(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE89

MICSR_1.PE89         Location/Qualifiers
FT   CDS_pept        172023..173102
FT                   /codon_start=1
FT                   /gene_family="HOG000264812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636094"
FT                   /orf_name="MICPUN_56662"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61627.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560508"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A646"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W6"
FT                   /transl_table=1
FT                   /translation="MSFALASLQGRALASPLHVKRTAPRRGTRAVLVRAAVDPERDVIL
FT                   VSGCRERVAQCCVDQLSKNERSAGVVIKVTLPHDAYVGVKNPLNAMAKDLVFPDKPMID
FT                   CLGALDAVECVDESTDLFKGCLKDATGVILASEYAPTLLQTAVDLCDRIKAGAMPKLRR
FT                   VVVLSHIGVERRDVDPWKFMNRKTMVGTGVIGGKPQPGGAPLDRWVDAEELIKATLESC
FT                   GGADKSPWSYTIIRVGDLRGNGPTSVTYGDAMLTLVDNAFDVRMQDIEMEEGDAFEGFT
FT                   KRLSVAVVMNRMLTTQSYRVINRTFSCISTGPVDRERRKGWDVAKGRSPPPIEDKVVDE
FT                   ELQPKEEEENVPAGAPVPT"
     atgtcgttcg ctttggcatc gctccagggc cgggcgctag ctagcccgct ccatgtgaag        60
     aggaccgctc cgcgtcgtgg gacccgcgcg gtcctcgtcc gcgcggcggt ggaccccgag       120
     cgcgacgtca tcctcgtctc gggttgccgc gagcgcgtcg ctcagtgctg cgtcgatcag       180
     ctcagcaaga acgagcgcag cgcgggggtc gtgatcaagg tgacgctgcc ccacgacgcc       240
     tacgtcggcg tcaagaaccc gctcaacgcc atggcgaagg acctcgtgtt ccccgacaaa       300
     ccgatgatcg actgcctcgg cgccctggac gcggtcgagt gcgtcgacga gtccacggat       360
     ttgttcaagg gttgcctgaa ggacgcgacc ggcgtgatcc tcgcgtcgga gtacgcaccg       420
     acgctgctcc agaccgcggt cgacctctgc gaccgcatca aggctggcgc catgcccaag       480
     ttgcgcaggg tcgtggtctt gtcgcacatc ggcgtcgaac gaagggacgt ggatccctgg       540
     aagttcatga atcgaaagac gatggtgggc accggcgtga tcggcggcaa accccagccg       600
     ggcggcgccc cgctggaccg atgggtcgac gccgaggagc tcatcaaggc gacgctcgag       660
     tcctgcggag gcgcggacaa gtccccgtgg tcttacacca taatcagggt cggcgacctg       720
     cgcgggaacg gcccaacctc cgtcacctac ggcgacgcga tgctcacact cgtggacaac       780
     gccttcgacg ttcgcatgca ggacatagag atggaggagg gcgacgcgtt cgaggggttc       840
     accaagcgcc tctccgtcgc ggtggtcatg aaccggatgc tgacgacgca gtcgtacagg       900
     gtgatcaaca ggaccttctc gtgcatcagc acggggccgg tggacaggga gcgaaggaag       960
     ggttgggacg tggcgaaagg gcggtcgccg ccgcccatcg aggacaaggt cgtggacgag      1020
     gagctccagc ccaaggagga ggaggagaac gtccccgcgg gcgcacccgt gcccacatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page