(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE95

MICSR_1.PE95         Location/Qualifiers
FT   CDS_pept        186102..186791
FT                   /codon_start=1
FT                   /gene_family="HOG000123402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636100"
FT                   /orf_name="MICPUN_56668"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61630.1"
FT                   /db_xref="HOGENOM:HBG409904"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A64C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X2"
FT                   /transl_table=1
FT                   /translation="MCAPIRASYRRDNVVESVFEYTQLSLDTSLGISLHDITPQVRRAI
FT                   RESGVTNGTVNVLSRHTTTAVTINEAEGRLMDDIRQYMLKLAPPGDPYLHNDIHLRDGP
FT                   PDWPGGNDAWRAQEPRNAHSHLLSILIGNTLAVPVVDGELAIGTWQSLMLVELDGPRKR
FT                   TVGVQVCGTRSGMGDKPKRIDTSESSSNAASKSYQKKASPVSDGYKDPMDALCEDDPSA
FT                   DECKVFD"
     atgtgcgcac ccatccgcgc gtcctatcgc cgcgacaacg tcgtcgagtc agtcttcgag        60
     tacacgcagc tgtcgctcga cacgtcgctg ggcatctctc tccacgacat cacccctcag       120
     gttcgccgcg cgattcgcga gtccggcgtg acaaacggca ccgttaacgt gctctccagg       180
     cataccacca cggccgtcac catcaacgag gcggagggtc gcctgatgga cgacatccgc       240
     cagtacatgc tcaagctcgc gcccccgggt gacccgtacc tccacaacga cattcacctc       300
     cgcgacggtc cgcccgactg gcccgggggc aacgacgcgt ggcgcgcgca ggagccccgg       360
     aacgcgcact cgcatctgct ctcgatcctc atcggcaaca cgctggccgt gcccgtggtc       420
     gacggcgagc tcgcgatcgg cacgtggcag tctctgatgc tcgtggagct cgacggaccg       480
     aggaagcgca ccgtcggcgt gcaggtgtgc gggacccggt cggggatggg cgacaagccg       540
     aagaggatcg acacgtcgga gtcgtcgtcc aacgccgcga gcaagagcta ccagaagaaa       600
     gcgtcgccgg tgtcggacgg gtacaaggac ccgatggacg cgctgtgcga agacgacccc       660
     tccgcggacg agtgcaaggt gttcgactga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page