(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE91

MICSR_1.PE91         Location/Qualifiers
FT   CDS_pept        178847..181057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636096"
FT                   /orf_name="MICPUN_52126"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61628.1"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000199A648"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W8"
FT                   /transl_table=1
FT                   /translation="MRPMANGAGGSKGGDAGPAPVVDSANDPMAISETWRRFMDAHVAG
FT                   VGIGTMDDSREWASTALTRLREEEDENRRRMDAVVTPDGRDANGEIVFPVKKDNSFVDL
FT                   LAVAKDDEAARCAVLLALALEAAETEARVAWNKLRAELRWKEPFAPAEKSAALESAHSL
FT                   DSAGDDNGVGGRRLGRRASGVADLDDIIIESPGEFLEQRRNSVAGWDAGAGVGRGGAWL
FT                   LEPLRDRWEARRVLEWSPWVMSEASVGASGELAILSGGGDGDAEGGVAEGGVAEGAPAA
FT                   AADEGAVVGLRGAKEEAARRRAAMTEEPNYVVESVPTQRAFDWTSLVPAASVPQVSVQE
FT                   VISVDAGDDLSSPSSAPGSPKGPGLEDPGSPTSKSIHSVTSDASTINIDALTDLRYGEH
FT                   MVFLVHGYAGSLQDLRLLRAHLQVACPNVHTRVSAANHERTGVDSIEAMGARLAEEVAE
FT                   TMEDLESGALVPRGGGREPRSPAAAAATTAARFGAPPRVSFAAHSVGVLIVRAALTHPA
FT                   MEPYLSRLHLFLSMSGPHLGYAGGDRVGADGMDKKSRRFIGKSAAFQLGLCCTRAINPK
FT                   AKCLSEITFRDAGKIEDCYLYRLAHHKNGLALFRHVVLVSSPQDKYVQRHSARLQLEGF
FT                   RIREGSRRARATMEMARAILAPVLEKAISRERGEAGSSGRDGVERESGARLTSLSRVDV
FT                   HFAKVGGGVDFNQLIGRKAHIDFLETDEYVRFLIWKLRRAFL"
     atgcggccga tggcgaatgg cgcggggggt tcgaaaggtg gggacgccgg gcccgcgccc        60
     gtggtcgatt ccgcgaatga cccgatggcg atttcggaga cgtggcggcg tttcatggac       120
     gcccacgtcg ccggtgtcgg catcggcacc atggacgact cccgcgagtg ggcgtccacc       180
     gcgctcacgc ggttgaggga ggaggaggac gagaacagaa ggcggatgga cgcggtggtc       240
     accccggacg gccgcgacgc caacggggaa atcgtcttcc ccgtcaagaa ggataactcg       300
     ttcgtcgatt tattagccgt ggcgaaggac gatgaggccg cccggtgcgc ggtgctgctg       360
     gcgttggcgc tggaggcggc ggagacggag gcgcgggtcg cgtggaacaa gctgcgagca       420
     gagctgcgtt ggaaggaacc ctttgcgccg gctgaaaaat ccgccgccct cgagtccgcg       480
     cactcgttgg attccgcggg agacgacaac ggcgtggggg gcaggaggct cggaaggcga       540
     gcctcgggcg tcgcggacct cgacgacatc ataatcgaat cccccgggga gttcctcgag       600
     cagcgaagga acagcgtcgc cgggtgggac gccggcgcgg gcgtcggccg gggcggcgct       660
     tggctcttgg agccccttcg cgaccgatgg gaggcgcgcc gcgtcctcga gtggagtcct       720
     tgggtgatgt ccgaggcgtc cgtcggcgcc tccggggaac tcgccatact ctccggcggc       780
     ggcgacgggg acgccgaagg tggcgtcgcc gaagggggcg tcgccgaggg ggcgcccgcc       840
     gccgccgccg atgaaggcgc cgtcgtcgga ctcagaggcg cgaaggagga ggcggcgagg       900
     aggcgcgccg cgatgacaga ggagcccaac tacgtcgtcg agtcggtgcc gacgcagcgc       960
     gcgttcgact ggacgagctt ggtcccggcg gcgtccgtgc cgcaggtgtc tgtccaggag      1020
     gtcatctccg tcgacgccgg ggacgatttg tcatcgccgt cgagcgcgcc ggggtcgcca      1080
     aagggacccg ggttggaaga ccccggatct cccacgtcga aatcgattca ttcggtaacc      1140
     tccgacgcgt ccacgatcaa tatcgacgcg ctgacggacc tgcgctacgg cgagcacatg      1200
     gtgtttttgg tgcacggata cgcgggatcg ctccaggatc tgaggctcct gagggcgcac      1260
     ctgcaggtgg cgtgtcccaa cgtgcacacg cgggtctccg ccgcgaacca cgagcgcacg      1320
     ggcgtcgact ccatagaggc gatgggcgcg aggctcgcgg aggaggtggc ggagacgatg      1380
     gaggacctgg agtcgggcgc gttggtgccc agggggggcg ggagggagcc caggtcgccc      1440
     gcggcggcgg cggcgacgac ggcggcgagg ttcggagccc cgccgagggt atccttcgcc      1500
     gcgcactccg tcggcgttct catcgtccgc gcggcgctga cgcacccggc gatggagccg      1560
     tatctgtccc ggctgcacct atttttgtcg atgtcgggcc cgcacctcgg gtacgcgggc      1620
     ggcgacaggg tcggcgcgga tggaatggac aagaagagcc gaaggttcat cgggaaatcc      1680
     gccgcgtttc agctcggcct ctgctgcacc cgcgccatca accccaaggc taagtgcctg      1740
     tccgaaatca cctttcgcga cgcggggaag atcgaggact gctacctgta cagactggcg      1800
     caccataaga acggattggc gctgttcagg cacgtcgtgt tggtgtccag tccgcaggac      1860
     aagtacgtcc agaggcacag cgcgcggcta cagctggagg ggttcaggat cagagagggt      1920
     tcgagaaggg cgcgggcgac gatggagatg gctcgcgcga ttctcgcccc cgtgctggag      1980
     aaagcgattt cgcgggagag gggagaggcg gggtcgagcg ggagggacgg cgtggagagg      2040
     gagagcgggg cgaggctgac gtcgctgtcg cgcgtcgacg tccacttcgc gaaagtgggc      2100
     ggcggcgtcg acttcaacca gctcatcgga cgcaaggcgc acatagactt tctggagact      2160
     gacgagtacg tcaggttctt gatctggaag ctgcggcgag cgttcctgta a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page