(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE87

MICSR_1.PE87         Location/Qualifiers
FT   CDS_pept        complement(168219..169832)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636092"
FT                   /orf_name="MICPUN_56660"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62074.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="UniParc:UPI000199A644"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W4"
FT                   /transl_table=1
FT                   /translation="MLNGQNNYQTAPPGGGGFPLVGSHGNMQGMQYGMGPGRGPGGMQG
FT                   APQARGQFMGGMQGGMQGGGMGNPPGVFNAQAQMNGGLGLGGAPPGLGGSPGGARASMD
FT                   RTGSGGQLLARQGSMPGAANGGMMGPNAGAGPRGMMAGGGSFGGGGGGGIPGPRGSGPD
FT                   LLAMINKGGAGSPFGAQGGMGMGGMGEDQTPFDMSEFPSLGGPPPGARGGLGGQPGAQG
FT                   AFGGMGPGQGGVFGGMDGMGSMGDGYGAMALQKPHPEFTIQNEDFPALPGAPGGGGGGG
FT                   GGASKGGGGPALGQPGPFAQGPQGGKLDLNGPMGGGAPYEFGGGKGSGGGKGVGGGQMA
FT                   AATDRFGLLGLLGVIRMSDPDLTTLALGTDLTTLGLNLNSPEPLYKTFGSPWADTPPRP
FT                   EVELLLPACYSVPVAGVRPAVFQKFQQETLFYVFYSMPGDESQLFAADELCARGWGFHK
FT                   ELKAWIMRVAGTEPVMKSERGERGSFWIFDVMSWERIRKDNFNLQYDQLEARPETGDKG
FT                   AGGKETKPPAGGLLTASAGK"
     atgttgaacg ggcagaacaa ctaccagact gcccctcccg gcggcggcgg gttccccctc        60
     gtgggctccc acggcaacat gcagggcatg cagtacggga tgggccccgg ccggggtccc       120
     ggcgggatgc agggcgcgcc ccaggctcgg ggccagttca tgggcggcat gcagggcggc       180
     atgcagggcg gcggcatggg caacccgccc ggtgtcttca acgcgcaggc gcagatgaac       240
     ggcgggctcg ggctcggcgg tgcgcccccc ggcttgggcg gttccccggg tggcgcgcga       300
     gccagcatgg accgcaccgg cagcggcggc cagctgctcg cgcgccaggg cagcatgccg       360
     ggcgccgcga acggcgggat gatgggtccc aacgccggcg cggggcctcg cgggatgatg       420
     gccggcggcg gatccttcgg cgggggcggc ggcggcggca tcccgggtcc gcggggatcg       480
     gggcccgatt tactcgccat gatcaacaag ggcggggcgg gttcaccctt cggcgcgcag       540
     ggcggcatgg gcatgggcgg catgggcgag gaccagactc cgttcgacat gtccgagttc       600
     cccagcctcg gcggcccgcc acccggcgcg cgcggtggtt tgggcgggca gcccggcgcg       660
     cagggcgcat tcggcggcat gggccccggg cagggcggag tcttcggcgg gatggacgga       720
     atgggatcga tgggcgacgg atacggcgcg atggcgctgc agaagccaca cccggagttc       780
     accatccaga acgaggactt ccccgcgctt cccggcgctc ccggcggggg cggcggcggc       840
     ggcgggggcg cgagcaaagg cggcggcgga cccgcgctgg gtcagcccgg cccctttgcg       900
     cagggtcccc agggcggtaa gctcgacctc aacgggccga tgggcggcgg cgcgccgtac       960
     gagtttggcg gcggcaaggg atcgggcggc ggcaagggcg tcggcggcgg tcagatggcc      1020
     gccgcgacgg accgcttcgg cctcctcggg ctcctcggcg tcatccgaat gtccgacccg      1080
     gatctcacca cgctcgcgct cggcacggac ctcaccaccc tcggcctgaa cctcaactcc      1140
     ccggagcccc tgtacaagac gttcgggtcc ccgtgggcgg acaccccgcc gcggcccgag      1200
     gttgagctcc tgttgccggc gtgctacagc gtgccagtcg cgggggtgag gccggcggtg      1260
     ttccaaaagt ttcagcagga gacgctcttt tacgtctttt actccatgcc tggggacgaa      1320
     tcgcagctct tcgcggctga cgagctgtgc gcccgcgggt ggggtttcca caaggagctg      1380
     aaggcttgga tcatgcgcgt cgcgggcacg gagccggtga tgaagagcga gcggggcgag      1440
     cggggatcgt tttggatctt cgacgtcatg agctgggagc ggatccgaaa ggataacttc      1500
     aacctgcagt acgatcagct cgaggcgagg cccgagaccg gcgacaaggg cgcgggaggt      1560
     aaggagacca agcccccggc gggcgggctc ctcaccgcat ccgcgggcaa gtga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page