(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE98

MICSR_1.PE98         Location/Qualifiers
FT   CDS_pept        complement(190250..190819)
FT                   /codon_start=1
FT                   /gene_family="HOG000264294" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636103"
FT                   /orf_name="MICPUN_99283"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62079.1"
FT                   /db_xref="HOGENOM:HBG560516"
FT                   /db_xref="UniParc:UPI000199A6B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X5"
FT                   /transl_table=1
FT                   /translation="MADVSDDDEDWYDTQADADDADADADDDDDANRQPDSWDAFWQRC
FT                   VRDNEQAVRDAGGDPAKVPGPQNLPTGRHGDVLKNGAPADHGKIRCWGCDARTTAQMEC
FT                   AQCLEIMKERAVKAAFDNWERAFFCSHLCYKEHYHEHKARHGPSKSVPTKTDGTIHHFP
FT                   CAEGCGALWDSKALRRHVFDECEPYE"
     atggcggacg tcagcgacga cgacgaagac tggtacgaca cccaggccga cgccgacgac        60
     gccgacgccg acgccgacga cgacgacgat gcgaaccggc agccagactc gtgggatgcg       120
     ttctggcagc gctgcgtgcg agacaacgag caggcggtgc gcgacgcggg cggcgacccg       180
     gcgaaggtcc cggggccgca gaacctaccc accggcaggc acggcgacgt cctgaagaac       240
     ggcgccccgg ccgaccacgg caagattcgg tgctggggat gcgacgccag gacgaccgcg       300
     cagatggagt gcgcgcagtg cctcgagatc atgaaggaac gcgccgtcaa ggcggcgttc       360
     gataactggg agcgagcgtt cttctgctcc cacctgtgct acaaggagca ctatcacgag       420
     cacaaggcga ggcacgggcc gtccaagagc gtgcccacga agacggacgg caccattcac       480
     cactttccgt gcgccgaggg ctgcggggcg ctgtgggact ccaaggcgct gcggcgtcac       540
     gtcttcgacg agtgcgaacc gtacgagtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page