(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE99

MICSR_1.PE99         Location/Qualifiers
FT   CDS_pept        191201..193954
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636104"
FT                   /orf_name="MICPUN_56672"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61632.1"
FT                   /db_xref="UniParc:UPI000199A6B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X6"
FT                   /transl_table=1
FT                   /translation="MAQTSRSTDIKVTRAMRDATNSVAPRDIAPKPPAEGKENSKYDGF
FT                   FFADPAGLTTPAPAFPTKTMDPSPTSVLMGPGTPDEAAEQRPREKATPENATDDGADAE
FT                   MTLATSPSDGESVDDDVASPESPERPATVPDLAVASTSPFVPNVLEELLGAQLPRAESN
FT                   VRARRDAAGNLAANGAPQSAQTRRVQHATSTPTSATSTRWRSVPSPAQIVSMGREWAAS
FT                   GTVTPGRSTAIPTFLDDLVNNHVAKVAVDTKGTNTESNNTDEWDRTGDLKVECERLKRE
FT                   VDFHREVSKEVGVSLDASAAELERTKRRVEFLEALKDEWDAQFKELSAETERYRAEADA
FT                   AREETLAAEALAAAARAAATSANAEAESLRKNVIHDDDGSTGEAPETSGTTSTSASATS
FT                   AEVGSAALFRRHRSGAENDVAASIAAALRERESELDAARLNLDQTLAAAKAAEAKLAAK
FT                   CEECAALRGEVNVAKSTLAAAREAVAQTEGALMTTLEDKKRLVEDKKRLIKKIEMMETD
FT                   ADAKARDACERVRDATERGRRSVLRARANWGAVALTTAALALGVCAWAAAVPPAGVLIA
FT                   VPFGIDFRDWRLGSDGSTSAFNAGFNVRTVNFTLPGAGYAVAAELSACRADLATSTALA
FT                   SALSSEASRFAGLAEENDRLAAEVEDFARVTESLREREADVRSLESRLAHLEASANDAA
FT                   TRGDDPFAASLAARAETERLRHALAKERSLRRRSAFLEKLDVVSIAAVCVAWGTCLLSA
FT                   WFFARKESGLRRTLNDYGALMEAASAEHERLGSELTRATLDANEERTRRERSEGRAREL
FT                   ERQLDASRKAANEATKRVEAFEAIGRRERERERDGARSAEKRFGKASSFGGGKSVTWDD
FT                   DVSIAPSTTSSSSVVDARAGAQNPEAAARPHNTVFKPPVGGVKSFQ"
     atggctcaaa cgagccgatc gaccgacatc aaagtcacgc gcgcgatgcg cgacgcgaca        60
     aactcggtcg cgccgcgcga tatcgcgccc aagccccccg ccgagggaaa ggaaaacagc       120
     aaatatgacg gcttcttctt cgccgacccc gcggggctga ccaccccggc ccccgcgttt       180
     cccacgaaga cgatggaccc gtccccgacg agcgtcctga tggggccggg aacgcccgac       240
     gaggccgccg agcagcgccc gcgcgagaaa gcgactcccg agaatgcgac cgacgacggc       300
     gccgacgccg agatgacgtt ggccacctcg ccgtccgacg gcgagagcgt cgacgacgac       360
     gtcgcctcgc ccgaatcccc ggagcgcccc gcgacggtac ccgacctcgc cgtcgcctcg       420
     acctcgccgt tcgtgccgaa cgtcctcgag gagctcctcg gcgcgcagct ccccagggcc       480
     gaatccaacg tccgcgcgcg tcgcgatgct gcggggaacc tcgccgcgaa cggggcgccc       540
     caatcggccc agacgcgtcg cgtccaacac gcgacgtcca ccccgacgtc cgcgacgtcg       600
     acgcgatggc ggtccgtccc gtctccggcg cagatcgtct ccatgggccg cgagtgggcc       660
     gcgagtggga cggtcacccc gggtcgatcg acggcgattc cgacttttct cgacgacctc       720
     gtcaacaacc acgtcgcgaa agtcgccgtc gataccaagg gcacgaacac cgagtcgaac       780
     aacaccgacg agtgggatcg aaccggagac ctcaaagtcg agtgcgagcg tctcaagcgc       840
     gaggttgact ttcacaggga ggtttccaag gaggttggcg tctcgctcga cgcgagcgcg       900
     gcggagctcg agcggaccaa acggagggtg gaatttttgg aggcgctcaa ggacgaatgg       960
     gacgcgcagt tcaaggagct cagcgccgag acggagcggt accgcgccga ggcggacgcc      1020
     gcgcgggaag aaacgctcgc ggccgaggcg ttggccgccg ccgcgcgagc cgccgcgacg      1080
     tccgcgaacg ccgaggctga gtcgctgaga aaaaacgtca ttcacgacga cgacggatcc      1140
     accggagaag ctccggagac gtccggaacg acttccacct ccgcatccgc gacgagcgcc      1200
     gaggtgggat ccgccgcgct gtttcggcgg cacaggtctg gcgcggagaa cgacgtcgcc      1260
     gcgtccatcg ccgccgccct tcgagagcgc gagtccgaac tcgacgccgc tcgtttaaac      1320
     ctcgatcaaa ccctcgccgc cgcgaaggcc gcggaggcca aactcgcggc caagtgcgag      1380
     gagtgcgccg cgctgagggg cgaggtgaac gtcgccaaga gcacgctggc cgccgcgcgc      1440
     gaggccgtcg cgcagacgga gggggcgctc atgaccacgc tcgaagataa gaagcggctc      1500
     gtcgaagata agaagcggct catcaagaaa atcgagatga tggaaacgga cgcggacgcc      1560
     aaagcgcgcg acgcgtgcga gagggtacgt gacgcgacgg aacgcgggcg ccgttcggtg      1620
     ttgagggcgc gcgccaactg gggcgccgtc gcgctgacga ccgccgcgct ggcgctcgga      1680
     gtgtgcgcgt gggcggcggc ggtacccccc gcgggagtat tgatcgcggt tccattcggg      1740
     atcgatttcc gcgattggcg gctcgggtcc gacggttcga cgtccgcctt taacgccggc      1800
     tttaacgtcc ggacggtgaa ctttaccctc ccgggcgcgg ggtacgccgt cgccgctgag      1860
     ctgagcgcgt gccgcgcgga cctggcgacg tccacggctt tagcgtcggc gctctcgagt      1920
     gaagcgtcga ggttcgccgg cctcgcggag gaaaacgatc ggctcgccgc cgaggtggag      1980
     gatttcgcac gagtcaccga gagcttacgc gagagggagg cggacgtgcg ttcgttggag      2040
     tccaggctcg cgcacctcga ggcgtccgcg aacgacgcgg cgacacgcgg cgatgacccg      2100
     ttcgccgcga gtttggcggc gagggcggag acggagcgcc ttcgacacgc gctggccaag      2160
     gagcgatcgc ttcgccgacg gtccgcgttc ctcgagaaac tcgacgtcgt ctccatcgcc      2220
     gccgtctgcg tggcgtgggg gacgtgcctg ttgagtgcgt ggttcttcgc gcgcaaagag      2280
     tcgggacttc gtcgaactct gaacgactac ggcgcgttga tggaggcggc ttccgcggag      2340
     cacgagcggc tgggttcgga gttgacgcgc gcgacgctcg acgcgaacga ggagcgaacg      2400
     aggcgcgaac gttcggaggg tcgcgcgagg gagctggaga ggcagctgga cgcgtccagg      2460
     aaagcggcga acgaagccac gaaacgcgtg gaggcgttcg aggccatcgg tcggcgggag      2520
     cgggaacgcg agcgagacgg cgctcggtcg gcggagaagc gattcggaaa ggcgtccagc      2580
     ttcggcgggg gaaagagcgt gacgtgggat gatgacgtgt ccatcgcgcc gtcgacgacg      2640
     tcgtcgtcgt cggtggtgga cgcgagagcc ggggcgcaga acccggaggc ggccgcgagg      2700
     ccgcacaaca ccgtgttcaa gcccccggtg ggcggtgtca agagctttca gtga            2754
//

If you have problems or comments...

PBIL Back to PBIL home page