgcgctgt gggcgaggcg cgcggtggac ggccccgacg ggaatcgaac gtgggaccgc      2880
     gcgacgcgcg tcctggacct tcgccggtgc ggattcggcg ccgacgcggg gctgcgaatc      2940
     gacgacgagg gatccgtcgc tcccaacccc gtgctgcacc aggtttgcgc catgcagtgg      3000
     agcgcttcgg gcacgcggtt gcttatcctg gtggcgtgtc actttaccac gacgagccac      3060
     gtgttcccga tgcaccagtg gatggtgtgg gatcccccgg cgacttggct gggcgcatcg      3120
     gatctctcac ttttggagga tcctccatcc gcgacgacgc acggcgccgg ctgcttcgcc      3180
     gcgagcggcg gcggccccgg ggcgcccgtc ttctgtcgct gcgtttcgag aagttacgac      3240
     gacgccctcg cgggtgattt ccgctgctcg cacggtcgcg accgctaccg gtgcgaggaa      3300
     tgcgggggcg ccggggtggg cgaggacgcg atcgatccgg gcacgctcga ttcgattcgc      3360
     gcgagggtgc acgagacggg ggcttatggg ttcgacccag acgacgtcct cggcgtcatc      3420
     acccgcggtc gctggcacgt cccgaccaag acgttcgtcc aggacgtcct gcccatcttc      3480
     gagcagtact cgcagacgca ctcgctgtgg gcacccgacg aggaccgcgt gtgctatccg      3540
     gttcgaagcg acggatccgg cgcgggcgcg ggcgtcggcg gcggcgatca cgtttggatg      3600
     acgcgttttc ctcggatgcc gatcgttcat cggttggcgt ccgtcggggg tggtcggaac      3660
     gtgaggcagg ttggggagca caacgcgctg ccgtttaagc acgcgttcgt ggattccgcg      3720
     gttgtggttt gcgaggggag cttctgcgtg tggagtccgt gctag                      3765
//

If you have problems or comments...

PBIL Back to PBIL home page