(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE90

MICSR_1.PE90         Location/Qualifiers
FT   CDS_pept        join(complement(177168..177194),complement(176382..176828))
FT                   /codon_start=1
FT                   /gene_family="HOG000012544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636095"
FT                   /gene_name="PSAN"
FT                   /orf_name="MICPUN_93625"
FT                   /product="Photosystem I subunit N, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I"
FT                   /cellular_component="thylakoid membrane"
FT                   /protein_id="ACO62075.1"
FT                   /db_xref="GO:0009522"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0042651"
FT                   /db_xref="InterPro:IPR008796"
FT                   /db_xref="UniParc:UPI000199A647"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W7"
FT                   /transl_table=1
FT                   /translation="MAAMTVCAPAMLSSKVSTGIKAKATAAKASKAQGAVCFFGDAKKA
FT                   AAATLAAAVLVAGPAMPAKADLTSDLLARTEANKELNDKKRAATSSANFERSRTVTDGV
FT                   CKFPQNMLGCEIASSTGDVAFLSADKALECEGTRDGKVCASKAPGSFPPVFGM"
     atggctgcca tgaccgtctg cgctccggct atgctctcct ccaaggtgag caccggcatc        60
     aaggccaagg ccaccgccgc caaggcctcc aaggcccagg gcgccgtgtg cttcttcggc       120
     gacgccaaga aggccgccgc ggccaccctc gccgcggctg tcctcgtcgc cggccccgcg       180
     atgcccgcca aggctgacct cacctccgac ctcctcgcgc gcaccgaggc caacaaggag       240
     ctcaacgata agaagcgcgc cgccacctcc tccgccaact tcgagcgctc ccgcaccgtc       300
     accgacggcg tctgcaagtt cccccagaac atgctcggct gcgagatcgc ctcctccacc       360
     ggcgacgtcg ccttcctctc cgccgacaag gcgctcgagt gcgagggcac ccgcgacggc       420
     aaggtgtgcg cgtccaaggc tcccggctct ttcccccccg tctttggcat gtaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page