(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE93

MICSR_1.PE93         Location/Qualifiers
FT   CDS_pept        183379..183975
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636098"
FT                   /orf_name="MICPUN_56666"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61629.1"
FT                   /db_xref="UniParc:UPI000199A64A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X0"
FT                   /transl_table=1
FT                   /translation="MDAQQLERYANLAPCFFAVIGVVFMAKCKVAWHPILNKTGWKKDG
FT                   VFACSADSVFLRWASLVSHTFFIIGAVIFGNGILAISNVLGLPLVLGFWCASSSIIQSI
FT                   MYMAVFKQSPMGTPDIDGPPVPARVVIAAVWIITTANYIVNRATLYRDVDETRLFGLMA
FT                   VGVFLPAAIGAKHRTKNWRLHYMKDLPARDEAKTY"
     atggatgctc agcagctcga acgctatgcg aacctcgcgc cgtgcttctt cgccgtcatt        60
     ggcgtggtgt tcatggccaa gtgcaaggtg gcgtggcacc cgattctgaa caagactggt       120
     tggaaaaaag atggcgtgtt cgcgtgctcc gctgattcgg tcttcctccg ctgggcgagc       180
     ctcgtgtcgc acacgttctt catcatcggc gctgtcatct tcggcaacgg gatcctcgcc       240
     atctccaacg tcctcggcct gcccctcgtg ctcggattct ggtgcgcgag cagcagcatc       300
     atacagagca tcatgtacat ggcggtgttc aagcagtcgc cgatgggcac ccccgacatc       360
     gacggtccac ccgtgcccgc gcgcgtcgtc atcgccgccg tgtggatcat caccaccgcc       420
     aactacatcg tcaaccgtgc gacgctgtac agggacgtgg acgaaacgag gctcttcggg       480
     ctcatggcgg tgggcgtctt cctcccagca gccatcggcg ccaagcaccg gaccaagaac       540
     tggcgcctgc attacatgaa ggacctgccc gcccgcgacg aggccaagac gtactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page