(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE88

MICSR_1.PE88         Location/Qualifiers
FT   CDS_pept        170740..171867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636093"
FT                   /orf_name="MICPUN_56661"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61626.1"
FT                   /db_xref="UniParc:UPI000199A645"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W5"
FT                   /transl_table=1
FT                   /translation="MAPADTAGLERLVRTVRSDAEQRKRLVCNACFLAALAQLHPEVVA
FT                   KPKGERRWRREELDALAAATAGRIDDADPVHVIVGVDDLNVNIRYMKGSLVYLRAETNP
FT                   PLRCMMYSSMPPPPGQEEPSADDSADGPKTPGQDETADLPTGPAKVLDDADASHALVRA
FT                   VLERLNDDPTIDTAGGGVDADDPEAVATWRAARVRESLTAAHGAHWHVVHDAKPFGAAV
FT                   VTSGEGRRVLAQRGRYSFLVWRHSSSIKSPLEAIRRRIRADLPALRRGARTTFLVVCAV
FT                   YALWYRAMCREEEEEGGGGGAGGGTRPNDDRTAVGIIAGAEPRLTTFLCAAGESAAPFA
FT                   FFALAVMFALGGGGTASAIGARYARAFARRKRKSA"
     atggccccgg cggacaccgc gggtctcgag cgtttggtcc gaaccgtccg ctccgacgcg        60
     gagcagcgca agcgcctcgt ctgcaacgcc tgcttcctcg ccgcgctcgc ccaactccac       120
     ccggaggtgg tggccaaacc caagggtgag cggcggtgga ggcgcgagga gctggacgcg       180
     ctcgccgccg cgaccgccgg gcggatcgac gacgccgatc ccgtccacgt catcgtcggt       240
     gtcgacgacc tcaacgtcaa catccggtac atgaaggggt cgctggtgta ccttcgcgcg       300
     gagaccaacc cgccgctgcg atgcatgatg tactcgtcca tgcctccgcc ccccgggcag       360
     gaggagccga gcgccgacga tagcgccgat ggtcccaaaa cccccgggca ggatgagacc       420
     gcggatcttc ccacgggtcc cgcgaaggtg ttggacgatg ccgacgcgtc tcacgcgctc       480
     gtccgcgccg tcctcgaacg cctcaacgac gatccgacga tcgacacagc tggcggcggc       540
     gtcgacgcgg acgatcccga agccgtcgcg acgtggcgcg cggcgcgcgt cagagaatcc       600
     ctcaccgccg cccacggcgc gcactggcac gtcgtgcacg acgccaagcc gttcggcgcg       660
     gcggtcgtca catccggcga agggcgcagg gtgctggcgc aacgggggcg ctactcgttt       720
     ctcgtctggc gacattcttc gtccatcaag tcgccgctcg aagcgatccg tcgacggata       780
     cgcgcggatc ttcccgcgct gaggcgcggc gcgaggacga cgttcctcgt cgtgtgcgcc       840
     gtctacgcgt tgtggtaccg ggcgatgtgt cgcgaggagg aggaggaggg aggcggggga       900
     ggcgcggggg ggggtacgcg tccgaatgac gatcgcacag ctgtcgggat catcgcgggc       960
     gcggagccga ggctgacgac gttcctgtgc gccgccgggg agagtgccgc gccgttcgcg      1020
     ttcttcgcgc tcgcggtgat gttcgcgttg gggggcgggg gcacggcgag cgcgatcggg      1080
     gcgcggtacg cgagggcgtt tgcgcggcga aagcgaaagt cggcgtag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page