(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE9

MICSR_1.PE9          Location/Qualifiers
FT   CDS_pept        complement(20306..21181)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636014"
FT                   /orf_name="MICPUN_56580"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62033.1"
FT                   /db_xref="UniParc:UPI000199AA50"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N6"
FT                   /transl_table=1
FT                   /translation="MAHVSTMMSRISITAPLHASPHRPAGAGSRRAAVTVRAGKGKGAK
FT                   YRRGADDPYAKEKNKDKMEKQTKAKQSAEDGPLNSVFSKEEPKEEYFLFVRKLRVDGSG
FT                   AAAPAADSDAEKKSVDEGEYSSANIGAMLGMKGPNTDGSGSKISSLGNWLPLGDVSIEA
FT                   GGDLDVVVAERRRMLVKFAKVKHLKLLPVCADEKLEFGVRVQRGPPRGTDPTAVFPVAT
FT                   DAEHEELVWDHETMGEEGSVRAELRLMQSLPSLGKGKKNEMLSSAMDMIKRQQEQAAAM
FT                   KAEREKVDDA"
     atggcgcacg tttcgaccat gatgtcgcgt atctcgatca cggcgccgct ccacgcttct        60
     cctcatcgtc ccgcgggcgc cggctcgcgt cgtgcggcgg tgacggttcg cgcgggcaag       120
     ggcaagggcg ccaagtaccg tcgaggcgcc gacgacccgt acgcgaagga gaagaacaag       180
     gataagatgg agaagcagac caaggcgaag cagagcgcgg aggatggacc gctgaactcc       240
     gtgttttcaa aggaggaacc caaggaggag tatttcctgt tcgtccgtaa gctcagggtc       300
     gacgggtccg gggcagccgc acccgccgcc gactccgacg ccgaaaagaa atccgtcgac       360
     gagggagagt actccagcgc caatatcggc gccatgttgg gcatgaaggg gccgaacacg       420
     gatggatccg ggtccaaaat ttccagcctc ggtaactggc tgccattggg cgacgtgtcg       480
     atcgaggctg gcggggatct cgacgtagtg gtggcggagc gtaggcggat gctggtgaag       540
     ttcgccaagg tgaagcatct gaagctactc ccggtgtgcg ccgatgagaa gcttgagttc       600
     ggcgtgcgag ttcagcgagg accgcctcgt ggcactgacc caaccgcggt atttccggtg       660
     gcgacagacg ccgagcacga ggagctggtc tgggaccatg agactatggg cgaggagggg       720
     agcgttcgcg cggagcttcg gctgatgcag tcgctgccaa gcctcggcaa gggcaagaag       780
     aacgagatgc tatcctcggc gatggacatg atcaagaggc agcaggagca ggccgcggcg       840
     atgaaagcgg agcgagagaa ggtggatgac gcttag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page