(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE96

MICSR_1.PE96         Location/Qualifiers
FT   CDS_pept        complement(186865..187356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636101"
FT                   /orf_name="MICPUN_107866"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62078.1"
FT                   /db_xref="UniParc:UPI000199A64D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X3"
FT                   /transl_table=1
FT                   /translation="MGPRPGWCFKADRHGLGYYRDPVQERREPEVPHHRATRNADRDKP
FT                   SPLYHAGEETEEPTYGHHHRGGRSATHHGGDGSQNRGNSIGTRPVVRQSKLFRRHESGN
FT                   AMKDILGNGGAMKWDENRMQGGYSGATYDHEAHNDALLRQHEQASILREVLSEVRGGQR
FT                   "
     atggggcccc gccctggctg gtgcttcaaa gccgatcgcc acggtttggg gtactacagg        60
     gatcccgttc aggagaggcg agagccggag gtaccgcacc acagggcgac gagaaacgca       120
     gacagggaca agccatcgcc gctctatcac gccggcgagg aaaccgagga accaacctac       180
     gggcaccacc accgcggcgg gcgtagcgcg acgcaccacg gcggcgatgg ctcacagaac       240
     cgcggtaact ccatcgggac gaggccggtc gtcaggcaga gcaagctctt cagaaggcac       300
     gagagcggca acgccatgaa ggacatcctg ggcaacggcg gcgcgatgaa gtgggacgag       360
     aatcgcatgc aggggggcta ctccggcgcg acgtacgatc acgaggcgca caacgacgcg       420
     cttttgaggc agcacgagca ggcttccatt ctcagagagg tgctcagcga ggttcgcggc       480
     gggcaacgat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page