(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_12

ID   MICSR_12; SV 1; linear; genomic DNA; GRV; PLN; 2053059 BP.
XX
AC   CP001574_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 1, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001574.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2053059
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 1"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(complement(1337..2041),complement(937..1263))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639211"
FT                   /orf_name="MICPUN_51161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68661.1"
FT                   /db_xref="UniParc:UPI000199C3AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FEZ6"
FT                   /transl_table=1
FT                   /translation="MISTLSSTHQTRMLCSSIAVSRRSVRGKAGCALGTTSGHRQGLST
FT                   KRVLTRRRVVGTGARASSVSPGFGTKGKARSCSVVMKGLPETLFTIGTVAVLPLYGAMI
FT                   GAPKAEMTQNAMSSHLPFMLMGALYAAAALVSLQSVDAKALVDVFFANTNGDGVMSIAR
FT                   HALTLLSGFLATAEPASCMWLHLLSLDLFVARHVYLDSLALNVPAAHSLTLCCMFGPCG
FT                   YLAHTFTKAFMANRFEDHHKVERAARGKPGRSCDGALQAAQDVRRTGADIRKRHPRCAN
FT                   PAFRERTGRRARRPRRRSRRRARGALVPHHASRVPRSGDGGRLLCGRKVWARDDGFLGV
FT                   RAA"
FT   CDS_pept        join(2224..3036,3097..3540)
FT                   /codon_start=1
FT                   /gene_family="HOG000264289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639212"
FT                   /orf_name="MICPUN_77703"
FT                   /product="Predicted protein"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO68271.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG559073"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="UniParc:UPI000199C3B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FEZ7"
FT                   /transl_table=1
FT                   /translation="MDVSLSGGTLRSFYRSIGSLSKVGAEVLIEAVRDSDGQRNGGLTI
FT                   KTINTARSAFLSVTFKSTSFDAFSVTVAEGTLQTAVYAKHLLAALRTQKVDRVFLSQGV
FT                   DTPDRMSIQLECGRGTLRKTFGVHCITDVAHVRATLDPSTMPIKIAFRPKELGRMLSHF
FT                   QSSQEDITISCAPEDGAGDVLRDANAPATRNLKLSSYVDPNAPAGQALQTSVSLDSGGQ
FT                   DAVLRYEHDGGEKVDVTVNLKDFRVMTGLCEQLDVDVAVYIDSPGAPLLQYHQYGRGYA
FT                   FDPSNVDFDAELVLASMLPRMDQEPSQTLGGTTREQRAAETGPPPPVASGMESELTERF
FT                   PRGGRGDPSVGAAASTGIPDSVDGSQPVGKHQRETVQGPSRDVQMAWAPGEVDNHGGDD
FT                   DWLGEYVEATPPNPKKPRH"
FT   CDS_pept        complement(3630..5075)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639213"
FT                   /orf_name="MICPUN_54776"
FT                   /product="Major facilitator superfamily "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68662.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199C3B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FEZ8"
FT                   /transl_table=1
FT                   /translation="MRSSSGELNPRRGRRLTASATADLEAGEPEPKLQPLEGRELLMRV
FT                   LPCVLVASLGAFSFGYHLGIVNPALDNLARDLGIALNTQLKGLVVSTVLVGATVGSSYS
FT                   GRIADSVGRRAALVGTAAPLVLGSILCGTAANVWFMLVGRLLAGWGIGAASNLVPMYIA
FT                   EVSPKQLRGTLGSLNQLMICIGILVAVIAGMPLASDPNHWHNMFLFAAVPGLLQGVFMT
FT                   VVPESPGWLRRNGKVAEAAAAETALWGAPDVSGGDDKDDKDEKKVSTAELFAPANRRAV
FT                   TIGTGLFFLQQMSGVNAIVYFSSAMFVAAGVESAVAASVAVCATNVVATILSGQALDRL
FT                   GRKPLLTGSFIGMGISCLVMSYAMANQGTWALAGPVAVIAVMSYIASFGMGCGPIPGLL
FT                   SSEIFNPRIRGAGMSLCFTTHWVFNFVIGQAFLPVVEAVGGPAVFIGFAGVCALSVLFV
FT                   KAQVVETKGKSLDVITKELAAAK"
FT   CDS_pept        6053..7414
FT                   /codon_start=1
FT                   /gene_family="HOG000201121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639214"
FT                   /orf_name="MICPUN_98447"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO68272.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000199C3B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FEZ9"
FT                   /transl_table=1
FT                   /translation="MAGDFFESPRSLDANFAAGTPAAGSKAPSSPSAGGSFGLDDLMSQ
FT                   SLGGIAGGSMSSSQKGPSMMATATSSRGGSAGDLSHGGSQAGGDADDILGAMFGTISGS
FT                   ETASPRGMTPVSGSVPNDMDAFDVFASGTAGNTGEENSSADISGGEGDFATDLERVVER
FT                   ARSKTSGSSRLSSVTRAEPVVDGFAGFDDLLSPGPGSMPKASVGGSGPASSGPSSSAPG
FT                   GDSLEDLLGVGTSSKKPAGAAGMSLGDELDGLFGAPSVPSGQPPAVIDDMFGPMMGSGG
FT                   VSSSGVATTIAGKVTLDEIEYDGSDDEQEGDTEERTAARKKRHDRVRAAMQAKLQEKRD
FT                   REIAAVAEQAERQVLKDLIGAEIDEWLRQNQGNIRTMLAKLGDVLWENHGYKAPSLNEL
FT                   IEANSVKKAYHKALIIIHPDKVRQKGGSTDQCYIADRVFDQVRDAYKAMCEKEM"
FT   CDS_pept        complement(7552..8418)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639215"
FT                   /orf_name="MICPUN_107437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68663.1"
FT                   /db_xref="UniParc:UPI000199C3B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF00"
FT                   /transl_table=1
FT                   /translation="MEPRPEDPARADTRHHVRPSAPGADTAAGEGEGYRVINGGLSEEQ
FT                   IAERVVDYDDDEYGFVKMVRSALVEAGVLKEETPLGKLHALAPPKGRRKNPFLFVLQND
FT                   LRKSKEFAAALHRFVRQEICAALGVSRVAYQRRPTFRVHMAGGPAQGFAHADGLEPYNH
FT                   QPGEVNIWLPLSKVHGSNSLMCESSPGKGDFHAFEAEPGQFVKFYGNRCWHYCLDNKTD
FT                   DTRVSFDLRVVPMDLFDNNHDGPSKTLTKKSSKKRFSGIKPLKLGEYYMDSDAEFDEQW
FT                   QQMRGRM"
FT   CDS_pept        <8873..>9628
FT                   /codon_start=1
FT                   /gene_family="HOG000031498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639216"
FT                   /orf_name="MICPUN_70936"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68273.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG521273"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C3B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF01"
FT                   /transl_table=1
FT                   /translation="LDAFILDDIVSASECEALIKCAEGAGYSFWNAAVSTATFRNSDTV
FT                   EIHSAAVADELWRRCAHLVVPTVVIEQGHPLWEPGLEGTWKACGVNDHLLFNKYEPGGH
FT                   FSPHTDGASIVDMNRRSLYSMLVYLNRCPDGGGTALFSPPEGTSMGKFVVDPALGVYRW
FT                   PEEWQTGVAPVEPGTALVFRQDTSHEGVPVGPGHRKIIIRTDVMYERVPPVFIDYVGKQ
FT                   AYDLHREAQSAEGEGDHMTAMRLYRHCRRL"
FT   CDS_pept        complement(9785..11683)
FT                   /codon_start=1
FT                   /gene_family="HOG000293296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639217"
FT                   /orf_name="MICPUN_96766"
FT                   /product="Predicted protein"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="leukotriene biosynthetic process "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68664.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019370"
FT                   /db_xref="HOGENOM:HBG444814"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR015211"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C3B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF02"
FT                   /transl_table=1
FT                   /translation="MPTFDPSSQSSYPATAVTHVAFDVDVDFDEKIISGTATASVKVQS
FT                   QSSTLVLDTRDLHIERVQLDGADLTFSIGETHPVMGAPLVIELDKQMEKDSSFDVVITY
FT                   RTSPSSSAVQWLRPEQTAGGKHPYLFTQCQAIHARSLFPCQDTPGAKMTYSAKVTAPNP
FT                   LTALMSAIPIGEPADAGDGKSSFEFKQDVPIPPYLLALAVGNVEAVEIGPRSKVWSEPE
FT                   MVQAGAFEFSETEDFLKAAEQVAGPYVWGRYDLLLLPPSFPYGGMENPCLTFVTPTLLA
FT                   GDRSQAHVVAHEIAHSWSGNLVTNKTWEHFWLNEGFTVFIERKIMNKMYGKSVFDFNAI
FT                   GGLMELKETVARLGTNHPHTVLKPELAGGVDPDDVFSKVPYEKGFAFLVYLEHMTRGDG
FT                   DGPERADAANGTPEFAEFLIEHFQRHQYATVESDDFKAAYTARFPEASAQVDWDAWLTK
FT                   PGMPPVDIGQYYDGGSSEASAELARKWHLCDVLGMGGEGTRPEGASAGDIKDFSSMQVD
FT                   HFLLSLIEYRGGSHALSVNVVKSLDELYKLSEFKNSEIRCKWLQLRLAAGDAGAFEPAR
FT                   DMLRSQGRMKFLRPLYRSLSKSKAEGGKKFAEETFAGARNMYHPIAEKMVAADLGM"
FT   CDS_pept        11925..12911
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639218"
FT                   /orf_name="MICPUN_98450"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO68274.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG607962"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C3B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF03"
FT                   /transl_table=1
FT                   /translation="MRVALASVAPAGVHRRVRLSRGRARGIRTRASPNPPFDAYEVLGV
FT                   NDDAKEDEIKLAWKGLQRRYHPDSGSEADAKKSADINRAYDILTDKSARVRLDDALMRS
FT                   NDGKRRRAARTVISASGLVGPLRERLLASMEVCGSVDACEIDVTDRMIESIREWGRMLA
FT                   FTSELPLPLPLQVDDVPSGVKLAIVKFNDKLIEVGALYITVEEDVDAGKVDVVITRSWS
FT                   EAQKGVDADTQLPGEQRILTDFSQEFNFLVGVESGRLGAKTAGGSKNPFAEGLSNVVSS
FT                   ISSFALPVMPLFGSARNVVPGGSYDAYKIRSGSFDSKDEDADDVADV"
FT   CDS_pept        join(<13084..14025,14461..>15015)
FT                   /codon_start=1
FT                   /gene_family="HOG000019333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639219"
FT                   /orf_name="MICPUN_67312"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68275.1"
FT                   /db_xref="HOGENOM:HBG349269"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniParc:UPI000199C3B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF04"
FT                   /transl_table=1
FT                   /translation="RRLVLFLVALCYLAAFASLRDQWRGLFGRNGVTPVDALLAQVRKN
FT                   GGLSSLVDRIWTLPTLLWLGDTASVDAMGEAMCSAGAVLSVTAASLALFTRGGGSSIVW
FT                   MSLWGMYLSLFHVGQVFLSFQWDILLLEVGFVCMWLSPKLRPTSRDPPHPAGLWLLRFV
FT                   CFKLMLMSGAVKIQSECPTWLGLTALDYHFDTQPLPTPLAWWASTHVPREVKRFGVAAT
FT                   LAIEGPLTLLLVAPFRRARTVGAYSQLLLQAMIAATGNYTFFNLLTVALACSALDDASL
FT                   GRFFFRNLWRRAEDSNGEPKTPNDDEPETPKTPTNAWLAFIVPCVVRYAWMFALPASCV
FT                   AHCYDRVRASSSRTVGFVRIAGACFTLVASAAMLGVVLKPLHQVVPKSTGVSVLGEFGL
FT                   PAGGVEAALPSFGSRWDEIIDTYAAKFRLGSGYGLFRRMTGVGDDGSVMRPEIILEGSD
FT                   DGSNWTAIEFKHKPSTDVKVAPTWVAPHQPRLDWQMWFAAL"
FT   CDS_pept        15800..27805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639220"
FT                   /orf_name="MICPUN_54783"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="protein localization"
FT                   /protein_id="ACO68276.1"
FT                   /db_xref="GO:0008104"
FT                   /db_xref="InterPro:IPR009543"
FT                   /db_xref="UniParc:UPI000199D58D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF05"
FT                   /transl_table=1
FT                   /translation="MVFENLLAPLLERFLGQYIVDLPREQLRVGVWSGVVRLENVRLKP
FT                   AAFDHLKLPFAVREGTIGLVELKLALKTVLLSARQHPFVITLDAISVTASPRAEDEWAA
FT                   EPAAKRALALKRAALAAAAAEIAATKKRKGRSSAPASSSAVLDALWAPLLDRLRLKVGS
FT                   VHVRFADVPRIGAVESHDTAAIGIRLDSLLVATPGVGEDERDRKPGEGADDEDEPSPST
FT                   SKGADDDVPPRGRGPSRGGGGKTRSSYTASIGGVLSMVTPVREARKRVEVKGLRVYSHV
FT                   RGDVDDPEEWCPRVTGSELVRGGGHDDDVHEDDVIVGTDDLSATLTLTARSKVSPVNQG
FT                   QDDRNNQNAKDSQQGGFDVKLELHGEVSARTRPSQARSLMRLGDQMKVYALRERHGADR
FT                   PVDTKDWREWWRYAIKSVMRDLSDKEDGSNPKEDLKRAANVMRYVDLYRKRLEGQSKLG
FT                   TKSLDESVDFGEDEFYDCEQPDDQDIARLELYSLENELSLEELLTARNRAEELMHDDED
FT                   DGEFHDAEESELESEFGVDDDEDTGETKRKGFRWAASALYRRGQSAVTSAVGLAVNTMA
FT                   STSTYVFASSERARSGRPAFTLIAECFSITLCAETEEQTYGVTRRIAADAVRVEVRGIK
FT                   VETWEGPSTSALALSVGVHDMEAWMVTRGDRNDEGDGNANRIRAAWRRNDSQLGDSGGP
FT                   VVKVTQRRTIGGSEGVEDDSTGVQPLEVAVAPLAIVAHSRIAAALAAFPQEIPGSHFGR
FT                   LLSSVCGLRGDSHRERLVRATTSIDLELRAQPWRLEVNHTLFLLPSAHTSNDPKACADS
FT                   CAAALEISRLAVEWSPGGSRALTASEISDVRAHAEALVRNPTSDPEDVNEAVFALEQAA
FT                   STHQVAAAFSGVQVSVPVLRTSRAGGGFTWSPLFDEFSGRVTAVMRSLAVGGGDASNRV
FT                   RARLGVLHVGVTPAVVSSLVRVQNAVEKLAAEVDASAPRHVGDAFLPFSSNPALDLDLS
FT                   MEELSVAASSTSTSALYVAKLTSMDARVGQSRSGHAWINCSVQSAGVDVANASLLRVNA
FT                   LRENMVDVKSFLRVDGCVPATGYGPGKVNVEACGVEAVVTSRLIVVAAEFAGLVDATGG
FT                   DVPAGGPRDQANYVSLLGAGRRRSVRRSLHFLRNAVESDAGTLSDETRDADWAALADPF
FT                   PMSLPEDISSKDGDAVTVSFALATTTRVVMFEHREKGPSETSGEPVAVVDVSTAEHSSV
FT                   VPRSAKSASAQHSFAVRNVRVWSPASSPATADVLPSSDPGEKDAVLLNVGVRVKADAFE
FT                   GSKQPVVDVSVTHVRAGAHSESIARIARFGAACAKHAAAFSPPATAVEEDASSDVNGAT
FT                   SFEPGCLTVKIADASVFVPSPRRGDPAGYSDGRGLLLALGGTNLMTRLPFACAWKDDPS
FT                   FALASFGVQSVRLAATEPEEYEWIVALQPQRSAAMNRRPMIHADPINVPALLSIGAVRG
FT                   IEKPSEALSLSVEVPLVSCTLTPTSAGLVLDAARAFSAADFGENPPALAAAAEETTVTR
FT                   DDKGSDWSVNIAVDRVSALVQSSDEREGEFGGDGDEISALITSSGMGLKVKSASSGAST
FT                   AMKIVASFDRAHVLDVSATAAGEAERMAAGVKLGAEQDVGVFLAWIGVVSGDESRRSVL
FT                   TARALFDDATDAPTSAGLDVALGGGGFAVNIPAWDRVVALGSALASEVDSANDADAAKS
FT                   LETSHASPLAPVAEDDSKPKKKPSRVPLIVKSALSTGEWTVTLPWKGSSETDARAMRLV
FT                   VDARASASASLDVNAGYAVKGWGGAVTLDRLSLDVRESLPDLSQRTHSLAEAKGVSLSA
FT                   TSDQSDWSTGVSLDLVVRDVSAAVSTRRLQLIKELQGLLDDGAAPPHTRSHGGSSAQQE
FT                   PKTSVPLAFPPISMSVQLDTVGTLIVNDGDEDETIGVPLVEAAVLGLSASLTADADARL
FT                   GLRVSVNVEAQALVDFLNHRKGAWEPIVEPWRVRVGVDALIAPEKTSAPTKIGVKVVGV
FT                   DQLEFTATEAGAVATAAAALALFNGVKATGSPTSADGEDVPSKAALQLQIKTRRQHHSY
FT                   WLHNATTSPVEYWLDNSDQTMTNGDTDRCGTVPAGERALLCFPDVKSRAAPRYSCVAGV
FT                   ETLVSPAPAPPPAPTRAVVLRVEGCAAASKPIVLDRAAAYVLDPSNGSNGSADGSSDAR
FT                   LVAEVRQVVDAQGGSRELSGTVRSELLLRSDLAFQNATLTPVELRFDRRLSERLVSSPA
FT                   LAVDAGQRVWLPMPLAGGSARVQWRPLPEPDEARSCGGATKVGVIRRGDGARGSLPDLP
FT                   DASEYGWSDPVSLRTLAAAAAAVTDSDDRPEPPHATAAPRWGSRATGSGSFRCVVTAHH
FT                   SRKAAASVVALAPPLYLTNSLPVSVSVSVGSGPTDAEASPDGSRASPRAEQRRQRGEHL
FT                   TVAPGATVAVHDGAADASSTVDVHVRPAGYTAVRPAVAVPVMPRTKRFGDEAEGAIWSA
FT                   RREVFFADDGTPGRLARRVPVSLKIEATVDEHGARRVRISCPTSAVNRSTDPLILQQVR
FT                   PPRPNTFGKGDAASLGLAGSDLRGWAKRRRDRESRVKTPGEGDCWLPAATEVVTLADAS
FT                   GGEVVRPRTPRRSHGPGVPSSFGVVAMSSPRRLTESQAHGVAHISSRSHSPPLSVHDVA
FT                   MSASTDGFSTDVSMSASASETSLARDSGTRKYNTDDEGALLGHRSSRQLEAVRAIDALS
FT                   VGMSPGDGQIRVHDGSPMDAVPRRGSFPTLFRDPSKIDAGSTNWSPGVAMYGGSPHNES
FT                   QSELVIPQFVRFRSPDAAHWSATTRLNPGDRPVVVRCPAALSPAACYEYLVSLRNPLTN
FT                   AGAVGGTVSVGPRFVVRGNPLGSTDAIWFRQPESAHAGRLLAGRDESVTLWGDAMGPRS
FT                   LRFRPDGGAWSWSAAVPVDRPGVVYVKTACLTRDPAEIARLVSKISSGLTTPGSPSVSR
FT                   RLGFHSPPLPGTPRRSNVSPRPSTYVRSSSSVLCRVFCVAVAQSRSVKGGWETEVSELG
FT                   PGEIDAVAPVKFENRSGTTVSFRQADAPRTSAGDDVVEPGQVAAYAWDDPFGLKKLVVS
FT                   IPGSEYVTTVAVEPDPDIDDLDSDEDEDEETGMVTRQIIARFVDEKRPNALLRLRIVRS
FT                   ETAGVPCVVTVEEADAHTNTAAAASHRASAEIEAVRARLAAQGASPIEGLVNQGQGVQP
FT                   STPASPASTAKSGPTPQSGTVPGGVSPVATRVMTPMLPRRLRPIAKALAFAADVSRAAV
FT                   KTSPPPLSIEVVLEIPSVGLSVVDAQGSVELLYARVAGARAAVLARGVGSISDVASAIK
FT                   EGSFSLRVAHVRADLQTPGAASQPSVFSSGGSSNLPRGAHPKPALAAKTTVARQQQVST
FT                   GARGPGHATHSFAWEVQSLLVDTAPLVVDLREELLSAAPRVAAGFARPFRAVGQTESSR
FT                   TDDGDDKAQAKPSRRAMALKSARSASGVPPEDFVGVGGVRVGPFDVVVSFTALPFLPWG
FT                   VRSIGAVDKARVSLRPFQLPSPISPKPPAGSSVWTAEQVATLATRHYIAEAAGQVVKFV
FT                   ASNKLLGDPARFWSQISGAVVELRSAPARRGAGRRFRRRIASAVAEAAKTTLQHAREVT
FT                   GEVEARFLEARELRAARLRLRRIEDPDQENVDGGESNVPGSDVAPSGAETSSSARVEHP
FT                   TWEVVVGVLRAAGSLVEAPLQGAELRGIPGFLEGAAEGAMGAAANVTSATLTLASALVD
FT                   KLAVYGDSNVDEEEGRSSDGAQSGAQMSIRGGRGGVVLTPRLRPPRPPPSNHLEPLLPF
FT                   NGVEAMARELHQYAAGGRFAGECFVAGAKLVRPRGAFVAVTDAHVIVGVNVGSSSETGA
FT                   SKWLAREALPLEDVVTVSNRGSIGAETVVVRALPRRTTASGRSDRSTEGGGGSDQTSGA
FT                   VAPAGDSALELVLRPVAYVAALAHRLGREGGRATPPANVTERLRNGTAAVNGTAAVNGT
FT                   AVNGTAVNGLVWMAKKPSASPGLGIREVELHCVDEACAGALERCLVQATRTSGREARGV
FT                   HLA"
FT   CDS_pept        28091..28660
FT                   /codon_start=1
FT                   /gene_family="HOG000010048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639221"
FT                   /orf_name="MICPUN_78252"
FT                   /product="Predicted protein"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="ACO68277.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="HOGENOM:HBG303311"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniParc:UPI00003260DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF06"
FT                   /transl_table=1
FT                   /translation="MVQANELRVGQIIERDGSLLQLTKVSYTQGQARAAGNVQVEWRNV
FT                   RTGQKQSLRLSPSDKLDRAVLSEEEHVFLFQAGDELVLMHPKTYDQVEVRAEVLGEVQR
FT                   KFLTDNCEVKLLMHEGEIVSAELADEVEIEIASAAPSLKGESVSNQYKPAETTTGVSLK
FT                   VPSFIDAGDVVVVNTKTGEFVRRAKR"
FT   CDS_pept        join(28931..29055,29183..29657)
FT                   /codon_start=1
FT                   /gene_family="HOG000264809" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639222"
FT                   /orf_name="MICPUN_77910"
FT                   /product="Bah-phd domain-containing protein "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO68278.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG318538"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199C3B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF07"
FT                   /transl_table=1
FT                   /translation="MAPPAPKGRKVDSCVFNGEKFAVDDTITLRPPNSSGPPFVGKISE
FT                   IIKEPNGEEQCHVSWYYRPEEARGGRKAFHGDKELFTSDHYDWVAKSSINGHCSVHKLR
FT                   EYQQLTEVTDNDYYTRFSYKASKGEFKPDKVPVYCACEMPYNPDLFMVECESCEEWYHP
FT                   QCVGTTKKQVEKLAHFVCPSCDKKAQAREAKKQRVK"
FT   CDS_pept        complement(29795..31210)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639223"
FT                   /orf_name="MICPUN_54786"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO68665.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C3B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF08"
FT                   /transl_table=1
FT                   /translation="MGCSASQLEQAKKYLPGRKGEARHDIDDMPDILQKLTAAKQNAAA
FT                   KVALKMLLDVAETEMASSAVVRSGKVVPKLVAWVSSKDPEVKANALDCCALLSMHDTGC
FT                   AEEIGTPEFLTQVGNMYKAKDKKLAEAAARFFSKAGGNKTVRQRILDCGVHKQLWMMVK
FT                   SKKESVMKLGLIGYSKLADDPAAAEKLCEDDVEELVKFFFIRIAKTDDTDVEKWCLIAV
FT                   ARLSLATEFGNKLAAMDKFGVLFVKANDTIAGRKLPAALAIANLATNKMLRVRLIKYRA
FT                   LQLFVEMSKVSSNARRDMQDFQRVAALGIRNLAGSFDLRALAGKMGALEAVVKMLRSKD
FT                   LDVARFAAKAASELSLHEENGRKMVLAGALKPLIDMAKSGDAYCETEAVAALANLAMGD
FT                   DNQKQFMKEGGMAAIEVMTLSKNPRVQHNAKRLISRLRLAKMRTAARFAAQMAASQKEL
FT                   QRKREAMGYMGGD"
FT   CDS_pept        31530..32006
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639224"
FT                   /orf_name="MICPUN_54787"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68279.1"
FT                   /db_xref="UniParc:UPI000199C3BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF09"
FT                   /transl_table=1
FT                   /translation="MSAATIASLRAAAEAQKASAERALRTLDEMEARGDTDDDASEELA
FT                   SLASTVAEELGGVVESWRGAADGNKPREMVGVGLMMGGMSLGELKGAIASRPSKNTDDD
FT                   DDGANDANRKIGVRVVPASSSTPVAPNVAGGKPAWMLELEAKKRAKAASERHVG"
FT   CDS_pept        complement(32109..35411)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639225"
FT                   /orf_name="MICPUN_54788"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68666.1"
FT                   /db_xref="UniParc:UPI000199C3BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF10"
FT                   /transl_table=1
FT                   /translation="MSWLNNLNVAKLAEQAQAAASKLGDELDKGFDMLDEGLEKGMNAA
FT                   KEAMRDDEDDGDRAGAMGGAAALGAVGGASAVAMSRRNDEADEIEVTLRRNLAVAHSEI
FT                   TRLDEELRAARADADAAREDASRFAKQAAAATMKAAGTTPTKEPKPSTDDDAESQEELA
FT                   KARSEANAYKEKFAKAVKKGKGIALELDGANKELDAVKRRLDDALREAETSRRKMEDAY
FT                   AEVANKDAELESKEHDDPSDVAKLKAAKEEIASLEQHVEKLEVSVAEVNREAAKELGAA
FT                   RKEATELKEKLAAAERELAEVRTNSEKSRAQLSADTDDSKPDAAATLASIEAKHQAEVE
FT                   AARVEAEGLKAEVESVKAKLEAEVESLKAKLEDAQSKDAKVDSEPSDNAGHPSEELDAL
FT                   RAQREASESTVSELRAELKSVTERLEEADKARSLMKLEGEGSEKVVEALRAEVDRHRRA
FT                   AEEAIAAATETQNELEKADADRVKAVKSLESKVGDLGAELEAVKAAKTAAESAIAEEEA
FT                   ARRGAEDRADDLERRVAELERNEATEREGRSGASRRVAELEDSAARMKKEMKEKDAKLA
FT                   NETERAADAQAAAGRAAAAMADVAKKLTEANAGKKAAEDQLNELRQRVENLDQTVEDAA
FT                   KATDARDAAVLQAAAAEQRARAADQRAEEAVAAAAETAKEGEERKRRFAKLQEQFKERE
FT                   EALLARAEEAERAVQTQNDTPSAEMEQMVGEAIEEAEAATREAREESGKLRAQADRLAA
FT                   ELDAVTRRTEELETDLADARSKASALEEMAKVRTETSNVIHRGGSGPGGIRDGGQTGVD
FT                   VAAIEAAAVKRGAEAASDEVRRARADAKAARDEVESLKARLETTGVRSNPNPNPNPKDV
FT                   HAADENDLAARERLARVLARLRGSSSTPGQEPGSNDSSLWSWAFGSSEENAAAEARASS
FT                   AGVGFEGTNDTSSLPPPLETLIADFESAESGAWAHETLEQARRVAADATARAAKAEAAL
FT                   GARDESNAAAAVTAAASQTAQAKRAAAAEELVQEVAAKLEKAEKRCRDLEWQVSMLVDK
FT                   NELGLGGGKGQASTNGVGPGPAPGGDAPRGPGQWLQKAIKGCVAPRPGRGGG"
FT   CDS_pept        join(35638..35685,35789..36721)
FT                   /codon_start=1
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639226"
FT                   /gene_name="SCS-alpha"
FT                   /orf_name="MICPUN_54789"
FT                   /product="Succinate-coa ligase"
FT                   /function="ATP citrate synthase activity"
FT                   /function="binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /protein_id="ACO68280.1"
FT                   /db_xref="GO:0003878"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG615372"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="UniParc:UPI000199C3BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF11"
FT                   /transl_table=1
FT                   /translation="MATRETARRLMQRVASVGRARQMSYAAGEEPAVFVNKHTKVICQG
FT                   FTGKNGTFHSEQAIAYGTNMVGGVTPKKGGTTHLGLPVFNTVAEAKAETGANASAIYVP
FT                   PPFAAKAIMEAMEAEIDLVVCITEGIPQHDMVRVKQALMRQSKTRLIGPNCPGIIKPGE
FT                   CKIGIMPGYIHKPGRIGVVSRSGTLTYEAVFQTTQVGLGQSTCVGIGGDPFNGTDFVDC
FT                   LERFVKDDETEGIIMIGEIGGNAEEQAAEFIKASGTTKPVVSFIAGLTAPPGRRMGHAG
FT                   AIIAGGKGGAQDKINALESAGVTVVKSPAQMGNVMYDIFKERNML"
FT   CDS_pept        join(complement(38907..39032),complement(36820..38784))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639227"
FT                   /gene_name="ACBP"
FT                   /orf_name="MICPUN_54790"
FT                   /product="Acyl-CoA-binding protein "
FT                   /function="acyl-CoA binding"
FT                   /protein_id="ACO68667.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199C3BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF12"
FT                   /transl_table=1
FT                   /translation="MAHKLPFPDRFYAAVGFAANPPLGSRAVSDETRLLLYALYQQVTA
FT                   GPCTTPKPFWNQLERAKWNSWNSLGSLSTIDAMRMYVSGIEDENPDWYDLVTNDGDEER
FT                   VREVAEAAAEAVAAAGMDAKAQLARLDDRGDGGQKDQPSPRTPGPPPAGRRSLGRSPRP
FT                   SADNLTQSVSRSSLSSRDPPLDPAVAKIPCLEDGTWTDVTYAVGGAKPRGRSGHASVRI
FT                   GASEVWTVGGVRNGRRIADVCVFDTIKMEWASDDELRCSMKPGEVDVAHLTGWPARSGH
FT                   AAVAFGTKILVIGGHTREDDPVDAQCEVWVLETTSREWSRLKVEGDAPCARGGHTATMV
FT                   EGKGGRNPRVVVFGGEDRRGRLLDDARVLDLTKMRWIEDERTRTNKAPRGRGVKAPTWP
FT                   AARSGHVACCFGYGSPDVYVFGGVKAGGAGEPTDELFCLNSMTMTWHRLNPAGVVPAPR
FT                   TNSAGCVLDDGIWLIIGGGNGGGGLADTVGLKLANPRGVGANQVSGLEWFTAGEVQRGS
FT                   ALAAEGMTCVSVGGNPGECGAIIAFGGYDGRRYSNCTHAMRRPGRARMDTRGETKPREA
FT                   AHEVGDASGHSARSVASPGVVAAMSRSNNGSAVSLRRVSSENSEIRRLRSENEAAKEAL
FT                   RRANERLAELGAAPIDFVIGDESGSGDKRSPPPPTRRRGLWAFISGGDADDVDSGYDSP
FT                   AR"
FT   CDS_pept        39246..39794
FT                   /codon_start=1
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639228"
FT                   /orf_name="MICPUN_77463"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68281.1"
FT                   /db_xref="HOGENOM:HBG646389"
FT                   /db_xref="UniParc:UPI000199C3BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF13"
FT                   /transl_table=1
FT                   /translation="MGKSAATPRRKPNVLITGTPGTGKSSLAERVAAAVEGFKRIDVSQ
FT                   LAKEQDMLEEFDEELDTHVIDEDKVLDHMEEHGLGGDAGGVVVDYHGCDLFPERWFDLV
FT                   VVLTCDNAVLYDRLQARGYSDKKIRGNVECEIFQTLVEEARDSYEESIVKVCASDTIDD
FT                   MEENEKAIVEFVGAWKSSV"
FT   CDS_pept        complement(39884..41122)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639373"
FT                   /orf_name="MICPUN_54792"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68668.1"
FT                   /db_xref="UniParc:UPI000199C3BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF14"
FT                   /transl_table=1
FT                   /translation="MTTTSGGCSITAARGRALGGAGVDRTRLVRSRRAASAAARASSSS
FT                   SNPPGVEGEDKRRPSCRSRSTSTVPLSRIAGACTAAMLSASVGGAMPVLTPPPAAALGE
FT                   YGSGLGYFQRLEAERAISEEPVPLSRRSERRASSPPAGASANATRGIPLSLGADDDDVA
FT                   ESNVAYTEPDFSDAVSSFGDPRRDPSLEEVRASRLRRAAFQWSVIAAVAYNAYRARTRG
FT                   SDVTKRLGLEGKAATQLAGTRWRLTLDIGRERGTWMPPEWGASGFRVILPMAVELGANG
FT                   VVTPIAIGGFAPMTVSAGKWRLEGDALKFDVKTSGMAKGDVTLPEDSLHFRTAAWGGTM
FT                   ASRGNLMLLQTRFGFRREWRMVGVFKAEPLLDDDEDDDDRKGGEGGEGGGDEESRERRV
FT                   LLESMRVTERKTS"
FT   CDS_pept        join(41239..42097,42155..42477)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639374"
FT                   /orf_name="MICPUN_98458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68282.1"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="UniParc:UPI000199C3C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF15"
FT                   /transl_table=1
FT                   /translation="MPDSPRLSIIGVVPVVILLLLASVTGGVGADEGDEVASSSWWHGP
FT                   DPPEGEPTDLEREMFHERTPSCIVCQRAVHYLDENLLVKILDERAKDRSVNDPANYGRI
FT                   EAIVEDEVSKVCSAQGIQLDKNLRKKCDDMLERFEDVLVRAWYDRSVQDDDWNMNWRIC
FT                   AKKHGLLKVCPVEIARLDVPQLDHLEQEVKLEELRSPVREGDDGRKRLRYQTQAGRAKL
FT                   ARAGSGEMHVLNGKDFHARVIAEHGADTDALVYFAYANAHPRTHRGVMRTLKRAALAFR
FT                   DENVKGKHHVALSVIDVERNEIPHPYGSHVKGPTLILYPAGNKHSPRMLPMRGGVGGRD
FT                   DEEAAPTLGDVLALLNKRGGNAYTRDAAGKAFVEAEQHELEGSGRFSRDHDEL"
FT   CDS_pept        join(complement(46314..46925),complement(45433..46277),
FT                   complement(44883..45027),complement(43455..44804),
FT                   complement(42615..43397))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639375"
FT                   /orf_name="MICPUN_77365"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68669.1"
FT                   /db_xref="HOGENOM:HBG445142"
FT                   /db_xref="UniParc:UPI000199C3C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF16"
FT                   /transl_table=1
FT                   /translation="MEEEEEASVAGGITNGAIADAAVVETGQTDAAQLYENYVPSKVTQ
FT                   GATHPDHVVETSTLSQLTPPDVPKGFDHRLHDAVEAETLSSMQLESVVYASMKHEQRLK
FT                   GGRRAGFFLGDGPGVGKGRQIAGLVYSHARGGGSRALWISVSGDLKFDAERDLRDLGLA
FT                   TPRLEVYPKGNGPMPNGDLNDMTKRGVVFCTYSLLIQGSGKTLLMKKGSRLEQLVRWLR
FT                   QDPHGPLIVFDECHRAKNLVNESGMPTKTALAVVALQRAIPDARVVYCSATGASEPKNL
FT                   AYMTRLHAHGFSNVEGMLNTLTESGMGALEMFALGLKATGSYLCRSLSYAGAEFELQNC
FT                   ELTDEMAAMYDRSCAFWQMLHNVFNTAATGRIAEGQRMEKASSVKWAQFWAAHQRFFRQ
FT                   MLLSAKVPHLARLALEHVHERNMAVVIGLQSTGESNVGQAMADAATQGEEVDDFVSAPA
FT                   VILRNLIAKQFPITSTKSQLEADAERTRVEEIAAAAAAVPDEKLTRNDKKRGWKDDASP
FT                   PQGDDKEPSEGDTPTKDESDSSNDGPVQCQADPTANLPIYERLPPAPRIGLSDEDSLIS
FT                   EEDERSRSPSPTRGDDAEKQQQGVGDAANEILVRNPYLVHIRDLLLEATESLQLPPNPL
FT                   DHLVDLCGGPSKVAEMTGRERRLVRCLETGNVEAKLRRSQLDTTQKLLNMAERESFQSG
FT                   EKLIAIISEAASTGVSLQADKRVKNQRRRCHMTLELPWSADKAIQQFGRSHRSNQSSAP
FT                   LYQILVTPCGGERRFASAAAKRLQSLGALLKGDRRALGAGVDLRAFDIDTKEGSAALNR
FT                   LYDDAREKNSGPMPNVNVPGGDFKRFARFARRCLVSVGMGHANRAKGNAWELPKKFEGK
FT                   VPLFLNRLMGLSVDQQKLLFAYFTETHEAEVAEAKARGTFDEGVVSLSAESVAMSDGYP
FT                   RVVHTDVASGATTELCRITIDRGVTFARVLEKLAQFKRTCVDTGHDFAYENGIWTSRPW
FT                   ILCATEIWRTHALGRRMFRIRRPYNSDSPSLAREHLVKNYRKLTPEELQAGGLGELTWR
FT                   FWYNRGMEPCIHGERCRRRAHGGVCKVGRRVSAEYLLTGAVLPLWQTVAAITSARRDAG
FT                   RNLRSVNANGAMASPTSPPMTAAAAQHLHNDRDKPKGVLRVVRTELDDGRLVLGLHLGK
FT                   EDVEALEQRLKDAVETVRERRASQMEEDERLNLPMRRESGGEDDGSDGDGVSEVEIELR
FT                   EPESSVCENRDPVTGCDRV"
FT   CDS_pept        join(47798..48932,49006..49955)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639376"
FT                   /orf_name="MICPUN_105020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68283.1"
FT                   /db_xref="UniParc:UPI000199C3C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF17"
FT                   /transl_table=1
FT                   /translation="MREPTGNLRVLFLTLEFRHGTFSGNGVLAQSQAHGLAKAGHAVLV
FT                   VSGCPDNLDVTDDSQREISQTAGAVEVRTLRVPASKWGKLTARCPWRELADAAHADEPL
FT                   HERIRSFAPDVVLGIDWHVTPTWRALRRRVWRDSDAARETDPNGMNPDIASSSPYPPFV
FT                   YSNYRVFARDGDPTHAAKERDAVEEAAAVVALCQVDADYLCEELSPEGAAVAPGVVIAP
FT                   LREDVHALATHAQTPMTPATTAENGVELDETGAQHLERVAPWRLDAVPGQNTPRFLLTC
FT                   CVRLSPEKEPERFVSLCAELVRRGVVLGGTNEPGTTEIVPVLCASTAGDYAETIRAKFL
FT                   DATRGKGLVCRDFLDARGMASVYRRTVLNVHPCAYDAYGMTVVEAAAFGAPSCVQRGDS
FT                   VGCCALLSETGNEFVPVDWTKDKGDKVDLIADAVEAYLRAGWDGSKRGGDEHHDDDDSL
FT                   RAIGTRARRRALGWDLFACGRDIAKILTRAVRGDPSGRFRWTLPDATEQKRLAPLWRAA
FT                   TIAVWHSGAWRMIRSEGDDDDTRGFSKQAQARALLPAGTYLIVTAYNPMGTRADPRLNE
FT                   AAARALAASVRDMRPSPSAVLPTLSVDPVGGFDAWNEPGMAVQLPIETDAQSAEVKTVT
FT                   IRLARRHGQAAVYELTCDSDGGMRIGVTPVFPGLEGLACAGVAAVNGGSPPASMPRSPL
FT                   "
FT   CDS_pept        complement(50106..50948)
FT                   /codon_start=1
FT                   /gene_family="HOG000264885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639377"
FT                   /orf_name="MICPUN_54796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68670.1"
FT                   /db_xref="HOGENOM:HBG619559"
FT                   /db_xref="UniParc:UPI000199C3C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF18"
FT                   /transl_table=1
FT                   /translation="MTAVLAATTSTASIRARVNAAPAAARVVLAAGRPRLNALRATEAV
FT                   RISATAAEAETTSAPAAEEDGVREFFDTQMVDEAGMLAASTFPIPPADLIAKCKLILAK
FT                   NNGGEDPSLLASDFKFVAPVVGPLEKERFLAAFQSFKIDEGFPDAKFNYYHFRVDPFEP
FT                   SRVWYDARFVGTNTGPLIGGTLPATNKKVESPPQSCSMRFNERGECTQLTVGYVMDKQL
FT                   GNTGGLGGVYGILYAIGYGLPFPEAQPWQKSVQYDLFQRFSGATQELQKFVKGLTGGN"
FT   CDS_pept        51094..52554
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639378"
FT                   /orf_name="MICPUN_98462"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68284.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniParc:UPI000199C3C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF19"
FT                   /transl_table=1
FT                   /translation="MSPWRAAGALFARAATRGGVTTSSRARGADRAPWMHAAEARTRGR
FT                   ASGWNIANTCSRRGGSSLSSHPPAPPSKVSPSDGAVADVVAALPGLGLALAVSQAGFAL
FT                   ADGISAAIGAPVAGVPCAVLLGAGINNAVALPKWVRPGLRTATGTVLRVGIVCVGAKFS
FT                   ASDVVTAGAFCVPAAAASVGAGLVLIPRVAGLAGLHPRLGSLLAAGTSICGVTAVSALA
FT                   PAIAATQTEVACAVANVVLWGSLAMLFAPHAANFLLGECPDAAGMWLGLAVHDTAQVMG
FT                   AGLTYAQLFDDERAFNAAAVTKLTRNLALAAAIPALAFAHEQTVRSETARVATASRRVP
FT                   GFLLAFVGMALVRSCGDWYYGGGVKVGSGDPVGGGGGSTPPVGAESWRRGMNALGEGFG
FT                   AKACLATALAAVGLNTGVSSLVGVGVAPFAVGAVGSAIVGGVGLVSALTLSELIRRSTS
FT                   AAAGGESVSGKASATARDDSDVNGGASS"
FT   CDS_pept        complement(52772..55405)
FT                   /codon_start=1
FT                   /gene_family="HOG000100094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639379"
FT                   /orf_name="MICPUN_54798"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO68671.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C3C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF20"
FT                   /transl_table=1
FT                   /translation="MLRYVTGANGNSGDDALLSEDGGINVRALPEDVQAVFADIDANGD
FT                   GVLDMDEFKTMLSTYAVLRRSNQEGSVSISTLPDKVQPALKVFDQDGDGTVDPKELMRA
FT                   AELYQSSKKSQKRMRKFIIGLVLFVVALIGINSAMTFMMVELGKETKASPDGVMRVNAG
FT                   GGQHGAVVKTAANGEPAPLTTALPDAAFEQLKQFQVDSPTGAHVSLAVQGWYRVPQPTA
FT                   ATGSVVKLITAAGFIILDGTDMTFEETLGTVFTEAGFTVGGRKLLGIYALVGLFNSIDD
FT                   WAGLTDHEREPGFGLNDFTMSYGVRHLCNATEGAEEKACVDPYGIPHRGLVVVDGVHYI
FT                   EVNTTIEMSVATMEAIETTFRPEFDSVIERYKSPDLHLKRQIKFDSDSGFGSKHYYCMD
FT                   LIPELPATWNVTNAKKVDQVETNGQIIREFSISTSVTEIEHGFITDFDPNIPYTGTVEV
FT                   KYFDNKATGRPLKFIMGPTEIIVHEYTEGPVEIPSPDDEYWDMSDTCLNMTAKDALTDF
FT                   SLPTPVPKDPYAFDARRKITEWCEHYGGCDGGRGNTTSSIGSGRKLLGGGRSPKPAPAP
FT                   APSNVACSGANQCHADILGSSQTARNGVMSISLPPDDKGFPVTFTMESWTNGCGIKSLG
FT                   LSGSCGSFDCSVTGTLNGKDVCCDNSKYCGPNGRLDGEISFDLMNFIKHEKIREMIEKA
FT                   GFEGGVALQFGYAMPSNSRAGIATVTLVGWIQAEATISITDIMTGRRLLAEDIDETEDL
FT                   LDDEGTKDQLGLPRGLRRLLEEEASGRQLLCSNPRSCRRKKKRANRAKRCIENGGCGFF
FT                   DQMGNFFDEVGNMFDAASVTAAARLEVQGTATHDFISKRTSFGASFTVDASLGPITLEY
FT                   TKGIGS"
FT   CDS_pept        complement(55953..56612)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639380"
FT                   /orf_name="MICPUN_107442"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68672.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniParc:UPI000199C3C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF21"
FT                   /transl_table=1
FT                   /translation="MAQAKVRIKERMGAAGPGDDTDGDFPTDDKTAADLAFLFAERELH
FT                   LTEEPATRGRAVASAGAGRRGAGSSSTGAAEDSDRAALFGSGGSAAGAASAGVGSSRMA
FT                   QSGSNGDDADRAALFGTSGSGGSVTYPVAPKVNTAADIRAKYGIRKKGSNTEGRGGSSR
FT                   DDASLAGALEETRDKLHERGERLRGIQDTTERMRSDAEDFASMAEKLRKRQEKSWW"
FT   CDS_pept        61181..62287
FT                   /codon_start=1
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639381"
FT                   /orf_name="MICPUN_77641"
FT                   /product="Predicted protein"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68285.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG715060"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI000199C3C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF22"
FT                   /transl_table=1
FT                   /translation="MKPDKIGDADFANYFCTYGYLYHQKDMLEDQQRMTAYHDAVRLNP
FT                   ALFRGKTVLDVGTGSGILAIWAAQCGARKVYAVEATYMATHAKKLVEANGLGDVVTIIQ
FT                   STVEEVELPEQVDVIISEWMGYFLLRESMFDSVIVARDRWLKPGGAMFPSHATMSIAPI
FT                   RTGVNSQKHAEYEDSCRGWDEFVDDTKDHYGVDMSALTETFDAEQREFFLNTSAWVDIH
FT                   PSQVLGKACVICDWDLHKVTLEDIKNLDVPFELRIHETGASGPSEVGAFAGWFDVSFRG
FT                   SEANPCENVVDLTTAPDANGATHWGQQAFYLSPGISAADGAHLEGRLEMQRKKENQRLY
FT                   DVRLTWRQGDGEKINESVGERRNVWHIE"
FT   CDS_pept        join(complement(62856..63319),complement(62502..62784))
FT                   /codon_start=1
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639382"
FT                   /orf_name="MICPUN_77613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68673.1"
FT                   /db_xref="HOGENOM:HBG669860"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="UniParc:UPI000199C3C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF23"
FT                   /transl_table=1
FT                   /translation="MLRGLALPRALASALPLGNHRSSPRSVPPRAPPRWVRPRALASDA
FT                   DARSPSFSSLDELAHHLRSLTGDPLESDGGRIVTFRGDTNARVMIIGEAPGAEEDKLGV
FT                   PFVGRAGKLLDEIFASVTLSTDRHCYVTNVVKRRPLNNRDPTAREIEWYRGYLREEIRL
FT                   LDPAIIVCTGRHSMRTLLGKNCEGITKIRGRWFDVDGRVVMPMFHPSYLLRNPQKTPGS
FT                   PKALTWDDIREVKRKVDELSLIEPEA"
FT   CDS_pept        complement(63463..65823)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639383"
FT                   /orf_name="MICPUN_98465"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68674.1"
FT                   /db_xref="UniParc:UPI000199C3C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF24"
FT                   /transl_table=1
FT                   /translation="MKLKRRSLAAPVPEVGARPSTPPEHDEPAHFQSTPGSVVVMPDIR
FT                   RGPVDLLVHPIGTERPPPRSSSPAPGKGRKICVQCDAVIGAAARVCPRCHAALLPASKI
FT                   NHRERPGLATAIASLAKTPVGPVGPGVNRKVVSVNELAEHGIARVRVVSGVASNDDDGE
FT                   QHRVINKDTTRVNDVNDVNDDDDVDDDDEEDEKELARLDAAVAEAKLRLEEGARTLREK
FT                   LRSLPPAPAPAPNAHSCGHGAWIAFGDECPTRRTFAHSNVPLACYFVKAFDPSWLDVNH
FT                   RPRYAACNSCGGWRDLGENPNAAAGGAAVRRIRKSRTDGAGDIDGENEHDGFDTELDAR
FT                   RAASRARRLTLAGLGRDTGAHGGAHGGAHGGAHGPYGYAYAAATAEELAGAAEEAACRV
FT                   RSSPSFSILGGRRGEEGLACVVEPVDALAVAATALATRSSPDVEGGDWSRSPAPSEALT
FT                   LEAMVAAAEASESGEADEPPPPPPPPAASTPARRLTFVMRRPAPDDTPAETPPNETIAA
FT                   PSPATLKHVGDEGEPPPPPTTKCGCVPDVPEGWRRWETMRTKPSANGQLAADCYYRSPD
FT                   VGGGGKLVGRGGGSGSVVLRSEKEIEAFLRSPPASLVDACAGLTIDRFWCRPFTRGRCI
FT                   ARGAGRRAREAEAEAETDEALEEALKTTEKGHRKDEPASLSAPLLGIEPAALERASVAS
FT                   DDVPAVPTPPGGPTADDAVPIDVEAMRAAVRAQLREELRAQVAAELRAEMMRTAVPAVP
FT                   PAAPPAVYAASCAADEDARAEREAWEGKAGMRE"
FT   CDS_pept        <66365..>66682
FT                   /codon_start=1
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639384"
FT                   /orf_name="MICPUN_74261"
FT                   /product="Predicted protein"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68286.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748033"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI000199C3CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF25"
FT                   /transl_table=1
FT                   /translation="CPVDKEELGRGTWALLHTMAAYYPDKPDALRKVQARRFFDALGDL
FT                   YPCTHCADDFRVDKARNPPRVESRRALSVWLCERHNEVNEKLGKEKHSCAIADLDERWL
FT                   KG"
FT   CDS_pept        complement(<67678..68286)
FT                   /codon_start=1
FT                   /gene_family="HOG000139712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639385"
FT                   /orf_name="MICPUN_78038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68675.1"
FT                   /db_xref="HOGENOM:HBG715202"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199C3CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF26"
FT                   /transl_table=1
FT                   /translation="MASIQTGGPDGVTLHGIELRRRYAGDVNPAGLRHGVGRYEFPNPA
FT                   YTYEGDFRLGRKHGVGTFTTPDGGRYVGEFVDDEITGRGERVWGDGRAYVGTFTLGEMN
FT                   GEGRLTRPDGGSYHGGWRANRRHGRGVDTHGPSGDTYDGEWVHGKRHGVGVAVLRSAGD
FT                   ETYDGAWERDERHGEGRMENRSSGESYVGGWRDGKRHGVG"
FT   CDS_pept        68359..68799
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639386"
FT                   /orf_name="MICPUN_54805"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68287.1"
FT                   /db_xref="UniParc:UPI000199C3CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF27"
FT                   /transl_table=1
FT                   /translation="MSNGKCAASECLVPVGLCRAADGTSTRADRVFAPFDQTRRTRNHD
FT                   AMSKRGRDEGALFAAPLTPNTASVADEKAMRLSRLRVHLNASFLEDLRRKMEQDPARVF
FT                   DMEVNSYLKHSQKLRVSKTQVKRGSSRVQARRPSSPSPIDGK"
FT   CDS_pept        68861..70243
FT                   /codon_start=1
FT                   /gene_family="HOG000234341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639387"
FT                   /orf_name="MICPUN_96161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68288.1"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C3CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF28"
FT                   /transl_table=1
FT                   /translation="MNNFPQRDYADVSERSELVRQTSLAVANAQSPPGECFVFGTGDNG
FT                   QLGMGEDVVELARPRLLDTIPGVNAASVIKICCGGMHTLAVCQGGLMYSWGVNDEGALG
FT                   RVTRKGAADEESKPGLVTLPSNAGGVVDVSTGDSHVAVVTSTGAIVAWGCFRNSSGQWA
FT                   FTAGEKICKTPTVVYSPDGSQGSYATNVASGTDHVLALTRRGDVYSWGCPEKGRLGRVN
FT                   ADLADDAEARGPEKTKPLVTPAKVPNITAVVTAVVAGDNHSFAICAGDDVVYAWGLNSY
FT                   GQTGLPYDPANPGSTQTSYFPVAVPSLRGLGIASGDGGSTHTTMLTRDGKVYTFGRPAY
FT                   GRLGQLGIDPRDDEPKPTPGLVHGLDGSKVKIVSVAAGGSGSNAAVTADGEAYVWGYGM
FT                   EGNLGRGDDCDDAHVPERLVPTRAMAGKKIVAVSFGGQHTAALCVGGQNGDGSPGGKRA
FT                   RT"
FT   CDS_pept        complement(70467..71345)
FT                   /codon_start=1
FT                   /gene_family="HOG000264545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639388"
FT                   /orf_name="MICPUN_54807"
FT                   /product="Thylakoid lumenal protein, chloroplast "
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO68676.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="HOGENOM:HBG559148"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199C3CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF29"
FT                   /transl_table=1
FT                   /translation="MSAVANLAGASSRAVVSTRGASHRASSARHVTRAVPASSAARTTI
FT                   IKCVSDEGSSRRQAPKLDRRALFTGAAALAAGLPFALEPAPARAAFDGSDSKMVGAYLP
FT                   AGPDGLYVFEARAPRTPALRAGALEPYSILLPPEFKEAPVSNARSGNYCQPRCDEATTE
FT                   VQFVEPSAGSLQIIIIPTTKLLIAKQDPTVEDVGTIDGILNAISPAITGSVAAEPEEVV
FT                   SASTKVKDGRSYYEYELLTPFAEFGLHSVSAVSTNKNYVMIATIAASEKQWAKSEADLK
FT                   KVIDSFRVCVK"
FT   CDS_pept        71732..73582
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639389"
FT                   /orf_name="MICPUN_54808"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68289.1"
FT                   /db_xref="UniParc:UPI000199C3CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF30"
FT                   /transl_table=1
FT                   /translation="MNSSAVSTRTLGASSRVSPIQRALRARGRIKIVNSNSRRFEGHYG
FT                   IPPFASARDDAIGVRLRREGKLRDKSIVNHEAAVAAAIATGIAVAIVAAEPAHGAALAS
FT                   HLMPPTVYAPQFQVAADLVADGVNPGSIGVTEVTLDTTLISTSAFLLLATVLGAAGKKD
FT                   YDRRAKRDPTMWSEQNESVTHRRSNIVAKKTSQTITSTQTKIDAPGAKSLKSSRYNITP
FT                   LKKGDVDNKRTDDKKPAGTRKLPLNKTQKATGKSNIVAFRSKTKPVNKKAATGTVFVTK
FT                   KPVNKKPIINKKPLAYGKFAVGKSAGKYDDSILAAAAAFVVGAVALANVAGTAPTPSAK
FT                   DQPMKIGAYDVPAPLRGGIRELGSMRVPPEIGRGAAAVGANVASGFETVAESFDALPPE
FT                   QSAATLGAAGVVALLALTSVVAAKRDAEYFEPKVFVFGDSIIADRNAAAARAEEAQAWI
FT                   DAWYRTDAGAKTFRRVKHRSLAYEDPTMGIDALTITTGTGKKPVPRRPSAFRSDRDALL
FT                   HDAYHKSIEIVDGVKLDKKILNVVRDFEANLTVIDIRQARRILKLVTDGPVRDHKRASG
FT                   KVVQSTVGNIELDTALYALDSFKWTSQAKTWFFKELEQYF"
FT   CDS_pept        complement(73798..76032)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639390"
FT                   /orf_name="MICPUN_54809"
FT                   /product="Amino Acid/Auxin permease family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68677.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199C3D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF31"
FT                   /transl_table=1
FT                   /translation="MTSSETPRRASVLSTAFNLINCAIGAGVLGVPFAVRSMGAVLGAL
FT                   SLCLVMAISVLTLNVLTRAARAYGASSYQELVRKSMGWFAAHVVSLTLIAYVFGSCVAY
FT                   TIVCADSFGEFNARAFGSGSFAANRSVIVLFTSTCVMLPLSLLRSMERMAFASSFSVLA
FT                   LLYTAVVVVAKGIDAVKALFFDVFLHIATMTRHRSGGGGGPDTNDFLAKSTPSSNSSVG
FT                   STPHVRAWVLDKGTILALPVLVFAFQCHVQVVSIFAELRDPSRATRKPSSSSSVQAAAP
FT                   GIEPATSAAPHESEAASVMNGPRWGKDFPSGGNDEVSETYESEDEDEGDVFVDATSQSA
FT                   SGLSSLASSRGGSPAPLGTTWGAEGGAEGADAGTHARRRSSGASGSTLSMILSPSPARR
FT                   PNRRRRLFSGGAEGAEGADVTRAANDGARTREGEAERAELDRVVTMERVSFWSMLACLT
FT                   GYLAVGVFAYAEHPDVPSNLLDAYPADDLPMLAASLFMGLSCVASYPINHFASRAALDD
FT                   LYVAGVCAWKRCFAKTAGDDDSGVTLGPTPAPPGQAPVGRHCTQTVAFVASTTALALAV
FT                   DDLGVVFQVIGATAGAVVIFILPGILLLLPGYHGAGCGGAVGGAVWGAVGEPDEESGDV
FT                   GLERTREDGGTHARAASRHWTEMGDSIGGYDELTFSGHLLDAPLLNAGDGPGPNGGVEG
FT                   TRGGAASRTVPRGAAALGAALVCTGALIAATSVHLIFFADDVGAPGSGFV"
FT   CDS_pept        76731..79244
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639391"
FT                   /orf_name="MICPUN_54810"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68290.1"
FT                   /db_xref="UniParc:UPI000199C3D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF32"
FT                   /transl_table=1
FT                   /translation="MPGDLRLSPSLTPSKVYHDPDRSSARKKAPPGTHARRQLDLGEDA
FT                   KNNNDARRVRVPGPPRGRVFDQGPERPGSDDPPWARRLRLKLRDVRAMADEDIDDDDDD
FT                   DDDDEPISAAMGAEGDGPTSRRAPTMRLRGNLEDILALYEPGNEKPEGFEVSITSPRSA
FT                   VACLKAKCDPNSLVPRPEPVFAPQNQKNVCARRRKEQRARLTALLARRDAMDDPREVAR
FT                   MARELSGAAQAEAKFKEKENERQRRRDDVDERVLAALAKAELEAATLMDDLNDIASAAD
FT                   HEELARFGEAARERERIAAKDAARSRNLHGRSPVRTPSSPPSRTFVAASPATPRRTTPG
FT                   RDKADFLASAPRVAFDASSILADRADIERRTMEALERERADAERATAKRTEALERKRAD
FT                   LRRVEEAVRASVERRREEERKYYNAMRARTEARTEEEIAVAEKELKAEEARVRATNEAR
FT                   EASFEGTRGGGTRDTDVAARGGRTVDSSAPGIEPATSAIDPAPSSPVGHHARPVSAPPR
FT                   GVTTPAHVAAHPTPSVRGSIDRTSSSSVTVSNGHTERAARRAAFADAEADERASYEAAA
FT                   AELARQKIARARLQRDADALVRQERRVAEKQRRADGVARRKEWNAKAESADREACRVRV
FT                   QMRLDAARKKKEAIDEEHASALAMRGAEREERREVAALQRARARAADAEWRASIARERH
FT                   VKICATSEKLDRRLRLESARVAAELARDEEAFLAKIASRAERIGVEADGVMARAFDVEA
FT                   RAEEEAYRREASAGRMHFEHSGAFATSLGDDGRVVSSPVGAKKVYDASLDGSTHGLDVF
FT                   VATPGVVRGPGALFSYEPGSSETGE"
FT   CDS_pept        join(<79375..79731,79786..80366,80535..80817,80872..81018)
FT                   /codon_start=1
FT                   /gene_family="HOG000182212" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639392"
FT                   /orf_name="MICPUN_78253"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68291.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199C3D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF33"
FT                   /transl_table=1
FT                   /translation="NIAMQAPIPVTLLSGFLGAGKTTLLKRIVENAGNFRVAVVVNDVA
FT                   ALNIDSALVRNTRALDPNEPGLVELQNGCVCCTLRADLVKAIADLAAQRKFDAIVVESS
FT                   GVSEPAQVAETFGIDLAAAVKSLRGASTLEQVARLDTCVTVVDAAAFNGDLASPADLLE
FT                   RFGARETGGEAADSDGDRSVAQLLVSQIEFADLIVLNKCDLVSRNDVLAVKSALAQLNP
FT                   GAEIVLATRADVPLNKLLGTGRHDPARAANAAGWLRTLQDKNNHRVVETKEYGICNFVY
FT                   KARTPFHPQRLRAFLHDFAAILDFDETEEEEVVFRSKGFVWIAGRDDTCGEWGHAGAVL
FT                   QLTCGGPWMGLLPEEMWPEDGSDERDLLERDFVNPILMDRRQELVFIGVHMNRSAIVAA
FT                   LDRCLVTRDEWKLGLDGFVSDEEDPFPKWPSLEDMNLGANDGHDHRGHHHGHGHHH"
FT   CDS_pept        81884..82591
FT                   /codon_start=1
FT                   /gene_family="HOG000220876" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639393"
FT                   /orf_name="MICPUN_96164"
FT                   /product="Predicted protein"
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO68292.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG559178"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C3D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF34"
FT                   /transl_table=1
FT                   /translation="MQGLDSLAPRLAEYKAAGCEFAKWRSPLEIDVSAGQPSDLIIQAN
FT                   MRDLARYALICQAEGLVPIVEPDISLKGDHDLETAVRVNVKVQSELFKAMLDHGVYMEG
FT                   AVLKSNIVNPGKACKTKYTVDEIAVANLAVFRRCLPTAIVTANFLSGGQSLEDASARLN
FT                   AINKHKTAKDPWNLSFSWSAALQMPLFQLCKGKDGLQLEAMSELYLKELAIASAAARGE
FT                   HVPGAGEGDHAIA"
FT   CDS_pept        complement(82724..88744)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639394"
FT                   /orf_name="MICPUN_54813"
FT                   /product="RNA methyltransferase"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO68678.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199C3D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF35"
FT                   /transl_table=1
FT                   /translation="MGGDAADAVPAGIKALRAFAKAPSHLVSAPVSRHDPRARRPPLTI
FT                   ARSFPSDPPPTIRELLLPISSPPTSLLSHRSQTASSALREGLCELAYPEGASGAGALDE
FT                   VLEASAETLARLGGPKMTRASARDVRELVVLHTACKVLALRDEPRAELTAWTPRGLDAS
FT                   SAKRGLLDTTWLALLARRCECSHVDDSTRHQAIDEMIAVVDGRRDWDAAKRLARLCVGS
FT                   VAEGGADGGADGGADDPPLDPRAAVFVAAALAEIVAEERRGEMIVPGSARAATLTTLVS
FT                   LADVALGMMTTTPMDDDEATYPRRLIARALIPCAVKAAAAAPGVGRADALVERIRASIL
FT                   RALAPTSHRPVTDQSPSERSSEPSDDDLHRRRSFGFYLLASHAELVLGPAGAARGAVAG
FT                   DDIGLVDALARGMRSDDGRERKAALTALTHALGAETAGRTPWLELVATTHAFDDFAAHL
FT                   NDAARAHVDALHPASPGSDVSGTSTSSTPEDVRKEGDPNETLLLPYEYVLSAWTRGLRH
FT                   PNPSVRAGTLRTFCDRDWARTQKHGSNPYVGALTESFVAEALVPSAMEFPGLCDEVAKV
FT                   CELWTREAGDGGADGGADGGADGGADRGAGESVAFRRVKCVAAAAAKNAPASNVAGLSA
FT                   GCAILASAGAALAVTNAGSSSTYVTADVTAGDAFLAHVADVVEAAACKRGDPEAQTAQI
FT                   NDAVAAARAVTRAVTCTPGAVRAVTSRVPVYLLDGSSPDADGVGVRPGFEALFADYEFA
FT                   DSVGRFTRSFLATGSESHATSSHPVKSVDDEALELALMFTLAGSSSNDVTATVTAHLAS
FT                   IVERTSHPDASASRRAKSLLAATYRVASSIPSCDWLQRALRRALVDAVIPNAMVTLVSS
FT                   CAGSIPDAAASACLEAVARWRGAEGATRGPRISPPAWNLVATDLSNLCVNLSQEPTGWV
FT                   GDPHDVTRVITARLSSLAGVARGLAAVAADAKSSDEIAAAVSGSIVNLEKVLQKVLTVT
FT                   PKVTDPKVTDPPADSTMDARAAGWTAAAALLSVHFFGARESLRLSASASAATVRLLDDA
FT                   LEGLPAVSSAGDEPSRLLAALRAIAALLERVVPLFPGEPELSLGVKIASSVERAVRSSR
FT                   LRKNAPIWAAAVACVLHPRLFGASSRLHAASDGSAGSSSSSGAGSSSSGAACVDGIGAC
FT                   AWFVRKAIAAGSKTGGARILRVVSHALAARLVRWPCHSKYYANEVWALGLCGEGGFTRA
FT                   ETLAMAEHWRAREAVKANKEKEKDGDTGAMNTGIYGVDRSRAGGDAGALADWLEDGGRG
FT                   GAAGGHVAARVAALSLAHALALGEPPSAAAGEGVSGRKEFLSGTEYGVGALEGAAALLR
FT                   VGLDAVSGGDSDLARGTYRRGSSTHRRKVRAWQMLCALAPALDRLRRVSSAGKVRRLLE
FT                   KSHIFQSLSKNPGFVQKLGLGQELLPANPTLNESNESNESNAADRLAGSIETALKKAAP
FT                   AAVATHNLPGVRYYAEVFFTLAARSYPCVVTDVAIPALRSPDVKPLQAASWILVAAGRV
FT                   VRDKKLTDHRDATNGLTLARQTLAAVAPWSLAHNHSLRVFAQLATHAMLDAFGVDAFEA
FT                   NPLTGTTGGNPSLSPSPSPSPSPSPGADSSSQSPSPAQSVLGSIASLLSTNSEMVKVRV
FT                   ACGPVFDAHLPCAPKDLLAGALDCERTGPDDPGFEGAPTSALASVEEFLRSSREGLRRT
FT                   RTAEDAWLWSDAMRAGCDLTLAWGGSGGGCDGGRVTGAVSLDDDDAGDGTVSHRVDDFS
FT                   LVSFAPDDEKAAGSNAGGTSALSLQKKVEGAGGAHGGSSMGSMGESMGLIGGSTDPMAL
FT                   ALAAMANRVDRTGDPDASLVAETAADVNETLDTRLPERPPGLVVVASLVDKIPNLAGLA
FT                   RTCEVLGAEALVIADAARTVSHRDFTAVSVTAERWLPIRDVPVNGLVSYLLRLRRDGYA
FT                   LVGLEQTRGAVDVNEYRFPRKTALVLGREREGIDADVLNVLDACVVIPQKGMIRSLNVH
FT                   VSASVAMAAYARAH"
FT   CDS_pept        join(88950..91011,91069..91544,91961..92091,92495..93182)
FT                   /codon_start=1
FT                   /gene_family="HOG000013300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639395"
FT                   /orf_name="MICPUN_113346"
FT                   /product="Radical SAM domain protein "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA modification"
FT                   /protein_id="ACO68293.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009451"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG457539"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniParc:UPI000199C3D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF36"
FT                   /transl_table=1
FT                   /translation="MQIARAGIAPTARRPHRLSSRRPRQLHRAVSNNRTNRTSFPLRPA
FT                   AVLTPPPPSPTRTDAERRAEEALLAGDDSDGTIAGFTKLEWSCIQTPARYLGNEVGAVH
FT                   KDWNDAQVRFTMAYPEIYEVGASNLGHVVLYTILNNQPGMLCDRAYLPGDDMLQLLKSK
FT                   NRDLFAVESKRPLKHFDALGMSLAYELGAVNVLEMMHLSGLPLTHKARDDKPDEAWNVD
FT                   EGSWPLVFVGGPTATSNPEPIADFVDFVALGDGEDVMVEIGECLKKTKSEGLNREETLY
FT                   RLATEVEGIYAPRFYDSPKGWGGAVFPTREGVPERCKRRVADPDPLLQVGLVPYVSTVH
FT                   DRLTVEIRRGCTRGCRFCQPGMLTRPARDVPPEKVIEAVEKGMRETGYNEFSLLSLSCS
FT                   DYLALPSVGLEIKNRLRDENVTLSLPSQRIDRFDDSIADILGGAGKAGLTFAPEAGTQR
FT                   LRDIVNKGLTNDELLHGVQTAYDRGWRNVKLYFMIGLPGETDADVLGIAETVDWLQKTV
FT                   GGNKARKRDRLTLTLTLSNFTPKPHTPFQWHSVSTEEFARRGKLLKDALAKVPNVKSNW
FT                   TSIRISAMEDFIGRGDRSLCDVIRRSWELGAHKATWWDGAESSFQSFDRAIEEAGLTWK
FT                   YRQVVNGEWDVLEKLGDGEYRGQGGGGKGRVDRGALADSRLDAPLPWDHIDTGIAKWWL
FT                   KADLQKALEGITVPDCSHSGVCTECGVCGDEFGENVVAEVPPLPVFEGHYEPDGRRTQR
FT                   LRFRFTKDGKESFIGHLDTLRLLERACRRASLPVSMTRSPYSSRPRISTAMALPLGASS
FT                   EAEMMEIVLTERMNPEDVRARLAEELPAGMRLTEETMNELLQSAEFLVHVAVPGAAAKP
FT                   AIESIGGDAPSWDVEGGGAFFDAGKNGDGIPDASADEDDADAAAEAAAEAEIAAAVAAF
FT                   AKAVTPADWKHWVASAMALEKFEISKTSKKGNVRVVDLRPQLLALEHMDQPEIDDSLRG
FT                   RHVPMPSVCPPGTAILRFRGEYTGAGGLSVEGMCQMLSHVSNVAITPLHSHRVRIDLGE
FT                   PTPPVVDKLWLDNIVRAEAFMALERRWDPAAGVNNRGHMGGGNKEGDRIDNHRSYRAEE
FT                   PPEKTSKKKKK"
FT   CDS_pept        93499..94287
FT                   /codon_start=1
FT                   /gene_family="HOG000100288" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639396"
FT                   /gene_name="RNHB"
FT                   /orf_name="MICPUN_113344"
FT                   /product="Ribonuclease HII"
FT                   /EC_number="3.1.26.-"
FT                   /function="RNA binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="ACO68294.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="HOGENOM:HBG584843"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="UniParc:UPI000199C3D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF37"
FT                   /transl_table=1
FT                   /translation="MVDHIKVDVPKASAENGDKTAAGTRTSGRKRTTKAEADAKAAAKA
FT                   AKKPKKAGPSRDAERRCWSAGKKIVCGVDEAGRGPLAGPVVAAACVFPEDLVIDAINDS
FT                   KQMTEEEREEVYEELMANDQVIKSVCVIDHERIDEINILEATMQAMAKSVEGLSTRADW
FT                   VLIDGNRVPPPLIDRAEAIVKGDAKSVCIAAASVLAKVTRDRMMVKIHDEYPVYGFDQH
FT                   KGYGVKAHMDAIHKHGPCPYHRKTFAPMKYMPGGSAYDGA"
FT   CDS_pept        94427..95311
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639397"
FT                   /orf_name="MICPUN_54817"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68295.1"
FT                   /db_xref="HOGENOM:HBG559200"
FT                   /db_xref="UniParc:UPI000199C3D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF38"
FT                   /transl_table=1
FT                   /translation="MRLAEYESIRAHLLSLPCARYPDMDALKAAHPGVSLDALVSICAQ
FT                   ESSRRIKAHHGRHARAISDHARRYLAGEDIFDVAHAVDFPPCQLMRLLVEHLLGVGHKA
FT                   AGALIRDPHGRVPIHPPPESPAGAHHADDPVAGAALCERIRFDVERCVAWDHVASPAVD
FT                   ASRHSAGREYEDLLEEKLNALGVPFVSEGSLRAEGHAKTPDVKLELPIAVRGRVVNWID
FT                   SKASFCDPIVHYERGAEQFQGYVDRFGPGMVVYWLGVVDEIAEESESRGDVLVVDDFPD
FT                   ESEVTKLKLTPRV"
FT   CDS_pept        complement(95453..98515)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639398"
FT                   /orf_name="MICPUN_98475"
FT                   /product="Predicted protein"
FT                   /biological_process="exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="ACO68679.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI000199C3D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF39"
FT                   /transl_table=1
FT                   /translation="MGAPVTSATAARASALRAALDRNKRACDGVVNLVSSTDAQLGELR
FT                   GIVGPINARTADLDRALRNLDVVGEETGAWLARIDSCRRADHALQDAERRRVIDDPRAW
FT                   IARLDELADAEAFFAERCASGGAHVDGTGGGGGRRRATPGAENARARARELLARCIART
FT                   EGEFASAMRAHETRAVGIAHRPDAPRALASMRTLSGDAAELLDATIDDEHRGNIPPDVS
FT                   SPTSRASRAEVHRAALLDVDPGLVALATHLLKTTSGKTPRGDENSGIDGLEVNTRAACI
FT                   ALYVDARTDACVDATNRDGLARLRAETKTSAAAQLATRFGSDGSIDANTGDRGGVRSGD
FT                   LAVRGGSAGRFGVGDGGTWVDRVARWRDVVRNAVARWELEPELAAAVLGGGGGGWGGGG
FT                   GWGGGTREFADDAVASASDEVLERAARHALGWLDELVARPAHPADDDDDARTDEKTRSL
FT                   DSGGTGGGRGKFGSRGDLWTMAKQFALPGVRSGDVANAAPAPLPSGYGDDDPNEPGNDP
FT                   ERVFGCLDARAALLELLPAVEGIRGADSSAARLWRRAASRAAEGARASALALPSQVARE
FT                   GRRLRGWADGTAAASAGFEPVTFETRAFALTVCDYCARLAARPDATGVLFPPADSNEAS
FT                   NEPTNETTSALSLFEKSAVGGTQEVSLEAVTTTVTSTVTTDRRVSVASRDSDGILDFTD
FT                   DDDDDVTDENEREQEAGSASSSSSPSPSPGLVPEGGTDAGVSDVAGSNPRGTAELGFLL
FT                   ARALDAVASSLEDDDVRAISRENVDKEALEDAVAKISGQNTMLAKVSGAMAASGKRAAS
FT                   SARRAAGKTTVTSTVTSTVTSTVTSTVQHVQHVRTFRPALGAVRCAVAATVVTAGVMNP
FT                   RNEGLLAALDRRWPTDARSRVRSYGEAAVRLAWGPPLLAMAPDAGPDPSAGMTDKQRRR
FT                   VKDLWCVVNDRADAAEGAVRAGLAWRVPSATVRVLREASVGIVGRAYDNFHARYAESGF
FT                   TRRHPEKYVKRTPEEFEHLLRSMLASTDDDE"
FT   CDS_pept        99936..100958
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639399"
FT                   /orf_name="MICPUN_98476"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68296.1"
FT                   /db_xref="InterPro:IPR021924"
FT                   /db_xref="UniParc:UPI000199C3D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF40"
FT                   /transl_table=1
FT                   /translation="MARIATASVSARSLFVRELEGNKGFVERPISSVRRFWSLGRFAAD
FT                   VGSDVFAAASFALTCALFRVACALTLLRLNSLFVMIQNLGGGGGDDAEAEDDDDDEEDD
FT                   EEDEVDDMDVDDVDRRRSDVGAIVEEHAALRALVRRIAHSYRMFLVVTTLACLGECFAA
FT                   SLYAVSVHGRHGDGDADVSSNVSSDVSSDVSSDVSSDVDRRDLKRALRSAVPSALRLLT
FT                   HAWGTALNLRAATLATHRMQKSGSYLSERHARITAQLCAASDSRVHERVVHERAVEHER
FT                   AVEAFAARHAAVGSFRDNKLGISVFGFVLDREFLRTFHAALVALALFVAARALTEKSHR
FT                   "
FT   CDS_pept        join(complement(101686..102240),complement(101100..101318))
FT                   /codon_start=1
FT                   /gene_family="HOG000243509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639400"
FT                   /gene_name="PDF"
FT                   /orf_name="MICPUN_96775"
FT                   /product="Peptide deformylase, chloroplast "
FT                   /function="iron ion binding"
FT                   /function="peptide deformylase activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO68680.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042586"
FT                   /db_xref="HOGENOM:HBG665227"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="UniParc:UPI000199C3DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF41"
FT                   /transl_table=1
FT                   /translation="MSASIVSRPCLAAAAASRARLVSRAARASTASSSSNDKLHARAHP
FT                   IQVRGLAQIARAKKGGFMAEMEEAKAEESGAKVEFTLPLAIQKYPHASLRNDNKIVGVF
FT                   DSDLEKLAQAMFKIMYDTEGVGLAAPQVGVNYRMMVYNEAGEPGRGKEVVLVNPKIVKF
FT                   SKTKDLFEEGCLSFPKIYADVERPTSVQVEAQNLRGKKFKMTLDGFEARVFQHEYDHLD
FT                   GVLFHDRMTDEVRGTVQGELDALIEAHPANEPKGV"
FT   CDS_pept        join(complement(103572..104655),complement(102498..103510))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639401"
FT                   /orf_name="MICPUN_54821"
FT                   /product="Glycosyltransferase family 47 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68681.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="UniParc:UPI000199C3DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF42"
FT                   /transl_table=1
FT                   /translation="MAPRLLCWFRRATQPRFSRHELWPTVAQVITLLATPRMASSEATV
FT                   VVEDDDDPRGVRKMKRGGSWVRRSLSAGSLLNILSGALAPPRDRSPPRKRHKRTFARSQ
FT                   SSVASLPVVEAAPAPAAGASSLFVRAALALALALLAVSAALALASGATGPSLASALLPH
FT                   GVRATAETWAMKLQWDAAALASSWRALPEAVANDATHRDEYGLLTFDSQCAALRERGRD
FT                   PRWPLRDPSAGINDGLDGLGFDSAAQLCDAMASLPNTLRMYTHPLGETEKRRYRTARMA
FT                   PTFNRGYDVEEHVLRNLGPNGPFAEPDPAEANAFLIPAAPYLERVAAFPNSGRDAMAAN
FT                   VANLVARLKREDAKAWRAAEPGCGRIFVSAHDTGTYAARLTDTAVRDRAVFIVANADVT
FT                   SDADVTKDVTKTPPIPPRNVESRMATGKDVSAVCSLSYHLPRDAVALGAMRPVFLDDDI
FT                   GTHPDGDVGDVGDVGDEKSAPGDVGDERPIEMSFRGTLRGGVRERILGHYLSVGKSRNW
FT                   DLRSDGQVSPSRYMRLMRDSKFCLHVRGTRVQSPRLIEGMLFGCVPVIVADGYVPPLSW
FT                   LFDWSKFSVRLPEVEHERLPEVLQGVDWATLQANLRRVAPFFVYHRTPIPGDALWTTAL
FT                   AAQRQIERGDACKGGETEAGRSAVAGSIPGGGGERGAGGADRGSRRVRRFGRRLMGRRM
FT                   AGED"
FT   CDS_pept        join(104949..105026,105241..105294,105605..106003)
FT                   /codon_start=1
FT                   /gene_family="HOG000039879" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639402"
FT                   /gene_name="RPS13"
FT                   /orf_name="MICPUN_89270"
FT                   /product="Ribosomal protein S13, chloroplast "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68297.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG737405"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="UniParc:UPI000199C3DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF43"
FT                   /transl_table=1
FT                   /translation="MQSLCASFNMMQVAPATSAPKAASAKSAKASSFVGQGVTVQGWKV
FT                   GGVKRGELQVRAARVAGVEIPNNKKAEIALTYVYGIGNTTAKKIMAKTGLENKRVREFE
FT                   EEELTILRAEVDTYMIEGDLRRFNMLNIKRLKEIQCYRGRRHIRGLPVRGQRTKTNART
FT                   RKGKVKTVAGKKK"
FT   CDS_pept        join(complement(109774..109851),complement(106179..109637))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639403"
FT                   /orf_name="MICPUN_54823"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68682.1"
FT                   /db_xref="UniParc:UPI000199C3DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF44"
FT                   /transl_table=1
FT                   /translation="MGGGSQRGDSSGGGVMPGVVMMTELQSRMSKKISQLARVIHHLND
FT                   RGDDNPSSPHTGGIRTSDLGDLVTVADRYDTETEQILADAAAKVQSFHRACARKEEAAG
FT                   LAHAVNALRSEHEAALASKDREMAKLRESNAKALAEERERFANVKFAMDELKQSSKTTI
FT                   ASLESKLATACANAAKASDGVPALMAAHARELDQVRAEHAEEINNLTKNHAKETEAQLS
FT                   AVRQEAEEAMKDLRAAVTDASSRVKRGESELAKMRRDVEARDAEIENLRTRLDSEKTRA
FT                   DSCERKCGDLAQKGEAERRNLMDAMRDSYDRERAALEADKASVEADKASVEGELSRLRN
FT                   ESAEASAARVAAERETTTRLVAERESLKTALGVTEAKLADAERRIITALARAADAESTN
FT                   QRLTRVAESQSNELERSLIERAASDAALRDAESKTAALERSFAEDTAALRSELAKEKTA
FT                   KTETLARLETLETLETANETLAAKLRDAEKAYEVAVASHRGGASAEEAEELRRRLVNSA
FT                   ANIAELEANATQLAAELANARSEAEASARKEHEQRFAALRAEHSKKLDAERRRFDSLVE
FT                   ASTKEATDRLRRETEALRAKEAETKVRHDDAIRGCVQEGDKRVAKALEEGQRVRNDLKM
FT                   QIAELSKLLADERDGALKSHEEKLALINDVARAKRAADEANERREAMERSHGAKETELA
FT                   EKENAMRRAAELARRNQGEVVAQCERLRDELRAAGENARENARVAEERLARELKRRDEE
FT                   WTRRAADLIQERCDALSEAHADAERSAVEAALADAETKCQTRLDALNESHERQIAAMAA
FT                   SMDAERVRLEAAATNAMSELAAAREGEKEAITELRALHESRVKKLEADAAATIAELTSK
FT                   HASARDECDALHAAELAHAVEHHERSMSAAADKAEKALWDLRVDLETAHATVVDEWRKR
FT                   HEDDVARLVAERWKQLGDLKEKLGGEHVAELARVRREWESREEELREAFHASCAAAAEL
FT                   ANEKAALTADAQSDARTIEDLRQRLDATEAAAAENAERMARERSESESERRRVFESDLA
FT                   SLRAEHEATMTRLSSEASTVEQTLRESVQEWTVKYESLAARFEARESREEDIARIACLE
FT                   RAVAEKENEVIEWRGHSEQTRLELRNREGTFTQAAFGNGAATLKPDAGGVMDWMLGGKK
FT                   DKARSGRRTLKF"
FT   CDS_pept        complement(110246..111385)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639404"
FT                   /orf_name="MICPUN_54824"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68683.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG609417"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199C3DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF45"
FT                   /transl_table=1
FT                   /translation="MPPHGSAKKKKKGGRDGKDRGKRSGRGASHRGADHSRGVGGGSSL
FT                   ENLIDSGNEHLAMDRVREGLADLRRACALVPDSADAWDAYGIALAEFGPNPDDAVKVLK
FT                   RAAQLSPDLGYEKFMYLGQLLDDGEAAATCTRRGLALIEYQAAHGDEDASERMCGACCA
FT                   LAEQLMAIADDVDDVADECDALLRRAAEADRASAEPLQVLASLRVLQGRSDEALEALRQ
FT                   SMAIWRSVRKSTTAGNDDDDTAGDDEDRATEFQGEYDVSFEFRFECAKLLLELDESTDA
FT                   AMDVLEELLEERDDVADVWHLLALANHGCCEFDRALEMLDRAESLYARGGAGDGGGPGE
FT                   DGETDADGGNGTGLADGVKADLAELRSAIEESKASWNGE"
FT   CDS_pept        join(112384..112504,112661..112983)
FT                   /codon_start=1
FT                   /gene_family="HOG000036561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639405"
FT                   /orf_name="MICPUN_77783"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO68298.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199C3DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF46"
FT                   /transl_table=1
FT                   /translation="MAAAGDTVVVPRNFRLLEELEKGEKAMGSFGYLSYGLADLEEDVM
FT                   MVNWNGTIIGPNNTPFESRIYSLQIECGENYPDAPPAVKFRTRVNLPCVTDAGLVERKS
FT                   LPVLSTWRRSNTIEDCLNALYMLMQHPSSRRLPQPPENAPEYP"
FT   CDS_pept        join(complement(113927..113988),complement(113125..113791))
FT                   /codon_start=1
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639406"
FT                   /orf_name="MICPUN_92703"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68684.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG436319"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI000199C3E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF47"
FT                   /transl_table=1
FT                   /translation="MGKKWLPLESNPEVMADFAHALGLPTTIGFHDIFGFEPDLLAMVP
FT                   QPVHAILLLFPITEASEKARREQSLNAANNNDAASPAVSPNVWFTRQTIGNACGTIGVL
FT                   HAVSNTQHEYPIADDSWFARFFAATRTMTPVERAAHLEADDSLEHAHAGAASSASASTA
FT                   VPEADEEVDLHFVALVHVDGGLYELDGRKDAPVRHGDTSAESFLLDAGAVVKKFVQMGG
FT                   DSLSFNAIAMGPSAGGDAMF"
FT   CDS_pept        115126..118902
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639407"
FT                   /orf_name="MICPUN_54827"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68299.1"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI000199C3E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF48"
FT                   /transl_table=1
FT                   /translation="MTVAVADDRRAVQHPPAPGKIRQPAETTPGADRRAPSPSDSGSDT
FT                   TEAGDAANPIQRTPDAVAMAKDGASVPAPARPASTPPQVQAGNANIGGASNPSAAVARW
FT                   PTNDATSPPIHSNAGGIASEPASGVPTPMIANDGGAKKPKHHPAGGSTPPHSPNSALDR
FT                   PSSGDPSDEDVVGEERVPRGAEGCRGVDAVQNVPRVAPGVVNNDDNSDGVSSGDDERLG
FT                   LTTTTTTVHQKLSENSSNPILKPTTAVMAKKPSPPLSEADERARAACVACFRSTDDAGR
FT                   LRELHAMGQRELQETFRTAFRRTTTSNNNQWLRRRIAGCMGIEGSAVAGAGPAGHARRA
FT                   AAAAAAAAQAAAGGGQAGALGSIGGSLIDATGVRKSSRAAKPKILDFLPSAVCAQVAAE
FT                   APGESAIGRRVRVFWPESNAFYAAKVVGFNAKNGQHAVRYDVDGAGATPREVLLAAERI
FT                   EWIRPGDDEAAAAVRAPATAAGGGALKSKYTAPATTADAARGTAGATGGSTDGGRSAEK
FT                   SHHRAVPPRAARSGAPKLDSYALPNPGKPAKVVSLLAPNWPQPQTHVWGRVKGHGWWPG
FT                   VVVRANSAEAAQAGPITASDAHSWRHVKFFDDTAAAVHRHDLVPFGEYVSVLANAKKSA
FT                   TYSRALSSARASYEKGVRKGSEDGFDGVCTRESLGLCGSDGAANSGQVGQAGQGQQSRR
FT                   EPKRSSTGRGKSFDLNADLDAPVGIGAGPVAGLLRGFGSDGGRLDASNGNLAVDGSNPL
FT                   GAAGLGEKRPLELVFDDDAVDGSLSGFVPPVGVGDYPTSAGHTTHVQGGGHHKRHKGSA
FT                   ADREGPGHGHANRKLAAVGPDGKPFKRSHKKGQGIKARLAAEAAGLPWPPPKPEGHRAR
FT                   NERAHHVVHGGSYRVTAGAGVKLGRTVKPDSTSPDADPARPGSSPVTTLDLGPDDQLGA
FT                   LSRKLDALQTRVVPLAIAASQHLRRRLQAAESRSAHSGGEAVAVHPTAMMTERERDVLL
FT                   EEMRTLQRLLTMARPGGGDARLLPPHGLRHQRGVHHQQGVHRGVAAQFHSDLGGMDAVG
FT                   AGANQGVSVPNLGGEATGFGALGPMAQMGLNDVELIDADVVGVGNDMDLVPNNESIGGL
FT                   FGMVDTGGMVPMGSTMVDARMVDEDEDEDGGMLVDGDDMVGEDDALGAMLGREIAREEG
FT                   ARGGGRAGDDGDGDGPMDDAGGPPVAVAVAVDGDGAARTIGGSDDPAVVAVMPLESPMA
FT                   NGAKKSKSLLRDGDQTDDEDEEDDEDLSTGVAA"
FT   CDS_pept        join(119372..123082,123162..123277,123335..123970,
FT                   124034..124970)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639408"
FT                   /orf_name="MICPUN_54828"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO68300.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C3E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF49"
FT                   /transl_table=1
FT                   /translation="MSTGGRSRGAARQLAAVVRDGGARASTSGRAGPDERSPVHHLLGK
FT                   IWAFGARRRRSGPGSGGTAAAPPPAADPAKRADERLARHLGLPAIPLPKSLVDGHRGVD
FT                   PRWRIHRVSTETTATSTGQPRVTLIVQDARRAEITREREYFGVDAPGPNAANTDAADRE
FT                   PHLWKWLANAGMNISTKSPSRQGVWVLADRIQPPPNNGGRSAGGASLFDDVRGRRTVRA
FT                   NRASPLFTARATRGGGAGLIPGAKIEFTPEGEAVVDHVALNALLYLQKPNTREVYVSFL
FT                   GLHAGRVGQAAGGQGQAGHQSVHSGRGKSAADHVAMGEQLAFHAEAARRINWLGTRLGF
FT                   DVNSDRWDGRSPVTMCEPWRLQLTRLPPKVAEAGGGKDRWLIACVVPPANAAFDGGGVA
FT                   GGTANNALADNPVVVADLVESIDFAQRTGTRLAVCGLELAGTHPQRLISKSTGTPPSSS
FT                   FDWSSSAGEEIDSIDSISPADAQWRLQREDLVNAVDKAARAHAAVTTAYVRENTQRIWL
FT                   EDWTHEGLRLEEASALVVDGARSPEWAVRWFAGFSRPYLTTPNDRALVSALSKWGADAG
FT                   RGGKADSFSADVTSSSSSSSSSSGAAVSSRSPPWFFLDPMASLARFWKGSLSRLFPNLY
FT                   MSGNVTHADYVRGAVTPLMRETCRYLANEIGEKRCVELLAEQNVAGARECLHDFLLGSK
FT                   FDGGSVLDRDWNAMFPPGSSAASEGLGNTRDGYFPPGSSAPSAPSAPSSSSSSSSRGAR
FT                   FFDAIMGDNLPLRAASDENLREPGLLFAAFRKFRNNVDLMTTRVGAWHLNLAFGHVLAR
FT                   VEHLRTTSPDDVSLLPLHRMTVDWIERLCEGHRSYLVDGRGIRQVYLRDADKVSRGATA
FT                   LIDRCDDLRRRMDDLRARHEGALADLKTLAEDVEKGFAKGDADAMAMAMGAEVERTYDL
FT                   SDESGLNHDTLLEDDFTSAGWRESLRRLEEAIARLESFEPDFTEDARVAASSSPDGFVR
FT                   AMSYDLPPYVPSAEDDFGSNDELTETSDDFGSEDGRAEREAVLAGAVGKLEPSKAEFTT
FT                   KNSGPVRATTSAPVTIDLDGTVSALRLRGPATDGDSTHHRPRAGPGADFPLVDEAEMLS
FT                   VYEDWLRPLNEAHCVLLRAYELRKQMRAAVDLVAATEKIDPSGIRTAIEKAKTEGAPHS
FT                   TVVAAEERLLALEDELAAFIRARRRRGNDSLLPPPKQGWTGAGRHVWYNEKDELGRGSL
FT                   GTAVYAGVYDEQEGRNTVVRRPAAIKRIPLPPGERRDAVRALVEREVGLHRFLNQNSKR
FT                   VTFLYGVHLDGDDAVFTAMERCGESLSQWLSNAPDGEVANLNPKERVDAAAAIVAAVAD
FT                   VHAANVVHNDVKPDNCLRASSGEFKLADLGLGVRMKDADVAGKSSGRYSMTTFAGYGVN
FT                   VQMTGRPPEVLQGDALTTAVDVWSLGSLVYTTLTGHPSPYAESTAGSKGPVGGSTGADT
FT                   IAGLYENQRIIKGAFNLNALETAKLPRHVVVAARHCVHDMLQPDPKDRPTAAAVRDHPL
FT                   FWTTERCVEAVRDVYDARILNDLSPEEEAAIVAEAWGAGRKESVGRRTARSLQGWKDQI
FT                   VPELRRRLVTRQRALQETGGAGVTSVTTGDGSSSDASAPDVSRVNGTRGAARGGAHQSK
FT                   KTVKENGGVSGANDGSSSDDGTGYESSIRDLFRLVRNLHEHPPLDINRGDRTKRAMVKS
FT                   MGALASTVPARGDEDPWSQARRVVEGYLTHAFPELPIIAKYLLDNREHIERLKSRRGEI
FT                   PIVGDGGSAGGRGQGQQRQQGSQQQKGGSQQQKQRGRKQRGKK"
FT   CDS_pept        join(complement(126369..126408),complement(126142..126212),
FT                   complement(125642..125959),complement(125119..125508))
FT                   /codon_start=1
FT                   /gene_family="HOG000265332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639409"
FT                   /orf_name="MICPUN_54829"
FT                   /product="Predicted protein"
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO68685.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG557954"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI000199C3E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF50"
FT                   /transl_table=1
FT                   /translation="MAKYFGDIGKAVKDVLTGGLSYDHKFSVSGKPVSDELTIKAEAVS
FT                   KGTDFSGDGTATYVVDKELSAELKVTDKGVAKVSVTKTGVVDGLKTVASVNPSDVAKSL
FT                   KLANTLLSGDVGVKADVSNCLGGNPKVEASACLNLGDAQVGAEAAVDAAKGVVSYAVAA
FT                   QLAADDLVLSAVLSDALSTIKAGAALKVDKDTTAAAEVVYKLNGGDLKLAGGIATKLES
FT                   GQSVRAVVCSAGHISASVKTSVADGLDLTACAQVHKDMKYKYGLQFAMKT"
FT   CDS_pept        join(127016..127312,127488..127715,127806..128081)
FT                   /codon_start=1
FT                   /gene_family="HOG000228204" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639410"
FT                   /orf_name="MICPUN_54830"
FT                   /product="Adenylyl-sulfate kinase chloroplast "
FT                   /function="ATP binding"
FT                   /function="adenylylsulfate kinase activity"
FT                   /biological_process="sulfate assimilation"
FT                   /protein_id="ACO68301.1"
FT                   /db_xref="GO:0000103"
FT                   /db_xref="GO:0004020"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG309946"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="UniParc:UPI000199C3E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF51"
FT                   /transl_table=1
FT                   /translation="MRSLRELARFASKVTAAYPTAAGSLASGNSSIAPAASLLQRRVGI
FT                   TMSAPAAVDVDAYKVGDSTNIKWHEGSVDTATREKAMNQKGCVLWFTGLSGSGKSTVAY
FT                   TLEHALFQRGKVAQVLDGDNIRHGLNSNLGFSAEDREENIRRIGEVSKLFADSGMITLV
FT                   SFISPYRKDRDQVRARVGDKFVEVYMKIPLEVCEQRDPKGLYKAARAGKIKGFTGIDDP
FT                   YEEPLDAEIVMEVAKEGGDGTLAPPEKMAAAIIEILEQKGFLSA"
FT   CDS_pept        complement(128349..129902)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639411"
FT                   /orf_name="MICPUN_54831"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68686.1"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI000199C3E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF52"
FT                   /transl_table=1
FT                   /translation="MCSRPFSGGHSRHFRPCLPVDDQALNCGAPTSFVHLARGGSGAMS
FT                   ASPVANVTTMSLYGDKESASEVRRTARNERRRPRKGGRVPSHLHSCFSHATARVGRAAS
FT                   LRPSRLTLPPIHPPTQFWVQKYERDARKNWDVFYKNNGDRFFKDRHYFGREWAHVFPAA
FT                   AAARRDGDVAADDSSSDGSSSEDDVDPLDRMGNVDRTGDDERELGPAPRYANPASPIHP
FT                   FPGRVFLEIGCGAGNSAFPLLDLDPTATVFCCDFSPRAVALVERRRQTLPADKRDRIKP
FT                   FVCDVSREPLCGGSSGPVPPGCVDVCTMVFVLSAIAPERMPDVLRNVSSVMRPEGAGRV
FT                   LLRDYADGDLAQRRLLDKGDGRKLGDNHYVRGDGTRAFYFEKRFVKDLFATQGMALEEM
FT                   TVHARAVTNRADARRMDRRWLQCSFASAHVCAAPLPPPPPPPEPEWRRRAREAEAARAA
FT                   RAAREEEERAAREEEARVEGERARAALGGCDRIELENFLEELRLAGRITADEIAARLGR
FT                   "
FT   CDS_pept        join(130021..130349,130452..130563)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639412"
FT                   /orf_name="MICPUN_105027"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68302.1"
FT                   /db_xref="UniParc:UPI000199C3E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF53"
FT                   /transl_table=1
FT                   /translation="MRTLSAPLASRAPGLTARARVTPRRGARTAAPVRAALDKHGRRDY
FT                   YAENYEYYKDKEITNAMLVGALVPAVASCAASFQLAMSAEATAAWFMSAAGFAEEVEIL
FT                   DMEYSTGLALRSAPPVAVDDKAYDMDGDDFYDCEIMSIRCAA"
FT   CDS_pept        join(complement(134000..135330),complement(133342..133927),
FT                   complement(130855..133281))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639413"
FT                   /orf_name="MICPUN_54833"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68687.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199C3E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF54"
FT                   /transl_table=1
FT                   /translation="MSPASRRRAASGSPRRFGVSRARAATFLALVVASACARPSFARGA
FT                   RRDDESWYRADVEEFALDGPDAVQAHVASALRENRERPDYDAAVNPILPGGRVRDVAVA
FT                   VAAARGDIRRPVSSAGLLGIGAGDGDGDGDDDDDDGARAPSPARPDDADDEASDEADDE
FT                   SEESFDGAAWGRRDVLGGMIVDDDDDDAGAPEGTPEGTQHRGRSLARSSRTRSTSALEL
FT                   ARRMRASRCGSAIASGAVAAAGAMPRDPREWAAAEDEETGLGVTEVPWMIAMEVGERRE
FT                   RERMGRIARASSQTGGANGGANGGARDESNSAVSSPHATDDREAELEARYSDLLRWVTR
FT                   KGGVVGVGVNVTRVVGKPGDGWGFVAADGVSDDDGADGSNRDEAEAVTAVSPGDVVARV
FT                   PIALALSHVAARTYRVDDAPVGDLLRRLFDQAPEYALCMMLLHERFKLVHGLDSPWGPY
FT                   VRTLSHVEPSVKVLRELRGTYADEARREWDARVRAAHEWITDTGCGGALRSMCQRKPGR
FT                   HGAGSGSFNRDDVRWALGVVRSRAVWIARRFGSGGGGADSGSGGIESRRRFPALVPLLD
FT                   LLPHDGNAGGSTTLGVDNVITVTSGSSFAANAEIAINRGTNCTDAEQLLAYHALAPGVN
FT                   RHNAVRLNLPGAEIASAGVIRKVELLRRWRREMAMPPRGADLWRDARGLGLYGDGDEEE
FT                   MRAMGDAARENAQSKKRRLASLVAKGEGGGRSGGAMTIEEELLLTDEARDPAEAAAKAA
FT                   ARIGVDVKDLLELDSQWDDDEDDDGEAYALYSAPNPDHPGGDSPALDHHRRSLARLAAQ
FT                   TAAAAAYADVSGGADYAGTRPDAISGSGRNGNPTGGSSGGADVNETRSPRGGADLEARS
FT                   DGGNATRAALRSARAFFERGAPPPRGLDPLDLFLLRKGRLMSECGGVKDFVITAAGASD
FT                   ALMCATRVLLANETEVKALEGGGSDPHWSGDRMESASEIERLKALGLMHEPFQPSRPLS
FT                   FTNELAAIRRIASAATNILAGYGTTEEEDLERLRDVDPVVLGLLGYDDDRYGDRYGDGY
FT                   GDGERGVWSGDSDDDDSNSSSSERASIPRERPKGFPARVPGGVLASAVALRVRERRMLR
FT                   SAVLALRDRAETLRDEDVEIFQVEEKERRRIERDAFERERAERIRELSRTFLEREVLAS
FT                   IDVDVVQPADSIGADDKSHDENAHPKRQTTTVTKTVKVRAGDDLESIVREFMAANSIDQ
FT                   SNDDAFASLKRTLLERVERGAAERRVANRRVGRCAVIVPDGRKVVVAPRVGEELTDVVR
FT                   GFAEAFDVPLPLVPALAARVNASLAKRAERRTLLTLNVVAPDGRSELEFDVVDGEQHDL
FT                   LESAREWALAYAVHPGAAVQVADAAFQALPPVVVAFPVDVPGRARKQLAIRDVDEVSIR
FT                   RTCAAFCEANDLGGGETTVDALTRGAMSRINPGAVLVDADRRDRS"
FT   CDS_pept        join(complement(136325..136509),complement(135687..136086))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639414"
FT                   /orf_name="MICPUN_51184"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68688.1"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199C3E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF55"
FT                   /transl_table=1
FT                   /translation="MPQLARYLQINTARDATPTKYDYALVLNGEDIETTPLYGEVQPKK
FT                   NVTLFGTHNEKDFGVVGNPPATRTFEVIPGSHHVLEASNRKLENVKAVLVVNAICTAVP
FT                   EPNFYAQVENAGKEIGPMFAQHDGLIVKHFLCSAWGDKDIGGGLYFFETKEQAEAYLAS
FT                   EFWDAILVDTEWDKDSITYELYSVNGYAMAA"
FT   CDS_pept        137125..139206
FT                   /codon_start=1
FT                   /gene_family="HOG000150224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639415"
FT                   /orf_name="MICPUN_92711"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO68303.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG284415"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000199C3E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF56"
FT                   /transl_table=1
FT                   /translation="MTLTTRCAAQGFPARRLGAVTSLRARDARAPILRLPGTRANGENS
FT                   SARRASILRARASAVPNDTTPAVASTKSGVSAKDTDEEYDVVVIGSGIGGLSAASLLAR
FT                   YGYSVKLFESHYLAGGCCHMFDHRDKDGGLWRFEVGPSIWEGLDRPTGNPLRMVFDALD
FT                   ETMPVRTYDGISMWTPEGHWRFQLGDDDAPGGFCDLLREKATDPELAIKEWKALKGRLE
FT                   PLYDALDACPLTALRQDAGLLLSTVIAIPFYLTHPKVMLDIPYILDSFHKLSRQYVTEP
FT                   FLTQWIDMLAFFSGYPAEGTMGATMIYSIPGFHRPGASLCAPTGGTQAVVDKLVGALDK
FT                   FGGSMELKKHVDEIIVEDGEATGVVLRGGRIVRAKHAVVSNATIWDTVPLLPDRDELTS
FT                   QGLPNAADWKEDMAEIPALGSIMHLFLGIDATGLPDLDPSHLAVMDWSRPLGDPQNVVT
FT                   IFVPTVLDPEVAPPGKHIVHVYTAGSEPFDLWEGKDRNSQEYKDYKRERAKILWDTIER
FT                   IIPDIKQRVEVEIYASPLTHQRFLRRHRGTYGPALPAGGKLFGVLPLPEVPQPGVLSPI
FT                   PKLVRCGDSVFPGVGVPAVAASGAIAAATLAPLPKHLGLMWDVARKQGEFWKENPGWLD
FT                   SYADGEHKPFHPRGQHPVGGAERMRPEEHFQAPKGKVKASGEVGKGGKKVVSEEPVSR"
FT   CDS_pept        join(complement(140389..141365),complement(140069..140325),
FT                   complement(139824..140012),complement(139329..139762))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639416"
FT                   /orf_name="MICPUN_77544"
FT                   /product="Neurotransmitter:Sodium symporter family "
FT                   /function="neurotransmitter:sodium symporter activity "
FT                   /cellular_component="integral to plasma membrane "
FT                   /protein_id="ACO68689.1"
FT                   /db_xref="GO:0005328"
FT                   /db_xref="GO:0005887"
FT                   /db_xref="HOGENOM:HBG702834"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniParc:UPI000199C3EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF57"
FT                   /transl_table=1
FT                   /translation="MGVSELWSRGFALFPEAGAGEEEEEATDGAATRGARASAPHGTDD
FT                   RGGAGGRPRWGSTAEFILAAIGSAVGLGNLLRFPFMVYKHGGCAFLVPYALAVVFLGVP
FT                   ILAMELALGQVAQSGCVDALAAMHARAWGIGAAATAGAFLLASYYCAVLAWAWCFLAAT
FT                   WQPTMPWSDGRAAAFFVDDVLARWDADGTAVSSHGRSDDVDESGAIAAFARKGLGPMNW
FT                   WLVLGLTLTWALCFSCVKRGAESAGKAVWITVPLPYLALFVLFFKGVFAPGAGAGITAY
FT                   LGTIELATLGRGEAWIDAVAQIFFGLSVCCGAMPAYASNCSRNERCGANAIRVAVANSL
FT                   TSLLSGFVVFAFLGHLAMTRGVDVADVAEGGWSLAFVVYPSAFASFGVPGGHIFATLFW
FT                   VAVLTLGVDSAFALTEAVVCAVCDRSVYCAANRGFAAFCVCFLCWCLGLTMCTRGGYYV
FT                   VDIVDAYVSRYTLTIAGLAECVFVGWVYGAERLRDETRAVSGHAFMGVGSYFPVTIKYV
FT                   VPVALVTMLSYQIAAEAREAYGGYPRWATNSFGWGLCVATPLSLACVGAARPLDVGRKF
FT                   CDSSYSLGVFDDGAQARRTTRVTDGVRTLERGEVEMGPSPGI"
FT   CDS_pept        join(141650..142669,142737..145883)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639417"
FT                   /orf_name="MICPUN_54837"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68304.1"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniParc:UPI000199C3EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF58"
FT                   /transl_table=1
FT                   /translation="MERYGAVAPRAAAAAAAGAADDADTIPLLHGDVSIAAKRPRGAGG
FT                   RAWALGVTVACWLGVLGTLQMFAHPTPAPAAILLRSAASKLGGAAAAEAHSAERDRDVI
FT                   SGDRVPREGGGGGGAASAGAASAGALSVPLVIGHNAVFQRAPESAAVWGWAPPGAAVTV
FT                   QVVDPGHQGDGAHLGRDGAKKDADRDEAEEDEDEDEDEDHRPDRSRNPTESAASSDEPG
FT                   KTRGAPTSQTHRHEGSHPSDWVLHLGGSTRAMATAVADSTGAWTVRLPPVPASTGLELV
FT                   ISAPGAAPLVRHNVAFGEVWLCSGQSNMQLAMAGAFDADADIADSGNYPLMRFATLKMQ
FT                   AYTVPVNDVPPYITVEPYKDTIWATSSPEAFYPQKSVAAQADPTLPYGGGSPAMGGWFS
FT                   AVCYTFGRRLYRHFDGTVPIGLVDASWGGKTIEAFAPPSAINADGSVRDASCGTGGTAS
FT                   TATADAGHSDGIDQELNHRSDLDLDLSVRNNDVEVPTGDDKWEKWPDHWRMKGTPTVVA
FT                   NYGAGTVVDDDDDAGPIGVESSEEEAEEAEEADRDPSGWSRSGSKRSSNPKSSKSHRKS
FT                   VRESRLSKAEVEKMTSADYVAKGTETPRRKTLLKLLSSLWESADSETRERFMEKLTEGE
FT                   IGVVNATVDVAGVPAEMDADDDVSVASPPPPGSPPTPVASPPPPGSPPTPVASPPPPGS
FT                   DVSAVAVSAVNVSAVAVSAVNVSAVADPTAADVSAAVNVSTAVNVSGAVNATAAVETGD
FT                   SDEEAEVGHRERSNAMAKAVRSSPIKPEGAVQQPAKGAAAQKVQQPAKGAAAQKVQQPA
FT                   KGAAQDPAKTAVQEPAAAQKTGQQQQPAQQQQQQQPSPAKKQPPDNDMDDISAKLDAIE
FT                   KMLNDELAERNAFASVPLVNMDDDDDDDAALGLSRRRLLEEIVAEIEASEAVTSAGPVV
FT                   SGGAAENDPFKAAMSANDAKGSLGGNDPDPYLTQGPSTIWNGMIYPIRKFRFAGVAWYQ
FT                   GESNFADPLKYSCLFPATITAWRAGFENPSMSWAFVQLHAYNLHDWSEFRNAQALAIRK
FT                   LPGVVMASAIDLGDPTSPLDPIHPRYKQEVGRRLAQAAIASRYSDYGGVHYSGPRFRDV
FT                   QPIAVAPEDNHGVKGLVLKFEDGNGGAAPGTTHVSAAAACSLTGSKKCCGESPFAVVDA
FT                   DTGQISRVPFWVDNAGDNGAGKVVLSIPGNVNSIKEVRYAWERFPQCLLYNGVGGYEAY
FT                   TDAMPAAPWCFDVVTGAPCPVRNLPNPWAAGVRTTADMGFTTMLHKLPVRDLIQWGQKD
FT                   FAEEYRPASAGGGAGAGEGADAGARVSADVGDAPASDVVDVGDAPASDDVDTNDAPASD
FT                   DVDASDAPASDDVDASDADAPASYEDEIIMDTLGTPAYSLFTPGV"
FT   CDS_pept        complement(145974..147134)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639418"
FT                   /orf_name="MICPUN_54838"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68690.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG609952"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI000199C3EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF59"
FT                   /transl_table=1
FT                   /translation="MAARVVASVSRVVCRPRVVVVQPRRVQPRSSDDAHLHHRPKPLAT
FT                   AATPLALDASLTRSILLVGDGDLSFSLALARRAPNARITATTFEAYDAIVKDWGGDDNA
FT                   TALRALPNVEDVLHSVDATKLHTRESPLHGLDAPVNDGNNDRKRWDRVLFTFPHIAGKG
FT                   KISKNRHLLRGFFESVGAVLAPFGVVEVTLVAGQGGTPADGVHLREYGNTWMASEQAAK
FT                   GGFVLCATESFDAESWSECGYTPTGHWRGLTSGARAFVAKEGVVHAFARPTEMPATHAR
FT                   CPHPVTHRRAFSIWISDEESENSGFRELELERVVKRAVSAGVHVASLTRMEPVDWTCPS
FT                   TGRRSRTYVVELTSSTSPWDGDRATEEQFRVREAVAAGAVPGAELR"
FT   CDS_pept        147393..148433
FT                   /codon_start=1
FT                   /gene_family="HOG000264321" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639419"
FT                   /orf_name="MICPUN_54839"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO68305.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG559322"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199C3ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF60"
FT                   /transl_table=1
FT                   /translation="MSASVAALHGLTVRRGAARTPRVRRITTRAVEEPKESTADETKAV
FT                   SGGLPPGIKTTPAPDVDRTQITGDWRTGKIWRPPPGTPKFRVDLGKGTVEIVDEEEERR
FT                   KYARMRAMNAAAAAGKAGIEDADANPAALVPERQIKLRDNGNVVIAAMTEEDCVDATKL
FT                   IMALFFKVRPQDFLAKDRLQKEQSERVYQGLVDGVANGKDRLLIAAKVGGKVVGVAEVS
FT                   LPGGKRFGAEKIEPKAPEDWPYISDVAVAPNQGKRGIGRQLVRACESAMCAKGLRKMYT
FT                   HTKVDNEAAQALFERAGYVEPAEVKASLTQMQIAQRGTKGGPLAKLGLVEVGHVLLAKE
FT                   LDPAEY"
FT   CDS_pept        join(complement(150158..150280),complement(148600..150030))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639420"
FT                   /orf_name="MICPUN_54840"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68691.1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000199C3EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF61"
FT                   /transl_table=1
FT                   /translation="MTEVPLTTAEISEQVKRRQKPVNQGYSLDAYFAVADSTGVTAKIY
FT                   RDEGNHQELFRVLMAFCSLVVETMGKHRDRGAAGHKARYAAYLAEVKNCMEEMEAIKPG
FT                   INAEARAFRERMESGNADGAPPVTRPPPVGGAVDVRASVQLDGGVHSTAMNDDERRRPA
FT                   PASSMNAVDDLLSASPEELAAASAASLETLALVGAPREGQSTHSCASFEARYRPNAEFA
FT                   AAASNDSAARHSLLGTSLPPPARTRVGATVHVPSIHVPSSSVTSSGTERYPTVSNTKTA
FT                   VPQTTANLSVPPPPPPGPPPTVPSAPPMAPTSAPTSAHASAPTVSVPRGQPPPPPGPPP
FT                   AGVPSQHAHFVATAASRELAPKRILSVPTPTFASKDHDRLDNRLAAYGLKEKKVRGDGN
FT                   CQFRALADQLFGDQERHAECRAVVMNQLRAESEHYAVFVPEDWGAYVSEMSRDSAWGDH
FT                   ITLQAAADAYGVGMCVISSYKDNFVIEISPRVRRSERILWISFWAEVHYNSIYTADAVV
FT                   "
FT   CDS_pept        join(complement(150848..151203),complement(150471..150708))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639421"
FT                   /orf_name="MICPUN_98494"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68692.1"
FT                   /db_xref="UniParc:UPI000199C3EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF62"
FT                   /transl_table=1
FT                   /translation="MVAVTLSSSSLASRAALARPKALKRNSRVALRVRAKLETEDDTAE
FT                   KTDAPTTEPGFLDGINNVIKSIWPGSDVANAFTAPKVNPAAKLFDANTMSEAERNALKR
FT                   QYAQPTFLEGLFPKREPHDGLEGIGGNELEDPSDPESAAASTPFHNSRWNLNPAAKLGV
FT                   PFGETEKNALEKQYASKKSFLDDMFPKREPHDHE"
FT   CDS_pept        join(151695..151841,151968..>152318)
FT                   /codon_start=1
FT                   /gene_family="HOG000127724" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639422"
FT                   /orf_name="MICPUN_77288"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68306.1"
FT                   /db_xref="HOGENOM:HBG595165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C3F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF63"
FT                   /transl_table=1
FT                   /translation="MVEFLVGECQAEVNARDSQGARPMHYAAEGNKVEALDALLRNGAK
FT                   VTMADDQGELPMHWACARGSRDACESLLRAGTSPTIPTKSGWTPMHVAALNGRAELLDA
FT                   LIARIRKTRGDTELIAALNAQIPSNGRTALHLAAANAKLEAIETLANAGADPEARDMNG
FT                   LRP"
FT   CDS_pept        complement(152958..154031)
FT                   /codon_start=1
FT                   /gene_family="HOG000258992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639423"
FT                   /orf_name="MICPUN_54843"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68693.1"
FT                   /db_xref="HOGENOM:HBG388130"
FT                   /db_xref="InterPro:IPR007884"
FT                   /db_xref="UniParc:UPI000199C3F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF64"
FT                   /transl_table=1
FT                   /translation="MERARAWLGFPAEGAVENLTVVCAHCNARLTPSQMDYDAARERLD
FT                   PTLAAVFRPLRRDDATNDFLMRSSRRPWVVNWAQSYACTQLRRFVSLTDANAVLGRGKM
FT                   MVLTETQARDLLGGGGDGGADRGADRGADRGADRGAERKGTLLDVGAGEGEVTTQLAAG
FT                   GSFGSVVATEASPPMCRALRAKGFDLVVQSTTIEDVASLAKKANVRHLRPDGKFECISL
FT                   LNVLDRCDAPFTLLTQLRSLLAPGGTLVLAVVIPFRPFVEDGKTHRPPRERLPLPTDGT
FT                   WEDGASQLWRKVLKPAGFTCRRLARTPYICEGDQRNAAYVLDDAVFVLSASDAGADEGA
FT                   DEGADEGAESVEDGAGI"
FT   CDS_pept        154411..155346
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639424"
FT                   /orf_name="MICPUN_54844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68307.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C3F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF65"
FT                   /transl_table=1
FT                   /translation="MASAAAVVIPNGSLRDDDEVNAERAQRGKGRRPARPPPARDPPPP
FT                   PARDPAPRVVKPSKKRGRPAVEPCPHGVRPRSRCGTCSACPHGRRQRQCVDCGGAAICV
FT                   HRRVKYTCVDCGGASVCEHGRQRYACVECGGASICVHARKRSQCVECGGVGICEHGAMR
FT                   HRCKECGLGAPCVHGVERRNCDTCGVIRGACRHGVKRYFCVVCGGKGVCEHGLERRRCE
FT                   TCERAGGAKCEHGRRRYFCKECGGAGICEHGRQRSTCKECGGTGICEHGRHRHHCKECG
FT                   GSGICEHGKHRHHCKECGAAKVLKQLTGAD"
FT   CDS_pept        155973..159104
FT                   /codon_start=1
FT                   /gene_family="HOG000100094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639425"
FT                   /orf_name="MICPUN_54845"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO68308.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG559360"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C3F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF66"
FT                   /transl_table=1
FT                   /translation="MFRYISGANGNSGDDALLSEDGGINVRSLPEDVQAVFADIDANGD
FT                   GVLDMEEFKTMLSTYAVLRRSNQEGSVSISTLPDKVQPALKVFDQDGDGTVDPKELMRA
FT                   AEMYQASKKSQRRMRKFIIGLVLFVVALIGINSAMTFMMVEIAKETKASPDGVMRVNAG
FT                   GGHQGAVVKTAANGEPSPLTSGLPDAAFAQLKQFQVDSPTGAHVSLVVQGWYRVPSPIA
FT                   TTGSVVKIMTAAGFIILDGTDMTFEETVGTVFSEAGFDVMGRKLLGMYEIVGIFNSIDD
FT                   WTGLGEEEKKPGFGKHDFYMEYSTLNKCVMEVGAEKSCVDMYNNTHGAYVQIDGEHYIK
FT                   IDSTILMDVDTNIAMESHYYAEFQATIEEMKSPTRRVKAQAVAYNVSYEGDEEEEEMFY
FT                   CKEVHTGDDSSVWNVTNAEKVGETEDADGRTIREFVITTPLTSLQHDFITGFDESIPYT
FT                   GTTEVKYWDDKATGYPVKFSFGGKDFVVTKYVEDEIDLPEPDEWHVADECFNMKPADAL
FT                   HDKTLPTPVPANPYRFDNRRRLRDECEAEGGCYSSEDVSSQPYCINGTCLNTTEIADIY
FT                   NSTAYDTQGSGRKLLQSTGFIQHDDTVLIYNHRFGGGLLKISNSVSSGKRWLDFNKGKT
FT                   YTKNLEAASKSSVPWGDHYFKVKDLGGGEVAFFNDARKKYMRLLECNGGKLSTGSTSHS
FT                   WTNLPDSWYHERFRLVPLSNTGRLNVRNPEYTYFGLYADKCGSFVRIDANGNVVGIQKD
FT                   MDKVGDNDLSFRFAFKVLTRSGPTPLSGNCNNAETCRKGCSGNACPGAALTHSIAFPPE
FT                   ALKPRVQFGIEFWHRGCGVKGMSLSGSCGTATCEVGGTFDGPDVCCSNNKFCGPGGSVY
FT                   GLISQDLLDLIQGSDKADKIKQKLEDLGVSGSLSMILSYYKPAGRSGAITLAIVGEVEA
FT                   SFRRRKLLSIESADEGDEGQVALTSYDAHGRKVVWFKKTLKKAKKFAKKVTNVVKSAAE
FT                   SFVEQFGFTNGVFLSVSGYAEYDFDSESLGVGATIEGQACLLNICGDFAVEVAS"
FT   CDS_pept        complement(159362..161437)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639426"
FT                   /orf_name="MICPUN_54846"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO68694.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C3F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF67"
FT                   /transl_table=1
FT                   /translation="MEELARSLGLAPGPASSSAPPSRDPARVPRPTPREAVDILRSLGV
FT                   PCASETEIVWVSVPTPYRRGRLRLAVLTRHLLVYARGLDPLQAAYERALQSTGGSSGGS
FT                   GRAWDLDWTGALENLAFAAEAYSLEDDDVRVGADVRDGNGNARTTWTSLTAAFDRYVRS
FT                   FTADVSEAAGRASSTGSADRGRAALVSVHFRPRHAWLGDPDATKRRHVAVSPDDVPSIL
FT                   EHLARAMRVTGRTPALAWAERPSKTTTIVYLKPPGPLASLVQFLSRVCSDHGLVPSPSA
FT                   DRRSIVAVTPAGARTRMETRLTLGRHAVKGDALVMEYARWETEEAAKDAARMAGAVGLM
FT                   AAFGAFGVIAVAALNATSAASPIVRYGAPPVRRVPVRRPGRSMMGRPAIWSWRWDFDFN
FT                   RAGNTGRTGDGGADGGADGGADDGGGGSHNVPGSNPRVVRADDPSLGSGVRARDKFHAI
FT                   FSGNLRSALANAGYVDAPKCPAQFALAREPRDNANNTSVSSNGDGVDDGWTLVLTPETA
FT                   WAEAEEAQPSGEPSLAVGDFNVPSAPPLPREPTPTDADVHDAARDRRRTGETTGSDDWN
FT                   VSGSDRMSRDASDSFTGDANVPKHFSCPITHELFVDPVIFADGHTYERDAIATWLRRRE
FT                   TSPMTGESFPGRRIVLLPNHAMRSQVEEWKAIRRSTSAAAGGENGENGDENRRDAR"
FT   CDS_pept        161797..163638
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639427"
FT                   /orf_name="MICPUN_51191"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68309.1"
FT                   /db_xref="HOGENOM:HBG559377"
FT                   /db_xref="UniParc:UPI000199C3F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF68"
FT                   /transl_table=1
FT                   /translation="MEEGFDYDGHRAWFARELRHEPNPRRLFQDAFNDVPVEAIPRDAA
FT                   LRMIQFFLSAREPAEFPGGTYPADVTRTSERLLRSFERPPHNLRFRSEFVVDLGPGAGG
FT                   GEVTVRSPIPAEAETQLSKSIDGDRRTHPAMTSFLTGAANVATGGVETDASLSRDVDFI
FT                   RPNKFALSGWYKPLIMQALIAATRWYGSHRLHAAGFTKTHDEKTGCDVWSRPRVAEKGD
FT                   GLNPEDPNRHDPVVFLHGLGVGLSPYADYVADFLPRDRPVVAPEWPNISYGWNDRCHRY
FT                   PTPREFASFLARAVTETHARSVRKEWEETSYEEAARFTKVEVGADGRAVGEPGGGGIDS
FT                   ASGRPPVAKGVGFKCDLVAHSYGTVILTAFRKHEGRLVRRCVYVDPVCFLPSFGSYLRY
FT                   AHDDHLRSTYDLLTHLAARGADPHEPMSMANLVLASWFVKGDPSTQQLMKRLLFPHEAW
FT                   ERGPLGANDMVVLSGLDDIVASAEIAERFARAWPLCEVVTQPQWQHGGFLLEPDPDGVN
FT                   ARIVRFVEGGRSDDDDVNGDDDKGRKRRRARGGLARGAIRRAWRLASRKSRKSREKIGA
FT                   EKGGAAAATAAAEDGDGDGEKVGGTTARAAVPLAATA"
FT   CDS_pept        complement(163737..164585)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639428"
FT                   /orf_name="MICPUN_54848"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68695.1"
FT                   /db_xref="UniParc:UPI000199C3F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF69"
FT                   /transl_table=1
FT                   /translation="MRFTSSRAPTPKFIRLDISGRRRAKRRHLVGRSAPLKNHRTALET
FT                   DMSASSILVANPTSPASVSRLTQRASSRGASPIHVASSRMMIPRNTRRVSKLAVVPVRA
FT                   FLGFGKSKEEKAIEEFAASDLGKRALEHASRGGGLASMLEFGKKELEREHVPTDSHIID
FT                   AKTRVLCATLINKVVDVPIINEATEQIIALKAVDVVADHMEAELEKAGLATFFDGVRDM
FT                   SEKDVDKWVKKVAERVNEAVDLPMLDETQEGIVIEMVVKLIAHKFVEGNKKREKKGWFG
FT                   R"
FT   CDS_pept        complement(164653..165198)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639429"
FT                   /orf_name="MICPUN_54849"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68696.1"
FT                   /db_xref="HOGENOM:HBG559393"
FT                   /db_xref="UniParc:UPI000199C3F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF70"
FT                   /transl_table=1
FT                   /translation="MRSTSRPVLELPSVDAAKTWINSDEYRAIKPIRTDNSTGPVAMFA
FT                   ANMLPDGFDTSSFGAYISTIKKFKSPEDKAKFAETYPPLLKANNAKFGATMIARVPMRG
FT                   DGSDALLYSENCEDMHLAVLIGFPTYEGAVAYLSDPEFGVAQTKCRLDTMVGPLAVVKA
FT                   TSRADGPFPQYSGVPHER"
FT   CDS_pept        join(complement(167043..167273),complement(165687..166769))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639430"
FT                   /orf_name="MICPUN_54850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68697.1"
FT                   /db_xref="HOGENOM:HBG610301"
FT                   /db_xref="UniParc:UPI000199C3F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF71"
FT                   /transl_table=1
FT                   /translation="MVYSRFLELPSLGSAPHGLLHRTAALSNPLDPVTASLEAKWLGVS
FT                   ELVLNATAEAKRAGVTTPHPYAENSICFVEPMAPSHGAEAVMFIFIFGVVLGAVPQYLK
FT                   LILLASSEGISLVSLALMNVSNLTATLNIFILHFEQIKQCVKQNAPEYSFDACQASLLT
FT                   FYYTLVYTLLWFPLYPLAAHFCSNRKSEVCGVVQTQRQHAWQGLLAHLVPCAILAAPVL
FT                   KMAASSGACHEYEAYALLLGVVNAILEATRYLPQVYASWYSMGSGSLSYLRLLLSIGGG
FT                   VGATVQKAVMHEDVSTWFPPLVGHSLEIVIVLMNLYHDMHGGNGGRFNGGENGKAEPDS
FT                   GGKAASGGDVESGEAAPLIGAHRAAETEAMNRALERGEKAAAGGKQELGSSKGEEEDHG
FT                   DESWIDELEDKGVVDGCGYCCEQMRTNPKFLRGLIKYM"
FT   CDS_pept        <167737..>168447
FT                   /codon_start=1
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639431"
FT                   /orf_name="MICPUN_71689"
FT                   /product="Predicted protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO68310.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="HOGENOM:HBG325345"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI000199C3F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF72"
FT                   /transl_table=1
FT                   /translation="EDLIERKKATRKRVRAALKELTEEQMSTESAQICEALLSTLQIFA
FT                   TENPPERGRPVRLGLYVHCAKLREVDTRPLLETALGLPNCEVYVPIVDDAKKDGESEGV
FT                   RPAMRFLQIRNLDDDLERKTMGIMEPKEFLADGVTRRQNLEHLWDVPESNPRPLDVLLM
FT                   PGLAFDSAGARCGRGGGYYDAFVDRYFDRCEASGYEPPPLVALAFSAQVLPAGEVPMAR
FT                   WDRRVDALATADGVL"
FT   CDS_pept        join(complement(169741..169920),complement(168746..169675))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639432"
FT                   /orf_name="MICPUN_107454"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68698.1"
FT                   /db_xref="UniParc:UPI000199C3FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF73"
FT                   /transl_table=1
FT                   /translation="MAKANAAEAEKNAKLTKAMAAAKFAAAHKHQQHKDEKGRLVAQVD
FT                   AAKTAADAERAAAKQAKILADAANTEARKAEAVAKQAKAEATRAREESDAAKVQAAEDV
FT                   ANAKAIAADAKKEAELALNAAKTSRLDAAAAAKKAMDAQRELARVKDAASRAEKLATAK
FT                   MQGADRKTAQLMAKSASLEHEKKSLAAEHAETKATLLSVEAALASATDALASSEASNKS
FT                   IRAADAQKYAKEVAALNAKYDAKTAQLAVELASAKAANVAAFELANTLRAQHAKECARH
FT                   SAELAKVKDVAKKALDAVKSREADAERRAERLHEEVMALKVAAAEARESLAAAEGNVLD
FT                   AKNSRASAVRVVGLVSVFSAYLVLSVKRK"
FT   CDS_pept        complement(172645..173781)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639433"
FT                   /orf_name="MICPUN_51194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68699.1"
FT                   /db_xref="UniParc:UPI000199C3FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF74"
FT                   /transl_table=1
FT                   /translation="MAGDSRVSDDGVSESRKSDAPSPIAAAPTAATPSGGDRPPPGGDS
FT                   PGGGGADPGADRSDPSAFETSIAKDAAALADALPPETADKVAKTSRRVAERRRRNTNAQ
FT                   GDKHGATATNGQSPPTPPSPRSPAVTWRVGARALPAPLRQPVFESGANPGEAGLGGASD
FT                   LPAREVLGSAGFEPGTNVKSRAGAVFAVKAAEARAAAMAELAPAELGVSAMDASTSAST
FT                   SASIQSASGAEARTPAAPKFLRGGDLYDYVPPERIVDPADDDLDDPDGSDDDDDWLRRG
FT                   LTADSSDFDRTALTDGARPIGGRSESTNPDLSLTRSATAAIAREMTAGAGGRHRGDARS
FT                   HGFYIRRSHPEGRAALAAALAAEESDLSDVASSVESLE"
FT   CDS_pept        178311..178697
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639434"
FT                   /orf_name="MICPUN_54854"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68311.1"
FT                   /db_xref="UniParc:UPI000199C3FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF75"
FT                   /transl_table=1
FT                   /translation="MDVDMDDARAEAADVIALDDASMAVEADDDATPGSLLHGDQIVAT
FT                   DEDDHDERPASPADASAAPAEDPIAIDGSDDDNALDDGAPDSPQSDENLDDIDGDTAVR
FT                   PPPTLTPSTPHREKTRRHEQRERR"
FT   CDS_pept        179836..182892
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639435"
FT                   /orf_name="MICPUN_54855"
FT                   /product="Ult-like transcription factor "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation elongation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68312.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR000770"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI000199C3FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF76"
FT                   /transl_table=1
FT                   /translation="MFDPANTRSRPRHTQPRDANADRSPAPRIAPHRSLRSCEGTVAAA
FT                   DVPSLVEKYELDPPQVTAVIASMWAKHLERGGLPSPHKKRERKPNSRYDQEAIAYAEAD
FT                   EEDEEEEGAEEEGAEEEGAEEEGADGDDANAAGRKHLDDDDDEVSYDEKTGISAEVRVQ
FT                   VTCGDLRGTIVLPAGYKKQQEFVVYPDGRKVPPSQFERDAGKGSSKSWKTSVFVVMPDG
FT                   SEGRAFRIWMESNGYFPKGTAWDESVVEAARALMGRRKKVAAPVKPVAKKPKPPAAAAP
FT                   KPKTAAAAAEKEKKPAEKAPEKSIFETQLENLLDDDGGLRLVEKTPNFVWLMRNALKNV
FT                   ERSLVVTVIHRTTDKKCAEAFVKSEGIKVLHEWCAKAKEENKSSLVLKMLKTFRRLPMT
FT                   VEVLSSTGLGNFVNKLRKYKPPGKEDDDLTNQVVQEAERVKNKWVSIVRAESEAAEKQQ
FT                   AAAAAASAAKRPNAAARTDDKDASKRRKVGEPGVGVAAVKGAEEAKPATAGVTKPSSST
FT                   SSVPKVEGSKPLGVTPAAVPAATRVGVPKPPGSGVATTTIASKRTVTTISRPTTSTITS
FT                   FGGVNVRGVAAYRKEPTASLASKPGAAATSGAAKPAAKPKEFFQKSTFAKKKSSKLAKV
FT                   GRGGIGWRADEELEAVKFFFKDDVVGNGAQNSDPAEERRRAAQEKRDAARKEREEEEEV
FT                   EDEDERAAIEKARERQQKEKAAEQRAANLTRTRRLNEMKAQCRWSRPGRIEYPANWEIF
FT                   PGKDSEERGRLQSRWKGEFEVKYRSPDQIPESPREAPHHAAYDPPFADPPSMIEVSTRA
FT                   PPRRQPDGGQPGPAHSHQHHSQTGGGFIPPLPGGPPPPNHVAALQASQNGGSGAGGGFD
FT                   QSALQALLQSVQSGALKVPATGGSQPGHAAHGSHQPPLPPPGAVYGNGGAPPHHHPGAG
FT                   IGAGMSSRSYSQGGPPPGLGGGGLAGGGVHHEPWRPDPTTGQKGPMPGGNGLCAFFNTP
FT                   KGCRWGDACRFRHERGPAPPPGAFPNRRF"
FT   CDS_pept        join(183387..183460,183649..185689)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639436"
FT                   /orf_name="MICPUN_98505"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68313.1"
FT                   /db_xref="UniParc:UPI000199C3FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF77"
FT                   /transl_table=1
FT                   /translation="MADVWCFNVDAKFERNGIVSSNTLKHVELIDASRDKENARAGMNH
FT                   KVDDLNASAKRQWVLRFGGDKAANDMSVGHIKAIYGKQVKEGKLTIEDKANVKVLIQAL
FT                   PAECARLMKTLTTLKGQAPAQQKVFLATLGCCVKCEAKVAEKKAKHEEKQRKLITAQLE
FT                   QAEHELAKKRKREQAEKEREAAKAAKLSAQLERVERMKAEKEEMESVVEAKRLKIEEEK
FT                   RNASALVEELREEKDALAEARRALKEEKKALDAEQKEIETLKTRIESERRRCERDQEKL
FT                   NAQLDAAKATAASLETARKAVEKESASLEKERERRETEAVKLEEQVKATEAKRAAWNEA
FT                   RKFKEEEQAWKQAAAERRRQEAAAKREEAVKRKAERDAATAAKMEEKRRKMEEWRAEYE
FT                   RWQRHGEAGTSPPPRPDQSSSPSGFYGTGGGGGGGGAGGFTGGASTAPRTKSQPPKQKK
FT                   KPILDDDDDDDDADDNRANDDDDLTSNDNTNTNTNTNTKQPDFDAAADPPLQEEDEDPT
FT                   VAARRADLERKRTEELQRQARERSAREEADRKLKELEARRAKTKKAQKEMMDELRRKQE
FT                   EEVAHREHQQRKTAAEAKIRQKAASITLATATDAIYEAHVAAYDRLRSMDSITEAAIPW
FT                   PIPSNVLLLTPRDDAAARKKKIVRAISRWHPDKFNAAFGAKLVDTERDAIMARVRSVSD
FT                   AVIELRQVFN"
FT   CDS_pept        complement(185785..186582)
FT                   /codon_start=1
FT                   /gene_family="HOG000264825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639437"
FT                   /orf_name="MICPUN_54857"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO68700.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG608929"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C3FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF78"
FT                   /transl_table=1
FT                   /translation="MASSNAAKRLMIFGGTGFVGSAIAREAARRGLLVQCVTRGGDAPA
FT                   HLRSEPWASRVTWLRGDALDPGTYAEHMRGADAVITSVGRLPFPHLTRDVIVRDNGETN
FT                   VAPARCAAEVGVDRLVVIGASVPKMIPGVGWGFAPGGGIHDAGYAAGKAMAEAHARDEF
FT                   VGGDAARRRGAAVLKPGPISGTRIVGSGPLARVPLWAALGPLASVMRALPLPDAVAQMT
FT                   PVHVDNVARAAVAAATEDSFAGAYCTISNAELIERFGLDESSR"
FT   CDS_pept        186741..187412
FT                   /codon_start=1
FT                   /gene_family="HOG000264830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639438"
FT                   /orf_name="MICPUN_54858"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68314.1"
FT                   /db_xref="HOGENOM:HBG559413"
FT                   /db_xref="UniParc:UPI000199C400"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF79"
FT                   /transl_table=1
FT                   /translation="MAAVSRALAGIKHPPRSSPRQMSRGRRSAVAVAAAKAPATSIASN
FT                   ANDAQEGGYFGSGFDAPNEYGYFESAITVAEQKRKDKLTEGGFKQIKGLSAEEEKARYA
FT                   RLCSKHPESQRCEEGFSQKYVTKPATTSKINGSLVRSDGIILVPGNREDLITYVLDPKM
FT                   SGDTIGLLIPTLFVILGAQLKKVAGVPEYVSGAVAITTKVVATGLIALYWLPEFTAGLV
FT                   Q"
FT   CDS_pept        complement(187481..189253)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639439"
FT                   /orf_name="MICPUN_54859"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68701.1"
FT                   /db_xref="UniParc:UPI000199C401"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF80"
FT                   /transl_table=1
FT                   /translation="MRATRELLRAFDIVASSPCRTAARHGSHRNTSWWRASTFAAGGTE
FT                   RPRWNPQRAHNAAALPPCVRVSSLTDARGDFDGLVPLLVEKIARSIRAVDGRRPVAVVT
FT                   SANDRDVLGMTLRRLADRPHQRGASDSRHRRREANGSTEYNDAPTRVFTAMDAALGPHR
FT                   HGEHASSHAVDAHAAMTTQLAATGKKAFAYDAKFAGDVDVDEIALRCAKRDWDPGDLEH
FT                   GEVEHDGARTRGVAGADFSSPGADFSPSPFGAVVVAWDGRDDSIFNRYLSLLPASESSA
FT                   RHASARDDERVKSGRVCGAMLDVVAVDAPAMLADFGDYGEVPSLAPESVARLRAADVVV
FT                   LHHVSLLPSSAAVEAVQRRVVDAVKSAPGDEKSAPVVPPGPVLVRTESRCEKTERLHRY
FT                   AGASPAHEWTPPPSRLRGARVLGMTACGKGDGRRRGFEALLRSLVAPADASDVNGYGLR
FT                   LRTTGTAEVLACDGEGADSGGGADSGGGAEGAEGTGAFAREFLARVVARFRQTHASSGD
FT                   VGGAEARVVLSERDAWRLLTGGSRDRIRDGLNFLSAADPLVLRFALQVETNGNGVEDGL
FT                   TSSLRSHLERCRDS"
FT   CDS_pept        join(189424..189659,189821..190394)
FT                   /codon_start=1
FT                   /gene_family="HOG000200948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639440"
FT                   /gene_name="DER1.2"
FT                   /orf_name="MICPUN_54860"
FT                   /product="Derlin-like protein"
FT                   /protein_id="ACO68315.1"
FT                   /db_xref="HOGENOM:HBG435574"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000199C402"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF81"
FT                   /transl_table=1
FT                   /translation="MAPAASPSDWYNSLPPVCKAWGTACFACTLFSQFGLVDLRNLYLD
FT                   WALVSSKFHVWRLLTNFCFLGKFSFPFLMRMMMIARYGVFLEQHTFAGRIADFVWMVML
FT                   CVLVLVPIPALVPSIQIPFFGPSLVFTLLYLWSRENPNANTSIMGMITMKAFYLPWGML
FT                   GMGLVMGQDPVPDLLGIVAGHLYYFLAVLHPRAGGARLIKTPDWVRALCYAAFGVRSAP
FT                   APSSYARGRDDARAAAGGVAANTGGGGSDGAPRRRAFTGRGQRLGGN"
FT   CDS_pept        complement(190655..191314)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639441"
FT                   /orf_name="MICPUN_54861"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68702.1"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="UniParc:UPI000199C403"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF82"
FT                   /transl_table=1
FT                   /translation="MEIGREGLRVRQTDATRNVLARAAAASTDDGTFASYAGESTVPFR
FT                   ILRRACEIARSPEGTEHPGTGGGGGPWLQDVVRGGGVQLVAPVPPARARALDAEISRLR
FT                   RDAHDREYAAMTRDVSHSNWGLGFRIPNENEKDDGRLRMSALTRDLGFGAHVLTVMFAC
FT                   ALGGWFAGDAIVRGFGDRFDDDSVTNTIVKASLAGIGAIGAMTVEALLFMLRDGRT"
FT   CDS_pept        complement(191741..192199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639442"
FT                   /orf_name="MICPUN_54862"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68703.1"
FT                   /db_xref="HOGENOM:HBG559416"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniParc:UPI000199C404"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF83"
FT                   /transl_table=1
FT                   /translation="MRASSALAASRRTRVGGARRHGLTVVARVANTTSPSGDAGDTRLS
FT                   SGVGGIVRSIRTNVSKNFNKLPWALVALLIGFAMTAYFPHPESPGDAPICLTIVFLAEF
FT                   LSSVLYSPKRPRGILKFLKLNDLVPLVLNNFKLGTLYGLFCDAFKVGS"
FT   CDS_pept        join(complement(195950..196036),complement(195708..195783),
FT                   complement(192737..195564))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639443"
FT                   /orf_name="MICPUN_54863"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68704.1"
FT                   /db_xref="UniParc:UPI000199C405"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF84"
FT                   /transl_table=1
FT                   /translation="MVAMTADQASIRAEIFQRLDAYLDKSRREGTLKSNELYELVRLTA
FT                   AFGVDGLPDDVPQDVAVRDILETELPPMPADDRPDSRTNERSSAFDYSPGGSASYAEFS
FT                   DGTLHLRDRRAATRRAHPDDIDEEERFLPTQAAIASTPRRGGDSHSLGIVSPNRESIPR
FT                   LSNHPSTPVHMGGFDLYERGVDAVHSATAAWRRSPSPMRARSPYSPAFAAGLRAASAPP
FT                   SRSSGQIPSGRLRTSPSSSIPVSLGFRARDDAEAAYVARIRGARSNPGPRWGGGGSDST
FT                   KRRPAWGGGGGAAASSRSTWGSDGRGSRARRLAAFDPDARARAERAAAVAAAAERKAVE
FT                   RMEAARSRRRTNGGGQSGGAAWQPLPSAGTTKPVPSPGRTSASSKSTSRWEESEKVEDR
FT                   LRRDWVLREARREATHAERIQLENERVKTNPFAVRHPTNASPARLAAHGRHLHARGEQR
FT                   RARIERAHASASVTQLASPPVGMGGEESVAFRGMTNVSRALMEDRAHEDFLQRQSSALK
FT                   KRDAKMEETRRVKEAEALKKEEDAMRSTPVITKTASAMRRSVDDLRAWQDRKNASVREL
FT                   RRRRDEYEDRVHNTFAPRMSKGSVAIERERRNAALGKYRPTGHSPGHSPVTSSHKSPVS
FT                   NDEPYRRERGHELFDDETSAGVTRGVTTGDAFSPEPRVRNLHTAPTPTPMTHRAGSNKG
FT                   GSSGADAMAAVLAGAAMAGAAALASARTTTAGGAKPEAAAAGARANTAGESGTFPPSGT
FT                   GRRTSTRNSMGTSIRNSVRVPRAAAGHYTRNPASVPPVAMTLDDERSVTFTPRITAMAA
FT                   SLRRSGDFGDRMHKAAVEAANERASASPGGTKRRGPRGVNAGARSSGVDSHRGPSDLPT
FT                   GGDDTWGPARLELTHASPVVSVGTPARARRRSSSVLEALARRKSVGPGSSPGLRGRSRA
FT                   TKRLDHRRVGDATATEGEGEYWTAAGEDSAGEFGDLGTDPDAFVATARRGRETDAAWGH
FT                   AMLREGA"
FT   CDS_pept        complement(202485..204341)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639444"
FT                   /orf_name="MICPUN_54865"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO68705.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG611295"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199C406"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF85"
FT                   /transl_table=1
FT                   /translation="MKRLSFINRGADDDEPGRAWPMATRESRRSSWRALLLVPLLVAAL
FT                   VLGAPAAADDDDDAEEFTTAQFLAPTDGSLVTFDPSTLFGALVNHTVVVAFTVEWCALC
FT                   TGYVPEFARVAAAFANANATDDGLTLPGDDDDDESGEAEETSRRRRRSRHPDPGSSSHK
FT                   KLVFGTVDAETHKRLAATFGVTNAPYVALLRNDDWYDRDTGVPHAPAPRFGGYLAFAPT
FT                   VEWLNAHLGTDVHAKPIVADLSTETIDAYVADPNADVLVQFYAPWCGHCKQFAKFYHEI
FT                   GAHFSADPTVKIARLDVDAHRAAADAYGVTGLPSLQLFPRGYKRRGLHFRGSERTPARI
FT                   ISFVKSPQVYLVDATVTDMPEWDCVLWLESRGVLGRGEISGRFGLTPEHLRAFESVARD
FT                   GTKGEGDTADGKNTTGDTSNTAGDTSDGGTTRRVSYDDIDSAADADDAARAMIAAAHSW
FT                   AGRSRWLETMEILTCVSHTPALRRTGIGSSPAMWNFLDNAKLHVEDPSLAGDSADDSGL
FT                   DGEDWDDGEDGGATGFAEAVAKAEAAAKRLEDGEDGKEDGKEDGVEDGSASFDWHAWEE
FT                   FTARRVGDSAGEHRELATEEFDDPEDGVDEGPTETDETRDEL"
FT   CDS_pept        204884..205630
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639445"
FT                   /orf_name="MICPUN_107458"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO68316.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG559418"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C407"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF86"
FT                   /transl_table=1
FT                   /translation="MLCDLASQDSVRSFARSFRRKALPLHGVLNCAAVILRPFELTAEG
FT                   RESHFAVNHLGHFLLVNELLPELIATSAVSGIQARVVNVTSAMHHFTYRVRRGRAGPSR
FT                   GIDFTQLDDPRGYDPINAYAQSKLANILHAWQLNERFRQVPRHQGGGSTFGGDTAGGDT
FT                   AGSDENTAVRPVAAFAVHPGAFGRELRDNLSRNLPFGAGDLLFDVARSMSLGLVKTPEQ
FT                   AAATVLYCACLGSVRLFFIFSACTGN"
FT   CDS_pept        join(complement(208078..208257),complement(207734..207989),
FT                   complement(206443..207461))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639446"
FT                   /orf_name="MICPUN_54867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68706.1"
FT                   /db_xref="UniParc:UPI000199C408"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF87"
FT                   /transl_table=1
FT                   /translation="MALLQYQFLMAKAAEYRAIAARQAMIANARLGGFPTFDPSSTTHL
FT                   TNVEKVRQIRQTRSGVRLLQQMQAQQMLVQQARPEASHARLVQQPEPAPRAGSFDDCTV
FT                   ARVLQDLKEDSPTHSGDGARLDPDSEDEAAEACRAAREEQRAALLLRSHPAHQSAAHPR
FT                   AYVKRHEFWARQAAESGGLDPSGFGTSYASEIERVLGKRRRGPGDDECDGTDHSSGDDA
FT                   DGLINNLSRKGKSEPDFDADLRMSSKVRSDDDAKDELAKEWAALTTWIRMNLHQPRTNK
FT                   RKVLFVGHHPRLHPVPGAEAAIAESFAEGEATRWRGRLGPSGEVIGGGDSRGGGSNPGG
FT                   GKRAKVSDNGSGATRKGRIDGEDFVFVLNPEIDWSDVNIDTRVRMRTLVAETMDIFKRK
FT                   YAKRKEHEWERKVQKYKPPGSRDGRTFNVPLGNVVRGIQETFYRHEPEARRAALERDEA
FT                   GAAQLAAAANIPGTKQPKTPSPPREP"
FT   CDS_pept        join(210557..212625,212770..213367)
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639447"
FT                   /orf_name="MICPUN_77912"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO68317.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C409"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF88"
FT                   /transl_table=1
FT                   /translation="MEARAATDPKVAAESERLLRELTRREQEGSLSTEGRRRPDESGAP
FT                   GAADQGKRGASERFDFDAGIYAQRKRLPAWSKREELLEAVRANQVVIVAGETGCGKTTQ
FT                   LPQFILDDAIARNEGGRCSLICTQPRRISATSVASRVAQERGEKLGAKGTTVGYKIRLE
FT                   SVASESTRILFVTTGVLLRRLAEDPLLAGVSHVIVDEVHERSLDSDFLLVLLRDVLPHR
FT                   PTLRVVLMSATLNAAAFGAYFAGAAVATIPGFTHPVQEHYLEDILQVTGYVPDRGSDCM
FT                   RNSKGNSGTNGDKRDGDKTAGASHRPHPAREAEFIAALSRRGYLPSVCDALRAIDQSVI
FT                   DYDLVTRLVEHVCASMEPGAILVFMPGLAEISKLHESLGTNPTVRAATGNGKYLIGLHS
FT                   TLSTAEQRTIFEHPPGDTRKIVIATNIAETSITIDDVVYVVDSGKCKENGYDPNTRMQL
FT                   LLERWVSRASAKQRRGRAGRVRPGRCFRVYTRQMHDEVFDEHTMPEIKRVPLEGLCLQI
FT                   QLQRMSGGIAGFLGKALEPPEEDSIKSAIKTLRQIGALDEKENLTSLGQHLASLPVDVR
FT                   VGKMLLYGAVLGCLGPVLTIAAVLGGRSPFVAPLDKREDADAAKRMFAEDQSDHLTNLN
FT                   AFNAWLDARALGKGAEMAFTRDNFLSFRTLEGIADLRAQFAQLLHEAGFLGTDGKRWGR
FT                   RGAPPPDDPIWLDANRNSNNTRLVKAVLVAGLYPNLVKVGTPHKPSAPPKLHYLSDEGK
FT                   EEMLQVHPSSVNYGAKRFGSRWLVYHERVQTTGVYVRDCSTVTPYQLLLFGGKIEVRHA
FT                   EGTLSLDRWATFKAPARVGVLLKEIRARLDGVLRDKIERPDEDVFASGGPVVEAILQLL
FT                   NTEPATAAPTNPNSVYS"
FT   CDS_pept        join(complement(214227..214751),complement(213462..214163))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639448"
FT                   /gene_name="IFT57"
FT                   /orf_name="MICPUN_77398"
FT                   /product="Intraflagellar transport protein 57 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO68707.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR019530"
FT                   /db_xref="UniParc:UPI000199C40A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF89"
FT                   /transl_table=1
FT                   /translation="MADDGELTVELAVEPEVGMELCLEKLKMLRYERDFLTSRRPPWPP
FT                   CTRTHFAVPTPGQNTNELFHHFTSLCAHLLTLCGRRFRPPDQFDDPNATCAAIFAELKA
FT                   CGFATPSFAPGKLRHGHGRECVGVLNGLCDLAMARHYQHGLSRPVYPRAGDAEGGDAVM
FT                   SDLAASDPSSALEEYAVASALDRDAPLDASLKKVLRKTEEEIEERRAIESAVDAREWRV
FT                   ELERVAAKLKAVSKEADAKDWRSNLDACRKAHAAVCAKFPDVRVALDRVGRECKEVVDK
FT                   IETRESYVNARMEPRSDEYKSTVVALESAQKEYDEGNERVSSLTNELARIGERLERAKG
FT                   EMASKGDEVSDATPLTKLRDVVDKMNEEMRTMEVKIAIARNALGHASMRRAASGGTGRA
FT                   GAAAAAAAL"
FT   CDS_pept        215082..216620
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639449"
FT                   /orf_name="MICPUN_98515"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68318.1"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="UniParc:UPI000199C40B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD21"
FT                   /transl_table=1
FT                   /translation="MATRATAHLASASHRVHPRRTAPPASTATPSAAARRSLHPAARRA
FT                   STDGIVTRAIGFNLSDRDEDTSRGDQEALALIEDAASVLFLQDPLRHECAQAYLALLQQ
FT                   ISLKAGPNKLFVAYGEFFRSLRRSGKASFADVVLDEIIAGRGNPVAVAVAAGANPADVA
FT                   PVDVAAVAADLELLQRICVSEATILKWCERLAAAASPARKQPASWVAAASALGVREEGA
FT                   EGGAEGGAEGGAEGERFTRPASVQLCASTRNAVAESWKWSDALDPHLMNHWRAHGVGEP
FT                   ALGNVLTWHNPKRGATRDVDPDSAFKSSDSSSSSNANGFCVNGVAWRTAPRAKDEAAHA
FT                   TLVSHFTAFASGDESAGHVLVHGAAGAGKRWLLMSSLGACLGVSSNDDPSAGVVGSRDP
FT                   SAGPSSRPSPLRVVRVPREALRQLPELCQFAKDHPRGRFVFLLDMPLALAPYAEFHNEL
FT                   TCALDGGGGGRWPSNAILAAAALEPTALKPEASSGGGGAANGGLACRFHLSVGV"
FT   CDS_pept        complement(216727..217527)
FT                   /codon_start=1
FT                   /gene_family="HOG000030826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639450"
FT                   /orf_name="MICPUN_107460"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68708.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG618881"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199C40C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD22"
FT                   /transl_table=1
FT                   /translation="MSAPAKTTARVLAFSARRSNGETRRPRAPTRATPASSSSTSSSDG
FT                   EVPRRAALLAPGVLAAAAAASVSAPPTARAALDPTSSLTRRGMAKFVQNDVEGSIADFD
FT                   LVVQNAPRMEPYMWQRGLSLYYAERYEDGAAQFRKDVAVNPNDTEEAIWAFLCDARDPK
FT                   IGFSRARLMRVGPDPRRYMRAAYDLFNAGDAASDVALEDVASLGPVDEFYSLLYRGLWR
FT                   EAAGDVAGARDLIVEATRTQYANRSGDYMAALALVHCKRRGWAT"
FT   CDS_pept        217795..218688
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639451"
FT                   /orf_name="MICPUN_107461"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /protein_id="ACO68319.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199C40D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD23"
FT                   /transl_table=1
FT                   /translation="MAAHTVVGVQASLAPRRSRVAPELTRRGGAPRVRSASARLTVRAA
FT                   KGDVLLEVKDLSAKVAETGEEILRGVTLTIKEGETHAIMGKNGSGKSTFTKVLVGHPSY
FT                   EVTGGTATFRGQDLFAMEPEERARAGLFLSFQSPIEVPGVSNTDFLRMMCNERRKARGE
FT                   PELDPLEFYGFLTPKLDQLNMDPSFLARNVNEGFSGGEKKRNEILQLAVMESEMSILDE
FT                   IDSGLDVDALRDVAAAVNVLKDGDKGLLLITHYQRLLDAIHPDFVHVMQKGKIVQTGDV
FT                   SIARKLEEGGFEALAA"
FT   CDS_pept        join(complement(218952..220061),complement(218805..218882))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639452"
FT                   /orf_name="MICPUN_107462"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO68709.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C40E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD24"
FT                   /transl_table=1
FT                   /translation="MFRDPVVVVESGHTYERSAVLSHFRCNGAKDPLTGRNLSSTKVMT
FT                   NWVVRQIVRGWLDRHPGVTPDGWDSRELLEPSEDDGTRLFDGESDVGVLRIWRAMCPAL
FT                   QERWPEDEQPEDWEGVTMENGRVVKLELERFGLTGAVPAEVGRLSALKTLELWQNRLTS
FT                   VPAEIGQLTSLERLRLHNNHLTSVPAEIGQLTSLKVLGLGGNQLTSLPAEIGRLTSLQE
FT                   LWLNGNQLTSLLAEIGQLTALEKLHLSRNQLTRVPVEIGQLTALRELYLQHNQLTSVPA
FT                   EVGQHRSLKVLSLYNNQLTSVPAEIGQLGWLKVLYLHNNQLTSVPAEIGQLTSLQELFL
FT                   YNNQLTRVPAEIGQLRSLERLDLNRNQLTRLPAALCKLRATCCIVRLDNRVTVDE"
FT   CDS_pept        join(complement(220675..221003),complement(220401..220608))
FT                   /codon_start=1
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639453"
FT                   /orf_name="MICPUN_77913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68710.1"
FT                   /db_xref="HOGENOM:HBG748961"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI000199C40F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD25"
FT                   /transl_table=1
FT                   /translation="MSDESAGCISPALARALSGALPARLRNSTWRLRYSTRRDGTSLRT
FT                   MYRAAGGARVGEHRCEESVLLVRTSRGERFGAFTTEHWRVAPRYYGTGESFVFVLVPGV
FT                   EEGAGGVFPWTQRNDYFVFGRNECAAVGGGAGFALWLDEELARGNSARSDTFGNDPLSS
FT                   EHEFDVACVELWTFE"
FT   CDS_pept        join(222303..222325,222467..223019)
FT                   /codon_start=1
FT                   /gene_family="HOG000160227" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639454"
FT                   /orf_name="MICPUN_107463"
FT                   /product="Predicted protein"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68320.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG559015"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000199C410"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD26"
FT                   /transl_table=1
FT                   /translation="MEFDLVDRGASSPEGNMKCVQEELKRKTLVMFSYETPDRTHINIR
FT                   LYDPDGGSIWNNSDTHRGSYAFTTKTEGDHKACFYKTTVDDPADLKHHKVRLDWKTGVA
FT                   VMDYEKIAQGKHVNKVADSLRRLEADLRDTHETMLWLRRKEAELRDLNEATNSRVTWLS
FT                   IMTLVVCVGLCVWQVMFLNQFFQRKKLL"
FT   CDS_pept        complement(223187..223744)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639455"
FT                   /orf_name="MICPUN_98519"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68711.1"
FT                   /db_xref="UniParc:UPI000199C411"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD27"
FT                   /transl_table=1
FT                   /translation="MSTPPPPLPPGCELANRAVQHDENGEWQLAIECYVRAADEIEAFL
FT                   NSGQPVPPNVDFAHHVAAYRTRASELMQDYSQEIAAQPGNNSAAASVSATASSMFQKFK
FT                   STAAKAASKTKETAIIVGNTAKSAANSAYTAAGTRGTFANKVADGVAVGLGRGFGWAFG
FT                   QNAAYAVSDALFPAPLRRRRWC"
FT   CDS_pept        join(224080..236230,236295..241090)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639456"
FT                   /orf_name="MICPUN_54877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68321.1"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniParc:UPI000199D58E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD28"
FT                   /transl_table=1
FT                   /translation="MFEGKLTSVLNKLLGEYVHGISAKDLSVAVFKGDVVLKNLRLKTE
FT                   ALNALDLPFVVRSGLVGKLSLQIPWRALGKQPVVATIERLYVVAGFADDVEGDDALTVE
FT                   ERTERWEKAKAALRRREIDEGETRWLESALAAEATRDDATKNEDAKGDGWLAGMLDTVL
FT                   GNLEVSISKIHVRLEGDLVETGSGNRPAGGASRADHRASSSGSTDSRGERFAAGATLES
FT                   LVINTVDASGAAAFTVGGLAERMRKSAKLTGLAVYFDVGADSLAPDTAGGWETVSPDAL
FT                   VAAMEPGVVVSNHPRGNGNDASFVVAPVRVMGPQPGSIDGSTGSAAAAAEQANRRQYLL
FT                   EPVSASAYYERRGKREPAARNDVPGSSLAPNGGVPAQRIHLRIDSVAARLTSSHLRAAY
FT                   VAAERLERDARRAPHAHLRPRGSGPSSIVSDDARFRGESGARAWWRFAVAAVTLRIREE
FT                   TLRAGGRYRSSFRVDEVVRAMRARREYVESYVQNAIAPHPRPMTKKKPNKRWPPSMDVG
FT                   SVPAMDAVEARYPAHVCVLFRAIAHQQARRRGLIRDVDEDDGGGGGVAGGFFRVFGFSG
FT                   KSSREKQLESSNSESAEEGGDADMSEDDWAKLDAVFDVGARAEAATDDTHGGELATAPQ
FT                   SEATIAVGSVSLKVVDDEAETCDADDANDENRANTSTSREVLNASVTGLVAGARSFGGG
FT                   GADARCDLRAMDLDVGGAKILRSAGAKSASSLDDWAPATGPGGSRSSSEAPGCVTASRV
FT                   AAALWGRASGAGDSPAGGVESGDEDEFVDASDAAVEPPVDDSMDVNQTAVEPPEALSLR
FT                   FEKLAKAPSRNSGIDDPNGSPSRPDVRVGIELAPARVTLLRAPVQALVRTLTRHKPAQL
FT                   AEQEELLRRAVARGASDAARGAREALVAALADRPVVDVSMTVHAPRVAVPSRYLRTSKE
FT                   VPTEVPSGVRGVHKEVSNDDELDAENDDDDATLLLDLGRFELRTVPATDLGADARDAKL
FT                   FNAFRVKISDVAASLLPGGWDPNGSWRKVTGGGAGLNSDLFQPSGPRSLLPLLPPFGAE
FT                   ATALQALAPVPGRASMEISFRAGALRAALSPARMRQLEAVAAQMSDVGEGTVSGTVPGT
FT                   VPGNGRDLDDDAASASGSDVFSDVGSSVDVTHAGSVAVKAARVSVLKVSLGRLRWVPCA
FT                   IRVDEPTNSLVLFDSKGKNVFPPTSLSGRGAGAVRFSKRAAVGQPNAIVVCDGARRMSE
FT                   AVAAMRAAERRRRSSSGEEANDGNGGGGDGGDGEDVCLDRVSAVARASRIIRFRSEEQS
FT                   VRWRDLINDAASRAAGGVDRPPSGPVASPEEESARTDVDDAGGTAIKIHATLAELSVVI
FT                   AAPLTPFGPPEESPIPAGTGIARANSSASAGSLNSSNSDVFYDADADADEWWNSAAGSE
FT                   PAEATGSTSRNACNVPERALVRLVLSRVAATVVNGAHDLDVTVSLSSLTVHDAHMSEKL
FT                   GRPCRLLTSGAATAVGVDGSSFGSSPEAIGSSPEAIGSSLVVRYRSVAERSPEYRGVNS
FT                   EVHAALGPVSLAVRRPSIAALAALPSLMNPKTTPDDDFDDASGGAHEVSPGGPDFGGGE
FT                   AIAVESGKRRVAMRINARVDALRLALLLDDALEDDAGGVRVPGPGRGGDGGGGGGFPGG
FT                   YMTNPGCLAEAEVSSLVALVSLYPSTVAAEFTLGSLTVCDPRLPVDHPYRWAVRAAAAN
FT                   AANAAGLEDGVSYVSPPGGPLVEVSYETFDVGTEADGASSSVSARLRPTRVVFLNRLVT
FT                   ECRAFVTGLVDGIGEADEGGKESAPAKAADGEVGGSNPGRGGGEVNAVRLDVALEAPTI
FT                   VVPRSTRDTSLALELDMGSLAAKNTLEVDKASPSRVVDRLAVGLSGVRVDVVRNGDDDG
FT                   GTTGRGGTGRGVTGVTDRTPLVREPASIDAVVWRVLADSSPQKPSPHENAQSAAHPRVR
FT                   TSDFPVVVSDDDPDIALEVDVAPLRLDLSAEDYQLLSTCFSDNLTRDAPAEIPKTTNPV
FT                   DKRALSNARRRVSDTMYGRHTRRTTTYATAQSGFGVDAGAQLLTLEEDAEEQYHEEQHH
FT                   EEPDDEVPFDQRRRLGRGAAALRRLPPGLAGFVPVGPSRVASRIAARVKLVELSLFRGG
FT                   GRGEPLASLSVRSLFAEVCAFDGETGTSTTHATIGALAIEDLRDPRARRRAVRGGYFPE
FT                   NVSTSPEESTSTSASESVSGTAVDRIPAPLLAYEQTKGPAVNGSRGSATLQRLRLEVEP
FT                   TFLLDVARVFVPTLAGGGGEAPELVLPDDVRMTPGETYVLDRDVALNGKNRRILADGVD
FT                   GGVYVLDGRGHAIAIDADGLVGGNGDGGGGGDGDEADFHPVIFVGPNCSLTIKNAVIET
FT                   SSSRGGGTGAKKGPARGKALWPRLVRLAPGGRISASSRDKVSFASSHGAAVAPDKVTDT
FT                   DKVTLVDGAKTSAVRGLKPGDRSSLSIRVVGVSLRLIGETRGDERDAIDLDFGLAASVH
FT                   DEASDVAVKRKDEADDVGRLSDEDEDEGVVETDVQVQLLRVGVSRPEWDAGALRWIERA
FT                   AGDDVLFPVDLTFRMISQANAATGARRRGVDARVTVVSGPTRLALSPSKIATLTRVSQR
FT                   LAAAVASSPARPCGVFAPVWSSYSYYSSDNGVFRDGVSGAASGAASWAVWRPTPPAGYA
FT                   PLGDCVSFGGDKPPTEPVLVIRDSPAFTAAPVRFERVALPDAAIANGVADGLALWRPVP
FT                   PPGFVSLGLVATSIRAGDHQTADANGVKDEDQTQHDPRRDHPHGLPNPPPADCVRCVRV
FT                   ELACAADGVFGRVCAGVGDPPAWIVDNKARTLVAGSSLASSASSSSALGPSFGSFTACF
FT                   DLRSPTGLPGDDVSGPSGASNKTNVDADETDKGRTGHSASLGRSSGRVFGASERRAFGD
FT                   DAPATATVVEFTRVWWDFNSGARSRLSVWRPTCPPGFVSLGDVAVAELQPPASTVVVQM
FT                   RRVDRRRRRDSNLRPPVAWPVNWEMVWRDSGWRAQGKKAGTISFWKPVPPDGYVPIGHV
FT                   ASASHAPPPLDTCACLRADLATIVPREAFERGPAWTPSGAGFKLGRKPLAIFRAANAID
FT                   LLSSSPPPDGRSPNGGCADPFDRDYLPLGTFHAVNGEERDVGGARGGGLAPPDVAYGLP
FT                   VSKWVKPSDGASFFFQTALSNPALSTATPPPGTVATAAMDLLDATLYVDDRGNDRGVIR
FT                   NGRNDGQGSMFPTPLARLALRRVNVDARLSPSIAAEVTATADVCHFNARTAAWEPVVEP
FT                   WALAARYEQAKKRLPDASEPQSFGDMRPTGSTIQVSGSTPLRLVVTDAFAEDVAKASKS
FT                   SLRTVATNGRKRSETVGNGQSRTGAVNATGRTLWVAHGSSSAATEVPPDGVIPHVLGGG
FT                   GSGGRGRGGGLDGDDDDRYDDRYDDADPTYLLVEILETEEGTPEESAGSSSAKAALVPA
FT                   PRDAFRVALVEGGDSLGASFLPAGETRGAALVDVSNWRSAARALADRVRGGRVPEPPPL
FT                   RVEVTLAPAHDAAVAAALAGSGLDTFTARCVLEYDAGAMLNDALQTKGGSKTSRLNGGG
FT                   WFPSERGEWREMRLARRDVTGGADGEGGSSDVNDARERRKPRIRVRARLAEGLDLRIPR
FT                   RGGGSDREEDAGDQRVATVGHTIGHTVGHDIGHTVEKVVSSSAASSFGGEGLRLVRVRQ
FT                   LELVWWSRNSGAACEASAWAPVCPPGTVSLGTAIVPSFRAPTEAFVVRAPWLTTATATA
FT                   SASGASPMEDPSPIDPSPPTDWRSPVAPSVGFDRVYGDSGSRLKKNPGVGTVAVWRPRA
FT                   PPGYVAIGNVVTPNHHPPNPTEIACVRADLAQPSAPAPAPLWTTAGAEAKLGRVPLAIY
FT                   RTGVCAGAGWMAVASRDAADVTQVPPPYEIRWDSFDSPSGVRVDDEDERSGGSGLGAGD
FT                   WSETATAASSIPRIALSPNGPWVPVGARRLGAAAAAAVGAGPARCTALVFDRRGGCVRG
FT                   PCVLTSTLPLALEVRTVPIAHGRGSASSSLPDSGLARSSKQSASVEESVFESERFFPFV
FT                   GWQEPKGQLDEFFTARFSRGVSGKASTSHFPDVPLPEGWRWDGAWNADTPADASVDGAG
FT                   WAYAVNWTREWPPPRGSENRGLCATRRRRWRRTRVPVGSSSEVGSSSSSVREWRGSIGP
FT                   AASGGSGADDSSRSTPLPVGCGGHRCGGDETMGLDLRLLRSPGPTGESPPGESPGGESP
FT                   LSTWGTRCAHARSNLWPIRAGSLGRKNKECGFNAQGPWLAPCGADPNDADLNDGGTNEP
FT                   EGQTAKRRTRFVVVVAEPDAGVTVAGSDALGGGDGASSCAWRLVAHPPLSIQTALPCDC
FT                   EYEVIDASDGSVAARGVVRAGAREPVLGVDPTSPLRLRLEPLDAPMGDGESTGRRSRVP
FT                   FAFARCRGTVPVNDPVPGGRRTTDRSPAVHELLVSPSDTLSDTSSGDNLIRLAVTCEPA
FT                   CATHGSLSGPAPILVDVRAPLVVANGCPFPVAMSGFDLVPTRGLRAAGADVVSFTNVAT
FT                   TSSNSGVNSRGTTHGFVVVAPGRQTMIPTDPRGGNREGKNNAGEEDLRRTVYVARAGHG
FT                   RAPTRVEVDPRRGIARAAVATAEGVVEIVAAASVWAPPGVTAASATPAVRVTIVPAIAA
FT                   VNLSNVTVAVEAAGSGTPRDLAPGAGPACVFRSPGGGGASEEARGGRSKRSKRSKRSKR
FT                   SNEGGAGDTDDDDWDMDVRLSARCAGSGHAWCPRMSVARLASMNGGAWVRLPRLDADDS
FT                   EPANFSLAHVSVESRRGGVEGAALLVIRGGYEASAVCSGASVRVANKTLDKDHRVVSVR
FT                   QVARRRGGNLNGGPWEPQGPWLSVESGRSVPWALANPLRVDDVEHGFTRMHPALGSVAA
FT                   AGSNSSSRGPALTRRLNIAEISDGAGDPNWFGSDSDPEGDGDGDGDGDGDGDDDDDEEY
FT                   VDLGAAAAATEPAHVEVVVGSDPDDPRAPRARVPIPALPTAPRRAAAGRARPGEARGGR
FT                   YERRVHAAYIRLGSALGEDGRVREGTLYAVRRRWDGGACVIEVSPAAIDEDGEGREEEE
FT                   VLEQTEEQTEEEEVGNEVGSSSSPEDLSRRIDESVLEVSLPTVSVSLVDDGDERLLWSL
FT                   DGIALRSGSRLGVDGGGAFTELRVLATQVDDQHPHTAFPVLLYHNPRRGALLDLAVTST
FT                   PPLDESDASHPGLCVNVTPGGLHLRVHEPLIWRLRAFIDKIAGGGGANGGAANGSRTGP
FT                   DGGGDGAMIRGEGRKTAAVDDPSMSLGLLRVSSVAVRLTFKPTPRSRPSTVGPALASVL
FT                   AFLNLDRLPITVGAFVRHRARLKRSDIARQVVGHVKGEAVSQFFAVLSSVNHLGNVAGT
FT                   LDQFGDNIRRLGNLGLKDAGDATNDEGGGGGGGDGDDDDDDATTKDAEYPYAGAAGFLV
FT                   GGRAGGGVVAAAVEKNVITGALTGGSELAMNVVGGVGGIFTKSAAGFQRSGISGLASGT
FT                   ARGIGGLVAGAAAGAVGAVARVVEGVDATVGAAQDQVKGGADAAAAVRRRLPLATRGDG
FT                   IVRAWNENDAAGLHLLRVASRRDSLGVRRFPFAGARFEAALPLEEESNGVGATRGGGDS
FT                   RVVLLSHRHVGCVATATGVVEWILPWARVASVGVDGDVVVVHARGAVDGGGDGGGDAFG
FT                   GVLGIGSVGKTSGGDVDRAKRFARCGSADRARVVAERTREAWAAHTARGGATGGGGI"
FT   CDS_pept        join(complement(244099..245197),complement(242625..243106),
FT                   complement(241320..241667))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639457"
FT                   /orf_name="MICPUN_77261"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68712.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C412"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD29"
FT                   /transl_table=1
FT                   /translation="MENGRVVKLELEEFDLTGAVPAEVGRLSALKVLDLRNYHLTSVPA
FT                   EIGQLTSLGVLHLDNNQLTSVPAEIGQLTSLTHLYLGCNQLTSVPAWIGQLTSLTHLEL
FT                   WSNRLTSVPAEIGQLASLEKLHLEGNQLTSVPAEIGQLVALTELTLYGNQLTSVPAEIG
FT                   QLTSLTDLYLGCNQLTSVPAWIGQLTSLKELTLYGNQLTSVPAEIGQLAALQWLSLKDN
FT                   KLTSVPAEIGQLRALKLLRLNGNQLTSVPAEIGQLASLENLLLGHNQLTSVPAEIGQLT
FT                   SLRKLYLDHNKLTSVPVEIGQLTSLVRLELEGNQLTSVPAEIWQLTSLKWLNLGYNQLT
FT                   SVPAEIGQLAALKELCLYGNQLTSVPAEVGRLSALRKLSLSRNRLTSLPAEIGQLTSLR
FT                   ELRLSDNQLTSVPAEIGQLRALKLLILLGNQLTSVPAEIGQLASLVGLHLRDNRLTGVP
FT                   AEIGQLTSLEWLYLAENQLTSLPAEIGQLTSLVESLLGGNQLTSVPAEIGQLTSLTHLD
FT                   LVDNQLTSVPAEVGRLTALRELNVSRNALTLLPAEIGRLTSLKGLYLDENELTSVPAEI
FT                   GQLTSLQELWLNDNQLTSLPAEIGLLIWLHILRLGGNQLTSMPAAIRKLKAAGCHVDMD
FT                   KGVTVDE"
FT   CDS_pept        245890..246447
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639458"
FT                   /orf_name="MICPUN_54880"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO68322.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199C413"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD30"
FT                   /transl_table=1
FT                   /translation="MPTPVEPGGDRPPDSANKNTRAKEAATEPATSVKPVTTLAVTTLA
FT                   VNSTAPGTTNLKKRGRGRPPGSKNKKGTASAGVATPASNKRPRDVWVVESSKVTFDRRH
FT                   DCIEYKDIHGVFASLRAANVEARKIQAEEVDGIDEEYSGNIQEVEKIDSDDKPFYYSHL
FT                   QETPGYDTETTTTIEVRQFPLR"
FT   CDS_pept        complement(246795..247967)
FT                   /codon_start=1
FT                   /gene_family="HOG000100152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639459"
FT                   /orf_name="MICPUN_77758"
FT                   /product="Choline transporter like family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68713.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG608013"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniParc:UPI000199C414"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD31"
FT                   /transl_table=1
FT                   /translation="MFALTISFAAAGATVPAIIFALLTALTAFVFYLWRDELNLVASLL
FT                   AVSTKGLRDNPHIVTAVVGLQLAAFAWLVPLVGFMMFANMNGAVAVSRDAVARDASSGV
FT                   CVDGVGAAVDCCAWETEAWVPPYLFLAAVSGIWFVSAALETRLFVIGGTICQWYFAPVG
FT                   TSDFSGGVRRALGHALGPSFGSVCFGSFVLTMVELARSAAERLRREDRDNILVCIIVTC
FT                   LECVYAIIEYISKFAMLQASITGEAFCEAAASVTDLLSRNFLTAYGTYAFPGMILQGAS
FT                   LVIAVGFGCATWLLSYGVFAATLAANAGLYAGLVGILSAIISLVVMSFFAMIALNVVDA
FT                   VFLCYAMDKDRNSVHRGELHAVLHEVNEKNQPQGGLVRNPGGQYAYGSYA"
FT   CDS_pept        249368..250111
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639460"
FT                   /orf_name="MICPUN_107465"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68323.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="UniParc:UPI000199C415"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD32"
FT                   /transl_table=1
FT                   /translation="MAAAASVSGACSRAIAPVSVRVTSRARAAAEPRRARAAMPAIRAQ
FT                   KLNDGVVPVAVNTTHGPMGLTSALLLDRIIIIGDRIDEDVATRVCAELLALSYEDPDKD
FT                   IRLFVNATAGTQYCVQTILDMMEYIQSKGVDISVVGMGCVAGPPAMLLAAGTKGKRLAM
FT                   PSCRIILSQPLGGLSGTSYEVRIQAKELSRNARMQVAVFAKFTGKSFDDMGEYLVRDTY
FT                   MSPQEAKELNLIDGVIGVNEAKKAR"
FT   CDS_pept        complement(250255..254676)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639461"
FT                   /gene_name="REX"
FT                   /orf_name="MICPUN_113163"
FT                   /product="Exonuclease and DNA helicase "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="exonuclease activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68714.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG559019"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199C416"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD33"
FT                   /transl_table=1
FT                   /translation="MSGRATIRAEVGSMHIVHRASRAAASAARAVSRVSSLERCSVAVI
FT                   PTTATTSALGAGTGPVPLPLLGAATRRRRWLAVPANAASPQHAASANANDKQATASSSL
FT                   ASQLRAGLDYELRNGCPNARGKQYDDFQQFLLSHLGRLGAACDVSGEGALAAELAAIAQ
FT                   DARRYAAMDAEHRDGLLRRLGSTLHHSQQRRRANVSQPQAPEAPRAWRPPSRDAPQRAH
FT                   EPKQRASSAAQRRAAMDGRSEGNPEGTAASAAGLDLGGGRLNLKPPDVIVPASAAHRQQ
FT                   QQQQQQQPSEVPCVVVFDLETTGLNKDRNRIIEIAAVNVSDPTHQPMSTLVNPGRFAVP
FT                   PPVVALTGITNAMVSAPAVPSFQRAAELFQEYIDEARRRCGGASVLLAAHNARQFDAGF
FT                   LQAEYRRLGRELPEDWRFVDTLPLARKTLAKEAVPGGSYKLESLAAHFGVDTAGASAHR
FT                   AEADARMLGDVLQRLVGCSLEGTAGTSIAADDVEHSELAEALSAMKTYSFSMGDPAKNS
FT                   LRRQMGSLGSASSGDALKSHRGNGPARWSSQQQQQQSTALGFGATSIVTSDGEDIDVES
FT                   SANIPESELDDLTYSDDGDEEDDSSSAKAEAFFAREEKELERASASASGKPEKRPFWIQ
FT                   ADPINGFVPETMDFARMVEADEQAAAASAAGAGDADRSELHALHAKLRTDYGSWEEIPV
FT                   DTLKDHGVSAQTVNKLRKAGVLTVEQTLRCYPRKYQEFARFHAGMQAGTAVLVTGRVVS
FT                   YLKAPYSRKGWGKTPSTLLIECDDGEGNTEQFELKLWEYVQKETEAGLTPGAPVAVRGA
FT                   LSTRTGRGHLTLDKAQLAAGVNPDAEVDVVTTYPKKHDIAPDRWHEVQTAAVKALKDHI
FT                   PADPMTVSLGTESSVLPELQLISHVDAMQFIHAPATVDQVVAARERLAFEELVLLQVSL
FT                   LQERNRAQRSGGEGVSIVSTSMCDELRGVLDFSLTRGQETALEEILQDMSGTTPMLRLL
FT                   QGDVGCGKTIVAALGLLAAVGNGHQGAFMAPTEVLATQHATTLENVFGRLENPPRVVLL
FT                   TGSTPKKERDAALRLIESGEGQIVVGTHSLISEDVVFKSLGLAVVDEQHRFGVEQRAAL
FT                   AGKGPVGGKVRRKDLATVAGPSEKEGWENRKRADEREADGDESDRAAWAAAGDDATETT
FT                   TVTTTVTTDTTESTDDDDMVEWRHAPHVLAMSATPIPRTLAMCKHGEMALSSIDEKPAG
FT                   RLPIYTKLLIGPDGIDDAHRAMVEEVQTGGQCYVITPLVNASTADSFERFKSAEVEHKR
FT                   LVEKFPQIKFGILHGQMNSEEKAAALKAFADGHTQVLVATSVVEVGVDVPNASVIIIED
FT                   ADRHGVSTLHQLRGRVGRGSRQSKCFLLVGDEAGYPSQQRLRVLERSNNGFHIAESDLR
FT                   MRGAGDLLGTRQSGSQVSLFHASVATDLFLLEAARRAAAETIARANVRGENLPAPLAIA
FT                   LKDRPALVDLNV"
FT   CDS_pept        join(254988..255055,255223..256204)
FT                   /codon_start=1
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639462"
FT                   /gene_name="FABD"
FT                   /orf_name="MICPUN_113164"
FT                   /product="Malonyl-CoA:ACP transacylase "
FT                   /function="[acyl-carrier-protein] S-malonyltransferase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="ACO68324.1"
FT                   /db_xref="GO:0004314"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="HOGENOM:HBG687898"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="UniParc:UPI000199C417"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD34"
FT                   /transl_table=1
FT                   /translation="MASMSAAALAPVVHNTRSSRRSRSSVRARAAHRATVAAADYSPKN
FT                   AFFFPGQGAQSVGMAKELCDECPAAKALFDQASEILGYDLLDVCVNGPAEKLNSTEVSQ
FT                   PAIYVSSLAALEKMKTTDEGKALIDSVDVCAGLSLGEYTALTFAGAIAFEDGVKLVKLR
FT                   GESMQAAADATPSGMASVIGLSSDKVDEVCAKASADSGGEPVQIANYLCNGNYAVSGSI
FT                   PAIDKVAEIAKPEFKARMVVKLAVAGAFHTDYMAPAAEALTAGLKDTPISAPKIPVISN
FT                   VDVEPHGDADSIRATLAKQLTSPVQWEKTMTTLLEKGLEASTEVGPGKVISGIMKRIDK
FT                   TAACDNFTV"
FT   CDS_pept        complement(256414..257781)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639463"
FT                   /gene_name="ELGR"
FT                   /orf_name="MICPUN_113165"
FT                   /product="Splicing RNP complex component "
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO68715.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI000199C418"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD35"
FT                   /transl_table=1
FT                   /translation="MADDEMMTDAPGGDFNWADEVTAEHAASGHDAAVLEAERVKAKKR
FT                   AERFGQEYKEPKANVVARGLMSRKEVLAMRKEQALKKMNRRGEFVAGIDVFDPEEEAKR
FT                   AARAAKFGTNAPSALTPEQQAIKDRRDAQDAQRLVANAAALQEAYADAMDDGTGAIAGS
FT                   ADVAQDFFESRVDPEVDASWRSDAVHLYGVDHMTTNECMGYFHEYGPVFVEWINDSSCN
FT                   VVFNDEHTARRAIRMKGVAMGAEANPDGGLALPAGTCAEMLWHSGPEFRKDGRVIQLSF
FT                   RLATEEDVKPDGEARSRRLWRGGRGKRRRGGGDRHHPYAGDGGGGGGGGGGGGRRRRGA
FT                   RGRSDRGGGMRAYDDDDDDGGVADLRERIRRRRRDAEAAGERDAGDAEAAGGVDGTVTG
FT                   IGTETVTGIGRDARADADDAMRGAVGMMRGALRGATRERATEPPRLDGSLEGDAGV"
FT   CDS_pept        258399..260411
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639464"
FT                   /gene_name="BRAP"
FT                   /orf_name="MICPUN_113166"
FT                   /product="Brca1-associated protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68325.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG604662"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C382"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD36"
FT                   /transl_table=1
FT                   /translation="MSALFTLRVSVPGQCDPPGSTGERGDADVGRGGDARSRPGLEDRP
FT                   GAPRWETLEFRAGNPRAEIITGRIRLYRDAIRASDASASPSATTTSAPATSLPEGRSPL
FT                   VCVLAVPIELSVADFCQFAAAIINKVTEMRIVQAAPRAIRTGADDDKAAKDREKGRAKA
FT                   AEQRESEPADSSSAFSAGQSSYAVILSFEDQDSADSFALNYHNRRFSSLVEGECRALFV
FT                   RAIELEGKDGEPVDLNSRLPSAEQHLSELPSCPVCLDRLDQDVSGVVTTVCSHSFHATC
FT                   LSGWGDSSCPVCRYTQNPEEEARCQRCGRVGDLWACLVCGAVGCGRYARGCSLDHWNES
FT                   DHCYALELTTQRVWDYVRDGFVHRLIQSKTGLVELAPGGGGRGSRVGIRSGAGARGDEG
FT                   SEIVASPPRPRRRGKGDDGGGGKRESGEVDAGTGGGANGSRRAGRDARVTTHGWLDEGL
FT                   DEYDADYPLDEGLEEALVSSKLDAIHTEYNALLTSQLDSQRRYFEGLMAANNAERDGAL
FT                   SAKEAAESRARVIAGAVDAARDARAKLQEAHAKIDDGLAKNAKLEEERDFFKQLNDTLL
FT                   ENQRQLRANLDATEAKLNEANEANDAKIRDLQEQVRDLMVFIEAQSKLAEGTEGGDSIE
FT                   GGDVVGVSDGDAAPSRDAAHARLQSKLRARRKPGR"
FT   CDS_pept        join(complement(261690..261761),complement(260755..261555))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639465"
FT                   /gene_name="LCO1"
FT                   /orf_name="MICPUN_107466"
FT                   /product="Low complexity orphan protein "
FT                   /protein_id="ACO68716.1"
FT                   /db_xref="UniParc:UPI000199C383"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD37"
FT                   /transl_table=1
FT                   /translation="MMGVSVVGNHVGTCANAIVKGGGKALEHTTSKGAAQRRRGAGTLA
FT                   CGALAATTTAVAVAHPARASAAPPPTKPAIIPILSHEIYVDKQLIAPTKSGRILRRRKG
FT                   SGGSGDDGDSRGDDGDRWNLDNGDNGGFNGGGNGDDDSNGGNWNGRWGGGGGGDKNNDG
FT                   SGNDAGESGDDFEDEFYRRVRMRGVDDRGVMWLWQTLCAATLAGSVQHALERGDRLRLE
FT                   AAARLLNPAESCAAAAQSMERAITPTVRLANASAQKGRRMALTASITRAHLSRQPFAAM
FT                   AGECAAGWH"
FT   CDS_pept        join(262244..262279,262378..262434,262497..262556,
FT                   262652..262936)
FT                   /codon_start=1
FT                   /gene_family="HOG000082123" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639466"
FT                   /gene_name="RPL11M"
FT                   /orf_name="MICPUN_113168"
FT                   /product="Mitochondrial ribosomal protein L11 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68326.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI000199C384"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD38"
FT                   /transl_table=1
FT                   /translation="MSGRTILATIRVVIPAGAAKPAPPVGPALGQHGLNIMSFCKEFNA
FT                   KTAGFLPEVPVPVMITAFKDKSFEWKMRTPPTSYFVKKAAGVSSGGGRPGHGMTAAISL
FT                   KHVYHIAKLKQQDEGSHHIPLISMCKSVIGAAKSMGIEVIR"
FT   CDS_pept        join(complement(264761..264894),complement(263101..264607))
FT                   /codon_start=1
FT                   /gene_family="HOG000243854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639467"
FT                   /gene_name="TIP1"
FT                   /orf_name="MICPUN_113401"
FT                   /product="Palmitoyltransferase"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO68717.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG319620"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C385"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD39"
FT                   /transl_table=1
FT                   /translation="MADSAKPEEQPVDDVWKAAAYGNLDRTKDFIQTDPQLVNKPDATG
FT                   FLPLQWAALNNRVAVATFLIERGAAVNATDNDKQTPLHWACVRGSLPCAELLLRHGARL
FT                   DQADCRGYDPIHVAAQYGHTGMIYHFKMRWNAEIDSHDSDGRSPLHWAAYKGFPDTVRL
FT                   LLFADCHIARPDKEGCTPLHWAAIRGKSEAAHILAQAGGVALLEARDAEGSTPAQLATE
FT                   KGHKSLGFFLANLQARLGKRSFWEEKGMAVVCLSLILGLVVMFVHLIVMAPGMTQMDVH
FT                   AAGWSWIVVLTSGAGLYFMYTVSYCDPGFLDTGVKGHGNGIEPGSPVVSGKLCRNGYGR
FT                   VSSNEASSKLNAALNHPELWSGNWGSMCTTCRIIKPWGAKHCGVTNRCVRRFDHYCPWM
FT                   GNTIGKRNHRNFVVFLCLETVAMAAAFGVALQRLRQGGPTPPQWTYTGVVAFIVCDVAV
FT                   LFPVLMLTGAQLSQVFRNITTNELSNAHRYQWLKDDNGRFNNPFDRGCQSNTVRFCQVV
FT                   EDEEEIQRRVVMSVREMGEMLKEKGENMV"
FT   CDS_pept        265583..266764
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639468"
FT                   /gene_name="NifU"
FT                   /orf_name="MICPUN_113170"
FT                   /product="Iron-sulfur cluster scaffold protein, plastid "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ACO68327.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="UniParc:UPI000199C386"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD40"
FT                   /transl_table=1
FT                   /translation="MSTSFAAALASIVPPLGLTIDRRVNTSRAFPSPKYPRRVQSKAAA
FT                   STSSDPNPTADPAEVYAVGETADDGEHIVSAAAWVVARQSSLDPDGRCGVFAMYDPSDN
FT                   MLYAGYAKDAISAVRTYVEKGLGARVRVAIFANRATATRVNLRAEQDRWIGEWIDSNGG
FT                   GETAIPPGNTAAGAADWTLPAEDWGEQPASSTAAAPRPKVDGDGNVVSPYAVTAAASVA
FT                   AAADVKEELDPNRKLAELTVENVDAALNEVRPFLAADGGDVEVVGIEDGIVAVRMFGAC
FT                   GTCSSSTATLKGGIEATLFKVFGREAIKEVVNLDQGGEGGKGPMSLSVEKMEEHLKKLE
FT                   GAIHNYGGSVKVVEVESGVVTLAFSGPLALAQSVASSIKGKFPLVKECKITQV"
FT   CDS_pept        268612..269004
FT                   /codon_start=1
FT                   /gene_family="HOG000100757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639469"
FT                   /orf_name="MICPUN_54891"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68328.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C387"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD41"
FT                   /transl_table=1
FT                   /translation="MRRETDKNNKYKAAATAVHKEFIPLVMDTYGRMGKPFLNFLKDVA
FT                   ALTARRASGNVNERTQAIYDSIDSPNELRNRIHLRNLALVHVALIISLMQRVAGSTVTN
FT                   DRQHGARGGMYGAHEHYVQPYPVTNS"
FT   CDS_pept        join(269154..269324,269390..269449,269513..269674,
FT                   269730..269897,269953..270039,270099..270174,
FT                   270239..270278,270365..270466,270571..270631,
FT                   270721..271064,271129..271342,271408..271635,
FT                   271692..271850,271909..271986,272055..272105,
FT                   272185..272250,272313..272405,272460..272543)
FT                   /codon_start=1
FT                   /gene_family="HOG000224125" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639470"
FT                   /gene_name="PRL"
FT                   /orf_name="MICPUN_113427"
FT                   /product="Minichromosome maintenance Mcm7 "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68329.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000199C388"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD42"
FT                   /transl_table=1
FT                   /translation="MSNPDYIAEKGSSRPRSRFVYLLNIRNHDFSPEKCKVFLKTFTTT
FT                   CTVGEKKYMNLLENISRRKSDALDIDLADLQEFCAEEEGFGSFYDNLLSNSRRYVSLFA
FT                   EAADELMPRRASDLMDEDDTFDILLQQRENVEANTDDVHGSNQGLPNLLRRRFRVYLKP
FT                   SVKSEMRDLRSIRAADIGHLVTFKGICTRVGDVKPLIEVACLTCDSCGFEIYQEILGEA
FT                   FNPISKCPSGVCRSSSNTKDLFLETRASKFTRYQEVKVQEMSEHVPVGHIPRSITVQVK
FT                   GSLTRRVGPGDIVVVTGIFLPKAFTGFKAINAGLVANTFVEAMSVTQSKFRSLDSCASS
FT                   DMMDTLHRYRKHPDVYGRLAQSISPEIFGHEDVKKALLLLLCGGVARRLLDGIRIRGDI
FT                   HVCLMGDPGVAKSQLLKHIVTVAPRGVYTTGRGSSGVGLTASIQRDTLTGEMILEGGAL
FT                   VLADNGICCIDEFDKMDESDRTAIHEVMEQQTVSIAKAGITTTLNARTSVLAAANPAYG
FT                   RYNLAATPQENINLPAALLSRFDLMWLILDAASADTDMALAHHVIHVHREGRAPGLSFD
FT                   PIGPVELRAYIAHARTFRPSVPGELADYIASAYAEMRQDELDAGELAMGYTTARTLLSI
FT                   LRLSEALARLRWANQVVEDDVNEALRLIKMSKVSLEDRSDDIPAKLDPITAVYSALREW
FT                   ADAHFSTEVSYERALSLIVSKGYPKEVLDACLEEYSSLDVLVLDGDNNIFFVE"
FT   CDS_pept        275485..275640
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639471"
FT                   /gene_name="HYP1"
FT                   /orf_name="MICPUN_113173"
FT                   /product="Putative uncharacterized protein HYP1 "
FT                   /protein_id="ACO68330.1"
FT                   /db_xref="UniParc:UPI000199C389"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD43"
FT                   /transl_table=1
FT                   /translation="MVDAKRGEYHRSPLAGKHIRNENLNTNKVGWWILLLILQPHFGMS
FT                   LSHHII"
FT   CDS_pept        complement(275824..277293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639472"
FT                   /orf_name="MICPUN_113731"
FT                   /product="Glycosyltransferase"
FT                   /function="transferase activity"
FT                   /protein_id="ACO68718.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="UniParc:UPI000199C38A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD44"
FT                   /transl_table=1
FT                   /translation="MDRLTVQFPLWKTPFLHVVAGFVISVLIASYGDHGEFLWKYLRIP
FT                   AVADSGNSIFVGIASYVDVEVDRTLEFLFAQARDPSRVYVGLVLQEHKEKRDAFPLSRW
FT                   RSHSNVRLLEIEPEASRGAGWARSKIATLHRGEKYYLQLDSHHLFVSSWDVVCIELLTK
FT                   LAAKVPKPILTTYLTSFPESTTTVAELVHQLPWRMTAGYWMKPFRGILPKKIQYLPLPI
FT                   QKHILMSSNGEPQPTSFFSAHFVFVHSTWLREVPYDPLVYFDGEEDSLAMRSYTNGYDM
FT                   FYPAIHIGFHLYERKNSTKHWHDHPQLFKQMSVNSMLRLKAIIETRGGTSGDQKKLGRY
FT                   GLGAARSIVDYQHFAGIDYQRMYITTRARYGEVLGKWPSGSVPRLWVHKDGHFQMTKRE
FT                   NSTEFWEEWKHGEASGGSVNGDIVSGEAFIVTSRWIVTQRDVLPPRPNLHMIDVARGIE
FT                   IHLMPEGCFYRYPNLTDLQANWTFMTYGHWM"
FT   CDS_pept        278121..279125
FT                   /codon_start=1
FT                   /gene_family="HOG000044956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639473"
FT                   /gene_name="RSU"
FT                   /orf_name="MICPUN_113175"
FT                   /product="Pseudouridylate synthase "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO68331.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG754478"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199C38B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD45"
FT                   /transl_table=1
FT                   /translation="MNACAATVNMRTTMSDCLHKYLGLKERKVKSRSNSCTVADTVTRW
FT                   RKATFETLCNSGDVDKVVRKPHRALMYGQHDTDTGGIELPFRSQQRISKIIALREFCSR
FT                   REAERLISRSQVVVNGVLIHQGSKAECDSEIQLAEIGDQVWFQSKSTVALNKPRGYVSN
FT                   LPSHGEVEACSLLITTTGSHIHSSKWSSRTENDNGQLNVCGRLDKNSRGLLVLSQDGVL
FT                   AREVIAGVFVSKTYLVEVDKMVTQNDLDRLNGPCKFLTDVIRPIRVRLLAPTLLEFVLR
FT                   EGKNRQIRRMCEQMGLIVVDLFRVRLGKSELGSLPEGSWRTMPTVEGNAFKNP"
FT   CDS_pept        complement(279843..280199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639474"
FT                   /gene_name="TAF11.1"
FT                   /orf_name="MICPUN_113726"
FT                   /product="Transcription initiation factor TFIID subunit 1 "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68719.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG559025"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199C38C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD46"
FT                   /transl_table=1
FT                   /translation="MNVAQNTERAQMVDLLSQFTSEQMTRYECYRRSSLPKSILKRLFQ
FT                   TVTSTAPPPNGLIILAAVGKLFVGELVEKARQVADEEGLSDLDEIRVGHIQEACWRLHS
FT                   GALKQKNMFQQHRL"
FT   CDS_pept        <280880..>280971
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(282734..282766),complement(282607..282669),
FT                   complement(282427..282450),complement(282198..282356),
FT                   complement(282053..282145),complement(281920..281991),
FT                   complement(281787..281865),complement(281537..281735),
FT                   complement(281436..281463))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639475"
FT                   /gene_name="PSF2"
FT                   /orf_name="MICPUN_113433"
FT                   /product="DNA replication complex GINS protein psf2,
FT                   probable"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68720.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG395978"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI000199C38D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD47"
FT                   /transl_table=1
FT                   /translation="MKGVREALEHQEVHFLAEDEKVVILPTFALTQRALPAFNTFGPFR
FT                   PQIQVTVPFWLALILKKQGRCLIVPPRWLQISSLDSLVSLERTDDIFQTLPFHYVEIAT
FT                   DLCKYARDDLPEWDHLFDLVETVRSVRHNKMQAGLRSLDARATKGVKLSNITLLEVNIM
FT                   RAFMTNSLEFYRLLSTQTAVAVVGIASSLSHTRSLHLHSVTQRHGPSIVKVSFETFFQT
FT                   RCNTTDTKVNKYRRRYLRRDLRVRRYQ"
FT   CDS_pept        complement(284535..285167)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639476"
FT                   /orf_name="MICPUN_54901"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68721.1"
FT                   /db_xref="UniParc:UPI000199C38E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD48"
FT                   /transl_table=1
FT                   /translation="MTHVVVTLAGTALHGAQRLPRNPKLIWRGGVLTNTKEASLQKVRA
FT                   PRSSRLTATENDEQDRRLPGADDLSTSFSKELKRRKRALKGGENDGADFGGQELLKAEE
FT                   QPRPMFRDDRDPSRDIGNQLKVSRDLQNDGLAGFPSRAGELLTLGLTVFFSFGPIIAVC
FT                   SAFFVVTYLLLGSDFIHGGHQDTNTPSYVTPQSLLYERDIDGKLEKR"
FT   CDS_pept        join(285576..285734,285858..287276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639477"
FT                   /gene_name="FCO1"
FT                   /orf_name="MICPUN_113399"
FT                   /product="Four-cystein orphan protein "
FT                   /protein_id="ACO68332.1"
FT                   /db_xref="UniParc:UPI000199C38F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD49"
FT                   /transl_table=1
FT                   /translation="MRCPVIPCPAVRIRDTCIIALQKTHSDVSSLTSVVDDDDDEATTE
FT                   HSHSSSLLMTGDWWNFRTSTPLAVSISVLVQYAIVLIPTFSFGSSFQGVLCGSTLACCY
FT                   LGVLVNRSFYFPGGVMQPLVFGALLGVIPATYVSSTLVMVAELSRAVGAYGDNGSGLHI
FT                   GEGNLEVTTADVFALRDLKPENFRYDMMGQAHEALPVKEENGARKAGKTEEGTFCAVPV
FT                   VGDEWKVDEPVPFWYVCENNFQFFVECRDAYEGVYADKDYYGYRALRECLRAPLDIMEG
FT                   WFNSEQVGQAEIPRKSPAVLSYNNLGTRKTSAKDRPSRVNPATEKVNMGRGETANVCER
FT                   FQHPSCAVLNESTTPRNILNHSAYSLPLGEVARRISTFANNGTVNADPQIISKPNQLTG
FT                   QKQPSSLLQNYTDHRLSALRTRSPVQLMYFYRLGFMSTNIHITQFAQTALMHSSIRFHV
FT                   ALRGEPPKLRLATYQEPCCTSHKADLIENIFAAALGPVLAAVLAHLTLTIFRALSRRQG
FT                   SSRTAFKT"
FT   CDS_pept        join(complement(290498..290734),complement(287523..290303))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639478"
FT                   /orf_name="MICPUN_113398"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68722.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C390"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD50"
FT                   /transl_table=1
FT                   /translation="MEAPATAYCFRPCQLDAPFQCLVTNKPRGSSGKFSGQLAHRRPRV
FT                   MGFRELASHRFPPPKRRRQRGQSLSKAMMRPMGEIMIMVESLGEEYRVTFEVSEDVEYD
FT                   INGNPTLTCNDLHLHWGMHREWLDEWMCLPDLPRGSKYNDDDPCKPATRTPLVRDGEGC
FT                   SIVFRNGFPLRMSRTKFDVPAYFAPVEIDFALVEIEFGTDRVLAYDGPKGPDQWPSASF
FT                   AVPIGMEKGHPEPLGASRAAPISNGPGYVNFALHSGCADKVTLFLQWCTGDGATPNTME
FT                   IALNPTVHRTGDVWHVALPVGIPGSILPLPASSASWEGGADPRINCPTVLYGYKCDGDP
FT                   ARGGWRFHPGMVMFDPRATCLLTPLGAFQDPFTRLPKFLGSLADVMNGGTQYQLAYDPG
FT                   PNEKAVAGVRKLRQIPAQEIIYELSVADFTNHISADLGNVERGTYAGVLAKVDHIIQSG
FT                   ATTVLLQPIAASARRAIDDNWGAAPVSLFAPDPEMTTPHGGDGSYQVRQLVRGLQARGL
FT                   DVLVHVVLTHLGEGTDASPESHSIRGIDAFSYYEMNSMGKVKSNPSVPGTAVLNLRSHV
FT                   TRELIIDSLRHWRTGFGVDGFLVDTTEGITNLTGIAALLEAIALDAVLSGKTDSGGVSA
FT                   AVEVARGNSTNKFLAGGGVRLYITPNDREVGQIQTWGILGERNSLFLRDISKFMEGSNG
FT                   ALRDFASRVCGSADLIKDCRSSSFGHVINSLTLSPHGKTLADTASDLAARAKVETTTGI
FT                   SHPRGLGEDVLGPSDFMKSRAPLRAMPPVPPTAVETNLMMRSLLTILFSADGIPLISAG
FT                   DEYGHTRLGEGGAPNSWKSEINSFRWDALKCGTAGHAVHSFISALSAFRRRRADLFSSG
FT                   GANVHWTVMDGYTSPKWDEYTAPCLLMCHRKAHSPHDRTGIKAADTTVPSQDAIIVFNG
FT                   TRDLQSAEIGHPPDEFAWVRVVDTSLAFPSDCTLSYVELAGTKGSYLVSPHAVAIFELA
FT                   PAPEGYLNPKDSQFVR"
FT   CDS_pept        complement(291066..291911)
FT                   /codon_start=1
FT                   /gene_family="HOG000100758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639479"
FT                   /orf_name="MICPUN_98531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68723.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C391"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD51"
FT                   /transl_table=1
FT                   /translation="MPCLTDAHNNQRLAYCCNPPHAALEPRHALNHLICVHTSTAGGNQ
FT                   TRTHDKVKFAVQAVCKLGGLITFTEPIGEIPGTTNRNGNTNNLRPDIRVDGLRDTGITI
FT                   LADVSITHIMDSAANHRSQPRPRQGNSAPNSDPIMRRETDKNNKYKAAATAVHKEFIPL
FT                   VMDTYGRMGKPFINFLKDVAALTARRASGNVNERTQAIYDSIDSPNELRNRIHLRNLAL
FT                   VHVALIISLMQRVAGSTVTNDRQHGARGGMYGAHEHYVQPYPVTNFLISNSGVSGRDSW
FT                   "
FT   CDS_pept        join(292708..292755,292854..292919,293093..293383)
FT                   /codon_start=1
FT                   /gene_family="HOG000197024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639480"
FT                   /gene_name="Ntf2"
FT                   /orf_name="MICPUN_54905"
FT                   /product="Nuclear transport factor 2 "
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68333.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG319937"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI000199C392"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD52"
FT                   /transl_table=1
FT                   /translation="MESQSSVCANFEQVGQAFASHYYNVFDSNRGQLGQLYKDEVSMLN
FT                   FEHSVGRPGQFKGTAAILQKLQSLPQQVKHQVITIDCQPTPGGGVLVMICGNLLVDTEI
FT                   PQKFSQVFQLLPTGSGSYYIFNDIFRVNVG"
FT   CDS_pept        join(complement(294175..294212),complement(293918..294092),
FT                   complement(293531..293836))
FT                   /codon_start=1
FT                   /gene_family="HOG000157065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639481"
FT                   /orf_name="MICPUN_113397"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68724.1"
FT                   /db_xref="HOGENOM:HBG447209"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="UniParc:UPI000199C393"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD53"
FT                   /transl_table=1
FT                   /translation="MTSTVVASCSRSCFINADPIVHVRRELPKSKRRIRLALETNELLS
FT                   DPVDAIEVFYHIKNINDPEHPYSLEQLDIVSVENIRVHSEAQFIQVYFTPTVPHCSMAT
FT                   LIGLAIRRKLQESLAGRFKTEVLVFPGSHSSESAVNKQLNDKERVAAALENTNLLEKVN
FT                   LCLRGNLVL"
FT   CDS_pept        join(complement(299304..299441),complement(296891..299191))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639482"
FT                   /gene_name="PSP2"
FT                   /orf_name="MICPUN_113184"
FT                   /product="Prasinophyte-specific protein "
FT                   /biological_process="cell adhesion"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68725.1"
FT                   /db_xref="GO:0007155"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002159"
FT                   /db_xref="UniParc:UPI000199C394"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD54"
FT                   /transl_table=1
FT                   /translation="MSSAWMSRCVTTFTMCARPFPVNVSVRKQPMSSSVEPSWRHIRIL
FT                   PACILFWGAILAISVTMAVTYLPERMKGSAYVLDPNQDMCYAGNVTICDTHAVSRFFFW
FT                   NLTNPLEVLAGTQPPELKEVGPFVMQGGKEKKSEVTFSGNGDSVVSFIATSYASWDPTS
FT                   FCETCDLNDKIISFNPGYYALIRKFGSEANFVHSLTAKVVATLVDRISEVFRSFVEQGI
FT                   APKHIEEAVHAGRNAVHAMAVAQWGNASPLQGASVADYAPDLWPHGKPEFASYASGLTA
FT                   GDGDTVGLDPSEANVVYRILTEDPTGISVLHMLARSTLKLAEDLSVSETKAELIRGYIG
FT                   VHLRKGYNLNAVESMVGPFLGPESSGIFVRRTVEQWLMGYFDPLLSPRYRTSDPRYLSR
FT                   FITKNFLATDLQPETYVERVPDDSIPRDQWPSVGATPWVLATGMDNPSRTLDVLESTLG
FT                   DVTVPNGTYTYTSTGRSIKITGKKVANAVYPEVKRKGLNAETVAWFDFGNSLDLARPVR
FT                   LKYADEYEEVHSDVKFHKFQVHPDELIPCPTSRKNCDYNSRYHGAWDLTDHRMVPMTFT
FT                   MPHGHRADPRMFGFINISDHACPFRPDAKAHEMEWDVLEQTGNVVGMKLRYQNNFEIKR
FT                   TDVFYPNLWKPDPISPADISAREGTLRDGIYLPIAWVDVSWRVPASKVADIARAIADVK
FT                   GAILLYALGIPPICFLLISYSVIVLYIRRQIRRGKSDCNAGRRANASESFVTICSENVS
FT                   SPSTDIERSDAELARVPKSFSTQRKTLFEAPSWSGMESDEESDKAPTILVNLRDMQKSY
FT                   "
FT   CDS_pept        join(302133..302321,302391..302422,302493..302595,
FT                   302839..304899)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639483"
FT                   /gene_name="MCM9"
FT                   /orf_name="MICPUN_113396"
FT                   /product="Minichromosome maintenance protein "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO68334.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199C395"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD55"
FT                   /transl_table=1
FT                   /translation="MILIFGLFVDFFTCRWSTPTISFLRAYLILGLLEYLYTFVIPGIC
FT                   ACWSSGRQGGVLVYYSQLGLSSEGLSSEGLRLSFEDLLMGESYRSQMHGILLVIVFFVM
FT                   VALMRSHAAILGLSANSIKYSARVRLDFHRIALLQLGSFVSQLCAPYSGHILTIQGTVT
FT                   RVSAVRSCEVEQLFECDFCKHRFSVPVSQGQKLYFAAPKTCPRSLTSASTAAKPDAAAC
FT                   AGTSFSVVQTKLPILNDFQEIHVQDSSWAFSERTKTCLQLDLTLLGTDGWFKKRQNQRT
FT                   SNIKAPQRSIAVILVDDLVDKCRPGDDICITVTVLSRWLKARCGQRAEVEMICSAISVS
FT                   YLPNGMFCEHQRACKEDVDDFASFWRYGAHHTTASRLEEPAAAKMQQTICAGRDLLLDS
FT                   FCPQLFQLYPAKLAFLLSLVGGVSYIEYETGNHNRNECHVLLIGDPGTGKSQLLKYVAK
FT                   LAPKSVNATGTGLTSAGLTATMRKGKDSNSWILDAGVLVLADSGVCCIDQFEKISGAQL
FT                   AAFQEAMEQQTLSITMETMVARLQTRCSLFASANPVAGRIDTALSLSANTGLQSPILSR
FT                   FDCILVFKDDMSSRHDRAISSHLTSHNQRNYVDNINHELSAIDRVDNERKSSLMNRQGF
FT                   SCQALNRGKGYLSFKAKDTHAGMLSQNRHKLWSFQHVRRYVLLVRYAIDPVLSSEAEML
FT                   IRGFYQVCRRERAGLSARPTIRLLVSLIRLSQAHAKLLWNQQVRGGDVVVAVDILKASN
FT                   DYTLPAHLGSTCSTLMPEASAMLQREIQLIGDIERVLGPSW"
FT   CDS_pept        join(complement(306122..306164),complement(305976..306037),
FT                   complement(305504..305800))
FT                   /codon_start=1
FT                   /gene_family="HOG000285966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639484"
FT                   /gene_name="TAF10"
FT                   /orf_name="MICPUN_113186"
FT                   /product="Transcription initiation factor TFIID sub.10 "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68726.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="HOGENOM:HBG398309"
FT                   /db_xref="InterPro:IPR003923"
FT                   /db_xref="UniParc:UPI000199C396"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD56"
FT                   /transl_table=1
FT                   /translation="MTLLHDQTSTDETLDGLSKNELAQFFSDLDELAPTIPDALTNHYL
FT                   KISGVTNADRRITRLVSLAAQKFISQIVTDARICARQRMEMQPKDKRAKGLDPKDRRVV
FT                   LTEEDLMAALADYGLDIRKPAYFAGGVAE"
FT   CDS_pept        join(306932..306997,307072..307111,307209..307876)
FT                   /codon_start=1
FT                   /gene_family="HOG000264396" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639485"
FT                   /gene_name="TIM17"
FT                   /orf_name="MICPUN_112700"
FT                   /product="Mitochondrial import inner membrane translocase "
FT                   /protein_id="ACO68335.1"
FT                   /db_xref="HOGENOM:HBG592677"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI000199C397"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD57"
FT                   /transl_table=1
FT                   /translation="MFGGLEEKKNEFESWMRAQPPAVEIGITSATSAIQGGILGFTLGT
FT                   VNQSIEKQAANMPNKSVMPTSGSFSGPPRVLALNLAVFTAVQGGLTLAVKRYRGVDDIQ
FT                   TNMIGMFGAGAALSLTTNIAGNQPAAPGQVKPSTPLGYMTDAARTGALFAALNGAFMKI
FT                   GQMLSGKDSSQDVYYYHTICMLNALGLEKYERNFRKGMLMDDCLALLSDSALREVKIPP
FT                   GPRLKILNYVAASKVSSQFDVVQDSSFGVDDVRHA"
FT   CDS_pept        complement(308173..309369)
FT                   /codon_start=1
FT                   /gene_family="HOG000264395" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639486"
FT                   /gene_name="PSP5"
FT                   /orf_name="MICPUN_112701"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO68727.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG559032"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C398"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD58"
FT                   /transl_table=1
FT                   /translation="MRHSRVARPRRRDTLISRGSSLVASPSALPSTTGFLGNISAVFPM
FT                   ADVLAGAAARAASQSTIHPLDTIKVRMQAALKGNSANIKQMTTTSVQTVSTGKYGIGIG
FT                   QATTPSGSLPKSMAVATGAMLGKVQAEVGSLYKGVLGAASGAGFAIGAYFAFYGVAKKL
FT                   LETHSDYSVSTIAFLAGGIGAFGSSIVKVPAAVCIRSVQANIYPNVIVAARQITSAAGP
FT                   RGLFTGYLPTLLEDVPDMAVKFAAYETMRTMHRRLTGRKQEDAAAAADISIGLIAGALA
FT                   AGATTPLDVVKTRMMCNASQRPSFTGAIAGVWRDSPAGLGRVQAFFTGVGPRAFSNGIN
FT                   SAIFFCFFEMMRASLKRWEERRKLLLESRALYKNEMSVLQNPADGTKKRVFKANRGGA"
FT   CDS_pept        join(complement(310287..310388),complement(309938..310024),
FT                   complement(309789..309872),complement(309629..309736),
FT                   complement(309508..309573))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639487"
FT                   /gene_name="PSP5"
FT                   /orf_name="MICPUN_112701"
FT                   /product="Prasinophyte-specific protein "
FT                   /protein_id="ACO68728.1"
FT                   /db_xref="UniParc:UPI000199C399"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD59"
FT                   /transl_table=1
FT                   /translation="MLTLKRQSRSGSISRFLGNPVRIFHSLLFICALEVLFWSFCLFTC
FT                   QSTVGWSGAARAYYTRETLNLKSTTGEALDAPVPAIDVRILELTLKAETAWHQRAFATL
FT                   YAALNHLPLQQSSSVLAHSLLFPEKAFSTDSFSKSGAVLNFETE"
FT   CDS_pept        311422..312813
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639488"
FT                   /gene_name="Nop53"
FT                   /orf_name="MICPUN_113190"
FT                   /product="Nucleolar protein"
FT                   /protein_id="ACO68336.1"
FT                   /db_xref="InterPro:IPR011687"
FT                   /db_xref="UniParc:UPI000199C39A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD60"
FT                   /transl_table=1
FT                   /translation="MRGESSSKRARTRMDLGEAEYMDTRRQDSRMGGSTDASPDDTIFF
FT                   LDNGGGSAASVRTPKEKARARVLRIDAIMSKQATSKPFPVATHQRCQASSSSKRFLRAS
FT                   KISKLHTNYGRVSEVREDADHVTRTSRENTQFGAFTLNGLVSGASDTPKGADLYNLWGG
FT                   KGRDRRKFTHTSDETIVPAASSLFAEATHLGLHQLCGQSWKRRKFNRRNTPNVDIAQVS
FT                   AVDIDAAGSSYNPPEDARQDVVAKEVGRIISTTLRKHFDPGRAPVPGKETETCLNGELH
FT                   YVHDYSEEEGGDVNEGCKNPEVTRVGKLSKAQKNKQTRRKKQQADEETNKRAKRQRRDI
FT                   SSLNELALQINKEEEVKRERLARRKVTRHERIFKAPSRLGKYTYQSEPAPVLLTEELTG
FT                   SLRTVAGTHTLIRERLKSLQRRALVEPRRKVDKTKSKSYIRYQPGEKGERESDMHKKKL
FT                   GAREN"
FT   CDS_pept        join(complement(314871..314923),complement(313580..314807))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639489"
FT                   /gene_name="BET4"
FT                   /orf_name="MICPUN_113723"
FT                   /product="Protein prenyltransferase alpha subunit "
FT                   /function="protein prenyltransferase activity"
FT                   /protein_id="ACO68729.1"
FT                   /db_xref="GO:0008318"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniParc:UPI000199C39B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD61"
FT                   /transl_table=1
FT                   /translation="MNFGSATSTLGTEVNRLNTLVDDPLIDELAFLPSAAPSDVFGESF
FT                   PPGGIVTSTAVPGAFLLVGHKLAIAINALVPVYNYISAAHRRACNHQNESDGGLASPGI
FT                   DPMTGLDTYRLLLLINGELNMAWNGLRRRMMQNFAGLGLKARSCIAKYELRFAQAVISG
FT                   NPKATACWVYRRWILKKLFVSPARGVTGLQIEHVFANEITMVERATRFRRFNYAAWTHL
FT                   RCCSQDFFAETKRLLPQALLANLTENLTSYKWRNLVDKCLIEYLRMLSDNLLSPECRPI
FT                   STLITKVMEVHPEREATWTYHRYLSGALANSLSQRLDVTFKTFKNVEQRLTLNEDLHFL
FT                   YRLLTKKDEVQCDLVQEISGWEPLYFTALYAFWSSERSRRLLMHPALGMYATGMAVPLK
FT                   IKRKADIVNLARFWTWNAAAMLGFFEA"
FT   CDS_pept        315016..315456
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639490"
FT                   /orf_name="MICPUN_54916"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68337.1"
FT                   /db_xref="UniParc:UPI000199C39C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD62"
FT                   /transl_table=1
FT                   /translation="MKKFTAITGKGGEVSQNQFSPKSPFTKNLYLTPHKLKASHSRRLS
FT                   VCREDDIQYLTHKCVYEAHVYEVASPLYPRTCGPEPDSDSLCHECHGPPKPNRIPSGWH
FT                   NIIFWISGSCMWTPRRYYYYCYYYYYYYYYYYYYRMGGLTQE"
FT   CDS_pept        join(complement(317661..317786),complement(317285..317407),
FT                   complement(317034..317090),complement(316735..316926))
FT                   /codon_start=1
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639491"
FT                   /gene_name="EIF5A"
FT                   /orf_name="MICPUN_92746"
FT                   /product="Eukaryotic translation initiation factor 5A "
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="positive regulation of translational
FT                   elongation"
FT                   /biological_process="positive regulation of translational
FT                   termination"
FT                   /biological_process="translational frameshifting "
FT                   /protein_id="ACO68730.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006452"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045901"
FT                   /db_xref="GO:0045905"
FT                   /db_xref="HOGENOM:HBG526951"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniParc:UPI000199C39D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD63"
FT                   /transl_table=1
FT                   /translation="MSDDEDVEQFETADSGASTTIPMQAGNVRKGGFMVIKGRPTKVID
FT                   VTTSKTGKHGHAKCHFTATDIFTGKKMEELVPSSHNLEVPIVSREDYTLVDLNDEGFLG
FT                   LMDDSGNVREDLKLPSGHDDAEALARQIQAQWDEGKELVLTVLKSMGEEQVNATKEAPK
FT                   QD"
FT   CDS_pept        319990..320841
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639492"
FT                   /gene_name="GLP1"
FT                   /orf_name="MICPUN_114061"
FT                   /product="Putative uncharacterized protein GLP1 "
FT                   /protein_id="ACO68338.1"
FT                   /db_xref="UniParc:UPI000199C39E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD64"
FT                   /transl_table=1
FT                   /translation="MRGHRGLAVAKNILNLDLRRLILEHARVHESDLSLMSFKRSWKSR
FT                   SLSFIHNCRLLEHSVGRHIQNLYDAALSHVFRNGASLEERVAGLFAIYFVYFTQHTTPR
FT                   VRIQLSRTHLEGLSSFIGHLKKLSRAEDAIFVVKLLSQEDAFTFGMLMRKEINLVSFKQ
FT                   QDAILERTRKQNISYRKDKVSRVHKVASHIIVNGLSTGSSRVKNASRIGLDRLRNTRIP
FT                   NTFPHICKASEAYLEIWRSLKDANLKHLQADLESSDRTKGVHEVIARQLLKNDEKLLFL
FT                   LK"
FT   CDS_pept        complement(321172..322251)
FT                   /codon_start=1
FT                   /gene_family="HOG000264451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639493"
FT                   /gene_name="GNAT1"
FT                   /orf_name="MICPUN_113394"
FT                   /product="Gcn5-related n-acetyltransferase family protein "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO68731.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG608571"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199C39F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD65"
FT                   /transl_table=1
FT                   /translation="MNVSWRGMNFQTNKRAHINRLGRRCIAFKGCTCSTRSSFGVTSSA
FT                   RTHIIDSRGNVVITTAFSGTDRDSGRGSRQPAQSTSVPDAQTEQTNSFLCLEGLQTNGK
FT                   AAHPYTEELATKIRNFETSQISVITAESFSEFSVAAELRATAFYDDLEARQALPFPSRF
FT                   IATFRREFAQRECLALKERTAHFTGTLRRCLCLMARLPDLGLVGCLDISVRVGPCGSQV
FT                   NGLCIPDNEEYVYIDNVAVDERARRLGSASAMLEASSEIALQWGAGFVYTHAHADNVAA
FT                   RRLYHTYGFRAPKGSRLADILPPGKVTPWVSPRLAGLILLRAPLPLVRQSPGNEDTTDC
FT                   KCVCGAIFDNCEKCVCGLV"
FT   CDS_pept        join(323861..323970,324052..325231)
FT                   /codon_start=1
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639494"
FT                   /gene_name="HEME4"
FT                   /orf_name="MICPUN_54920"
FT                   /product="Uroporphyrinogen decarboxylase chloroplast "
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="ACO68339.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG628392"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI000199C3A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD66"
FT                   /transl_table=1
FT                   /translation="MITTNFFAKSHTTCFTFKRSQLTCASSRRFLGVGTNRSPTIKCGV
FT                   LASHNSAPANDIMIRAAKGQKVERTPVWLFRQAGRHLPEYMEYKNARGKNFLELLKDPK
FT                   DVAEVTLQPIRRYNIDAGILFSDILVVAEAMNINVEMPGGLGILVPNPLRNPEDLSRLP
FT                   RSVNVEERLGHVIEAIKEINRQIEAEALNVPLIGFSAAPWTLMYYMVGGSSKKNTDVGM
FT                   QWLREHPNESQQLLERLTTVVIDYLDAQIKAGVHMVQVFEAMCEHIDKDCFLSFAMPSL
FT                   TKIAKELKARHPEIPLLVFARDAPYALPLLQAAGYDVMTVDTVKPGDVARRELAIGAVG
FT                   ADPKQLQGNFDPALLHAKTGSDEAAIEKAVRNMLISFGPQKYIANLGSGLTGLEDPSKV
FT                   AFFVDCVHKVSEELMAEEAVYTEPADPLRR"
FT   CDS_pept        join(complement(326231..326366),complement(325976..326174),
FT                   complement(325835..325910),complement(325695..325772))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639495"
FT                   /orf_name="MICPUN_51230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68732.1"
FT                   /db_xref="UniParc:UPI000199C3A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD67"
FT                   /transl_table=1
FT                   /translation="MFEDFTLFIAPKGLNQPTETSRQRELAIVITNDLRTLPGHDSSVS
FT                   GWSDALSIATCLEKDGAHLCGAKRKLSRELEVWKTHDGAHLLKSGDVTHIIDFVASETV
FT                   EDFKSTPRDRICDDEINKQGLAMSSPNLDIAAEDAVVSTLLHGISKCNTTVAFLESFR"
FT   CDS_pept        326783..328378
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639496"
FT                   /gene_name="MPP10"
FT                   /orf_name="MICPUN_113197"
FT                   /product="U3 small nucleolar ribonucleoprotein component "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO68340.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="UniParc:UPI000199C3A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD68"
FT                   /transl_table=1
FT                   /translation="MPPDRGNGLVLAYKGFRDPVRVGMLSSKVHPTEEKVSAAARKVVE
FT                   DIFFCITSSEAAGNIDLPVPELQTTGLDAEQLWSQINLQLEPVLSRIMNVLKNADFSEG
FT                   IERMSGHGFVKDLNVGPISNIVTRRAAAEADKQPHSDTFHVPPSIVNKAARTSETTRFN
FT                   EGSVTVQHESSKLEEAVWHFPTRQHQSTEEVSNVRKLSAFQRAQQLLSKQIETLEEQSM
FT                   QEKKWQLRGEAYGRERPKNSVLCMEMEFDDVRQTSPVISELMTTSLENVIQARISEQRF
FT                   DEMERENTLSGPLEISMPPVAEDTKSKVGLGELYAEAFQNARLQQNAGGGNGVDGKVAL
FT                   GNEAKKILSVLLSKLDALSHSQQSPKFVVDETSFTEVPALKVEQAGSVEVSEAARRMSR
FT                   KRMRSQCIESRSRAHSEADHKAKDELTKQDKSHIRAMHKRKKKSSITQTGLTPSKSTYV
FT                   AAKQLKDVEQFASSRHSHKGLSKSTRLGSISPGYTKSSQVFSRIQSEKDGSNGVEFLSR
FT                   TTASRSSELNNLKL"
FT   CDS_pept        join(329310..329327,329436..329503,329559..329625,
FT                   329722..329827,329894..330024,330096..330218)
FT                   /codon_start=1
FT                   /gene_family="HOG000100759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639497"
FT                   /gene_name="ODA-DC3"
FT                   /orf_name="MICPUN_113454"
FT                   /product="Outer dynein arm docking complex 3 "
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO68341.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG559041"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C3A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD69"
FT                   /transl_table=1
FT                   /translation="MAQDARERFAKKNEAEDLRRAFDKLDTKGDGKIDAQELREVLLLL
FT                   RHETKKSEVEDIIWEVDDDSDKCVSWSEFQAMCHRCRVDQTGYEPRRLFNIVEFIMNDR
FT                   DGSGSVSVEEATQILYLRFGNGLLDKRLEDIFGTSDTNSTKDLSLTEFLKSATSSWCFK
FT                   QLRSKVA"
FT   CDS_pept        complement(330936..331187)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639498"
FT                   /orf_name="MICPUN_54925"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68733.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C3A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD70"
FT                   /transl_table=1
FT                   /translation="MKPEELMGHVTAGAFAGAAVELALYPLNTIKTRLQAARGGSSVNL
FT                   KHLYKGFGGNILGAVPACAVFFAVYEPVKLQLSVAVSQ"
FT   CDS_pept        complement(332306..334111)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639499"
FT                   /gene_name="MBB1"
FT                   /orf_name="MICPUN_113199"
FT                   /product="PsbB mRNA maturation factor Mbb1,chloroplast "
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68734.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG609664"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C3A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD71"
FT                   /transl_table=1
FT                   /translation="MSRRTSMRQRIICPPRSSAVSLGYSPPDRNSASQALRVRFFTVVS
FT                   FRSSFQVNANNFAYQRRVYFKHDVQISRGRRRGGYLRGSLVERAAGSSGSGDPLRSNLA
FT                   SSEDGDVHARGTDDFSISSLPDLQSSPLKINQDILIFQATKLRNTARKTRKKEDRIKLR
FT                   LSAIRVYERAKAIDPSDGRAYVGIGYVLRQMDDIIAARQCYQDGCDATGGDNAYIWQSW
FT                   ATLEAAEGNVSKARQLFDAATAANKTHAAAWHAWGMFEKSLGNFQRARDLFLKGVRLVP
FT                   ATSANAHLFQSLGVMAMERGRIQEAREHFKEGTKTESGAQSAALWQAWAILESREGNSD
FT                   QARKLFQRGLSVDPENRYVWLSWAVYEAQEGFIDRARGLLRRGCELNPSDPPLLQALAR
FT                   LEASEGNITAARQLFEQGTKLDPLHQANWQAWALAEWRAGNVHRARQLMQRGVWVAPRC
FT                   CDACKLFQAWGVLEEREGNVALARQLYKCGIKADPSSEVTWLTWALMEERQGNDIRATE
FT                   LRNLCVQQRAEEAVGQSDLSPAAMFGIDSALRPVLRSISTLLGNQSTQTEDALSGNRSD
FT                   ADLSISRREVVKAEPLYGVALPEEK"
FT   CDS_pept        336164..338119
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639500"
FT                   /gene_name="MYB119"
FT                   /orf_name="MICPUN_113455"
FT                   /product="Myb DNA-binding family protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68342.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C3A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD72"
FT                   /transl_table=1
FT                   /translation="MRTKESKEPGKVGSKEWKKSKERGISKPEHLIQTKQATGKTEGIQ
FT                   SRGGTVKRVASGGQAPSLGESLKEELGINPPHIPTVSGGVTHLSDDYLQGLSIDSGGTP
FT                   NFFHDKSLNDDAHTISLGAPANRGWGGSLGGMLVATRSTGSGRSGGSSGGKSPGYFNNN
FT                   ELSELFSIVRGKSSFGEADDTKRQHTAETLKPSTSKVAPMAAMSLSQFEQLASLPEHLR
FT                   ALPPIRTKSMDVQNMSELGGGVNIPGSSGRLFSGLTPHGYMGSGLTPTAVTPGSITGFP
FT                   GVDHFGMSLTEGHQGGLTPGMPGWASAAQQTAETTQGGLVIAAGAENNKKRKFATGNGE
FT                   IRTSKAVKSAAIRNHGSKGEAKKVKGRLKDEQLEDDADDIPLSGLVKISGVGGAAITAA
FT                   AAAAKLGIPLPGAGDKVSFEEDAYDVDDEGDKLGSTKSRSRSWLPSEDELVRALVAQHG
FT                   PRKWTLIASRLKTKTQKQVYARWRDYLQPGLTTKPWSKEEQAKLVELQGHVGNQWAVLA
FT                   RLMPGRSPNAIKNRFHATKRKMERHNKREGSNLGSAEVKHAGKKPKTVAKVKLSSHDGR
FT                   KLGEEEEEYSKEEQMAVEGLLLADTPTSLLAMTEKESISRQFDSANASIEDRMREEADK
FT                   AAKVAEMVVKGQIKRS"
FT   CDS_pept        join(complement(340395..340499),complement(340262..340322),
FT                   complement(340104..340207),complement(339951..340001),
FT                   complement(339732..339887),complement(339550..339669),
FT                   complement(339429..339496),complement(339186..339371),
FT                   complement(338887..339130),complement(338652..338828))
FT                   /codon_start=1
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639501"
FT                   /orf_name="MICPUN_113380"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO68735.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG320579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199C3A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD73"
FT                   /transl_table=1
FT                   /translation="MAKQKIVFLHPDLGIGGAERLVINAAMELSRLGYEVVMYTTFHDV
FT                   QRCFEETLSAGTRAAWIRVHGGWIPRQIYGLFHAPLAYFRTFWCAACLILVEKNVPLVF
FT                   IDQVAAPILLFRLLTSSRVIFYCHYPDLLLAEHSSWFRKLYRLPLDYIEKVTTGMASKI
FT                   LVNSEFTAAVFARTFKDLYIRGTRPSVLYPAVESRQDQNQRKMKYAAEAKQVEDILNFT
FT                   GTFFLSINRFERKKNLELALKAFAHFRLSPRKCAADRVMLVLAGGFDKRLKENVEYFKQ
FT                   LKRDAYDLRVHQEVIMLPSISSEEKEMLLSQCLCVLYTPVNEHFGIVPLEAMAAGKPVL
FT                   ACNSGGPVETIIDGTTGFVCSPLPEDFSSAMEKIYSSPMVAARMGNIGRHHVKTNFSLE
FT                   KFGTELHFHINDLLTNDDHTPEDN"
FT   CDS_pept        join(complement(342049..342066),complement(341169..341900))
FT                   /codon_start=1
FT                   /gene_family="HOG000100758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639502"
FT                   /orf_name="MICPUN_54929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68736.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C3A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD74"
FT                   /transl_table=1
FT                   /translation="METAINRLHAFNHLICVHTSNAGGNQTRTHDKVKFAVQAVCKLGG
FT                   LITFTEPIGEIPGTTNRNGNTNNLRPDIRVDGLRDTGITILADVSITHIVDSAVNHTSQ
FT                   PRPRQGNSAPNSDPIMRRETDKNNKYKAAATAVHKEFIPLVMDTYGRMGKPFLNFLKDV
FT                   AALTARRASGNVNERTLAIYDSIDPPNELRNRIHLRNLALVHVALIISPMQRVAGSTVT
FT                   NDRQHGARGGMYGAHEHYVQPYPVTNF"
FT   CDS_pept        342430..343971
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639503"
FT                   /gene_name="MET10"
FT                   /orf_name="MICPUN_113202"
FT                   /product="Sam-dependent methyltransferase "
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO68343.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="UniParc:UPI000199C3A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD75"
FT                   /transl_table=1
FT                   /translation="MKRPTLSLSAKQIREVLHALDSLDPTTEFAELAASEDLDAALWYS
FT                   LYPRTRDCDKIERQSSDARGDARRAAGIARMHPRNVFANIKADFFVLGKRQPCFRPFVE
FT                   QCSLGLWYVNFKSWEVTRALNRALLVDVYGLVSWDIPKGHLCPPVPNRASYIHWLEDLL
FT                   QLSHPCGRPGIECEGVRGIDIGVGSNCVFPLLGSTANRWSFIGIDVTDVALIWADKNRL
FT                   DNPDLASRIKIRDARRSGTLHMKRNDSAVLAVQMGERFSFCMCNPPFFETMKHAKRNPG
FT                   TNFGGTLAELCCPGGEETFIRRMYNESLVTKDRVHWYTTMCGKKETLKSLRCLLDMAKV
FT                   PAIRTARFLQGKTVRWGVAWSFSAQALPISTIPLRSGVDIKFDTVPHSRSCWRITFEPQ
FT                   AVEGSCLAEKLAEQIRLVLEKCGCAISPDSRLQNTFNYRCVMEEYVFPTVGSNRLLVKI
FT                   LQPLPGAVVVVTAACDDKSATNLMMQRRFKLVWEAIKARISAQTQRQVGSRVDWS"
FT   CDS_pept        complement(344629..345018)
FT                   /codon_start=1
FT                   /gene_family="HOG000056700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639504"
FT                   /gene_name="XTP3A"
FT                   /orf_name="MICPUN_113203"
FT                   /product="Xtp3a-related NTP pyrophosphatase "
FT                   /protein_id="ACO68737.1"
FT                   /db_xref="HOGENOM:HBG342270"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011394"
FT                   /db_xref="UniParc:UPI000199C3AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD76"
FT                   /transl_table=1
FT                   /translation="MHASGDSLSGLNLEGLRVQLASFAAERGWEKFHTPRNLLLALVGE
FT                   VGELSELFQWRGDEDARPGLPDWDDVAKTRVGDELADVLLYLIRLADACEIDLSQAVAA
FT                   KLQKNATKYPVQKCFGSSAKYTTFQ"
FT   CDS_pept        346324..348159
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639505"
FT                   /gene_name="JMJH"
FT                   /orf_name="MICPUN_113204"
FT                   /product="Jumonji domain-containing protein "
FT                   /protein_id="ACO68344.1"
FT                   /db_xref="HOGENOM:HBG608560"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199C3AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD77"
FT                   /transl_table=1
FT                   /translation="MSDVWALFDSDEPVELNSAKLCKHFSSSALRLDEDVVVASSTSRE
FT                   RVYARLDAGKIASEHPFFAPTRALWPAHELVDDSSNMNMRVRAFVESLTVDASERAGII
FT                   AERLRGCQPEGQVAAEALIRAQTACGARDWPLTLLSAVHCMSAHSRQLDIGDWPNYSWQ
FT                   LSHFFALGFYIGARLSINMMRNGETVIEQNTSENTINKSAIDNNRRAHIPTAEAMNKAY
FT                   GKCETVCYAAAVRLSQPQGSLSDYQQLTRVVIEALNMATLVPDPSMVPTWLGTGILLAE
FT                   KLCVKVKSWKETLNAALKPNRNPEHCLVKPHKGLRHKSAYIVPNTLPHGSPQICPTRAV
FT                   NRQPSCSLSVPDFFNLFVMRDVPVVITGQMSRAHGWAGLEQWRDLSLLVANRAMEARLV
FT                   PVEFGGFGDRKGADIISLGNFVDEYLVPSNTEHIPFSGAAWNTLNSRDNAHGQHFQPCC
FT                   THVAYMSQHALFHQFPDLQKMFSIPSYTLGRLRPDTGAVNVWIGTKNTITALHRDPYMN
FT                   ILAQTAGYKYVRLYSADQTKFLYAEPALRDGNGNTFERSLVAVEAPDFELFPLFAHAKF
FT                   AETLLGPGDMLFIPKGTWHHVRSLTTSFSINFWWK"
FT   CDS_pept        join(complement(350644..350677),complement(348902..350553))
FT                   /codon_start=1
FT                   /gene_family="HOG000190693" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639506"
FT                   /gene_name="SGPL"
FT                   /orf_name="MICPUN_54933"
FT                   /product="Sphingosine-1-phosphate lyase "
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="ACO68738.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG657947"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C3AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD78"
FT                   /transl_table=1
FT                   /translation="MVPDTRKLSYEFMFVVSNKMDAMMIIVDDFLHGTPPSRIVGGTVL
FT                   VSYLGLKIISVGTDFYCQLRNRGVLRVVFEAAKSLPILNQFVSREKAKLIAKLDKDLRK
FT                   KIAANPLRVVELPIDGLSSREILSEADFRRAKDTCQLMKSSQMSGAVYMADHEHCDLLC
FT                   SIYSSFVHANPLHADAFPSVTRMESEVVSMTASLLGGCSATNPGVCGLMTSGGTESILT
FT                   AIRASRDYMRATRHIRRPEMIVAVSAHAAVYKAAEYFNIQIVRVPVDKDFRMDVDATAR
FT                   AIRKNTILIYASAPGYPHGTVDPVEKLGALAKKNGVCLHVDACLGGFVLPFIPSSKQSP
FT                   LPMFDFRAPGVTSLSVDTHKYGLSQKGSSVVLYASSLLRQYQYTAVMDWSGGLYISPSQ
FT                   PGSRSGGLIAQTWASLLHLGRNGYKVMTEKICSASARLRAGISQIRGLQVLGSDVTMVV
FT                   AWGSTDPLLDIYVVNDIMITKGWHLSVLHTPAALHMCITPANLERVPELLSDLREAVDE
FT                   AQNSNDEGISGGKAPIYGLAGALPDRDLVGDILKDVQDLMLKHV"
FT   CDS_pept        join(complement(355000..355288),complement(354680..354748),
FT                   complement(354497..354532),complement(352480..354335))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639507"
FT                   /gene_name="UBP1"
FT                   /orf_name="MICPUN_54934"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO68739.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199C3AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD79"
FT                   /transl_table=1
FT                   /translation="MADSGGTIRGTGLYNVSNTCYLNSVLQALCHVRGFRECLLSDEAG
FT                   TYLYAAGKAGGSLNAPSPTPTDEILSFPGFKKRRKRKRGESSDGEEAVVPFLRPPAMTR
FT                   TGKASIAAADHACLGGELRAVLRTLWYGEYAAFPPYRLLRAVWTLVPSFAGNQQQDAHE
FT                   LTRFLLERLRLEFVRGSQLIAAQAAKESGRILPRGNEHGIGSNLMGNLGIPVPIRRTRT
FT                   SRSRRQLLGKSWSSSDVDCSYYPAQHCVTETIGEAEGLARLGSPTVGNKRRSTLSCKEK
FT                   VAIEKAESDGHVIISRWGAVRHKKGCFCRPCLSRRRKQGKDDNLTSSCRTFEQSSEGLP
FT                   DDRGEKRDDTVFPHAIHHDSKPGSAELKPKTRADHSISEASRRGLECLSVMNREFGLPL
FT                   DPVWRLFGGTVLNLIHCLRCGHTNTSEEPFLDISLTIPSVIDAHTRVCFSKENSRPSPE
FT                   AGETVEPGEGPGGCATLQQCLAVHTRDEILSGSAMYSCDHCGSVASTVKKTKLQSLPPV
FT                   LCLHLKRFTWRGSEHESKLNAHVDFPLENLDLAPYMESGSYVNEDSCSPSIRAVTRARQ
FT                   GENATVYSTDLLRKAENKTCGTAKNFQRGSPGGQERGSTTARQQGIQKIAPASHASADA
FT                   KITLRSDPLFSKRPVHAQKSTSLLYDLSGVVVHHGLGAANGHYTVFAREESCKMRRTAR
FT                   HSSGDVSHEISDVASPEVWLQFNDEKVVQVTREEVKRCDGYIFFYTKQSDEKFTN"
FT   CDS_pept        join(356345..356404,356499..356600,356668..356777,
FT                   356838..356981,357050..357114,357213..357478)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639508"
FT                   /gene_name="PAC1"
FT                   /orf_name="MICPUN_113362"
FT                   /product="Proteasome_alpha-4 subunit "
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="ACO68345.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199C3AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD80"
FT                   /transl_table=1
FT                   /translation="MARRYDSHTTTFSPEGRLYQVEYAMEAISHAGAAVGIRTNFGVVL
FT                   AAEKKILSKLLEIGTASEKMHKLDDHIAVAVAGVNSDANLLMNSARIFAQRHALSYSEQ
FT                   VPVEQLVHSLCDQKQGYTQFGGLRPFGVSFLFAGWDKDCGFQLYQSDPSGNYAGWTATA
FT                   IGANSQAAHSILKADYTEHMSILDAKKLAVKVLKQTMDSTTLLPEKVEMCEISFSNNED
FT                   RTVNFHMLLPNELVNLCDEANKSSIK"
FT   CDS_pept        join(complement(360782..360937),complement(360665..360715),
FT                   complement(360468..360581),complement(360204..360404),
FT                   complement(359931..360140),complement(359758..359867),
FT                   complement(359402..359702),complement(358536..359344),
FT                   complement(358441..358483),complement(358154..358363),
FT                   complement(357604..358092))
FT                   /codon_start=1
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639509"
FT                   /gene_name="COPG"
FT                   /orf_name="MICPUN_113363"
FT                   /product="Coatomer protein gamma-subunit "
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="ACO68740.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI000199C5AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD81"
FT                   /transl_table=1
FT                   /translation="MADGHAESSKKRDEESEEGLDFSPFWGIEKGAVLQEARCFNESQL
FT                   DARRCQQVITKLLYLSNQGDSFTKVEATEVFFSVTKLFQSSDSNLRRMVYLIIKEICPS
FT                   ADEVIIVTSSLMKDMNSKIDLYRSNAIRVLCNITDAGLLGQIERYLKQAVVDKNATVSS
FT                   AALVSGHHLLQVNSEIVKRWSSEVQEALSSKNPLVQYHALGLLHRIKQNDRLAVSKLVT
FT                   QLSRSPLRSSLAQCLVIRYVAQVIKDTKVDEVTGERPFFDFLESCLRHKSETVIFEAAR
FT                   VIIELNEVTTRELQPAVTVLQLFLSSSKPILRFAAIRALNKVAMNNPSSMTNCNIDMES
FT                   MISDQNRSIATLAITTLLKTGKESSIDRLMKQISTFMTDIQDEFKVVVVEAIQELCLKF
FT                   PHKHRILMNFLSNVLREEGGFEYKKTIVDCILCLVKSIPDATEAGLTHLSEFIEDCEFT
FT                   YLSSQVLHLLGELGPSTADPGKYIRYIYNRVILENATIRASAVCALANFGSCSVALRAR
FT                   VLTLLQRCLYDNDDEVRDRAAFFLSVLRTIPETDSECVEDPLIYPLAPLEASLRQYLEN
FT                   TGDSAFDLAVINQIHNNIASHPDMHASAFDCSSMNISSTKNDLRESENIITSRGEFMSY
FT                   GPIFKVSSYSSSVVNSCHAVDLTEAETEYKVTCTKHIFKEHIVFHFMCSNTIEDQILEN
FT                   VSVVTDPIEGIEVFAKVSTIPLGTMPLGQFGSTFVSYKRAQGLHPVAKMACTLKFTSKE
FT                   IDPSSGEPESEGYEDEYTLEDIDVTVTDFLTGNPLSAFRKVWDTLPIENEKVGDYSLGT
FT                   RDSLGEALEAVVGILGMAACEGSEVIAPHARSHTTLLSGFFVGGHSVLVQLNLGMGPSN
FT                   SVAMKLIVRAEKPYIADMIHTLVSEA"
FT   CDS_pept        363438..364208
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639510"
FT                   /gene_name="PSP3"
FT                   /orf_name="MICPUN_54937"
FT                   /product="Prasinophyte-specific protein-3 "
FT                   /protein_id="ACO68346.1"
FT                   /db_xref="UniParc:UPI000199C5B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD82"
FT                   /transl_table=1
FT                   /translation="MNSLLHTRRRASVALRDCCFHPSAIITRPELGNRAVNNSSGGSSF
FT                   SSSSASSNHDQVDGNESISRNLAAPQIRGYNSNAAAQKSPTNGAGPSFTRQGSGIMQHQ
FT                   EQQQQKQQHPKRSDSGYSARQQSSSFDRIGGVPLGHSHAPKSALPDDIDALYHQMQHLG
FT                   SRWADLHAEAELLEESKKCVLASITLHYMNDGDTKSSGETKAFAAPEYREHVQKMVEAR
FT                   RRANQAKVEFEGMKAHLNLTRTYEASRREEMKLM"
FT   CDS_pept        complement(364438..365442)
FT                   /codon_start=1
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639511"
FT                   /gene_name="RFC2"
FT                   /orf_name="MICPUN_54938"
FT                   /product="Replication factor c, subunit 2 "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="ACO68741.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000199C5B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD83"
FT                   /transl_table=1
FT                   /translation="MNGAQAVASLPWVEKYRPTKIDDIVGNKDAVDRLTAIASTGNMPN
FT                   LIFTGPPGIGKTTSVLCLAHTLLGPSYKDAVLELNASDDRGIDAVRNKIKMFAQKKVTL
FT                   PPGRHKIILLDEADSMTSAAQQALRRTMELYSSTTRFALACNASEKIIEPIQSRCAIVR
FT                   FTRLSDQEVLERIVKVVEREEVPYVPDGLEAVVFTADGDMRQALNNVQATHSGFGFVNQ
FT                   ENVFKVCDQPHPQIVVDCVACCLRGDVDHAHDKMKSLHDAGFSAADVIGTVYRVVKNFD
FT                   AESMPEFVKLEMIREVGFTHMRIGDGVNSLLQLGGMCAKMCQVVERAKTGVMR"
FT   CDS_pept        join(366350..366513,366831..367350)
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639512"
FT                   /gene_name="LHCA1"
FT                   /orf_name="MICPUN_104693"
FT                   /product="Chlorophyll a/b-binding protein, psi-associated,
FT                   chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68347.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199C5B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD84"
FT                   /transl_table=1
FT                   /translation="MATFISHNPIVARASLFAGRRLATQTTNGTSKVSMRATWMPGSAP
FT                   PSYLDGSMPCDYGFDPLGLGKEPDNLARFQEAELIHARWAMLGVSGAAGAEIITGINWV
FT                   EAPVQSQQTYLGNTIPFPLPAIAAIEVFVMAYVESKRGSETDRSKRMYPGGAFDPAGFS
FT                   KGADFEKLKRKELANGRVAMLAFAGIIGEAQANNLEGPVAALARHLADPWHVNAATNVA
FT                   AVPYL"
FT   CDS_pept        complement(367819..369390)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639513"
FT                   /gene_name="OBG1"
FT                   /orf_name="MICPUN_113212"
FT                   /product="Obg family gtp-binding protein "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68742.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG716038"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="UniParc:UPI000199C5B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD85"
FT                   /transl_table=1
FT                   /translation="MGSTMFIELHAFSAGSHIRGTHIEASLIGLKRHALTNRYKMQTSI
FT                   NCARNSDKSYHEQHKVANLILPYPIEREEFCLCVFTTKHHISQHPQRGDRRSVLNDSQP
FT                   DKNHKHRHLYFDEATITVSGGQGGDGEAWQTSKTKTVKNFKYKWGTNSQKFIELPAAEP
FT                   ADGGRGGNVYIRVDRACDSLLHIHKRKFWRAKKGYHGSSAPHSTPGRERPRLALTQEDL
FT                   YISVPAGTVVRRKRSGELIADLTSHGMAILVAEGGAGGIAARPSQQMYSRRQKKEKEVS
FT                   DVGLEISPRVTTSGEPGEVVTLQLLMRVVADIGIVGLPNAGKSSILKAITRATPDIASY
FT                   PFTTLMPNLGVIHCERIVSEKLIDIDHETCALPVIADLPGLIKGAHKGRGLGRAFLRHL
FT                   RRTRAMLIVVDASGQDPVSDYTTIREELRLYNPEYILRPHILALNKIDFEWAALRVQEI
FT                   KAEVQSLEESAVGPAPIAVLPVSAVSGSGMDILISELMEAMRLCDEELSIVRGSAMDSR
FT                   DKSDSI"
FT   CDS_pept        370484..372391
FT                   /codon_start=1
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639514"
FT                   /gene_name="TOP1"
FT                   /orf_name="MICPUN_113917"
FT                   /product="DNA topoisomerase I"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO68348.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG521929"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI000199C5B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD86"
FT                   /transl_table=1
FT                   /translation="MSDGEDDLPLSTRARVAIAGNESDSDDDVPLSARVPGATTGKRKN
FT                   MSNRNRPAHKRKSSDTEDDNSSDDKPIGSLVDISDRKSTTAGGSAKKKTKRADHEPWRA
FT                   KRGAKQMWSTLEHNGVVFPPPYQAHGIPLVYDGHDVKLLPHEEEVATFFAVMKDTDYAQ
FT                   KDIFVKNFFDGFKKTLRGGPHGFIKDFKKCDFTKIYMWNLQERERKKSVSAEEKRKVKA
FT                   EQAAAEEKYCWATIDGRRERVGNYKVEPPGLFRGRGEHPKMGRVKKRIMPEDIIINIGK
FT                   GAKVPEPLPGHKWKQIIHNNTVTWLCGWNDTINTKDWKYVQFGATSSIKAESDIQKYEK
FT                   ARKLKLAVDAIRRDYFKKMKSGSVLEQQLAVTTYLVDKLALRAGGEKDDDLADTVGVCT
FT                   LRVGHIDFLPPSTIKFDFLGKDSIRYLQEHEVDPLVFHAMQRFCKGKKKDQDIFDHIDP
FT                   TKVNKHLQTLMPGLTIKVFRTYNASYTLNKLLKETTPAGDSTVPMKKAAYDAANKEVAV
FT                   LCNHQKGVSKAHDAQMEKLQDKKKIIEKEIAALRRDKKDTNKAKIRTLKERLSKLELQM
FT                   KMKDELKSVSLGTSKINYMDPRITIAWCKHNDVPPPTVYTKALVEKFNWAMEVEPDFDF
FT                   "
FT   CDS_pept        complement(372607..373320)
FT                   /codon_start=1
FT                   /gene_family="HOG000078819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639608"
FT                   /orf_name="MICPUN_113916"
FT                   /product="DSBA oxidoreductase"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /cellular_component="outer membrane-bounded periplasmic
FT                   space"
FT                   /protein_id="ACO68743.1"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0030288"
FT                   /db_xref="HOGENOM:HBG559048"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C5B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD87"
FT                   /transl_table=1
FT                   /translation="MDEVMQMPMDRSNPLRFFVLRVPFFLEPHYDRDASWHETNRERLE
FT                   RKWGGKASFVAQKQRHRLKERGQEVGIQHFNLDRLASNTLASHRVVQWMTKLYGCVASE
FT                   ALYNELNHNHFIEGMKLNDSSLLCQAATTAGADYIACDAFLASNEGIVEIEQTQVVLER
FT                   LGISSIPTFLIGGKVIISGAVHSSELVRVFREIEKAGIGAPDTVFADTLKIPNHMRQST
FT                   LPPPEKDFSIRPASF"
FT   CDS_pept        join(375074..375120,375271..375305,375437..376306,
FT                   376392..376795)
FT                   /codon_start=1
FT                   /gene_family="HOG000201905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639609"
FT                   /orf_name="MICPUN_112663"
FT                   /product="Fatty acid desaturase"
FT                   /EC_number="1.14.99.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68349.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559049"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199C5B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD88"
FT                   /transl_table=1
FT                   /translation="MLSTTSMTCTGCMHIGLSAVKSHNLSRGGRLHWPVSKLTSRSRKP
FT                   ARATTRKTVCPAASSAIQDIPHSGLEGQALRFPTKDDFPTRAEVLTSIPEDCFEKDTVK
FT                   SLFYAALSAAMTLSCGLLAFAYVPMKLAYLPTWLAYAALTGTIGTGCWVIAHECGHNAF
FT                   SKNRFIQDAVGYLLHSLLLVPYFSWQRSHAVHHSRTNHLTEGETHVPYVKGEVKGSLNL
FT                   ELHKRLGEGPFAILQLVAHLVFGWPAYLLTGATGGSARGVTNHFIPSINTGPIELFPGS
FT                   WKKKVWLSDVGVVGFVAILAHWAYNSGLATVAALYFGPYLFVNIWLVLYTWLQHTDTDV
FT                   PHLAASEWSYIKGAFLTIDRPYGAIFDFLHHRIGSTHVAHHVECAIPHYNALKATDALK
FT                   QKYPDLYLYDPTPINAALWRVASKCVAVEPRCQGKDTIWTFTTKKQPAVERS"
FT   CDS_pept        join(complement(377199..377295),complement(376996..377066))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639610"
FT                   /gene_name="SNRPD2|FCP1"
FT                   /gene_synonym="FCP1"
FT                   /orf_name="MICPUN_54946"
FT                   /product="Putative uncharacterized protein SNRPD2|FCP1 "
FT                   /protein_id="ACO68745.1"
FT                   /db_xref="UniParc:UPI000199C5B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD89"
FT                   /transl_table=1
FT                   /translation="MVCEARSFGVIVIAQLARHKSPNCKETTKFCEGEFRQRDALGRAQ
FT                   DTAFCVKSST"
FT   CDS_pept        join(complement(377856..377867),complement(377415..377708))
FT                   /codon_start=1
FT                   /gene_family="HOG000223545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639611"
FT                   /gene_name="SNRPD2|FCP1"
FT                   /gene_synonym="FCP1"
FT                   /orf_name="MICPUN_54946"
FT                   /product="Small nuclear ribonucleoprotein sm D2 "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO68744.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199C5B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD90"
FT                   /transl_table=1
FT                   /translation="MSVQKNEGQDFQAGPLSVLSHSVKTSAQVLISCRNNRKLLGRVKA
FT                   FDRHCNMVLENVKELWTEIPKTGKGCKKARTISKDRFLSKMFIRGDSVILVLRNPK"
FT   CDS_pept        join(complement(380223..380298),complement(379915..380168))
FT                   /codon_start=1
FT                   /gene_family="HOG000168285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639612"
FT                   /gene_name="PHF5"
FT                   /orf_name="MICPUN_89348"
FT                   /product="Component of splicing factor SF3B "
FT                   /protein_id="ACO68746.1"
FT                   /db_xref="HOGENOM:HBG332020"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniParc:UPI000199C5B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD91"
FT                   /transl_table=1
FT                   /translation="MARHHPDLIMCRKLPGIAIGRLCEKCDGRCVVCDSFVRPATLVRI
FT                   CDECNYGTNQGRCVICGGPGIADAYYCKGCTTTEKDRDGCPKIINLGSAKTDLFYERKK
FT                   YGFRK"
FT   CDS_pept        join(382064..382229,382481..383574)
FT                   /codon_start=1
FT                   /gene_family="HOG000223249" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639613"
FT                   /gene_name="HISG"
FT                   /orf_name="MICPUN_54948"
FT                   /product="ATP phosphoribosyl transferase chloroplast "
FT                   /function="ATP phosphoribosyltransferase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68350.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003879"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG391868"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniParc:UPI000199C5BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD92"
FT                   /transl_table=1
FT                   /translation="MAALMSAAQVKPSWFSAHNLLRGPKTGRASAVRAERSGVNHLTVA
FT                   SIRQQKPSMQAVYRRSVESRDSIRMGIPSKGRMAEDTMNLLDDCQLKVRKINPRQYAAE
FT                   IPNVPGMEVWFQRATDVVRKLLSGDIDIGIVGYDMLREIGNEDDELVVVHDALGFGFCH
FT                   LAIAVPSSWEDINSLPELLSDKRWSKDRPLRVVTAYMNLAERFFGDLGFENVELFTADG
FT                   ALEAAPAMGAADCILDLVSSGTTLRENNLKQIEGGRVLDSQGVLVASKTALLERPGTLE
FT                   IVHELLERLEAHLRAEGLFMVTANVRGETAEEIATRLAANGGRLLRGLQGPTISPIFTA
FT                   GEDNLPSSDGTFFAVSIGVPKSRIYEAVKEIRKQGGSGVLVFPLTYVFDEEPPRWNALI
FT                   NHLGLDSRDYQHLKIGGGIR"
FT   CDS_pept        385639..387162
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639614"
FT                   /orf_name="MICPUN_54949"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68351.1"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199C5BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD93"
FT                   /transl_table=1
FT                   /translation="MPLAGRSFFTARRANILLSDRYVDRRAPASTTISTAPGKFCGAAR
FT                   PVSGGTFQSRCQDPVAGQRGNVPTCRNISSGMSTPPAYFPGPVEDLEESLEPAVVECLE
FT                   FVVKREASLNGCSSRPTVIETMDDDSFDMEESMSEFVKANRSGIGVYKNASGCMCEDVF
FT                   CTDPGLNQNLISNEGSATISRFFDQDEWERHRNVGRYWRHLFSAHKSTVFLRVLEPVLM
FT                   MSTAAALVAAWNTFMTTVYGLPALCIVPLAHQLTGGVVSLSLVFRTNNANRRVIDARQL
FT                   LSKLSKCTRDMTRVSQYIPNEGDCRIETLRHLRAFPYALESHVRKGRTRQNPKDPTSFR
FT                   VDPMPCMARALGKRRARRFMFYENIPAQVLMDMTQILQRALMKGMSTQMHAQAEIIVKE
FT                   LSAVLAESEKILYTPIPISFTRHTSRILTMWLFTLPLSLWLPLGWCMVPAVFLISWVML
FT                   GVDEIGIEIEEPFCILPVRPLCDMCDREIVGTMAQALQAQDYQPARKKV"
FT   CDS_pept        join(complement(388725..388762),complement(388389..388558),
FT                   complement(387721..388262))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639615"
FT                   /gene_name="LHCA2"
FT                   /orf_name="MICPUN_54950"
FT                   /product="Chlorophyll a/b-binding protein, chloroplast "
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68747.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199C5BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD94"
FT                   /transl_table=1
FT                   /translation="MTAIVSQQTFRTGLMIRAHRHRSLGCRSARSSVRTVAAAVRPNYF
FT                   PGSTPPKHLDGTMPGDYGFDPLGLGEDKAALAWYQQAELMHARWAMLGVAGMAAPEIFG
FT                   NPLVDGPLPNWADAPFYDGYIADANTLFVVQMFLMNWAEVRRWQDMKNPGSVHADPYDE
FT                   SRKCTGTDVGYPGGGLFNPMGMAKSAEEEKTLRTKEIANGRLAMVAAMGCFIQHDVTGT
FT                   GPVANLKAHLADPAHATIFQNFQPLSF"
FT   CDS_pept        join(390219..390315,390608..392026,392159..397062)
FT                   /codon_start=1
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639616"
FT                   /orf_name="MICPUN_113382"
FT                   /product="Acetyl-coa carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="ACO68352.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG320067"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI000199C64C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD95"
FT                   /transl_table=1
FT                   /translation="MQALSAAASRSAFAPRTSTSTKTRRKQVFFARGKTSSAPLSPSFN
FT                   AFIPAPGNQTVYRVFHKSKPLHTDICTRAAISAPADTSADATSTESLARYVAAHGGKRV
FT                   IRKVLIANNGMAATKAIISMRRWAYNEIGDENAIEFLVMATPEDLKANAEFIRFADDFV
FT                   EVPGGSNKNNYANVDLIVDIAEREGIDAVWPGWGHASENPKLPTALKERGIQFIGPTAP
FT                   VMSVLGDKIAANILAQTAKVPSIPWSGDGLEADLTEEGTIPVDIFNKAMVTTIDECLES
FT                   ANRIGYPVMLKASEGGGGKGIRMSANDDELRVNFEMVKAEVPGSPMFMMQLCTQARHLE
FT                   VQIVGDEYGNAVALNGRDCSTQRRFQKIFEEGPPSIADPQVFREMEKAAQRLTRNIGYI
FT                   GAGTVEYLYNAETHDYFFLELNPRLQVEHPVTEGITGVNLPATQLQVAMGIPLNRIPDI
FT                   RKFYGLKPDADTPIDFMEEDYVLPDCHLIAARITAENPDEGFKPTSGGIERVSFQSTPS
FT                   VWGYFSVGANGGVHEFADSQFGHIFAVGVTREDARKSLVLALKGMVVRGEIRTAVEYLV
FT                   QLLETDDFKANAIDTSWLDGIIKAKSIAMKEDPHTIVASAVIYRAFQMVKSEEAAFKEF
FT                   WQKGQTATQGIARLTQFPMDITYQEVKYSFMVQRRGPDSLVLSLRGEDLINARIRERSD
FT                   GVLLGIWGGQTHEIDGLEEPLGLRMVLDGQTWLLPNQFDPSELRTDVTGKLIRFLQDDG
FT                   CEVIAGKPYAEVEAMKMVMPLIATESGTISHAKSGGAVIEAGDLLGTLQLKDPNKVKKI
FT                   SPFGGKFRISSDEGSDAPSPSEALEDAITATNLVLDGYVLPVDETVNNLLERLCDPTLP
FT                   DVDGGRWQRACSVLNGIVDRYLAVECIFAGKKVDAVMRDQIRINAGELDNLLKIVLAHA
FT                   RINQRTQMVISLLKQAPTLPQRIMGGPIGWADDHAPISDEFRASIERLSNLRGTDYGEL
FT                   ALTASNILLEKRLPSIDKRLSELKSILSGGVGLDRAWGTAEAGDLKSLIESPTLAVDLL
FT                   PSLFVDSDADVADAALEVYTKRVYRAHNVISTDIVRVDGLDSMNFKFQFNTYPEESPLR
FT                   FGVMVVTSTLETAKLQMVAILDRLADHIGDASKDTPIHVLHIALSNQADDGSLADRCAA
FT                   VLSEFRGRMAELGVKFVNVISYVPPNLPHYYTFTAASGYQEDPLYRGERPTVAHLLELA
FT                   RLENYNLTRLPTVNRDLHVYVGESKQGFGKRGLQKHMLLRRISHSRDAADGGIERVLGK
FT                   AVEALDLASLDPRTKGTSSGRIYINFLPLQTSSPFDACVSALKTKVLEFISRNSTELLA
FT                   QQVDEIEIRFRIAENPGSPVQVPVRIMATSMSGQWLKVDVYREYLDPQTGKATQFCMLG
FT                   ADGAEEACFLEPYPMPGTLQQKRSIARAIGTTYIYDFLGLIEKALVLEWRQFVATRGAG
FT                   DVPVDMFRAEELVLSQDDGSLSKAEASRIAGSNDIGMVAWQCYMKTPEYPDGREIVLVG
FT                   NDCTFMSGSFGVKEDDFYFAVSQYARQRGLPRVYIASNSGARIGLVEELKPYFRVAWID
FT                   ASNPSLGFKYLYLSPDDYAAFPSGTVNASEVIDDGETRMKLDDIIGQIHGIGVENLRGS
FT                   GMIAGEQSAAYADAFTLSYITGRSVGIGAYLCRLGQRNIQMTNGPLILTGYLALNKLLG
FT                   REVYTSQDQLGGPQVMMPNGVSHMQVDDDQEGVREILRWLSYVPSTCFTRSPALPSVDP
FT                   VTRKIEFKPTKTPYDPRHMISGTEAVDGSWVGGFFDRGSWTETMAEWGKSVVCGRARLG
FT                   GIPMGVIAVETRLMEQRIPADPANPESRETVLAQAGQVWFPDSAYKTATAIRDFNNAEN
FT                   LPLIIFANWRGFSGGTRDMYGEILKFGAMIVDELRVYRHPVFVYIPPNGELRGGAWVVV
FT                   DPTINEERMEMYADEESRGGILEPPGICEVKFRDKDQKAAMHRLDPVLLELDQEPETNQ
FT                   AEIAAREAQLLPMYTQVAHEFADLHDRSGRMLAKGVIRDVVKWEDARKYFFDRLQRRLT
FT                   TDELSTETNANRMVLEDRLLSMTLQAGVDWNDDAAVTKWLTENAEVVKEEAMSIGRDSI
FT                   IEDAIQNLKQLDQSALLRVLEKISQGRTK"
FT   CDS_pept        complement(397202..399793)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639617"
FT                   /orf_name="MICPUN_113925"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68748.1"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniParc:UPI000199C64D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD96"
FT                   /transl_table=1
FT                   /translation="MFIDSLSLRVPSTGVQYGVRAQIWWVACARDVSPCTSGLLRLSNI
FT                   FNLNNWIIQQTTRITPVLRFDAGLCAGETNSELVCGARFSLGRSFQRSEISVDAQLRAY
FT                   ADDKVVVGAIFVGLLPRQVSLYIAPVIEAGLISVKGIGVVDRCVGLEKPNNACSFQSCF
FT                   DARYDESSQQKSVEIYAEPRCCENLKDLLSIIYPELCAAAALAQQRKRAAKDMLISRLV
FT                   TGIRFAKNASDQGLDLFSAHEQLILNEFSESSRAAKYLAVRLLQRRTPRTRISSIKMYF
FT                   ESPKIQSAVDELIDRGLAFSSCCVSRHYTTADIKAICESLARDELTQFADYVRNNLPSS
FT                   RGSMIDMITHASTDGGARFGHCSSTKILYKIKGGKGADIELNGIADIIGVASSLKRTLR
FT                   TVLLFLFLQRSGIDWLMIEDIRATRFTLFDMPMETLASTCPAPAFDISSNGKQKVIMTT
FT                   CVNSVCTSAPAFAAFAALCEKSTALDLASEAGDSSTVFRILSHDFLPHFFSAGHQDFIK
FT                   KVVCSTSFHIVNAIVTYMCLLEKHGYYENATVVLVKSILSVFHPKNQSLWLVHTSSNLS
FT                   RIHARIRDALEVNLSVLRNPLLHYGVGPVLQQRVRRLARLCNHTSQLPESLFVDVETVL
FT                   RVDNICARALNANAKEKKRYASLRVGMGRVSLTVEDLALLHYAGDDCGNWRGVHVESRF
FT                   WTMLFSLLFADVIFMPVVGAFRSPFQSTPFDMYTANFTSVRLSAINQRLASIRRGDSRT
FT                   IIIRSWSAHFGRKISGIFWHLLRIEDLCDILDGIGGMAIHYMMKLLMLDYRVWSIGAPD
FT                   LILWRKTTNSSAEVKFVEVKSSNDHLTERQQAWLSALYEAGVDVAICKVSS"
FT   CDS_pept        400764..403631
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639618"
FT                   /gene_name="PIGO"
FT                   /orf_name="MICPUN_113927"
FT                   /product="Glycosylphosphatidylinositol ethanolamine
FT                   phosphate transferase"
FT                   /function="transferase activity"
FT                   /protein_id="ACO68353.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000199C64E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD97"
FT                   /transl_table=1
FT                   /translation="MLRTDLSSGTFGGVRFPLFVFLVLLAVGKTLALLIYGSGFYLTRM
FT                   QLLNANTCDFQRNASQEFRYNQALTPYDLSPGDAECWTETRVDKVVLMIIDGARFDFAA
FT                   ASFNSKENVWSGNSPLSSIAETVQKYPETTELYRFVADPPTTTQQRLKSILTGGLPTFL
FT                   EISKSFGAAKLVEDNLISQAAAAGRRISFSGDDTWLELFHHVHFAASVDAHPSFNVRDL
FT                   DSVDQGVRRHLLTALDNPDDWDILIGHFLGVDHAGHTYGVESQAMIKKLQENDADIKAI
FT                   SSAMRADSAFDNALLIVMGDHGMTLHGDHGGGTSAETDSFLLIHQPRASSLQEVTQHKN
FT                   SSKALSNLDLKTMSQIDFAPTLSTILDIPIPYGSLGAIQRRFLEVASTLDPRKETHALH
FT                   MNNQVIEEWYLRALRGATMQVWRYLNAYVIEAGNPFSVDDWSRLQDLYNSSQSLTASDG
FT                   DRVQMLEGFLSIAAETSRERWIQFSIRKMAVGVVLLICLLAICAMSKLLFLCEDAVVDA
FT                   RWKSILSRINAIHNMFESRAVHMEMIFLLIVAGLISGYRVSNSFITAEADVAHFIVASF
FT                   ALFFSVFRISFLRRALRSQIRSDAALQSGLGAALLTCNTGCQLLGATWLKHADHGASRH
FT                   VLPMTLSFLSRTIIFCAHGALPWICHRAMIQGNANGQRACITLASASLGLLTFKHGTCF
FT                   SVLLRLVGVGTLGPSVSPELFLPWVTYIASSIAFIVPVGFGKRSLNRYKIQIDTHGTMW
FT                   SLLSIFVLSFGERGSLWGVLSITQSAAVLYSSSPGSAAVNYYNFREMTLALTWHVLALQ
FT                   CFFAGGHHCTFDSLHLTCAFIGLNNFHFVIMGILLSSNTWSGEALISGQIPTVVVSCLN
FT                   SRRVDEEHLTKVLRNALSRFVLSYAVCRLVTIVVISGFVGAERGHLMVWAVFAPKFAFD
FT                   AAGQLFGDAWLIFGVLICVRHLHTE"
FT   CDS_pept        join(complement(404740..404742),complement(404506..404628),
FT                   complement(404344..404389),complement(404196..404281),
FT                   complement(403887..404084))
FT                   /codon_start=1
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639619"
FT                   /gene_name="RPS14"
FT                   /orf_name="MICPUN_113929"
FT                   /product="Ribosomal protein S14"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68749.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG385416"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="UniParc:UPI000199C64F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD98"
FT                   /transl_table=1
FT                   /translation="MADEEKGVPAAEEKKPWLPNPREGEHVFGVAHIFASFNDTFVHVT
FT                   DLSGKETIVRVTGGMKVKADRDEASPYAAMLAAQDVAVRCKELGLTALHIKMRATGGNK
FT                   TKSPGPGGQSALRALSRSGLKIGRIEDVTPVPTDSTRKKGGRRGRRL"
FT   CDS_pept        405520..406011
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639620"
FT                   /orf_name="MICPUN_54955"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68354.1"
FT                   /db_xref="UniParc:UPI000199C650"
FT                   /db_xref="UniProtKB/TrEMBL:C1FD99"
FT                   /transl_table=1
FT                   /translation="MNRLVGASGRWDQYACMSCRVSAADTGDNRRDSSPPESQFFLRSH
FT                   PAPPVTSKRANMGDTHAEAAAGPEPMTNRWFYASCPWRALRERTLLSCIEPGLLHSFVV
FT                   FVYYVNSPAVKANFPLQDEYTLTLCDRFTVNLARISPTNHNVIQLKRSLRLSKFVITLE
FT                   "
FT   CDS_pept        join(complement(406771..407052),complement(406467..406688))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639621"
FT                   /orf_name="MICPUN_54956"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68750.1"
FT                   /db_xref="UniParc:UPI000199C651"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA0"
FT                   /transl_table=1
FT                   /translation="MSYTTGHYMKAVPFRPKRNACLKPDGGHISATQPAAIKLRCESGA
FT                   SCSSSHFAAMEVQLVLCRRHVKKSSDGASIVLGPQPDTEEEGSALDFPEEYVRAVPSRR
FT                   PDIFPDLKEPKQPMPNPMPADPEMPDEEEEEEERKKSPGEPGTDPDEDEDNPKPAKKDD
FT                   EEDA"
FT   CDS_pept        409069..410235
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639622"
FT                   /gene_name="BDP1"
FT                   /orf_name="MICPUN_113932"
FT                   /product="Transcription initiation factor TFIIIB, Bdp1
FT                   subunit"
FT                   /function="DNA binding"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO68355.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="UniParc:UPI000199C652"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA1"
FT                   /transl_table=1
FT                   /translation="MHVNKNRARETRRQDAADHSKRHAQGDAACPGSLSNQVSVGTTRE
FT                   QNNLRQAYSRLHDGKRQKEGVQNDESTLLLLGSVQSVKHNDLNLRERNRPASKSGDSGN
FT                   RGPTSTHNPLFGKGTPAHRWVRTASTVRGNRLNATSRKNGAAPFSSKADYDVSRSIRDI
FT                   IRQRSREERVAESKNRAVTRSTDTQPSPEKRQATVAPSQVVDGIGKNAKYSQKLLRDES
FT                   NVCNMGVESNVAGLSDGTFPGAPQVRVVDGRIVVNEKSLIVSAMDERASILRDFIRVEE
FT                   SGNKLNSATYANYTKAEKWTREDTDFFYEALRQFGTDFSLLQRLFPGRSRRQLKKKYLV
FT                   EDKVNPSRIEAAINDLKPRQQLYRSLIDLLTVPEQNASVEDARELLSD"
FT   CDS_pept        join(complement(410904..411500),complement(410797..410847),
FT                   complement(410554..410712))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639623"
FT                   /orf_name="MICPUN_54958"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO68751.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C653"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA2"
FT                   /transl_table=1
FT                   /translation="MAYHPGVNMPTGQEPDQVDVEAFYVRTEELIPCAEPKTDAASIPS
FT                   LLESESWISVCHALLLARRLAAHHPEELSRTLEQILPSLNLHMNSLRSSLCKTALICTA
FT                   DFFRSYGDSLLAIAPGGLPVLVNTLLSKAALEKKFVIEEAKRTLAAMTTSISTNILIDV
FT                   LLPQARSPNSKIRAVVASCMADTVGKAISETRPGTESCIHITRAELLRTAAALVTDKEP
FT                   AARKSARVVLCKLKESHVSSASLESWQTFIVTVLGKGLVLQIGRAL"
FT   CDS_pept        413151..414515
FT                   /codon_start=1
FT                   /gene_family="HOG000239005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639624"
FT                   /gene_name="TAT"
FT                   /orf_name="MICPUN_113229"
FT                   /product="Tyrosine aminotransferase "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO68356.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG525477"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005958"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021178"
FT                   /db_xref="UniParc:UPI000199C654"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA3"
FT                   /transl_table=1
FT                   /translation="MKVNPLVSKANNPIRSIVDDLVGKQNPAKDLISLAQGDPTAYGHL
FT                   KPPEEAVAAVVRAFLSGNHNGYTASSGSAACRAAIATTHSCKNRPPLSRDDVFVTVGCS
FT                   EALEHCITVLAVPGANVLLPRPGFPLYETLCQRHGVSFRFYDLLPETGWEVDLESVRRV
FT                   YDDATAALLINNPSNPCGAVYSRDHLKDLVTLAQTLELPLIADEVYAGMTFGKPFIPVA
FT                   EVAGKVPVLSVGALSKRWLVPGWRLGWLCIHEIGTTLYDSGVRTAINRLCQISLGPSTP
FT                   LQAAAPQILALDDSIWLRNVLRKLMSAAAYSAKRVARIRGLRILSPPQGAMYVLVHIDR
FT                   HAFLDCPSDLLFAEKLLEEESVLVLPGTCFRAPGFVRIVTTVPEPVLQAAWDRVESFCA
FT                   RRCTRTLQITDTSTSSAREGHSTLANLPQVASYIGGHEGLLLRPPSQCATQENSE"
FT   CDS_pept        join(complement(417420..417648),complement(417119..417344),
FT                   complement(414620..416987))
FT                   /codon_start=1
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639625"
FT                   /gene_name="PANK"
FT                   /orf_name="MICPUN_113383"
FT                   /product="Pantothenate kinase"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /protein_id="ACO68752.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG388109"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniParc:UPI000199C6D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA4"
FT                   /transl_table=1
FT                   /translation="MQLVGAPPETAHLTATVPAISKPRSKNVLDLTDAAISTGEASQPE
FT                   SSGEHASQAKREAVPSITLPRQSSDVRHFAMDMGGSLVKLVYFSPDAEDEAADSLRPSF
FT                   IGGGRLHFRKFEASKIEQCVRFIEQKRLHLGAEGGKAVVKATGGGAFKNSELFLDQFGI
FT                   QLQKEDEMKCAVAGANFLLQAIRDEAFTFTEGRKNYVAHKDGSHDDDLFPYLLVNIGSG
FT                   VSIIKVDTDGFERVGGTNIGGGTFWGLCRLLTGMRDFDQMLACSAIGDNSKVDMLVGDI
FT                   YGGRDYAKVGLSSTTIASSFGRVVMDGGSLTDYNKADITLSLLRMISYNISHIATMTAV
FT                   KHDLKRIYFGGYFIRGHAYTMNTISFAVDYWSKGNLRAMFLRHEGFLGALGAFLQDGQA
FT                   QALKTSPLQGAWIEKFIKCSMPMSSDERLEAKMRDKAGNACNLWGPGESLSISSSRTDL
FT                   RKHPGVGRAQSFLETGPTKADVNTTSINIFLENHDQGPFCDLLVDDQSGLESSVLDYGS
FT                   NQLLSKAGLQVGVLHLVPTLQLFPLLKVPERYEPNVIDILEFREEREYWLDTLQKLNPG
FT                   LLEKAVASECAFQGTGKVSCSDTHKRAKAFCLAFSTHLDRLRDEPAAYGRIGLSELLEM
FT                   REECLRAFGFKDVYSAIKQQENAAALAVLPDLLADLDVLHEEERVLALIEGVLAGNIFD
FT                   WGSQSCVDLYKNGTILEIYKNVRSSIARPWAVDCFDDFREALLGIDQQRTTSLVGEKQQ
FT                   QQDVSSVYHSRYKKALVFCDNSGADVVLGIIPFARELLRQGTDVCLVANSLPAINDVTA
FT                   DEMRDVLRRAAHMCEIVSSAIARGHGKESGNISNDVGKLTVCASGSGSPCLDFRRVSHD
FT                   LCEATRGVDLIVLEGMGRAVHTNWKAKFCCDTLKLAMIKNSRLAKSLFQGKIYDCVCMF
FT                   EPRMCDDDGE"
FT   CDS_pept        417908..418174
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639626"
FT                   /orf_name="MICPUN_54961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68357.1"
FT                   /db_xref="UniParc:UPI000199C6D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA5"
FT                   /transl_table=1
FT                   /translation="MVEILYGCSIGTKSPYNYYYYYYYYYYYYYYYYYYYYYYYYYYYY
FT                   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYDYYYYYYY"
FT   CDS_pept        join(419248..419283,419342..419554,419611..419973)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639627"
FT                   /gene_name="RBX1"
FT                   /orf_name="MICPUN_113936"
FT                   /product="E3 ubiquitin ligase Rbx1 "
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO68358.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C6D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA6"
FT                   /transl_table=1
FT                   /translation="MATHKKNFEVKRWNAVAVWSWSICTDTCAICRNSLHEPSIEYQAN
FT                   PSSASEEGLSIAWGNCGHVFHLDCISKWLRTRSNCPLCNKEWEFAKIEKVRMHDIYLLA
FT                   EGLACIHRSIIPHMTLNTDTTPCHGGRWMIIFFNLKPAVFAEESYKTNSSKACPAYFFL
FT                   ERVISCSRRCHPTGRDNFPRASVECYWHGTKNGKSGFPHD"
FT   CDS_pept        complement(420060..420134)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639628"
FT                   /gene_name="XBR1"
FT                   /orf_name="MICPUN_113231"
FT                   /product="Antisense non-coding"
FT                   /protein_id="ACO68753.1"
FT                   /db_xref="UniParc:UPI000199C6D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA7"
FT                   /transl_table=1
FT                   /translation="MVSCFVRTFVPSNVPSKERNEVFI"
FT   CDS_pept        join(420711..420758,420824..420904,420986..421144,
FT                   421237..421299,421355..421504)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639629"
FT                   /orf_name="MICPUN_113393"
FT                   /product="Transcription initiation factor subunit A "
FT                   /function="DNA binding"
FT                   /function="transcription initiation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="ACO68359.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199C6D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA8"
FT                   /transl_table=1
FT                   /translation="MGDIANEAADAFSTQIKVFHGRRAHSVHEATDAVQAIPRHSLREL
FT                   LLKAAPGEDIEPAVEDFLLDLADDFIDSVTSFACKLAAHRRSDTVEMGDIMVHLKRSWD
FT                   ISVSGLGVDGSIKETRDPNNICGMHNSRMMDMRQAIASSLSQEDMLKEKEVEASKGLPA
FT                   LSR"
FT   CDS_pept        join(complement(422184..422225),complement(422045..422117),
FT                   complement(421935..421990),complement(421716..421870),
FT                   complement(421603..421648))
FT                   /codon_start=1
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639630"
FT                   /gene_name="TRM112"
FT                   /orf_name="MICPUN_113392"
FT                   /product="Methyltransferase-associated protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO68754.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG526194"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI000199C6D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDA9"
FT                   /transl_table=1
FT                   /translation="MRLLTHNLLASNVKGAKTGFPLKIHVFVQEEHETAFNKAFLLATL
FT                   RKINWIAFREAADSLGVPNLPELPPDLDKCDDSMLRKYHHALMEVHVKEGYLICPDTGR
FT                   RFPITKGIPNMLLNEDEVC"
FT   CDS_pept        join(422878..422899,422997..423850)
FT                   /codon_start=1
FT                   /gene_family="HOG000175900" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639631"
FT                   /gene_name="TFB4"
FT                   /orf_name="MICPUN_54965"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   4"
FT                   /function="general RNA polymerase II transcription factor
FT                   activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="core TFIIH complex"
FT                   /protein_id="ACO68360.1"
FT                   /db_xref="GO:0000439"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016251"
FT                   /db_xref="HOGENOM:HBG737144"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="UniParc:UPI000199C6DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB0"
FT                   /transl_table=1
FT                   /translation="MLGVRGSGTSSALVILVETSIDENSDGERMEGTSSDDGLGIMHTL
FT                   RDLVLFISCYLALNLQNDLVVLALHNGDCHYLYESPKSKLRRGVRVQPPVSDVCKEIIT
FT                   RIFRISSSPLQSPSGDASSSGSESPLAAGLSMALCHIQRLGTGSFRGLRRIFCLLRSPV
FT                   SQRQYIPMMNVIFAAQQAFVTIDSYSLCDMHSDILEQAANMTNGLHRKLQKDGELGQHL
FT                   LTFSSWSQTCRHSLLPGKQCGVDFKTFCFCHKKTLQRGFVCSACLSISCVALKTGGDCM
FT                   TCAANFDTCS"
FT   CDS_pept        join(complement(424767..424957),complement(424213..424669))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639632"
FT                   /orf_name="MICPUN_113391"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68755.1"
FT                   /db_xref="HOGENOM:HBG559063"
FT                   /db_xref="UniParc:UPI000199C6DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB1"
FT                   /transl_table=1
FT                   /translation="MPTTFGLGTIAVKAHPLGRLRLSQKAIRLAKRSTRSPSLQVTAKG
FT                   KGGGRRAGKSQRPGGQPSVEKFMPPVDPDNEQFVIYVRSKKGFKAWFPLNVVTGGSTAN
FT                   TLVKGLDSNLSRDMAKKSLTNNIGQAIYKDADQLQEMCRRMPMLKAAKELEYGFMILDK
FT                   KNPSSMFNPPAESVFVIPPEDETRMPAQKMAEGWQSAANTVKNILGSKNSAD"
FT   CDS_pept        join(426117..426152,426349..426399,426495..426561,
FT                   426735..427798)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639633"
FT                   /gene_name="GAPB"
FT                   /orf_name="MICPUN_104695"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase B "
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68361.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000199C6DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB2"
FT                   /transl_table=1
FT                   /translation="MTAFVASNTSLKYGFCGNVAGLKRGKAVKAAAINTMTEAKVKVAI
FT                   NGFGRIGRNFVRCWMSRGADTTLEVVCVNQSGGAKPAAHLLKYDSILGTFDADVKVVDD
FT                   ATITVNGKPIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKHIQAGAKKVVITA
FT                   PAKGNDIPTYVVGVNADQYDPSANIVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTCHS
FT                   YTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNV
FT                   SIVDLVCNVEKKGVTAEEVNAAFKEAADGPMKGVLAITETPLVSVDFRCSDVSTTIDAA
FT                   LTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAKGLIEGGDVSADPMDALCADDPSAE
FT                   ECKVFD"
FT   CDS_pept        complement(428482..430146)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639634"
FT                   /gene_name="LOLT"
FT                   /orf_name="MICPUN_113236"
FT                   /product="Pyridoxal phosphate dependent aminotransferase "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO68756.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C6DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB3"
FT                   /transl_table=1
FT                   /translation="MLSKAAQMMRTARLKLAEYIRARREDVALVENCTAATTSILRAVG
FT                   IRPGDTIICLSTAYGMVKNCIKYYAQHASAEVITIEVEFFGRETGPCGPDGNSLESALA
FT                   QIIDATAERGSRIPLVTFDYISSCPGVIMPICTLANTCKARGIPCLLDGAHVLGQVRLN
FT                   CHALEAAGVTYFMADAHKWLFSPKGSAFLWVTNRLQDDVHPPAVGAVCSNSPSTNFDPA
FT                   AVHGLSDFEHRFQYTGTRDYTPLIAVYDALLFRGRVGESLILRYNHDLAVWSQEWLASL
FT                   WGTETLIPRVCTGFMAHVRLPVTSAAAARLLKNMLEVEMSIHVMTFTLPARSRSGETQQ
FT                   THWIRPCMQLFVCRQDVYALGYAVLKLAPKCERVAILGATWVVKTRQSAKKRCETEIDT
FT                   PATEQADTGHKVTMGFSLIPRMGTRLHMDSDHDLNSNINRCRILPALCDVAAVAKYSAG
FT                   HLGGIVPVNSGADHVSYPSLSPEMQGPTMPPLSLTGSEKIRDADEGVGRSPLSVIDIMS
FT                   SSVASSGGTPIDGSGFSHPRWLLHNMTSSIAMHTARS"
FT   CDS_pept        432230..434866
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639635"
FT                   /gene_name="SFI1"
FT                   /orf_name="MICPUN_113943"
FT                   /product="Spindle assembly associated Sfi1 "
FT                   /protein_id="ACO68362.1"
FT                   /db_xref="UniParc:UPI000199C6DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB4"
FT                   /transl_table=1
FT                   /translation="MQGPAPDGRSEVYDVDAVYDALAMSEHIDGGFTTFVSECGRPAQP
FT                   LNAFVLGMNRPGILLAFQNPLCREAGSSLSNRTSDPNCKLNISVTGRNPSKRPRHSDYL
FT                   QPLPLAFSLSAFSQMISWNEAKPNRDLDTGVEAVIMTRILGSIGHVHQLISELRLSDFR
FT                   PDPTNSHLSARFQEVPCRFGANPRNDPQRSGKLLKVLVSPAFTHWRERSKIWALYIMRR
FT                   LLQMRRYAEGNLMRKAILAWHKMTSGLVAANNQVALATFARSLQQEVFMRWVKFASKSA
FT                   HARSVLAAAIERLRSTLMSITWNRWCKRVGEIHSDICAIKFFEHRDKAARFRRWLERVV
FT                   KVTAQREYMHICLKFREHNLIVATWNQWRKYVDDIGSARMAVKWSRERKKIGYWLRWRE
FT                   SVVASKRAAYALKTKAFVQWVALSKKGHATRRNMFFAVRCLKFYTIKMAFKLWCFYMRN
FT                   TQVTYELVHEMESRSQTSAMTIAWKRWSYHVEFAQCAKNLASKATAFVIKASMAKAWST
FT                   WREYRMSHAVSERALTFWVQCLMRKVFERWCQIARYRAFLWEMTSLSRAHRNARLRMVA
FT                   WDSWRMVQSANVLDACARCHKYHLFLTSSFKRWTVATTQALIDMEHWRIAEGYNCRALI
FT                   GITFTRWIETMHGLPSLAFKLEQQEIAFQHRVWRLGVDALCLWRKVAKAGVMHRKSITF
FT                   AALFERGNRLKKYVRSWYQWSWACWCGRVALARSQLRLWHSHVEEELIKRGKYETASKH
FT                   NKIRLRRRTFMTWLDTWLIGARVRLAKAVLDANAQRRALRKWRHVQHEAARIQQCLIRA
FT                   DRHYKGRALSLCFSVFVHTWARRMLLRAFSYRRQRRSTVLVLRGWGKLMYEAKAEQWPS
FT                   AERNRVN"
FT   CDS_pept        join(complement(436838..436952),complement(434982..436723))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639636"
FT                   /gene_name="CS051"
FT                   /orf_name="MICPUN_113945"
FT                   /product="Putative uncharacterized protein CS051 "
FT                   /protein_id="ACO68757.1"
FT                   /db_xref="UniParc:UPI000199C6DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB5"
FT                   /transl_table=1
FT                   /translation="MYFIPYLLLIRTMLLSTIYVYDSSIVCVYNIRMRACLLGKRRPLL
FT                   LPITPPCKILDPHHLHNFWGASPSLDLQAVASAARDAVGSSCDARDEAEPGDRPFAAFL
FT                   IGAGDPRHVITTLARSRRHGGECKLISFHIFESTMPEIARHVLLLAVLMTDDSPPTERC
FT                   ERFLEILMNARVRVSTAEYIERIAERLNRVACAVFAGEIGTVLDDPFSQIFDLSFLKFR
FT                   ERDDLLDVFHSWSRQGEPSKRHDEFDMERAWERRCRRFYGERYDHRKNMVDWDYNTRLV
FT                   QEGASVIHFSHFAQWRLTGIGFPVRESIYPEMNRTLVTRSCGITKEYIDRNMQDHGCSV
FT                   QSKGYWGDLLSGPYFSFGIEAEEPELFRVSNKQHVKNAVQVSEYNVAACIFEMRTGVPW
FT                   KVVMGRRPGMGQDDAMYDADIINAWGSEDECFPPVPSGCCSQATENGENDENGGAPRKQ
FT                   LLWRDRSRSYAEYWRRLRVILTGPGDLEKVLTSRAIKLNNGGFDCITVGAWHALKLLPE
FT                   LGPTARRWKGPGTTPGILIVEGAKYLVFMDKKTVANFTTKIGELATRAGFRPVPAKVPE
FT                   KDANWTTTKPLKDFGTSAETSTPVEPGILCGVDDVHRVFVAI"
FT   CDS_pept        join(439228..439416,439511..439592,439742..439965,
FT                   440063..440416,440504..441094,441184..441606)
FT                   /codon_start=1
FT                   /gene_family="HOG000027493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639637"
FT                   /gene_name="ASNB"
FT                   /orf_name="MICPUN_113949"
FT                   /product="B-type asparagine synthetase chloroplast "
FT                   /function="asparagine synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="asparagine biosynthetic process "
FT                   /protein_id="ACO68363.1"
FT                   /db_xref="GO:0004066"
FT                   /db_xref="GO:0006529"
FT                   /db_xref="HOGENOM:HBG752912"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000199C6E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB6"
FT                   /transl_table=1
FT                   /translation="MSVVNSTSPSWTPCPRRDWRLRSNKTQTKFRPLGVARSEIYGSSI
FT                   QLEGCRGYISNLPLVLTQAAQGYMGRRGFRFNPEMCSILACYDPNGAFADNRETLMRDL
FT                   SARMRSRGPDGSGYYGNEKFGLAHERLAIMDPEGGKQPIVYEDAKYSVCANGEIYNFRQ
FT                   LQEKYELGTAKTGSDSEVLLQLFKLIGPEFVKELNGIFGFVCVGDDGENILAARDHCGI
FT                   KPLYIGYGKGGSIWFASELKAICDQCETIEEFPAGYYWTPVSGFVKYYRPEWDSDDYVG
FT                   RKDTSHVREVLTQAVREQMMSDVPIGLLLSGGLDSAVISTIIKPMLEETKQQFITFTVG
FT                   QEGSPDITAARMMSEHLGTDHHEYLFTSEEACSIIPDVVYHLETYEPELIRSAIPNYFL
FT                   ARLASKYVKVVLTGEGSDELFAGYLYFRDAPNSTAIHKELRRIFHHLHNVNCQRADRMT
FT                   MAHGLEARVPFLDPNVIDAVMQVDPELKRIEGENKPEKHALRALFDGEIPDPVLWRTKA
FT                   MQCEGVGLNWVDDLQAFCAAHVTDEEFDKATTLYKINPPQSKEEMYYRKIFESHYQNMD
FT                   KFVHVWDGGCRAGGAAWQNQAYTRFGLKDVAQLAKGIEGVRGAE"
FT   CDS_pept        join(complement(445164..445313),complement(442037..445060))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639638"
FT                   /orf_name="MICPUN_54972"
FT                   /product="Sister chromatid arm cohesin "
FT                   /function="binding"
FT                   /protein_id="ACO68758.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="UniParc:UPI000199C768"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB7"
FT                   /transl_table=1
FT                   /translation="MQRHDSRVCLFDLLADDNQLAVEIVASEWLARYTSNWKLALAELY
FT                   TLLAKAGSCIFTVTVQDFEQLSAEGIGARVLSDMMAGNFLDDNPLDFQSTKSPKRQFKH
FT                   FRTTYLEFWDSIVKVCDDNGAFNMGRQSQENIEVGAVDNPTTLFDCITDMLAVFSSLRA
FT                   RRLRLAATEAGLQLISSLVQNAKVAANTRDLKQRQLDAERKKNRPNRSIAKSLHDGLGN
FT                   AQNSIRNTETMIQGAFNKFFTHRFRDIDPSIRSACIHSIGQWMCDLPLFFLSDFYLKYL
FT                   GWSLNDKDSRVRLAAISSLLHVYQASSENLALMDTFNARFIVRICEMLNDADSRVVASA
FT                   VKTLGVLHGSGVLSRQDMEPVVTLLLDEDAEIRSAAASVIPCMVRWEVSRDADVPTRGS
FT                   LRGENEPTDKEVRFSTLLAIVRMTADLCDSRARIASVVDSLWTTYQDIFTDWNLMFSIL
FT                   LNDGTDDFEQHSLKSNVCLNNSHATALSNVLICSVRRARGEELVKSDSICGHPMHLLSK
FT                   RQVTRSQREAQCHAHELFTQASMILLPSVMCKWKSDEQVLVPLIEVVQHLKLEHYSLRH
FT                   REEDFGAIVKFITEMFFLHSSKRIMDACMDVLCKVIGEGTFHFREMCAQCGKDVLSVVA
FT                   KRIGEIVGSDRSEHAREVTQSKFDKSSEENHVTPPKGNDEFDHLQMQIALLRLNSCLSF
FT                   ILLPISLTGLVSKYDDIHKNLLTIISDVVNVPSHFRAHSAALATRAAAMLLVQRVVSAV
FT                   GETPESDFDVGKYTTMIADFMETVAAACRSLMESNTCNRLLVKAFAASVTNLVVYSQFV
FT                   IQSPTAVEEGLVGGLQLCIPDSTLRTVWDACNHLIDIPHEDIHCLDFPTRESASDDEEM
FT                   SRSAYSLAMCDIALLNHGFVASELLANLGQSGHWTDCALRSLMTDLRFLGPHATANTIM
FT                   TSLASAFEEVNAAELENNDGLVEAFGELALRFADMFTVGSHRDRMVVRCIIEEGLKYVV
FT                   PHALPHPSRLQFLSLGLGPFVAKLASGDAKALVQPLTAVVSVIEEDDDLYAPLFAFIKV
FT                   VATRARGTS"
FT   CDS_pept        446458..449940
FT                   /codon_start=1
FT                   /gene_family="HOG000100760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639639"
FT                   /gene_name="KEA1.1"
FT                   /orf_name="MICPUN_113466"
FT                   /product="Kea1-related potassium hydrogen antiporter "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="solute:hydrogen antiporter activity "
FT                   /biological_process="potassium ion transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68364.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006813"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C769"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB8"
FT                   /transl_table=1
FT                   /translation="MPNNERTKLSVVVTADPNTAKMTAAGFHIRSSIITRHLGAAGNAK
FT                   SVQRCIFKQSDAPLRGPSGPLSPSRRSIFFLCKKRRSLAALRCAPFLGSTPSTTSVSAS
FT                   GQGQSEHLTSMDDGAASDMLAEQLEEIEKERERLVEVVETEKRRERNELERRDDLEVVA
FT                   QAQAQLAVKAWEEYTQTEQFVAEAMEKNDAALETVGEAELKLGELKQKLAVLEVAISAE
FT                   CVSEDVPCVEEALVAVAKNNLDDDSAAKNASRAKENPTGASSDEKEKYGIIDSLPIIRR
FT                   AELWWINDGVEMEEALQMILGNIEKAETAYEKAKADRSRAEEFSVGVAKSAREAEELAK
FT                   AADKRADDAMALVQSTMETAVAARIAAAAAEEEISTLDKRVSALLGEKNDSSLSPSDEQ
FT                   DAVWVMTSLDCAENDDECKESAAAALDAVKMIPASIDANIDIMEKDVITKEKKDREDGK
FT                   AEVEKEKVEKPKVAASSKQFAGKWFSSETTEMNAVGIAAVLGLGLAVGSLTPGAAPVRQ
FT                   AMSNSSSQVATSLKKGWTTITLMIPESERKIAEHAAHEAHEAGLTDALVLLFASILAVT
FT                   LVSKIPGGSPVLGFLLGGAAVGPYTTGLVGHVAQAQVLAEFGVVFLLFNIGLELSLERL
FT                   QSMAKYIFGMGSAQMVMTTMLCAAAAIACGLTIPQSVVVGMGLAFSSTAVALQVLQDRG
FT                   EAGTRHGRGTFSVLLFQDLTVVLVFMLVPLLAGPDSGSVAAIIGSLAKAIVKTVAAIGA
FT                   IMTIGRTILRPIYSRIAKLGKAEVLTATTLFTALGTSLLTQSIGLSMALGAFLAGLLLA
FT                   ETEFHLQVESDIAPFRGLLLGLFFMTVGMQIDPTTLFANFNTIVTIASGLLAIKMCVMA
FT                   ICGPAFGLNLLASLRAGVYIAPGGEFAFVTYGIAAAAGLLSLDIVNQINLAVVLTMAAT
FT                   PMLANVGANLKKLLKKEDSVASLQAKEGDVDDLSGHVIIAGYGRVGRMIGELLSEQLIP
FT                   FVAVDVSAEDVQKGRDMDAPVYFGDAGSPAVLHAVGAEKASCAVVTLDSPGANYRTVWA
FT                   LNKYYPNIKVYVRARDIDDGLALEKAGAKAVVPETLEPSLQLGAAVLNEMEMSNEDISI
FT                   AVDNFRRSHMGDLQMLANRSGSALGYGLPSNLEALKSYDAGEEGSVGKDIDNV"
FT   CDS_pept        complement(450022..450951)
FT                   /codon_start=1
FT                   /gene_family="HOG000249463" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639640"
FT                   /gene_name="COQ5"
FT                   /orf_name="MICPUN_113465"
FT                   /product="Ubiquinone biosynthesis methyltransferase "
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO68759.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG559580"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI000199C76A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDB9"
FT                   /transl_table=1
FT                   /translation="MLRSNARFGGKLIRISSFLKHERFSSKQVAESADYLPITSFGFKE
FT                   VDKEEKEGMVREVFLKVAPTYDLMNDIMSAGVHRIWKDSIVSKLGVFPGMIHVDVAGGT
FT                   GDIGFRSLSALRAAETSARDSSFHAPNVGPKPGRIIICDINSHMLVEGKRRAAHLDLTN
FT                   STDRQGNRLATINFKEGNAENLPLDDGSVDLYTIVFGLRNVTDTLAALKDARRVLKPGG
FT                   KLICMEFSSVRNESLRTFYEAYSFGVIPLMGELIAQDERSYQYLVESIRMFPRQVELEE
FT                   IMREAGFKCVAHENLTGGVVALHSGFRI"
FT   CDS_pept        join(451982..452092,452178..452399)
FT                   /codon_start=1
FT                   /gene_family="HOG000248742" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639641"
FT                   /gene_name="RPL18.2"
FT                   /orf_name="MICPUN_54975"
FT                   /product="Ribosomal protein L18, chloroplast "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68365.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG602198"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniParc:UPI000199C76B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC0"
FT                   /transl_table=1
FT                   /translation="MSASVKTIGRGEQLHHLLVFFSNRAVYAQVLRKVDSHIVAAASTT
FT                   EKVLRATLTNLGNEDAAASVGRVVAERSIAAGIHVVHFNRPKGKRFHGKLRTLIDNMRD
FT                   AGLPLK"
FT   CDS_pept        join(complement(455622..455725),complement(452554..455530))
FT                   /codon_start=1
FT                   /gene_family="HOG000223594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639642"
FT                   /gene_name="PEPU32"
FT                   /orf_name="MICPUN_113244"
FT                   /product="Peptidase family U32"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68760.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG551762"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniParc:UPI000199C76C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC1"
FT                   /transl_table=1
FT                   /translation="MPVPRPGAKKNRHCDKIPRARICNSRFCKGSKKTGCGTRPSRNSN
FT                   SAAPHTVKNSQRAFATSERNKNPDLNDVNTLVHPAFKRRQLSRKPEILAPAGGWPQLRA
FT                   AVEAGADAVYFGLEALNARARASNFAVEEVADVIGYLHERGVRGFVAINVLVFDEELAQ
FT                   AEKLVRAVARAGADAVIVQDVGLVSLIKGLAPDLVIHGSTQMSITSAEGAEFARELGCE
FT                   RVVVGRELSIREIAAVREGTTAEVEAFVHGALCVSYSGQCFSSEAWGGRSANRGQCAQA
FT                   CRLPYGLVVDGEVRDMGDVKYLLSPQDLMAVELVPQLIDAGVSCFKIEGRLKGPEYVGL
FT                   TTSVYRRAVDEAWEARCCESVDGHAPSGAEWDLPDAVRTDLAQVFARGQDDNYDGLTKG
FT                   FLEGPNHQRLVRGRSPRHRGVLLGKVVDSFIHSGGGVVVLLSGKVSVKRGDGVVFDRGM
FT                   PDKAEAGGSVWEVLDSSGKSVARSAHEAVISGEYELMFASATMNMWASEHGGLQEPKPG
FT                   DLVWRSSDTSLTARLRKMYGKDVDQRLPQKKEPVVVHMTSEGIGSPLRISLIDAQGRRG
FT                   VGITRGSFSVAQRRPLTFASLATAVGQLGDTYFCVGELNIESIQGLNSLPGLFISVGEI
FT                   KAARREAVEALMSFRSTSGIAEADNNSESLALQESMEISWWDNRATEKETKILQPKAVF
FT                   TKTSDQECKLTVLCRTREQTFAAMNIPWLQEIILDFLEVHGLQDMVDRVKASGRRAVVA
FT                   TPRVLKPNEERLWRFYLKLGADALLVRSAGLMRILKNLRENGEDRFIPELRGDFSLNAA
FT                   NAVGASVLFRHGGLLTLTPTHDLNAAQHVNMARALGAEGAAKLEVIVHQHLPIFYTEHC
FT                   VFCRFLSEGNSYRDCGHPCETTRIHLRDGGGSDHLVLADMGCRNTVFNAKAQSGAEYVH
FT                   ELINAGIKRFRVELVDEPAETVSPLLEAYKDCLLGLKRGRDVVRLVGSFPDANGRSHGA
FT                   GRGSFEVKKEVDRASMKQTAAARSTAHVPARSVIEDN"
FT   CDS_pept        complement(458915..460945)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639643"
FT                   /gene_name="HYP13"
FT                   /orf_name="MICPUN_113956"
FT                   /product="Putative uncharacterized protein HYP13 "
FT                   /protein_id="ACO68761.1"
FT                   /db_xref="UniParc:UPI000199C76D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC2"
FT                   /transl_table=1
FT                   /translation="MSNSVHAGEGPSHLELSSTEIHVFVLLREALKNRCWPAREGELAQ
FT                   DGNPERQRRCCVDAYQLMAEAANGEGRAAWILASENWKMRHSVQPDSVVPGNPPRRSYF
FT                   DDGSGSYREKKVTGEVRLNSVQARTILQLVADPEFLAVSEGALYWFPDQIVNIDFLAGM
FT                   RRITQQDTKALIPGAHALTLGAVNEFMARWDSANFLHTVEGSMRALDFLTFVRLASRGT
FT                   GHSMHSVVPINPDRTTVDYTNIYPKRSTSAVPHATKQQATSVREELRKVARRATHDRET
FT                   IVLIDSLRQEYSSWVACNPSAAGGGECDPSFRAEFVFGRQSVMGRLAPAPSLALCLAAV
FT                   DETLSGYVSPIGARLALAHFGLFLTARETFMIGYALRSILGSSSSMSRWAIVDILDLFN
FT                   ASALPDGFDGRVAVRRWLDSAKETVSKYLEDGESGFDNRELLRFLPIGSKEVLAAIQSV
FT                   VHASLTRYRQLARFCCILGEHNEDCSGCDRDAATISLSNLKYAVKLIGNHPSSFLRQQR
FT                   LNTLADLFIAPLTDSTKGRSSEKRLYWHKLLRRCSPLHALLAFERSHDTGAGGVDADEP
FT                   KFDKDAEAVCSSFASWIYDKGFVALCREFEKRDTDKTGSLKSDEFKTAAIAAGYGSELF
FT                   SAEPMRWVIAACHHHAQEKCISYAKYLAIILLGLEKIVGYF"
FT   CDS_pept        complement(462987..463553)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639644"
FT                   /gene_name="HYP14"
FT                   /orf_name="MICPUN_113247"
FT                   /product="Putative uncharacterized protein HYP14 "
FT                   /protein_id="ACO68762.1"
FT                   /db_xref="UniParc:UPI000199C76E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC3"
FT                   /transl_table=1
FT                   /translation="MHITGMVSRSAEQVNQGGFLFLGNLQNEIARIWRHSNANQLSVIS
FT                   EEHSVSTCLHSNYEFMLKDRRAFADKLHASNKSFLQKTFSRHTINELVVSGSSEQSLSS
FT                   FLVSIKTAHESLKAISKQTESSLQKVLSATEKRAAGHLGDMQTDFDYLVVNLNAERVRV
FT                   DKATGQIAEYSKERKRIEEHMKSLW"
FT   CDS_pept        join(466271..466519,466673..466736,466835..468081)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639645"
FT                   /gene_name="SDP1"
FT                   /orf_name="MICPUN_113469"
FT                   /product="Myb family transcription factor "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68366.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C76F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC4"
FT                   /transl_table=1
FT                   /translation="MDMAAARLEASFLAPDLHGASGEILHNSGDEENERKSLLHQTQAY
FT                   DQMLMDMETNMHKSSHSSETQCDCGSVEYKQALDLHPPNAPIIRSRGEYPPQNSVHTLK
FT                   GEFSSFDGGLNFIGEDDGDDLLCDFAPNALQEDGSVGLIADDGSLVKPSFSQTSHWNMC
FT                   QTSPAGHQRTSTLSCARFAASQQFQGFAKIGYDGVEEPCLSDSWHSKNQPVAQVHPAGP
FT                   ADSSDSSITALRQRYHKVFGKETSSNNRQWLLRRLAEINTFGEVDNCEERKKLHGQDIL
FT                   VATAKLSRVSAIETSEYVRVTHRLKLTRKEQEKYLKLVETNTVEHSARQAKSMWKGTNI
FT                   HKRGRGDNESHSLGGGLAKTDGSSAGKRIKKGNNSDSDSAGEPPVKSRNNSSAGGNCKA
FT                   TQARKTLDTNIGGNGRRSKHHNPWALEEAEALVEGVAQCGGGKWADIKKLGFPAIEHRT
FT                   AVDLKDKWRNLLRIAMLPHQPVKNAGDKKREIPPELLARVRELAAKHAKKQTQDGRNRH
FT                   GR"
FT   CDS_pept        join(complement(469914..469942),complement(468516..469830))
FT                   /codon_start=1
FT                   /gene_family="HOG000223061" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639646"
FT                   /orf_name="MICPUN_54982"
FT                   /product="Aminotransferase"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO68763.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniParc:UPI000199C770"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC5"
FT                   /transl_table=1
FT                   /translation="MFDHTQCVVRSSLLEKLGRTLPVKGRHRKTVIVHANSNVRRNPNI
FT                   AKLQAGYLFPEINRIKMKHLEENPDAKIISLGIGDTTEPIPQPITKAMAAAAENLGTLD
FT                   GYAQYGGYGAEQGQTLLREKLAERFYAEVNIQASDIFVSDGSKCDISRLQMMFGSNRRV
FT                   AVQDPSYPAYVDSSVMIGNTEMYDHASKQYGKIVYLACSSENDFFPNLGLAKDAELIFF
FT                   CSPNNPTGAAATRDQLIELVRHAKETGSIIIYDAAYAIYISNPNCPKTIFEIPGADECC
FT                   IETCSFSKYAGFTGLRLGWTVVPDKLKFADGSLVKNDWNRLMCTSFNGASNIAQAGGMA
FT                   CLSDEGMNAMSELVSFYKENATILKNTFEEMGYAVYGGTDAPYVWVSFDGRDSWEVFTE
FT                   VLTKCDIVVTPGSGFGPAGDGFIRCSAFGHRENILEAAQRLKESFSRS"
FT   CDS_pept        471761..473458
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639647"
FT                   /gene_name="GLP2"
FT                   /orf_name="MICPUN_114066"
FT                   /product="Putative uncharacterized protein GLP2 "
FT                   /function="endonuclease activity"
FT                   /protein_id="ACO68367.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="InterPro:IPR003611"
FT                   /db_xref="UniParc:UPI000199C771"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC6"
FT                   /transl_table=1
FT                   /translation="MSCHVLFINATTRWGQEQARVIPSVARSALVHGGEGVNRRFRRES
FT                   ASTSCDRTRCDTVDGNSSLVCELRKLCVTRVLSEGRHSANGPASRDVFETTGTDGSDLQ
FT                   VEDTNALHEFGQKRGSSQKERSRANEGFVVRAKPHTNGCGCDVCMKLRSLIKAAKPDNN
FT                   NTAVSKSAIFVCFDGGFVIGKQQQKHHVSGCHCPNCNHLRFQRDTGQVDCITVPSKVLH
FT                   AMIGKAQCNQNVFSERTEARRRAKIGAANKGKPAWNKGKKHTPETIAKIRANTAIAMQN
FT                   PQVKQRMRAAAAKTFHSDTTKIKIRRTVRDKAHQKMQARNEAKARALGVRRGKVGICTI
FT                   GMHARRISSVQRVNFGTWTKHAWENRSKRKHHFSRAARTDENNLAQKMTPRFVEKRKES
FT                   RSNRGVPKSAQHKAAISAALKAKWNDPKYVASQKRANSVRTKNVDKATTERNSTQSMAV
FT                   SSKDRNDTVTSKRHALLKEMKEIYMKAVLAVRTLQEQKAAGVDVDEAMLKKALSAVAQT
FT                   RQVLASVSLDDSVDFISSGHKPLRAKHEDVRQQVSSREAKCKTSSKIS"
FT   CDS_pept        join(complement(476421..477200),complement(475160..476326),
FT                   complement(473638..475101))
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639648"
FT                   /orf_name="MICPUN_54984"
FT                   /product="Glycosyltransferase family 20 protein "
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="ACO68764.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C80A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC7"
FT                   /transl_table=1
FT                   /translation="MSPKKYPKKSDIESDGIYRLPRSHDQRPPTAEPWNVPRENAASNM
FT                   ESGPLKELRRQLESLSTLGSSDCLGELGSNAAAAAAAAVEAALESGNISRDKSTRVERL
FT                   LQERQRSMQRIKSSTVITPATEEDDDSCPSEEQGRDHSRAKQRLIIAANRLPISAQRKQ
FT                   DGKWALNQSAGGLVSALSGVGNNYEMLWVGWPGVFVEEGPDRDALTQLLLRRGCLPIYL
FT                   SRSEVDLYYNGYCNNVLWPLFHYVPLSFESKLSETKNMGLQWSAYQEASEQFAHVILNA
FT                   YRHGDVVWCHDYHLMLLPSKLKEEHQDMNVGWFLHTPFPSSEIYRMLPVREELLLSVLS
FT                   ADLVGFHTYDYARHFVSACSRILGFEGTPEGVEDNGNFTRVAAFPIGIDPSRFTQALET
FT                   ERVQAHIHELRQRFQGRKVMLGVDRLDMIKGIPQKLLGFEKFLSEHPEWRDRVLLVQIA
FT                   VPTRTDVAEYQRLTSQVHEIVGRINGRFGTLGSVPIQHLDCSLAFTELCALYAVTDVCL
FT                   VTSLRDGMNLVSYEFVSCQSKNAGVLVLSEFAGAAQSLGAGALLVNPWNVNDMAAAIED
FT                   ALTMPDAERRERQRQNFTHVTIHTAQAWADTFVSELNDTHVEAELRRKRIPPQLVPMTI
FT                   INSFVTARHRLIILGFNATLTVQADSSKRQVRSGVLPMKPIKTATRIHPVSQECLQRLC
FT                   DDPTTTLCIFSGSERNRLSQAFAHLPKLWIAAENGCFIRPPLEGKHCQLGVGGTGKWIT
FT                   MVETSNLDWIESVQLVFDYFCERTPRSYVETRETSLVWSYKYADPDFGRQQARDLLQHL
FT                   WTGPISNAAVDVIQGAKSVEVRPIGVSKGAAVERIVSMMGEFGSSSLIRREESCEHVPP
FT                   ETRIHASTGEQTDVVSHMATFRSTDNIFTGIDQQDHENTAPPPAAIEHRQVDFVMCCGH
FT                   FLGRDEDIFEYINYGSSAVFRHRHIPAVQHPSKQKIKNPHRVESLANVFESDQQGNDAH
FT                   SKQTGDVNDAVDSKGNDDDKPSILTTFRTPITCTVGRKRSGAGYYVNDSDDIAELLATL
FT                   TNSLDDGKARVELLQFDTESSLGSNRSLADLARHNSGANMQLMSQQGSLVDIANHRFGR
FT                   NISVSNMSDNSSLDCSHKGGEASISLKLT"
FT   CDS_pept        477695..478891
FT                   /codon_start=1
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639649"
FT                   /gene_name="RPF1"
FT                   /orf_name="MICPUN_113472"
FT                   /product="Ribosome biogenesis protein RPF1 "
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO68368.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000199C80B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC8"
FT                   /transl_table=1
FT                   /translation="MGARSTEHATRDAEWLSNTTDGRQQRSDSSQRFPVNMNGRIPNHA
FT                   ALSGPGKLRQQEKRVARKARRIEANNTLTPKLATAPRQVPKTIENQRVRDETHVKDIDE
FT                   EVVEELAHDEFAKHFSDVTSQKVMITTSRKPSGEMFRFLENIFSVVPNVYYHARRAYHV
FT                   QEVIKHAVARGFTDLLVFNENRKFGRGAKVNGLLHVHLPVGPSCLYRLSSLALTKTIRN
FT                   HGRATKHHPELILNNFSTRLGHRIGRMLMSVFPQRPELQGRRVVTFHNQRDFIFFRHHR
FT                   YIFELRKGIRQYDQRESDNSTKSVEYAQGSPEGRKPIEAVARNPEIQDAPERITSGRSS
FT                   CSGDGSNFRARLQELGPRFTLKLLSVQKGVFDSKHGEYEYVRCRRADGNKLDRRKFVL"
FT   CDS_pept        join(complement(479822..479866),complement(479617..479652),
FT                   complement(479021..479209))
FT                   /codon_start=1
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639650"
FT                   /gene_name="ODA-LC8"
FT                   /orf_name="MICPUN_113471"
FT                   /product="Flagellar outer dynein arm light chain 8 "
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="flagellum"
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="ACO68765.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="UniParc:UPI000199C80C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDC9"
FT                   /transl_table=1
FT                   /translation="MSERKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAFIKKE
FT                   FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG"
FT   CDS_pept        join(481364..481648,481705..482238,482310..482428,
FT                   482488..482677)
FT                   /codon_start=1
FT                   /gene_family="HOG000264509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639651"
FT                   /gene_name="PIPK1"
FT                   /orf_name="MICPUN_54987"
FT                   /product="Phosphatidylinositol-4-phosphate 5-kinase "
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="ACO68369.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="HOGENOM:HBG559077"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniParc:UPI000199C80D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD0"
FT                   /transl_table=1
FT                   /translation="MTGRSGASSLRVGSVFCETLKDEHFVVLRRAFNLQDTFLESNFHF
FT                   SQLGNGGGKGGDLIARTVDGRFFVKQLNVGDAKTLLQDNFLSSYVARVKEGATLICKIV
FT                   AAFTHDSLGRFIVVANCLPANIKTWNGLYDLKGSADDKVLIDDGVTVIEAHKRCWKLSW
FT                   MASEALGCDRCIPVTRRRYLSGKRKAYDMPIYLTKEQKREVMELLREDVAFLTNHGLMD
FT                   YSLIMAVHGPPLGTYQLTASDSANILHSKSYVSYHRGSVSVVYFGIIDFLQAWTVTKLC
FT                   AHHIKACCAPTPISTIPPRLYGRQFLNHFEWKFRALAYPVPLRDCNALINLSHETQEDE
FT                   ELRAQLEALSRTTSELRDKLDIAEKRIDELVYAGK"
FT   CDS_pept        join(complement(483673..483742),complement(483344..483413),
FT                   complement(483143..483267),complement(482863..483029))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639652"
FT                   /gene_name="PSAO"
FT                   /orf_name="MICPUN_112733"
FT                   /product="Photosystem I subunit O "
FT                   /protein_id="ACO68766.1"
FT                   /db_xref="HOGENOM:HBG608997"
FT                   /db_xref="InterPro:IPR017498"
FT                   /db_xref="UniParc:UPI000199C80E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD1"
FT                   /transl_table=1
FT                   /translation="MAATSCISSIRAPAPVRLATRRSGLRGVSRVTPQKKPRGRATLAV
FT                   ASESKTFDDDWLKADTTVHLLTLFGWSIPSGIAIKAYGDTSLLAAFADSIGSNLANFPQ
FT                   GPGLDDKFWLYLITWHIGLFSTMLLGQIGWQGRKQGYFK"
FT   CDS_pept        join(complement(486584..486630),complement(484929..486375))
FT                   /codon_start=1
FT                   /gene_family="HOG000196276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639653"
FT                   /orf_name="MICPUN_113915"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO68767.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG617617"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C80F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD2"
FT                   /transl_table=1
FT                   /translation="MSADLAESKFSIPVDSENKAKSLNIFSFNFPHHASFHMSWMGFFV
FT                   SFVSTFAAAPMIAIIREDLELTKPNLGSAGLAAVTGTIGARVLMGSVCDVVGPRYGLSI
FT                   VLLLSAPFCFCMSYVTSAAGFLICRMGIGLGLATFVACQFWMSCMFNGKCVGLANATAA
FT                   GWGNLGGGVTQFLMPLIFRGMTSATEGRIFSAWRWAYLVPGLLHTIMGVAVMFIGQDLP
FT                   DGNFKFLHTSGQLEKKSAATTQYLGITNYRMWCMVATYGFCFGVELTMNNIVASYLYDQ
FT                   FELDLVTAGTLASCYGLMNIFARSVGGLMSDYMSVKFGMRGRLWTLWVVQTLEGILCVF
FT                   MALAKDSLATTILFMVLFSICVQASEGASYGIVPYITRRALGVVSGYIGAGGNAGSTIC
FT                   MALFFTSSSIAVYEGIMYMGFTIIGVTLLVVPIHFPMWGSMFFPGDPNVSEEDYYIARE
FT                   FNEEEIKEGLALSVQKFCQNSYQERAPSMRPVESSEAKV"
FT   CDS_pept        join(489411..489536,489742..490218)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639654"
FT                   /gene_name="Nar2"
FT                   /orf_name="MICPUN_112726"
FT                   /product="High affinity nitrate transporter accessory
FT                   protein"
FT                   /protein_id="ACO68370.1"
FT                   /db_xref="HOGENOM:HBG559078"
FT                   /db_xref="UniParc:UPI000199C810"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD4"
FT                   /transl_table=1
FT                   /translation="MARTLTIAAILALAITGASASALYSTTPQVDGKVYIEGTCSKTLT
FT                   GGADSITVKWSDFTEPADTIAIKLCFHKDKIVDRPWRKFNDNINKNKQCWQTAKLAKFL
FT                   KEGIVYDSSGSGSELIELPMNTAPSTYSVQVLSQAGGTYKQWGDSKTYTQTADKCAHVT
FT                   TAIYENQPSTLVGTQAFFTVFSIVVLIVSYTYDRSKN"
FT   CDS_pept        join(complement(494363..494428),complement(494160..494261),
FT                   complement(492848..494038),complement(492232..492738),
FT                   complement(491923..492110),complement(490890..491829))
FT                   /codon_start=1
FT                   /gene_family="HOG000100762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639655"
FT                   /gene_name="Nii"
FT                   /orf_name="MICPUN_113259"
FT                   /product="Nadh-nitrite reductase"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68769.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559079"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000199C811"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD5"
FT                   /transl_table=1
FT                   /translation="MQSTNLLPNTIPRGRHLSFNPQAEIKHPTHVLRNDAVQLWTSRTP
FT                   SAATGARASSTKRCVRISVIARPDGVAQGRALPGPDRMETLAEYNKNTLSEYNIPDVVR
FT                   ADSHVYKDQDGYYVVKEEYRKPTNPFERLKLEKDPMKELIHLGGLEEMAEASAVNFKEW
FT                   DEANGADEVDQRPKWAGLFHRRKGHYGRYMMRLKIPNGVVTSKQTRYLASIVKSCGEDG
FT                   CADITTRQNFQLRGIELKNAPGIIQGVMDHGMCSLQSGLDNVRNATGNPLAGFDPHEII
FT                   DTRPFTRAIQDYVSGGGRGNSDIANLGRKWNVCVVGGPDFYEHPDINDLAFIPALREGV
FT                   VGFNILVGGFISSARAAEAIPLDAWVPASEVVEATAAVITTFRDYGHRGNRQKCRMMWL
FT                   IEEMGIDKFRAEVASRMPSQSMACASEDDLIDTSVSRRSYLGVHEQKQNGLCWVGICVP
FT                   GGRLQADDMQDMADLADIYGSGEIRLTVEQNFIIPNVPKEKVDSLLAEPLLQRYSPFPG
FT                   KVVSGMVACTGNQFCGFAQIETKKQAFAAAEHLESILDFPKGDIRMIWTGCPNSCAPVQ
FT                   VADIGLMGCQVKNPSGEKGMVDGVNIFVGGTVGPGGHLKEHPEVEKVACSELLPVLEDL
FT                   CIEKFGAVRKAVPSENPRHADRWKINKSAQYTKGIPKALGKATHICTSCGYIYQESQAF
FT                   MTQSEDFVCPSCSAPKSKFEALKDSKDPASSRPVKEYPSDAMVALQGAGSTVELKLISK
FT                   VDISSDTRIFRFALPTESHILGLPVGQHVSIAFTDDSGTVVSRPYTPISSDDDVGYVDF
FT                   CIKIYQDGAMSQKLDSLAPNETMTFEGPLGNVTYTDRGQFSIYNPATTDVDVRSGINNV
FT                   VMVCGGTGITPMLQVIRQIFKDVGDTTRVTLLYANKTPSDILLKHELDSLASQHPNLQI
FT                   RYTVDSAGGGPWDGLVGLVDVDMIKACLPTARNETQVLMCGPPQMLEKGIKPSLKSLGF
FT                   TESSWIEF"
FT   CDS_pept        join(496242..496571,496679..497431)
FT                   /codon_start=1
FT                   /gene_family="HOG000271394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639656"
FT                   /gene_name="NAR1"
FT                   /orf_name="MICPUN_113973"
FT                   /product="Formate-nitrite transporter family "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68371.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG726755"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI000199C812"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD6"
FT                   /transl_table=1
FT                   /translation="MSTYVRYLAAKKCFEGLSDRNTPRRRTAASKCCHTPAMTAATHFV
FT                   MTSGGCGGAHITKRRYPARPSAMSPGRLRTAPKTPVNVASRRKCLTVVANVVPQGDALP
FT                   PPAVFNAVLATAEKKAAQDLSTTLVLGFSAGALIGIGALLMSCVGASSPALATANPGLC
FT                   NFLKGAVGLPAGLTLVILTGAELFTGNVMTMFSGLLAKRIEAGALFRNWLLSYAGNFIG
FT                   SIVMAYLAFGAKTASAPAAKAAVVGIATSKVSLSFGVALCKGILCNWLVCLAVWGTMAS
FT                   TSVAGKVLAIFWPITAFVTLGFEHSVANMFLIPHGMLNGAQITVKDMMLNNILPVTLGN
FT                   VISAVIFVAGLHFWAYGRQN"
FT   CDS_pept        join(complement(500572..500689),complement(500368..500468),
FT                   complement(497541..500240))
FT                   /codon_start=1
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639657"
FT                   /gene_name="Nia"
FT                   /orf_name="MICPUN_113975"
FT                   /product="Nitrate reductase apoenzyme "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68770.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326850"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000199C813"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD7"
FT                   /transl_table=1
FT                   /translation="MDNISETLSFIGQGAFVVAMLRKVLQRADSEKKDGSYSTGSNSLP
FT                   ISADDFLSLLASCKGNRTSLIKYDSNLKADRRDLNTPDYMIPRYCGLIRLTGTFPLNCE
FT                   PNLTELINCGAITPVALHFVRNHGAVPNLDWSSHRIQVCGNVNKRRDFTMDDLKRMHSV
FT                   SLPILMVSAANRGKEQNMLEQTNGFNWGAGAISNTIWTGVPLRDVLRIAGVTKVTPERQ
FT                   FVCFSGPSGELSGGVDGSYGTCIPLSRALDPSHDVIIAYAQNGEKLRPDHGYPVRVIIP
FT                   GFIGGRMVKWLTKIEVTPGPSTNFYHLRENRILPSHINSELAEREGWWNRPEYTFNELN
FT                   INSVISCPAHGDTIEISDRNFTMKGYAYSGGGRSIIRVEVSLDNGQTWRLARHYHPCPT
FT                   TKYGKQWCWAYWTHDIPRRDLNGVHYLMCRAWDESNNTQPSDLTWNTSGVGNNHYFKIR
FT                   VNEIDSDKISFDHPAEPGSLPGGWMGSISGGHAVMFTKTPKLTVDRARLEFANVAREFN
FT                   PLILPDATQSLSSMSSVSPVLQKQHYTPPPPGAKLYRMQEIEEHDSEEDAWILIKDRVY
FT                   DVNRYISEGHHPGGNASITMNAGTDATEDFEAVHSAKAWKQLEAFAIGYLDPRDNPAAV
FT                   SISEKDVDNSKNVSSSTPASRVALTTGPVNLLQFALAHPEMYGETLVGEAAEAEAFDRM
FT                   WDGAQRDAGDAPIALDPKKWIPLVCDAKVPLSHDTILLRLKLESEGHQCGLPVGYHLYL
FT                   RGDRNGKKVMRAYTPSSLNGTLGAVEFVIKIYFPNDHPNFPEGGQLTQYLNAVNVGDVV
FT                   EVKGPMGHIKYAGCGRLLVDKNEHIIDKMTMIGGGTGVAPMLQMIVAVLANPADKTQIK
FT                   FLFANKTTKDILLKYTLDRLQRENPDRFSVHYTVSKGDEHWPGSIGRVNKKMIEDYCFP
FT                   AHDSRAQSKTVALLCGPPSLEEDTCIPALKELGYENENIIQY"
FT   CDS_pept        join(complement(504070..504195),complement(503388..503864))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639658"
FT                   /gene_name="Nar2"
FT                   /orf_name="MICPUN_112726"
FT                   /product="High affinity nitrate transporter accessory
FT                   protein"
FT                   /protein_id="ACO68771.1"
FT                   /db_xref="HOGENOM:HBG559078"
FT                   /db_xref="UniParc:UPI000199C810"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD4"
FT                   /transl_table=1
FT                   /translation="MARTLTIAAILALAITGASASALYSTTPQVDGKVYIEGTCSKTLT
FT                   GGADSITVKWSDFTEPADTIAIKLCFHKDKIVDRPWRKFNDNINKNKQCWQTAKLAKFL
FT                   KEGIVYDSSGSGSELIELPMNTAPSTYSVQVLSQAGGTYKQWGDSKTYTQTADKCAHVT
FT                   TAIYENQPSTLVGTQAFFTVFSIVVLIVSYTYDRSKN"
FT   CDS_pept        join(506871..506917,507126..508572)
FT                   /codon_start=1
FT                   /gene_family="HOG000196276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639659"
FT                   /orf_name="MICPUN_113915"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO68372.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG617617"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C80F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDD2"
FT                   /transl_table=1
FT                   /translation="MSADLAESKFSIPVDSENKAKSLNIFSFNFPHHASFHMSWMGFFV
FT                   SFVSTFAAAPMIAIIREDLELTKPNLGSAGLAAVTGTIGARVLMGSVCDVVGPRYGLSI
FT                   VLLLSAPFCFCMSYVTSAAGFLICRMGIGLGLATFVACQFWMSCMFNGKCVGLANATAA
FT                   GWGNLGGGVTQFLMPLIFRGMTSATEGRIFSAWRWAYLVPGLLHTIMGVAVMFIGQDLP
FT                   DGNFKFLHTSGQLEKKSAATTQYLGITNYRMWCMVATYGFCFGVELTMNNIVASYLYDQ
FT                   FELDLVTAGTLASCYGLMNIFARSVGGLMSDYMSVKFGMRGRLWTLWVVQTLEGILCVF
FT                   MALAKDSLATTILFMVLFSICVQASEGASYGIVPYITRRALGVVSGYIGAGGNAGSTIC
FT                   MALFFTSSSIAVYEGIMYMGFTIIGVTLLVVPIHFPMWGSMFFPGDPNVSEEDYYIARE
FT                   FNEEEIKEGLALSVQKFCQNSYQERAPSMRPVESSEAKV"
FT   CDS_pept        join(complement(511403..514383),complement(509989..511288))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639660"
FT                   /gene_name="WDR6"
FT                   /orf_name="MICPUN_113265"
FT                   /product="Wd-repeat protein"
FT                   /protein_id="ACO68772.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C89B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE0"
FT                   /transl_table=1
FT                   /translation="MPSKSVQRGLYLGDVTALCTLEHSSTPTQPRNTSTCGENDFQEKD
FT                   RRGHTLLAGIGGSVRWYDPFRSGQEAILLVSSVFDSGRIHGIVPAPPFDKSYPVTHFHI
FT                   GNKVSRPSFIRALVIWGERRVILAAIQCDDLNFVKARLVRSVAVLPLLAHWVHDVIPLS
FT                   HDTVNYGQPTVAVGLADNSVEQWNMPTRATVKVGVTIEPTCIRRIECAMRSVLYSLALY
FT                   GSSMDDLKVAGGTIFNEIQLWAPSDARNIGMHVERACLARERPKPWAALSGHEGSILRV
FT                   RWASDGGHVFSTSDDRTARIWRVPSRHKRDLDSNGTTPGINKKSGGVVTLYGHSSRVWD
FT                   LHVTSLSKKTLVVTAGEDCTVRLWNAPSFSSLGKICKGKGDDLDLVDDLFVDEPLAILR
FT                   GHRGRGVWRAMTMLSPSGEKLLVTAGADASIKLWDIQQYIRSRPERNEQIREAYIAHQQ
FT                   DDESVNVLPATLRARALPDQNADSESDLHAGRKCWADVSNYEINHYTSTLKDHLGNSKG
FT                   EYIRVICLSDHLTLYVATNRGRLYMVNVTKAAKNVWHWREIHRVNHRGPVIGLIRVTYF
FT                   GDISAPGLNEHDLVLGDMHGMISTMKISWNNDDNDDKLVSHKSSGFATQIQQSWQACEP
FT                   RRLLDVFSGTDNTSEMTEHLFTSEVGGIVKCWKRMSTASFTGAECQATWSMLGIAQMPF
FT                   KQRVLALSYHCDKRLLLCGDQSGNVAVFDVNVLSGYPHFHHGTIKSPFGLLAVSQRAHG
FT                   KNAITLVAIRNVRNNQRNFFSNSEHQIPVEFLTAGRDGWLRTFTLRPISELVQSHDDQT
FT                   NIYDEQPMLSMPMTKRWHAKSRKQLISDTHSSLCLAMGAPNSNVNSPAPLAPYYFICVT
FT                   KQRVPEISTMHALRWGKDHWLQKAKRWPVGNAKTDSLCIVAGFKETEFVAINMFSHREL
FT                   LRVQCGGWHRPLSLLIDGDNLAEISFAFVKGDELSLFHSLPRTFGIKPTDGEWSLCELN
FT                   GWSHGREIHAVRILPPPDVCSEHFGLLTGSEDGSIICHHHTRTSSGQMMHREEEIGMHI
FT                   GGSAVRAIALFPEFPGGGLVDIVHNTRSYILLSAGAKEVIMAWRIVWIRADECELHFSE
FT                   AAQYDTWDIRTTLLGAREQTKESKTSNQRCMAVVGFVPLQCRSHHCALHSVGLSATSDG
FT                   SLKVLALHSDGSCGNFGVHFKLVTTMHHSSHALISLAVVAMTLNGAATFAMDVVVLACT
FT                   GATDGTIAIWDLTSIIHSLSTQPSRSGNELKNFHNTGKPVVSLPCFHQSGVNSLAMTTS
FT                   TNGTPGRVFIASGGDDQVIRVTLILINQRNTLEKNNSNFISVDVLQTVHTDFAHGSSIK
FT                   GVWMDNSGTLATTSHDQRLRVWKVREVANQDLAIAAVAGSFVECPEPETLDACFLGGNV
FT                   NILYIAVAGRGLQMFCVDQGSLRS"
FT   CDS_pept        join(complement(517143..517162),complement(516904..517051),
FT                   complement(516730..516856),complement(516525..516674),
FT                   complement(516360..516454),complement(516182..516295))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639661"
FT                   /gene_name="RAB11"
FT                   /orf_name="MICPUN_54997"
FT                   /product="Small GTPase from the rab subfamily "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ACO68773.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015595"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199C89C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE1"
FT                   /transl_table=1
FT                   /translation="MSKDHDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCSESKSTIG
FT                   VEFATRCIEVCLEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKSESYDNV
FT                   QKWLKELRDHADSNIVITLVGNKTDLKHLRSVQAESAAEFSSIEGLSFVETSACESTNV
FT                   DVAFKKNLTDVYHIISKKSCSSAEVDDKNGGAGIIEVKAISESSKKNPSKCCNV"
FT   CDS_pept        join(517844..517852,517923..517940,518024..518055,
FT                   518116..518158,518210..518386)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639662"
FT                   /gene_name="U1snRNPC"
FT                   /orf_name="MICPUN_112698"
FT                   /product="U1 small nuclear ribonucleoprotein c "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO68373.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="UniParc:UPI000199C89D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE2"
FT                   /transl_table=1
FT                   /translation="MLPCHATIATTVTHILRMTRLPSESNIIRVTNIRANVRNYYMQFE
FT                   EQTTQSLLARHVQEKATLQQQSDSYMAYHSKVNETFKKQIEQYTAGL"
FT   CDS_pept        join(complement(519933..520091),complement(519596..519865),
FT                   complement(518559..519539))
FT                   /codon_start=1
FT                   /gene_family="HOG000017735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639663"
FT                   /orf_name="MICPUN_92834"
FT                   /product="Ammonium transporter channel family "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68774.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000199C89E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE3"
FT                   /transl_table=1
FT                   /translation="MSFDISQLDTTERAMYDAINAVVEGTKEDVARMESNLDVLWLLFG
FT                   AYLVFFMQCGFALLEAGSVRAKNTKNILLKNVLDACLGGLIWWTIGFPIALGDVGGQTE
FT                   ANHGKPFFLDRLQGSSSSTYYAMWLFQWAFAATSATIVSGAVAERCAFSAYLSYTFALT
FT                   GFIYPTVVYWGWGNFGFLSAYTAEKPYLGGNGLIDFAGSGIVHMTGGGAALMGAIFLGP
FT                   RTGRFAPRTGEVQDMPGHSTVLAALGTFILWFGWYGFNPVSTLAFSHMQHAARAAVATT
FT                   LSACSAGVTTLAIHVLGKNTPDVSPALNGILAGLVSIAGPCAVVDAWASVIIGFIGAFV
FT                   YFVSSRLLLRLKIDDPLDASPVHLFCGIWGVLASGLFANKEFTNSVYGTDYGEDAYGFL
FT                   MGANGTQLGVQVVGVLVIGSWTFVSSGVVFFTLKATKLLRVSAEDEDAGLDSSHHGGDA
FT                   YNFASGKLNRN"
FT   CDS_pept        join(521724..522599,522683..522825,522913..523715,
FT                   523797..524068)
FT                   /codon_start=1
FT                   /gene_family="HOG000264593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639664"
FT                   /gene_name="ABHG"
FT                   /orf_name="MICPUN_113982"
FT                   /product="Green algal specific Aspartyl/Asparaginyl beta-
FT                   hydroxylase"
FT                   /function="peptide-aspartate beta-dioxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="peptidyl-amino acid modification "
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO68374.1"
FT                   /db_xref="GO:0004597"
FT                   /db_xref="GO:0018193"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559083"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199C89F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE4"
FT                   /transl_table=1
FT                   /translation="MDSLRPTGHEKLFVIAVILIGFVASLWLPSFKIASGGRQFGPFPA
FT                   GGSGGPASNSIHFFRSGQFLGPGPKAKMRNLVLATHGRLMWFDPISKHAEIIHEGRGVY
FT                   YGMFPSAENTMWVVSRPHNWHPRTSSEALLLVDYSNRKIIREVVIPSRFTHDAIRHKNR
FT                   VFIADTGSGRVFELELPTMNRVLYSVNFTKKEHPNTLAYANDPSHPHAVWVVLHNLGAS
FT                   KVALVDLESGKRLREYEGIGEKVHGFVQWGDGFIILNSGAGQVCKFTPPSEMPAGQVGS
FT                   DSNKGVLDILWEDAGKPFMKGLAVVENIAYFGIAESGERPSRGEASKMAEVAALDLHRR
FT                   RILWKTRIQTRGLLNVIGAPHIAEWSTYQHVRSWPQVLLARTPAPEQVGTSAVIDEEEK
FT                   HPSPWYHDFRTGHSEQLSEPHLGEPRVYNTSSDKNKPKRNHQNFHTSPSGVEWIDLQKK
FT                   KTFTATKDGDIFIQHGSVDVAELKAMLQTDPFFCRPENQKGNAKLGGRQSNMNRFKPGV
FT                   DSVILIFSDFSGMFVYKFPYFYKYQEKLMPVLLSVLRDHFGLSDPVQHIMRLQFACMNP
FT                   KSKILKHTDHGGWVKNGHRIHIPVVVPKTNDGSTDAVQFVVDHGEKGFVNVPLNEGHFF
FT                   EINNGVPHMVTNDALSRRIHLLVDFAEDPIPPTRRFVLEPGQECAYDKLQNCAARLEVG
FT                   ASV"
FT   CDS_pept        join(complement(524740..524892),complement(524362..524682))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639665"
FT                   /orf_name="MICPUN_113604"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68775.1"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="UniParc:UPI000199C8A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE5"
FT                   /transl_table=1
FT                   /translation="MYSLLAHLKRRHRIVGTFLTFVPQNPSIHFSTGLAQKNSRGHKVD
FT                   PNIPTEDLNKLIYRAKQRGFLELDILIGTWAECNLSSRSQGFWAEFSEILDEENPELFR
FT                   WLTCQEQPPPRMTRNRAFISLHAYTSSLMRRKCDRETRALKGHHWVRGWDDPV"
FT   CDS_pept        join(526724..526744,526872..528233)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639666"
FT                   /gene_name="OLM6"
FT                   /orf_name="MICPUN_112732"
FT                   /product="IFT52 intraflagellar transport protein-like
FT                   protein"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO68375.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniParc:UPI000199C8A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE6"
FT                   /transl_table=1
FT                   /translation="MSTADSKGKSGFPCIAFSICKKERYHPNSTPDGFKQWCRHLKASF
FT                   RLDILTDALSLESLKGVDVLVFGTPRDEFSNSELDILRSFSKGGGGIMFMLDEGGECMS
FT                   KTNVNCFTENYGISVNDDCVVCTSMQTCDHPRAPSVSYRMSNYHKSESLLDRGVVPQLR
FT                   EDGTQRNSHARTLSSENVERLSVALPSCTTLRVQKPATIVLSTGRLAYPVQHAVGAVSK
FT                   GSVKWGECGRIAVLGSGKMAVDQWYDRADNCKILDLLLHWLVPQFLPKARNLPTEDLDI
FT                   IDHNYISDMQALANRPRSCLHETDDSPKDFASLFGSKRIHLFQSITAPETALLRDKISM
FT                   KVARLSLIAPSYAELLMPMQFAAFPAATREHPPPCLELLDLEEEFTSEFKRLNVLSIRG
FT                   RPTLDDEHIGTFVHDVARVCGLHIDSMRISQIHDSTPTAILKNIFTHLMHLKSSPIRPV
FT                   RS"
FT   CDS_pept        join(complement(528696..528803),complement(528595..528621))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639667"
FT                   /orf_name="MICPUN_113999"
FT                   /product="Pilus-related protein"
FT                   /protein_id="ACO68776.1"
FT                   /db_xref="UniParc:UPI000199C8A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE7"
FT                   /transl_table=1
FT                   /translation="MRRVQGRVPLDENHLKSSSRRSRATQDYGGEVTVVEPASRHDSK"
FT   CDS_pept        join(531121..531157,531259..531538,531614..531825,
FT                   531903..532142,532213..533426)
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639668"
FT                   /orf_name="MICPUN_112720"
FT                   /product="Heat shock binding protein 70, ER luminal "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO68376.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000199C8A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE8"
FT                   /transl_table=1
FT                   /translation="MNPRKHLKALIYAFATVVLLQGTKAEESSEQLGTVIGIDLGTTYS
FT                   CVGVYVNGKVEIIANDQGNRITPSYVAFTDGERLIGDAAKNQATANPTRTVFDAKRLIG
FT                   RKYTDKEVQRDMKMFPFKVVNKDSKPCIEVELKEGKKTFQAEEISAMVLTKMKETAEAY
FT                   LGKDIKNAVVTVPAYFNDAQRQATKDAGTISGLNVARIINEPTAAAIAYGLDKKGEKNI
FT                   LVFDLGGGTFDVSILTIDNGVFEVVSTNGDTHLGGEDFDQRIMEYFMKLIKKKHGKDVS
FT                   ADVKAVQKLRREAERAKRSLSNQHQVRVEIESLHDGLDFSEPLTRARFEELNNDLFRKT
FT                   MGPVKKAMEDAGMKKSQIDEIVLVGGSTRIPKVQALLREYFDGKEPNKGVNPDEAVAYG
FT                   AAVQGGILSGEGGDETKDILLLDVAPLTQGIETVGGVMTKLIPRNTVIPTKKSQTFTTY
FT                   QDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA
FT                   EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKIKERVDTRNSLETYAYNM
FT                   KNTVTDDDKLASKLADDDKRQIEEAVKETLDWLDDNQNAEKEEYEEKLKDIESVCNPIV
FT                   SRVYQQGEDSNNEEMNDDFDDHDEL"
FT   CDS_pept        complement(534651..536378)
FT                   /codon_start=1
FT                   /gene_family="HOG000009550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639669"
FT                   /gene_name="PGM"
FT                   /orf_name="MICPUN_112722"
FT                   /product="Phosphogluco-mutase"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68777.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG286308"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000199C8A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDE9"
FT                   /transl_table=1
FT                   /translation="MNSALSKRLKTVAAAGIVVTEVPTTPIEGQKTGTSGLRKKAALFS
FT                   SGNYLANWVQALFCALPSDELKGSSMVLGGDGRWFNKEAAQIIIKLAAGNGVGKVFVGQ
FT                   NGYLATPAASAVIRARKAYGGFIMSASHNPGGPDEDWGIKFNYSSGEPAPEKITDKIYG
FT                   YTQTVELLKMADMPDVDLTTCGAHKFGDFEVEVIDPVSDYLNLAEKVFDFDLIKSLLRR
FT                   SDFKMKFDAMHAITGAYAKPILVDALGADPSCCVNDVPKEDFAGGHPDPNLTYAEELVK
FT                   TMFSEEAPDFGAASDGDGDRNMILGSNFFVTPSDSVAIIAANAQSCIPYFSGAGGLKGL
FT                   ARSMPTAAALDRVATSLGVECFETPTGWKFFGNLMDAGRLSICGEESFGTGSDHIREKD
FT                   GPWAVLAWLSILAHRNKDVPVGGKKVTVEQITREHWAKYGRNFFSRYDYEGCESQPCNE
FT                   MMQHLRAIADSSKKGDKYGPYELDFADDFEYTDPIDGSVARNQGLRFVFTDGSRFIFRL
FT                   SGTGSSGATVRMYIEQYESDASKQNIDAQEALGPLIQVALETSKLKEFTGRDSPTVIT"
FT   CDS_pept        join(537062..537850,537935..538289,538346..538842)
FT                   /codon_start=1
FT                   /gene_family="HOG000193775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639670"
FT                   /orf_name="MICPUN_55005"
FT                   /product="Eukaryotic translation factor "
FT                   /protein_id="ACO68377.1"
FT                   /db_xref="HOGENOM:HBG409391"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="UniParc:UPI000199C8A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF0"
FT                   /transl_table=1
FT                   /translation="MHLIERGPDGVQLRAVEGSLVCEHAESFSASQTVFADDGQLLACL
FT                   HTDEVHIYDTINNSILHRLPTPGTIAAYFSPAGSYLVIYQKANTSGAGEEKNLSVWQLD
FT                   GAKKVFACFQRTFNNSNRRTLQFSDDESIASRAVTNEVHFYNTNDFLAQPFRLRVPHVS
FT                   SHKISPGKLPTFVAFVPEMKGQPASVRLYGVPSGVSDGFSEAEPLAQKSFFRVNEVEYE
FT                   WAADGSAVLILGSSELDATNRNYYGESSLFFMRADGTLECKVPLDKEGPVHDAAFSPKI
FT                   DEFVVVYGYMPANATIFSSLKCEPIYQLGAGPHNTVRWNPFGRFLCLAGFGNLPGDMQF
FT                   FDRKADGKYKVIGKARANCSVRCHFDEHDLNSYTFSDFLRCPEWSPNGRYLLTATTAPR
FT                   LNVDNGYKLWRYSGELLQHVARERLFEAKWQPVSKNDYLDRPISPGRVRRENRETGSHG
FT                   HATFQSAAPYRPPHVTSGSGNFSLAKAAPDEAGPGRYRPTGASKAHLSPNSMNQGPPGA
FT                   IFVNPDASKNAAKNAKKRAAARARKQNMS"
FT   CDS_pept        complement(538955..540109)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639671"
FT                   /orf_name="MICPUN_55006"
FT                   /product="Carbohydrate-binding module family 48 protein "
FT                   /protein_id="ACO68778.1"
FT                   /db_xref="UniParc:UPI000199C91B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF1"
FT                   /transl_table=1
FT                   /translation="MTLTTSLSGTPLLYWTKRCTFAKGNYRSSGGNYRQLEDKGSRNRR
FT                   NYKTEGHRSRFIHDPREMALVGKSTAPLRGDGLSHGASEMDENQAPADVTLQDSKVRPK
FT                   NPTFRRRVEDAAATLRSGKSTQQRRRISTNAADFHAMHVKGPTEVSQQTTWQSSTTAAS
FT                   LRSSKRGSEAFPRSSLLSSPENNDQMAASQRRLFEQMVTLRTRLNERLAASNKFAKYLE
FT                   STLKTRDKDIKHANERLVAAMLEIESLKHIAKEAVEAVEDEKMSRTQIAGRLDTLTKRL
FT                   DLMHAALRRDVQDIDAACIKSVPIRWVGMASDIRIMGSFDHWTKGVAMSPEFIEGGNNV
FT                   FVADLMLVSGTYEIKFVVDGIWQTAPEWATTGDGLGANNLLVVE"
FT   CDS_pept        541226..542191
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639672"
FT                   /gene_name="SEN2"
FT                   /orf_name="MICPUN_51324"
FT                   /product="tRNA-splicing endonuclease subunit Sen2 "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="ACO68378.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniParc:UPI000199C91C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF2"
FT                   /transl_table=1
FT                   /translation="MANPPFLSGLGVAFRNDKRKFLSKPPSPGQCISLLSGSSQHGVIC
FT                   RGGVWLACTRQLAYVFDRVCLGRRLPREAAAGLPLLLNALKNQDSDVTDTQKATKTDTD
FT                   NMFMVRFSLEETFYAVWILNCLTVHTSSSNKSESAEGDGNLSCRLSRSELWRTLIRLEN
FT                   ARSGGQTTMGICHLISRICSYLHFRRVGWLPKSGLQYGSDFVLYYCHPSTVHSEYCVVL
FT                   HPHKAGNALRDDSAIAAQKLEQDCALQSNSIETDQLASWADVQAVTRLCGQVSKSLVAA
FT                   YMPCAPEKRLTTHQKVHEIWMKEMRMFRLTSEKLTKNCHA"
FT   CDS_pept        complement(542854..543321)
FT                   /codon_start=1
FT                   /gene_family="HOG000100757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639673"
FT                   /orf_name="MICPUN_55009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68779.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C91D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF3"
FT                   /transl_table=1
FT                   /translation="MDSAVNHMSQPRPRQGNSAPNSDPIMRRETDKNNKYKAAATAVHK
FT                   EFIPLVMDTYGRMGKPFLYFLKDVAALTARRASGNVNERTQAIYDSIDPPNELRNRIHL
FT                   RNLALVHVALIISLMQRVAGSTVTNDRQHGARGGMYGAHEHYVQPYPVTNF"
FT   CDS_pept        complement(543750..544940)
FT                   /codon_start=1
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639674"
FT                   /gene_name="FOLD"
FT                   /orf_name="MICPUN_113278"
FT                   /product="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase"
FT                   /function="binding"
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO68780.1"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG328751"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI000199C91E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF4"
FT                   /transl_table=1
FT                   /translation="MRPNWPKLKLTCNCVKEPLRGWGRRLSFSPQLLARAAWNSSKPEP
FT                   DSESSPSWTGSAIMLDGRLQAARWKREIAAKILFRRTSKRMGPPGLAAVVIGDRPDSLL
FT                   YVRRKSEACEEVGIRFHLERLPGDADQDMVVNVLRKLNSDDRFHGIMLQLPVPVHLNES
FT                   RLLGSINPMKDVDGLHPYNVGRLAMRGTWRPAFIPCAPLGCVELLWRENIQIKGRSVAV
FT                   LGDSNVVGMPISWLLRDSGASTINVVHGYWLKVPEQNNMKFPAQANFVEPNLLNTVRNA
FT                   DIIISAIGRAEVIKRDWVKAGATVIDVGINPIPWDHHEGIARCRHASSRKVPAAFLEQR
FT                   PDKPEKSDYKVVGDVAAEEVSHVANAMTPVPGGIGPMTIAALLSNTYLGASRQEYL"
FT   CDS_pept        join(545671..545817,545860..545964,546017..546277,
FT                   546345..546668,546720..547223)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639675"
FT                   /gene_name="DRNK"
FT                   /orf_name="MICPUN_112723"
FT                   /product="Deoxynucleoside kinase family "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="ACO68379.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="UniParc:UPI000199C91F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF5"
FT                   /transl_table=1
FT                   /translation="MFLSARNERVVLSRKNVLVKRPAFAIRAARVYCAQHDMFSCLDGC
FT                   SDLLVIKLKNTSQLIPGINPTSEALLEQKGFSSLSDLQTLHHQAFTDRFDRSKEELENF
FT                   LLCEAGLSKKSQAAAVARFVERTIVSQESRPINNVDIKPLTLCVEGNIGAGKSTFLSSI
FT                   IKGSTLLEDLGTSIVLEPVEKWQQVRNRGEQVSAFEAHNILNEFYKNPTRFAYTFQHHV
FT                   FMTRLLLEAETRSGSVRIMERSILSDRMIFVESVYEKGWLSDLEFSLFNSWYEPVVKVS
FT                   PHLIPDAFIYLRTTPEVCLKRLKRRARGEETEIDLQYLRTLHNKHEYWLNQDKHGDVPD
FT                   EPAGFTDSTLHSICFLRDGCLSTLRGIPVLVLDFDENLNVNRSSHAKRAMRRAVASFVS
FT                   FVQKRALGYYDRAQMTHEYCPSFLEVKHWNDFYDDAMSAEDKTSSQD"
FT   CDS_pept        join(548226..548307,548421..548464,548534..548656,
FT                   548713..549168)
FT                   /codon_start=1
FT                   /gene_family="HOG000264872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639676"
FT                   /orf_name="MICPUN_51328"
FT                   /product="RNA recognition motif family protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO68380.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG609514"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C920"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF6"
FT                   /transl_table=1
FT                   /translation="MGDMLNSADGAAGSKIFVGGLDRSVDEGVVRSFFQQFGPVVEVLV
FT                   MRDPHNHQSRGFGFITFQRDESAKQVLQNRYHDMMGKRVEVKSAVPRGQAPPPQRGPPR
FT                   SSQGYGYGQPRGGPGQGGPSAGYGYGGSYANAQAYSGNNNPWGMNSGFGDPNSLSSGQS
FT                   SHSAPQKAAFAYSKDSSPTQREDQGSASGAPAPAHGWTEHTAPEGYVYYYNSKSGVSQW
FT                   ERPMELDYPLSN"
FT   CDS_pept        join(complement(551163..551366),complement(549597..551006))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639677"
FT                   /orf_name="MICPUN_51329"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68781.1"
FT                   /db_xref="UniParc:UPI000199C921"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF7"
FT                   /transl_table=1
FT                   /translation="MPLLFKMPKRSTSLFTPRRTVLSGSHVNTSSIRQKFEDTEIALLR
FT                   KKLAVVVSAFNTEIRKHENELKMMARAYSSEVAERDYSFSSAQLQLADAKRHNKVLQFQ
FT                   RNALRDDLQRARGESTILAAQLKEEQDSCDMLKLELATLQRALINSARALSQADAKLIQ
FT                   LMVTTKSSRHVADAAVVEQDVIISKRLAKAEAGLAAATRREASLEQLLTSERVARRKLE
FT                   AHPAFEIVSKIDSSRTFGHLSEERRSSLQQNEEIMNRNNQRSGDLGGIIMKDNVHENLQ
FT                   PDLHQSRRIQDLETGTGKTTFDSDPQVTANRTVQGREVSIARGINFIKMETRDTRDCMK
FT                   NLHVDLRPSGPAEITEINSQLPPARNTKAGGVNSDRARTNEVSKPPKKIERGTSGLYEE
FT                   AELTTVTVLNVIDDLSSRGYVSPVNNSFARNIGVEPQQGSCDGAPDNHRNVALSLGTQL
FT                   DSANVKVKVPPVSDVTDYRTTAFLDLPLHNVQEMQTGEMTRHRSGQGKKKRKLLGQRAL
FT                   ASSETLPQSMVRGVELGFEG"
FT   CDS_pept        551997..554015
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639678"
FT                   /orf_name="MICPUN_114010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68381.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000199C922"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF8"
FT                   /transl_table=1
FT                   /translation="MRPRHGTKLERIVGTTFVSGETFETFLLHCDEYLVPATQRCFRLR
FT                   EIRRCVMIGDHFQDVKRECSCSAASKADVVFLHRGVPLASNQNTPRLGCREKYSTQNGA
FT                   LHLPTRLISICFQTSADIVCMRRTAWTRIDMPRRVFSHVRLQDGVPSKRNDSLLDVSFS
FT                   ARDVELPNWFVPDFGAIRKCTCRLYSEIKGKPCFPLYRCGAGWLQKTETTYADSTHSKT
FT                   GVLEGISVCINSVRPFDMLQSRELHRECLLILQRQGAVSLKCDDAWNDATKCSTLLDLR
FT                   TLHHRATKLSSVQGNYSLLQQTTPRGVLPIYDMTDDNRKGGKLCFEEFLTEVGTTFKSL
FT                   CSPYRSLGPKDREALFLQIFRSRSRVRLPYLTSLALDCLNLVHLSSSFNAIQQSTVHFW
FT                   SPQSIAIGSGSILRLMLDTCEQRCSPREKANTVAHANDVQPEDHARKRHLNITDASEHE
FT                   NLILIEAAKRIEQNLKFVDVDGQDSLKGHVVLENKNGHNLWGAGIISPWMYYMSMGSVF
FT                   CCHIEDYAFGSANAIIAPPDSHTWVVWYSVSRKDLGNLHLYLQDLMGVNYTLDCLEKRK
FT                   VWLDPVAMKAWRGAEGEQINVFHHLQGPSEYVITDYGSVHWGVNLGVGWKAAVNFAFSD
FT                   WRAAAELVHLVYKDREIATGQQRNYRCVPDFCSGCWG"
FT   CDS_pept        join(555807..555842,555942..556016,556081..556164,
FT                   556221..556348,556440..556596,556651..556776)
FT                   /codon_start=1
FT                   /gene_family="HOG000100763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639680"
FT                   /gene_name="Nsp1"
FT                   /orf_name="MICPUN_112724"
FT                   /product="Structural constituent of nuclear pore,
FT                   nucleoporin 62"
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO68383.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG559092"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI000199C924"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG0"
FT                   /transl_table=1
FT                   /translation="MFSNIEADSKLKVPSEAQGKSVGEIVISWNTELESRTNFFLARTK
FT                   GLTEWDSCIQKNKHILSALQIDLARVTSSQDRLERQLEILQLHQQEVDEALTIMESVAE
FT                   QLGRTQHPTSGSSPQQTRTRHETIFNLAESVSASLSALGSALRHVTPSVYMAPAESDNK
FT                   NCSIIKTQAHSFSDKILKAHLQTVLSVERKALQSQQLF"
FT   CDS_pept        join(555807..555842,555942..556016,556081..556164,
FT                   556221..556348,556440..556776)
FT                   /codon_start=1
FT                   /gene_family="HOG000100763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639679"
FT                   /gene_name="Nsp1"
FT                   /orf_name="MICPUN_112724"
FT                   /product="Structural constituent of nuclear pore "
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO68382.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG559092"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI000199C923"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDF9"
FT                   /transl_table=1
FT                   /translation="MFSNIEADSKLKVPSEAQGKSVGEIVISWNTELESRTNFFLARTK
FT                   GLTEWDSCIQKNKHILSALQIDLARVTSSQDRLERQLEILQLHQQEVDEALTIMESVAE
FT                   QLGRTQHPTSGSSPQQTRTRHETIFNLAESVSASLSALGSALRHVTPSVYMAPAESVCI
FT                   HSCGKSSDSCFEFTQDNKNCSIIKTQAHSFSDKILKAHLQTVLSVERKALQSQQLF"
FT   CDS_pept        join(complement(560397..560577),complement(560182..560306),
FT                   complement(560032..560124),complement(559839..559962),
FT                   complement(559679..559770),complement(559538..559623),
FT                   complement(559348..559463),complement(559254..559288),
FT                   complement(559105..559182),complement(558800..559042),
FT                   complement(558682..558741),complement(558559..558612),
FT                   complement(558451..558498),complement(558249..558383),
FT                   complement(558149..558167),complement(558048..558087),
FT                   complement(557941..557986),complement(557808..557879),
FT                   complement(557716..557742),complement(557575..557652),
FT                   complement(557437..557514),complement(557265..557375))
FT                   /codon_start=1
FT                   /gene_family="HOG000247212" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639681"
FT                   /gene_name="ARGS"
FT                   /orf_name="MICPUN_112725"
FT                   /product="Arginyl-tRNA synthetase "
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68782.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="HOGENOM:HBG695395"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniParc:UPI000199C925"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG1"
FT                   /transl_table=1
FT                   /translation="MIVSSLCHSRVHCQHSSFVTSLFRRGGVRRRHARHVKVRKCDTLV
FT                   TSSACNPSTFGSVPTGDGLREIVKAAFSEAVTAVLSRGTLVDVNISECSNNVVGDYQCN
FT                   SAMPIFAELKQKGDTSFSNPRSLAEAIVEAIPGREHLFAQTSVAGPGFVNVTFSASFLA
FT                   AGVLDTVVNSTDEKIRIPPQRNMSIPKRAVVDYSSPNIAKASEMHVGHLRSTIIGETIC
FT                   RALESFGVETVRLNHVGDWGTQFGMLLTHLHDMQMGSDFAITDLQEFYKVAKLRFDKDD
FT                   DFKARAQSAVVRLQAGDVQMRKLWEEICEISRRDFEEIYRVLDISIIERGESFYNEIIP
FT                   LVLDELVKKGIAVEDQGALCIFGNLESTPLICRKSDGGFNYASTDLAALWQRTTQLEAD
FT                   QIIYVTDVGQSKHFEAIFDAANRAGWLDKKDNTKIRLDHVGFGLVMGEDGKRFRTRSGG
FT                   TVPLRSLLSEAQSRCLESLQTRSSDLDDKELLEASHIMGIAAVKYADLHNNRSTNYVFS
FT                   YDRMLDMKGNTAVYLLYTHARISTLLSRAEDQDLTSPAHQMVFTDEKERALAVAILKLP
FT                   DALRAVVQDLLPSRLCDYAYHLCVAYNEFYSTCKVIGSPEEKSRLILCRATVFSLRRAL
FT                   FVLGITPLHKL"
FT   CDS_pept        562380..562586
FT                   /codon_start=1
FT                   /gene_family="HOG000243245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639682"
FT                   /gene_name="PET191"
FT                   /orf_name="MICPUN_113285"
FT                   /product="Cytochrome c oxidase assembly protein,
FT                   mitochondrial"
FT                   /protein_id="ACO68384.1"
FT                   /db_xref="HOGENOM:HBG737843"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniParc:UPI000199C926"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG2"
FT                   /transl_table=1
FT                   /translation="MSKSCKGMLEELLKCVENTDCVQKYSLTKCLQNSFLFPRACATAR
FT                   DLYVSCRRGQFDMRSRVRGNKGY"
FT   CDS_pept        563880..565274
FT                   /codon_start=1
FT                   /gene_family="HOG000242429" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639683"
FT                   /gene_name="UTP18"
FT                   /orf_name="MICPUN_113286"
FT                   /product="U3 small nucleolar rna-associated protein 18 "
FT                   /protein_id="ACO68385.1"
FT                   /db_xref="HOGENOM:HBG715348"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C927"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG3"
FT                   /transl_table=1
FT                   /translation="MSTHTGENPASRQAAGCAVVNATTMSNEILNPAWEDRDDADAKPT
FT                   TTNKSRPSGLCTVGGSARLQHGRLVGSPRWANSFRAQHAGGQDDCKDMNTGLGNMRDLV
FT                   RNGGDQLEGGGKSDQAGCLTPDDLIVATRLQDGNVSDPSHGVIRSLEFHQNGRMLLTAG
FT                   LDKHIRLFDIDGVRNAKVQGVFLEDFPIHKACFGGDGLKIVAAGRRNYFYTYDLQHGTI
FT                   ERSSALLGKEVRSLESFVQSTAGANHPVVAFLGQDGQVPLVSLKSMTTIGSVKMNGSAR
FT                   AGVFSSDGQRLMTAGGDGVVYVWDLRNQSRCIEKIVDESSVQVTSLALSHGHLAVGSDT
FT                   GVVSIYENLKGEPGIPVEATENCWNGMQQMMRRKRVNTITNLMTEVDNITFSADGRILA
FT                   VSSRFKRDSLRLVHMPSCKVFSNFPSSKSPLNYVWTACFSPNGAHLAIGNARGRALLYR
FT                   IHAFDT"
FT   CDS_pept        join(complement(566627..566723),complement(565349..566556))
FT                   /codon_start=1
FT                   /gene_family="HOG000194333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639684"
FT                   /gene_name="CSN2"
FT                   /orf_name="MICPUN_51338"
FT                   /product="COP9 signalosome complex subunit 2 "
FT                   /function="binding"
FT                   /protein_id="ACO68783.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG319169"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI000199C928"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG4"
FT                   /transl_table=1
FT                   /translation="MDDDMEDYGFEYSDEEPEQEDVDIENQYYNSKGMIENGTIDCALK
FT                   GFASVISMEPEKGEWGFRALKQCVMLYFKAGDFEQMMKSYQELLTYVKTAVTRNYSEKV
FT                   INHILDSVSSSSNSAFLQDFYERTICSLEEAKNERLWFKTNLKLCKLWFELREFTRVKS
FT                   ILKKLHISCQQNDGSADQRKGTQLLEIFAIEIQMYTEQKNNKKLKELYQRALTIKSAIP
FT                   HPRILGIIRECGGKMHMAERQWTKAATDFFEAFKSYDEAGQARRVQCLKYLVLANMLMR
FT                   SEVNPFDAQEARPFKTDPEIMIITSLVTAYQQNSISDFESILKAHRDQISEDSFIREYM
FT                   EDLLKNIRTHVLLNIIKPYTTIHIPFISGKLRVREIEVENLMVSLILDSRIQAQIDQTR
FT                   QLVELTAELGCYAKSEFQGARSWTTSTKERLKAFV"
FT   CDS_pept        join(568309..568472,568553..568643,568715..568765,
FT                   568850..572191)
FT                   /codon_start=1
FT                   /gene_family="HOG000100764" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639685"
FT                   /gene_name="SIN3"
FT                   /orf_name="MICPUN_55021"
FT                   /product="SIN3 component of histone deacetylase complex "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68386.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG559094"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="UniParc:UPI000199C9A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG5"
FT                   /transl_table=1
FT                   /translation="MKRQSTPAGQKASTDDALRKQEALTYLRELKERLKDKKDTYDEFL
FT                   EIMKEFKAQRIDTEGVIKRVKTIFKGHRDLILGFNQFLPKGHEIRVEDVDREEREEAER
FT                   AKAAAGSVPPVKPQVEFVHAISYVNKIKTRFANDERVYKAFLEILNMYRKNLKTIGQVY
FT                   DEVASLFKSHNDLLEEFTYFLPDFSTPAAGKKAATGKTLRGKSAFTSGQHSGALKRKGK
FT                   GEKGITPEAPPPENREEDRKTAASLAKELSFFERVKARLRNRESYNELIKCLNIFNSEV
FT                   ISKMELQSLVWDILGRHPDLYSGFSEFLARCESMDFELLESGKGKDGKLSVKELQKLKI
FT                   ISAREKFLSRPISELDLSACERCGPSYRLLPKDYPKAPASARTSLCQEHLNDNWVSVTS
FT                   GSEDYSFKAMRKNQYEEALFRCEDDRFELDMVLETTAVTICALQPIIDKLNAMPSDEAS
FT                   QFRIPEGTLSPIHLRTIERLYGIGTDRGSDIRRMILDYPSATAHVVMARLKQKDAEWKQ
FT                   IKTELTPVWVDVYEKNYNKSLDHRSFYFKQTDKKALSAKGMTGEIKEVWEKKKHSEDII
FT                   SRSNDVTSAACNISPDLTFTYADRTVHDDIYAVLKFCTHEMMNSDHAERVMNTWRIFME
FT                   PFFGITRKDPEGDYYDDSAEQAALFVHGFDDDDDGDDDAGDVDDDDDDIDGEDAGNGDG
FT                   DDDGKNRDKILSAEGVVTHGSNEPTQPAFGDNDARNPELLTSNESNLLKLKNAEWSDEQ
FT                   GEKSCDDSSSKHAYSSCNPLSGTTRTTLNGLEYSCSTHETLGEGPIFYGHDGFYLLFRL
FT                   HQHLYERLATARVSAFSMSQQFGQTANPAESRTARERSIHNDFLRLLFKLLNGTIESSN
FT                   FEDECRILLGANSYLLFTLDKLIYKIVKQVQSLLADEMASKLLQLFDYERTRKDGFSEH
FT                   IYHANANVLLLDESCYRFSSFDRGKRLTLQLRDTSLDKADLPAGTMDAQFHGYLGRFLH
FT                   ASIQPDEILSKSWLDQSDRPPVYLRRTKLNVQPFDRKDEDSAFLADKCADVVFNSLECK
FT                   VSCSNSKISYVLDTEDIFYRKSVRWAGRAVHKRIQHRKVMESKFRQWLNTQIPSSVKIL
FT                   GTDPLSMLPQASTPSTEIINNDNETNKSATFPFPGIAVEVAKDHSRQVQHEVRSPDGGD
FT                   GNKLETQVGAADILFKDPGQTDKDHFEEPKFDPDQHTVPDATELDWGIK"
FT   CDS_pept        join(568450..568472,568553..568678,568876..569186,
FT                   569277..572191)
FT                   /codon_start=1
FT                   /gene_family="HOG000100764" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639686"
FT                   /gene_name="SIN3"
FT                   /orf_name="MICPUN_55021"
FT                   /product="Histone deacetylase complex protein "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68387.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG559094"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="UniParc:UPI000199C9A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG6"
FT                   /transl_table=1
FT                   /translation="MKEFKAQRIDTEGVIKRVKTIFKGHRDLILGFNQFLPKVDTCAFF
FT                   LSESAVPPVKPQVEFVHAISYVNKIKTRFANDERVYKAFLEILNMYRKNLKTIGQVYDE
FT                   VASLFKSHNDLLEEFTYFLPDFSTPAAGKKAATGKTLRGKSAFTSGQHSASLAKELSFF
FT                   ERVKARLRNRESYNELIKCLNIFNSEVISKMELQSLVWDILGRHPDLYSGFSEFLARCE
FT                   SMDFELLESGKGKDGKLSVKELQKLKIISAREKFLSRPISELDLSACERCGPSYRLLPK
FT                   DYPKAPASARTSLCQEHLNDNWVSVTSGSEDYSFKAMRKNQYEEALFRCEDDRFELDMV
FT                   LETTAVTICALQPIIDKLNAMPSDEASQFRIPEGTLSPIHLRTIERLYGIGTDRGSDIR
FT                   RMILDYPSATAHVVMARLKQKDAEWKQIKTELTPVWVDVYEKNYNKSLDHRSFYFKQTD
FT                   KKALSAKGMTGEIKEVWEKKKHSEDIISRSNDVTSAACNISPDLTFTYADRTVHDDIYA
FT                   VLKFCTHEMMNSDHAERVMNTWRIFMEPFFGITRKDPEGDYYDDSAEQAALFVHGFDDD
FT                   DDGDDDAGDVDDDDDDIDGEDAGNGDGDDDGKNRDKILSAEGVVTHGSNEPTQPAFGDN
FT                   DARNPELLTSNESNLLKLKNAEWSDEQGEKSCDDSSSKHAYSSCNPLSGTTRTTLNGLE
FT                   YSCSTHETLGEGPIFYGHDGFYLLFRLHQHLYERLATARVSAFSMSQQFGQTANPAESR
FT                   TARERSIHNDFLRLLFKLLNGTIESSNFEDECRILLGANSYLLFTLDKLIYKIVKQVQS
FT                   LLADEMASKLLQLFDYERTRKDGFSEHIYHANANVLLLDESCYRFSSFDRGKRLTLQLR
FT                   DTSLDKADLPAGTMDAQFHGYLGRFLHASIQPDEILSKSWLDQSDRPPVYLRRTKLNVQ
FT                   PFDRKDEDSAFLADKCADVVFNSLECKVSCSNSKISYVLDTEDIFYRKSVRWAGRAVHK
FT                   RIQHRKVMESKFRQWLNTQIPSSVKILGTDPLSMLPQASTPSTEIINNDNETNKSATFP
FT                   FPGIAVEVAKDHSRQVQHEVRSPDGGDGNKLETQVGAADILFKDPGQTDKDHFEEPKFD
FT                   PDQHTVPDATELDWGIK"
FT   CDS_pept        complement(572391..573719)
FT                   /codon_start=1
FT                   /gene_family="HOG000038763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639687"
FT                   /gene_name="PF2_B553"
FT                   /orf_name="MICPUN_113289"
FT                   /product="Component of dynein regulatory complex of
FT                   flagellar axoneme"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO68784.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG717147"
FT                   /db_xref="UniParc:UPI000199C9A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG7"
FT                   /transl_table=1
FT                   /translation="MKIHKLEQQKVLQEHQKTRAELERERVYSLFEIARRHVDEEDSAV
FT                   RNKDKALEVVEDRHRKEINAYKHKIKHLLHERENSLSSFKRDTSNALKLQHRSANAREA
FT                   LLHAEKRSLKSDLKEEELAHAEIMRQLKMEQAKVIAKMRQEFAMARVDMEHKYETQVKT
FT                   LYGDFDLRLNHEVHEIEERNNGHVNSLIKAHDVAFTELKNYYNDITRNNLNIIKTLKDE
FT                   LEDVRKREAANDILMHEISEENKRMADPLTRALQEVQELRRALAQQGKDKQALGVAQNR
FT                   LLDAKNMYLSLEKEYVLQGRRLTRAQLERDEFRRKFELVVHDIQQKTRLKNMLVERKLD
FT                   VAGEKIKRRDAELGEVLCSFSLNPEALQRVSKKLDEVLASKGQLISSLQRDNLKLSKAY
FT                   NDLVLVYRAMMNKFGVPVEELGMSNEAAMSDLSSFAEQSAQSL"
FT   CDS_pept        575962..576411
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639688"
FT                   /gene_name="CAM"
FT                   /orf_name="MICPUN_104708"
FT                   /product="Calmodulin"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO68388.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C9A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG8"
FT                   /transl_table=1
FT                   /translation="MADTLTDEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPT
FT                   EAELQDMINEVDADGNGTIDFPEFLNLMARKMQDTDSEEELKEAFKVFDKDGNGFISAA
FT                   ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYDEFVKMMMAK"
FT   CDS_pept        join(577627..577831,577870..578643,578738..579366)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639689"
FT                   /orf_name="MICPUN_114017"
FT                   /product="Centrosome protein SAS6 "
FT                   /protein_id="ACO68389.1"
FT                   /db_xref="HOGENOM:HBG559095"
FT                   /db_xref="UniParc:UPI000199C9A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDG9"
FT                   /transl_table=1
FT                   /translation="MSENPRMPTGRVDSEAWASSIIANASVLFQKSIPVCCKGPGQTPE
FT                   KVEELSFRILLGFDRERQTKASNSDFSSRAQVLCVQVSSETDPFFFHHLEVSEEEFQAL
FT                   KTEQSILVDFVRFPQKFIELLEACMQRRDDVRPKFLAIMRVGESFAPDFSNLGIVETND
FT                   FKHLSHISLRLKQGSDAAIKHYLAARVMELRCDRGKMIQRNENNAAQLKYLSRKLEDSA
FT                   AEVSLQRQMFQKSEEAMQSRLDELSVNLKTAAMKELENTRKKLESERKTSEAAMRSAIE
FT                   SLTSRNCELDNQVRDLMETKFKLDSRLSDVVSRLHMAENELKTSSGMSPEMKINIVLYK
FT                   TDRHERAKNTAQHDLRVEWLEQQIKDKEDLIASMNGRLRSAESRESSTESALEDARATA
FT                   ARAEDRVSASAGEIRKGNQIIERLQAELRSAKAKARLKAAIIAQQEKLLNERQDVLDKS
FT                   ARKLSDLNRAAETSSSEVNRLRKIVDDQRLKLEESQTLLASNQQMIQWLNSQVNDAQLG
FT                   RLRLRSASAFGPSTPARP"
FT   CDS_pept        complement(580143..581234)
FT                   /codon_start=1
FT                   /gene_family="HOG000186284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639690"
FT                   /gene_name="CYP59"
FT                   /orf_name="MICPUN_55025"
FT                   /product="Peptidyl-prolyl cis trans isomerase cyclophilin
FT                   59, nuclear"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO68785.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199C9A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH0"
FT                   /transl_table=1
FT                   /translation="MAVLLETSMGDIVIDLYTSQCPCATRNFLKLCKIKYYNNVLFHNV
FT                   TKDFVAQTGDPTGTGKGGDSIYGVLYGYQARFFDDEIRSSLKHERKGTVSMASAGQNRN
FT                   ASQFLITLRDNCDALDGQRTVFGTVSEGFDVLEAINNAYCDDKGRPYQNIRIRHTIVLD
FT                   DPFDDPPGFEAFKLEASPLLPKDPDEVHLEDVPPLTGVTGNSQEHMETNAGEKETHSRA
FT                   VLLEMIGDLPDVEAKPPEECLFICRLNPVTTDEDLEIIFSRFGKVQTCDIIRDHKTGDS
FT                   LNFAFISFATKEEAETAYFKMDNVLIDDRRVRVDFSQSMHSLWKNYRRFGRRGGTREDG
FT                   DRAYSYGNVQNEKKHTKKGCEVE"
FT   CDS_pept        join(complement(582382..582453),complement(581485..582255))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639691"
FT                   /orf_name="MICPUN_104710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68786.1"
FT                   /db_xref="UniParc:UPI000199C9AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH1"
FT                   /transl_table=1
FT                   /translation="MKVPSHLRTCYDDGTFVPTLNITKVQDTLLRARPHHQRPKTHLLP
FT                   HPPDENRQLRRKQQQDARQNLRRSRTPRSPRRLRSVHRATRRHTRTPHAHQRQDPRLHH
FT                   RKGRRRPRVRRLHHGHCPQLHPRRHQAHPSPTQPRTRQHPRRRRHQDLRGQKDSRVPPR
FT                   TAGQQQDHHHRHRMHWALQQKRSRMVRRHRETPSRTPTPAAPPRPEHHQRARHIRPRGH
FT                   QEVPLQRRRNTTRAPQTKHGVVHRNHRKSTPQTRRRRARVRRETGHDLGLNTNPKSPV"
FT   CDS_pept        join(583110..583330,583386..583547,583600..583651,
FT                   583715..583792)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639692"
FT                   /gene_name="CUP250"
FT                   /orf_name="MICPUN_112731"
FT                   /product="Putative uncharacterized protein CUP250 "
FT                   /protein_id="ACO68390.1"
FT                   /db_xref="UniParc:UPI000199C9AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH2"
FT                   /transl_table=1
FT                   /translation="MRYSRLTARDEVAVNAGSSLENVLSNQYRAKARRQIREKIERLLW
FT                   LIFSLTTIWYGDGKINLVTWLYNRYSAVRTWFLLALFAISANGIILMYLIHRHDLHRKG
FT                   SRWESQASWAVPTSCCLGFVSFVGFGAVLWPIYSWVTPIAEVVLCMGLLMSSYFVPSLN
FT                   QLPQKLS"
FT   CDS_pept        join(complement(584746..584796),complement(584619..584672),
FT                   complement(584489..584554),complement(584329..584410),
FT                   complement(584207..584260),complement(583988..584154))
FT                   /codon_start=1
FT                   /gene_family="HOG000264543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639693"
FT                   /gene_name="TF2A1"
FT                   /orf_name="MICPUN_112730"
FT                   /product="Transcription factor IIA, alpha/beta subunit "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="ACO68787.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG559099"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR013028"
FT                   /db_xref="UniParc:UPI000199C9AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH3"
FT                   /transl_table=1
FT                   /translation="MDVAPIYLQVIRNVIEGADFSTEQFEEASLTKLAKLWEQKVLESG
FT                   SLRSFDSEIKTESRKRAVFDSHVATSSVEDTAKTVEGTKGAVRSDEILSSDTDDAEEGS
FT                   DYDDDSKCLNLILAQFEKVARAKSKWKCVLKEGVMTLENRDILFGRGNGEFRW"
FT   CDS_pept        586058..587164
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639694"
FT                   /gene_name="ELF7R"
FT                   /orf_name="MICPUN_55028"
FT                   /product="PAF1 complex protein"
FT                   /protein_id="ACO68391.1"
FT                   /db_xref="InterPro:IPR007133"
FT                   /db_xref="UniParc:UPI000199C9AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH4"
FT                   /transl_table=1
FT                   /translation="MTEDLGPENKWKRETAFLCTADFNNNLPPNPIRWKLMDFPTHRTC
FT                   LALPGAEALHDELSQRNTLSADLGESVDPVLLKKLQVCSGRASLLSQDATLLNEYTNAH
FT                   RAAARNDFNVSSARRPDLSKALWLMNTQYISSMTLPEHLGRSEKDWAKRKHSNVLDITR
FT                   RNSHASQIEAIHESFKAAQNVPAHEKNADIHPAEVIEVLPDIDRQHGSYIHFTFDESPA
FT                   SDIEGKDILRNDCPLGQVENSLVKPYSIDGASSSPDKFIAFMTPSLPIVYFPKIQEGSH
FT                   KYEWRNEYQYRMANDYGTKPDTVCLLFDPGMSCMRYVKLNSRMILSRRSKHAKGKAARR
FT                   MQRPSSITVKRIPSDLPDSPRVHKINRL"
FT   CDS_pept        complement(587482..587775)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639695"
FT                   /orf_name="MICPUN_55029"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68788.1"
FT                   /db_xref="UniParc:UPI000199C9AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH5"
FT                   /transl_table=1
FT                   /translation="MAEALAGESRKRADEARDFLRKAREMVNGAREAPHRLRRDEKRFH
FT                   KAEDAYQLLWERQVEKMKDCRDTLKRVKPRLEAYGAERSHRLSLDRSENLII"
FT   CDS_pept        complement(588717..589676)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639696"
FT                   /gene_name="PAP2"
FT                   /orf_name="MICPUN_112729"
FT                   /product="Phosphatidic acid phosphatase-related protein "
FT                   /protein_id="ACO68789.1"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniParc:UPI000199C9AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH6"
FT                   /transl_table=1
FT                   /translation="MQTPLRPTARGDRHLALHRCAASHVPFMRPAVQISSCIGKAIFTL
FT                   PMRAEVAWSSDSATSSLRRARPAFARCAIARDIHDLPPSAPASSAQLQSNLVKKNMYRG
FT                   TKRFSVRAVSEKVGAVLKGHFVKNSSVSSGVSSRTACSAADSASCDFFAQCTTTAAFAT
FT                   VFAELSGNLVFMCAFWSWLTAQTMKYFTAFYREGKWDWRVMFDSGGMPSSHTSLVVGLT
FT                   TAIAYQYGLGSTLFPLSLAFSLIVMYDAAGVRRHAGKQAEVLNKILEDMFHGESISERK
FT                   LKEVLGHSPLQVMAGAVLGVFVAVLYAYQYGSGYAALS"
FT   CDS_pept        join(590778..590876,590945..591017,591086..592002)
FT                   /codon_start=1
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639697"
FT                   /gene_name="RAD51C"
FT                   /orf_name="MICPUN_114025"
FT                   /product="Rad51 DNA recombinase 3 "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="ACO68392.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG413235"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199C9B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH7"
FT                   /transl_table=1
FT                   /translation="MADSKVASPTHSPQWYEDSLQLTSVPLAPSIRSKLQNAGFVSVRD
FT                   VKGARGPIDLARETGLTNAEASEVIKALRLGIEGTALAGAKSASEILYEESRKLAVFTF
FT                   SKDLDDLLGGGVAVGEITELCGCPGIGKTQACMQLCVSVQMPGAFGGYEGSAVYIDTEG
FT                   SFMAERAKEVAQATVSHLVSISQFLPKHLSESGALSQFTVNEILDRVHLFRCHEITELL
FT                   AVVESLPMYVRAHGVKLVVIDSMAFHFRQDFKDMALRTAILAKMTTQLLNLAKSEHLAV
FT                   VSVNQITVKPDPASGVARLVPALGESYAHGCTTRVILSWESDRRMAYLFKSPRLPRGKA
FT                   KFTVTNGGIRDVRGMKRQVDLK"
FT   CDS_pept        join(complement(593257..593385),complement(592851..593150))
FT                   /codon_start=1
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639698"
FT                   /gene_name="DIM1"
FT                   /orf_name="MICPUN_55032"
FT                   /product="Mitosis protein DIM1/U5snRNP-specific component "
FT                   /biological_process="mitosis"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="ACO68790.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="HOGENOM:HBG522501"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C9B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH8"
FT                   /transl_table=1
FT                   /translation="MAFLLPHLRSGWAVDQAILTEEERLVVLRFGRDADDTCMSMDETL
FT                   SSVADKVKNFAVIYCVDIEEVPDFNAMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINW
FT                   AMDDKQEFVDIVEVVYAGARKGRGLVVSPKDYSTKYRY"
FT   CDS_pept        594531..596192
FT                   /codon_start=1
FT                   /gene_family="HOG000271515" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639699"
FT                   /gene_name="ALDH"
FT                   /orf_name="MICPUN_113300"
FT                   /product="Aldehyde dehydrogenase"
FT                   /function="aldehyde dehydrogenase [NAD(P)+] activity "
FT                   /biological_process="cellular aldehyde metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68393.1"
FT                   /db_xref="GO:0004030"
FT                   /db_xref="GO:0006081"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000199CA2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDH9"
FT                   /transl_table=1
FT                   /translation="MLSKLDVRPADVLTNDRTKAALCTFAGLTCVALSLQSWSSPIYAS
FT                   RCYAFDKGDRERSKGWKILGKRSVVDVSEIQTCVFEMRDAYASGCNLPLENRIASLSSL
FT                   LRMVTENENRILDAVWKDLRRPVGETLYYDILLVQSELRKLIKNLRLWTAPERIAKHSL
FT                   LTFPSSQWIENEPYGTVLVVGPFNYPFLLTISIVAGAVAAGNNVILKPSNDVPFSSILL
FT                   EDLFSRYLDPAVVSVVGPRVPGDGIDVMTALLAEKFDFIFFTGSTQVGSIVAQRAGAKL
FT                   TPYALELGGKNPVFVTPTADLQIAAKQCIWGRTLNSGQQCVAPEYVLCHHAILGEFAFE
FT                   LKRWIAKLISDPYSEGCMGQLVGGGSVARNATDRAVRFLDKIGTAGEKLVCGGGYRKEL
FT                   GIIEPTVVICGWDSELMQDELFCPILCVIPYHNLEDTAVMVRSRPKPLALYIFSRSTIE
FT                   QRTVLDNTTSGGVTINGVIYHAGHSSLPFGGVGESGSGVYHGRHTIDCFQHKKPVLKKW
FT                   RGVGDMGIISDPFFIYGPYRNGGMKTKLLRLVGYMS"
FT   CDS_pept        join(complement(598149..598214),complement(597798..598022),
FT                   complement(597575..597668),complement(597029..597469),
FT                   complement(596595..596977))
FT                   /codon_start=1
FT                   /gene_family="HOG000276712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639700"
FT                   /gene_name="TR"
FT                   /orf_name="MICPUN_113706"
FT                   /product="Thioredoxin-disulfide reductase "
FT                   /EC_number="1.8.1.9"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="thioredoxin-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68791.1"
FT                   /db_xref="GO:0004791"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006338"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000199CA30"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI0"
FT                   /transl_table=1
FT                   /translation="MTPDVHPYDYDLVVIGGGSGGLAAAKQAAKLGAKVACLDFVKPSP
FT                   RGSTWGLGGTCVNVGCIPKKLMHQAGILGESFSDAKEYGWHVRNDGHDWNKMKNGKIET
FT                   MTANRILIAVGGRPSYLDVPGAEESLGYDTTVAIRSIPLRGFDTEIAEKIVGYMERHGT
FT                   KFMRDSQPCAFEKRAGGKIAVKVKNTVFGNEFETEFDTVILAVGRHAVTAGLNLGAAGV
FT                   RVNPRNGKIPCVDEVTNISHIYAVGDVLDMRQELTPVAIKAGVNLVNRIFSGGKYGCIG
FT                   MSEELAIETFGDENVEIYQSYFKPLEWAVNHAEHDGVAHREDNACYAKLITNLSDDERV
FT                   VGFHYVGPNAGEVTQGYAVAMKMGAKKSDFDGTVGIHPTVSEEFTILSITKRSGVDATK
FT                   RGC"
FT   CDS_pept        complement(599174..600613)
FT                   /codon_start=1
FT                   /gene_family="HOG000227974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639701"
FT                   /gene_name="ANSA"
FT                   /orf_name="MICPUN_92871"
FT                   /product="Asparaginase"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO68792.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="HOGENOM:HBG497495"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI000199CA31"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI1"
FT                   /transl_table=1
FT                   /translation="MAPAATALVSCNKLFVWQFGMKKSGVPLRPPMHTAPAMPCASKSP
FT                   HRTYAAGEDPQKEDAVDGPLAKSMRFKGTAKLVPSDCTPAPEQSGPSSEGGVLPVACEA
FT                   SSGVVTQTRPLPSVLIIHTGGTLGMQTTAFDASEQLQSRFQGVVVFKSGTGGDYTKALQ
FT                   PGKLLLNLVTAVPELKTFANLQLKVLMNKDSCQIGPKEWIQVAHELHKRRDEFDAFVIV
FT                   HGTDTMAYTASALSLMLSGFAKPIVITGSQLPLCMPRSDARQNLIDAVTCATAGFSPPH
FT                   IQLEEVALCFGGVLLRGNRARKKSATIYSAFDSPTYPPLARLGVGLEWKRDALLQFEGT
FT                   GDRAHRRVAYTPRLKLEPSVIRLPIVPGCDPKKAYGDLYARGVRGIVLEAFGVGNMPWT
FT                   KATGWIPWLRSQRKQGMVIYLTSQCESGGLHPELYRTGSLALELGAESGPMMTPECAVV
FT                   KLMLCLAHPDLPLALPIAGEL"
FT   CDS_pept        complement(601835..602632)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639702"
FT                   /orf_name="MICPUN_51355"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68793.1"
FT                   /db_xref="UniParc:UPI000199CA32"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI2"
FT                   /transl_table=1
FT                   /translation="MARMLNQDGGTGIHFLNILPRPCPRHVISWKQNSATFMKGHESNT
FT                   LPSQNHHGQQNRLPPTYLSHAVEHAVRLNPLALATWYFDCIYMNSITFLHGPVSCYLQK
FT                   KTHFLHQVSSCARQASFSSTALTQFTPWSIRLSSLLFVDKNGYQITSSHLHELLAGKQI
FT                   RLLRRSQRCLSSAGDGIIRSISTELGVLYILTPLKPSQLKSVDMVMLFDMVLPLHLILI
FT                   NKLVHVHPFSCNNGLATSGSGAKVIRSRRNMWRGDRHVLSGKQ"
FT   CDS_pept        join(<604885..605292,605390..605629)
FT                   /codon_start=1
FT                   /gene_family="HOG000243994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639703"
FT                   /orf_name="MICPUN_77911"
FT                   /product="Glutaredoxin-related protein "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO68394.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG319386"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199CA33"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI3"
FT                   /transl_table=1
FT                   /translation="IPSGPGVYAVYDANKDLQYIGLSWKVIASINLHMHELPQLCDSVR
FT                   YAAVPTPSKAALQNAWKQWMSEHINENAGNLPPGNAQGNSLWAERKLSPVKDSFVLTDG
FT                   VAECVNDDEIIKLCRKLVSSSRIVVFIKGSRSNPECGFSHRVCMIMDELRVEYETVDTL
FT                   DEVHNHNLRNVLKRFSDWPTIPQVYFNGVFLGGHDIIEEMHNSGELKSILME"
FT   CDS_pept        join(complement(605742..607229),complement(605698..605706))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639704"
FT                   /orf_name="MICPUN_55038"
FT                   /product="Inositol-pentakisphosphate 2-kinase "
FT                   /function="ATP binding"
FT                   /function="inositol pentakisphosphate 2-kinase activity "
FT                   /protein_id="ACO68794.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0035299"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniParc:UPI000199CA34"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI4"
FT                   /transl_table=1
FT                   /translation="MTYPRHALTIASDWHYMAEGGSRVVMCYRGPDPSLVGKVLRVRKR
FT                   AKDRPLQNLTKTVDYEQNHRHDLTDLELWVEFFSLERQDQDELAEIFSDKLLRPFLSRN
FT                   QTDTGVRIRVDASFLTQVATSIASFRPAKRRELSVVDVKSRSAVIVQNHRNIVKGDYST
FT                   AQVISLEIKPKCGFADPMNRAGIARFKMHQGLKLAGGKLLRTSNYDPLDLYGELDEKIY
FT                   TDTCLRVHMARQGSPQHAQHRRAMLALIQEPQNNFLVTRPNDLDGTNFSTHLINDPKYP
FT                   GSMNPRPCKERNFYTHGDADRISIKPHSFRNFGIWQLSGFLGRRTPGEQENALHNNGSV
FT                   VNNLIDVALMALSCTGVLSRIRAAQRLDRVGIEGAMRLVARIRHMKQIPTSVTGTGNHH
FT                   EISMWGSVSKVDRVEFAYRLLRNFIISATAKDCSIILSINRLNTMASGVHVKLRHDSRK
FT                   VLIKSPVFRMQRRTVRETTEEYVKFLCQVAVVDQDMKLKD"
FT   CDS_pept        join(complement(610325..610542),complement(608529..610092))
FT                   /codon_start=1
FT                   /gene_family="HOG000264307" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639705"
FT                   /orf_name="MICPUN_55039"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68795.1"
FT                   /db_xref="HOGENOM:HBG559106"
FT                   /db_xref="UniParc:UPI000199CA35"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI5"
FT                   /transl_table=1
FT                   /translation="MYCSSENMLKCPIQRACAKRAACLSATAGLPNTFIHPCRPILTSR
FT                   RAITLGRCIAANVSTVLPVGEPGRQRNKARQLTLQEQILDAQDAATVLDIVDASLEQFG
FT                   GVNAVTAVYRISRLLTSRTGRLRRKESEHITSDPRFECLIQTLESKSSELDKLGLENRK
FT                   RAYQKLRVDADLRAGAALSVRLIERAKDIQGDLMDAASVEDVLLLVEKQGEIFNKVNTS
FT                   TALHRIARIASTAPYATAGANQQSPDAVLRITRDERFHHLLQLATALSKEMSIVSVSNT
FT                   LWALARLRCDIHEMNTLLDDLAGRAAATAHNAQPKHLATVIWALAVLGHEPRSRLLRAV
FT                   AMRVMDTAGDFRAPDVVNMLWAYARWTRLAPLNSPDGLPGAKDVVKELSCVALANLTDF
FT                   TPYQCANLSWSLAMLDAEVQPRSLASILDRAASDPNGLDDTALTHTLWAVGVKGTVIDG
FT                   AGGSFQTLLAEAAKRALDRGVGRTGAAGVLWACGHLRVTPREGEADALLDCLLDDGEEA
FT                   LKGKLVQPQALVHGVWGVCHMDGVTLSQKHRDAVFSNVSRLAEAGKMEARYADALRASA
FT                   TGAGLDPVELEHALTTR"
FT   CDS_pept        611459..612634
FT                   /codon_start=1
FT                   /gene_family="HOG000225930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639706"
FT                   /gene_name="TOP6A"
FT                   /orf_name="MICPUN_77331"
FT                   /product="Type II DNA topoisomerase VI subunit A 2 "
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO68395.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="HOGENOM:HBG559107"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniParc:UPI000199CA36"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI6"
FT                   /transl_table=1
FT                   /translation="MDEVLSKVHALETAVKCRPELRKTLNDLNLNEAYREVVDLPGVEV
FT                   AAAIEQVMIAIADTILRNEGFGYSLPSRGNTDQVYVEQLDRIVLKEKHTFTTFHNTSSV
FT                   RKVAILTRVMQLIHGVLTRGIHVTKRDLFYTDVKLFRDQKDSDSVLDDISCLLGCTRNS
FT                   LHVVASEKGVVVGKLTYTEDGDEIDCTKMGIGGKAIPSNIDEVDCFRSVAKFVLLVEKD
FT                   AAFMRLAEDRFYNRFPCIIITAKGQPDVATRLFLSKLKRDLRIPVLALVDADPYGLKII
FT                   SVYMQGSKNMAFDSANLTTPDIKWLGVRPSDLDKFKIPEQCRLEMSQKDIETGHHMLNE
FT                   DFIQQNPKWVREVKMMLASKTKAEIQALSSYGFQYLSEVYLPLKLQEGDWI"
FT   CDS_pept        complement(613234..614220)
FT                   /codon_start=1
FT                   /gene_family="HOG000264327" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639707"
FT                   /orf_name="MICPUN_92877"
FT                   /product="Phosphatase 2c-like protein "
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO68796.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199CA37"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI7"
FT                   /transl_table=1
FT                   /translation="MEDRWNVALHSQGHAAIFAVYDGHGGSQVSTYLMENLSQTILQDP
FT                   TLLSDPVGALKRSFATCDHAATEENPKRNPLSSSPGPGSTAVVLLILPPRLLVANVGDS
FT                   RATFVNRDGEIVFETVDQRPTCPTEISRLRDLGGKIRCVNGVTRVSGILAVSRAFGNAG
FT                   LKQFIKAEPEVTDIDLDKIDTCIVCSDGVTDVVDSPEAVDFLLRSSQRSSAYSNAHAMD
FT                   PVDQNGRKQEHSWHGKRRSGHFLDGEPDKFSAISLLGPNNGRGAAKRLTTLAKTRHSTD
FT                   NITALLLSVSKRTSAACGYNLRSRQKSPSDMDSNKDIKRSRTDACKT"
FT   CDS_pept        join(complement(617348..617420),complement(615689..617235))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639708"
FT                   /orf_name="MICPUN_55042"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68797.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199CA38"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI8"
FT                   /transl_table=1
FT                   /translation="MHHSMSCLWSSSCASATLWWNFYEDYVSVFFCNNNLLLRLCACPR
FT                   ITFLLQRVPYSVAPQAFNDSYRDILSAFGRIAGITEELDTADEVTRGRIALPLRHGGQG
FT                   LTDPSHIADQALVANWAACAPLLANKAPALSDIANEISGPRRSARNAATTRRREPNQSG
FT                   PCHGHIRAAWDRIRSLGDEEQKILAVGFSESAGEVFPVKGLQRTLSHLEHERRYKGLFH
FT                   DASPEVSAAMHSLSSPHAITWHRVCPFEPRLQIASDLCKMRIRQELDLPMPCLTDGHNN
FT                   QRLAYCCNPPHAALEPRHAFNHLICVHTSNAGGNQTRTHDKVKFAVQAVCKLGGLTTFT
FT                   EPIGEIPGTTNREGNTNSLRPDIRVDGLRDTGITILADVSITHIMDSAANHTSQPRPRQ
FT                   GNSAPNSDPIMKRETEKNNKYKTAAAAVHKEFIPLVMDTYGRMGKPFLNLLKDVAAHTA
FT                   HRASGNVNERTQAIYDSIDPPNELRNRIHLRNLALVHVALIISLMQRVAGSTVTNDRQH
FT                   GARGGIYGAHEHYVQPYPVTNF"
FT   CDS_pept        join(617925..619511,619584..619654,619754..620006)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639709"
FT                   /orf_name="MICPUN_113605"
FT                   /product="JmjC transcription factor domain-containing
FT                   protein"
FT                   /protein_id="ACO68396.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199CA39"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDI9"
FT                   /transl_table=1
FT                   /translation="MCDSSDPNGLYDLLSTFLLRAKENFDRLVPTLSVVGGGSVARVLR
FT                   ASYDSMLALRACFQESTRDTRPTTKYLVKINHTAAIAVDIAWEKLHTGAWSDACLAWRE
FT                   LYVVGTLLFVSTALLIESKKNDESTWTFSREHLSKRVQIAGLLGIPMYRGVIEATLRQV
FT                   CNALKCGSVAIVGERHVEKTTVTNHLTEKVQRPWRIGCKHNSISPANFMRRRLVRWSSS
FT                   LPLGSLICDANPIRRPVQQLSRPYPAGSLSTVPLLDDLLGSEPFMMSGVGEGWPALYKW
FT                   RDPAYLIVSTEDRVVPIECGEHFLHCTWTQKLMSMAEFMENYVRPEKAVPQAAEMANQF
FT                   HLKQRIRKRRDAMHAFCGRTEPQEIFDETVFSRCSKGYMAQHDIFEHIPRLLHDLDFPF
FT                   FCSQGSCTRGHFPKKMIWIGPAGTISPLHTDPHANLFSQIAGYKYVRLYAPRCETNLYR
FT                   NTTAKYCNSSQIELRGSLMGMLSEFPDFLNAPYVDCVLGPGDLLHIPPLHWHYVQSLTS
FT                   SVSVTMWCRPKYAQEILDECTYPCFLPFNPALLAKVRMSILDGYKTLLKFDMRLRLSNP
FT                   SAVLWKAESMGWQFYLGPFQGSDCGCEMLTPVAFFGKPRKGMQMPKLWRHIVILKCSGH
FT                   R"
FT   CDS_pept        join(618558..618911,619053..619532)
FT                   /codon_start=1
FT                   /gene_family="HOG000264453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639710"
FT                   /orf_name="MICPUN_113605"
FT                   /product="JmjN/JmjC protein"
FT                   /protein_id="ACO68397.1"
FT                   /db_xref="HOGENOM:HBG559590"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199CA3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ0"
FT                   /transl_table=1
FT                   /translation="MRRRLVRWSSSLPLGSLICDANPIRRPVQQLSRPYPAGSLSTVPL
FT                   LDDLLGSEPFMMSGVGEGWPALYKWRDPAYLIVSTEDRVVPIECGEHFLHCTWTQKLMS
FT                   MAEFMENYVRPEKAGYMAQHDIFEHIPRLLHDLDFPFFCSQGSCTRGHFPKKMIWIGPA
FT                   GTISPLHTDPHANLFSQIAGYKYVRLYAPRCETNLYRNTTAKYCNSSQIELRGSLMGML
FT                   SEFPDFLNAPYVDCVLGPGDLLHIPPLHWHYVQSLTSSVSVTMWCRPKYVSRTND"
FT   CDS_pept        complement(620139..620549)
FT                   /codon_start=1
FT                   /gene_family="HOG000241672" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639711"
FT                   /orf_name="MICPUN_113606"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68798.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG747332"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199CA3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ1"
FT                   /transl_table=1
FT                   /translation="MPPKATAHPKYEDMVKAAILALKDRNGSSVPAIAKYLAANYKLPD
FT                   NFKKILSTQLKNLVKSGKLLKVKASYKLGEALKKVPKKPKKKAAPKKKKAAKKPKKKAA
FT                   KKPKKAAKKAAKKPKKAAKKPKKAAKKVAKKK"
FT   CDS_pept        join(621878..621961,622028..622162,622386..622475)
FT                   /codon_start=1
FT                   /gene_family="HOG000155312" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639712"
FT                   /gene_name="RPL36"
FT                   /orf_name="MICPUN_114038"
FT                   /product="60S ribosomal protein L36 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68398.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG324276"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="UniParc:UPI000199CA3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ3"
FT                   /transl_table=1
FT                   /translation="MDGIAVGLHKGHVVSKRKLAARPSQRKGKLGKRVKMIRDLIRDVV
FT                   GSAPYEKRLMELLKVGRDKRALKLAKRKLGTHLRGKKKREEMGNLLRKMSRKAAPNA"
FT   CDS_pept        complement(622869..624458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639713"
FT                   /orf_name="MICPUN_114040"
FT                   /product="Sac phosphatase"
FT                   /protein_id="ACO68800.1"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI000199CAC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ4"
FT                   /transl_table=1
FT                   /translation="MSDFAGHFQSSLEVSSKVVFGCVGTIRLLAGYYLIVLTSYEVVDE
FT                   IQGFRVYRASGFDIVRCFAPETYGSLSPRQKRDEGRYLQLLRASLQRGSRLLYFSLGYD
FT                   LTLNCQRQHLFTRSSASLPKFIAKDKLLGSKLTLRAMHSKEVAITYRGRMAVPGAVEYP
FT                   RTCWQTADKSFCWNRHPGQTLATAVAATGSANEHDVQSMILPLVCGSFESLQESIMNIT
FT                   VKVSLISRTSIGRVGIRNHCRGVDSEGEAANFIETEQVLEIPGREALYSFVIVRGSVPV
FT                   KWSQPLVDLAWNQQILLHEPCDIAPVRRHFSRLLSRYGIVTVVDLLGTIGDEGRLKACF
FT                   KKALASLPLPQTHEKLIRYFQYDAHAESRRGCPASLKRLQIWSKLEICHQGYFAITLDE
FT                   GTESVVTRMQDGVFRVNCKDCLDRTNIFQCRLAQIALQEQLCAVLPQDGDSMIRRLSRL
FT                   HRRLWANHGDRISLQYSGTGALKRDAVRVGRQTLSGLLRDGRVALTRYFRGKFSDGWAQ
FT                   DGLDLWTRGHYA"
FT   CDS_pept        complement(625996..626202)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639714"
FT                   /orf_name="MICPUN_55048"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68801.1"
FT                   /db_xref="UniParc:UPI000199CAC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ5"
FT                   /transl_table=1
FT                   /translation="MSPRRIQCSTTVITEGRDLPEGVWDVFKLFLTTQARRDELFKAKN
FT                   AGELNPHNLLSKMNLWWTMQILD"
FT   CDS_pept        join(complement(647351..649360),complement(626753..647284))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639715"
FT                   /orf_name="MICPUN_55049"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO68802.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199D58F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ6"
FT                   /transl_table=1
FT                   /translation="MDSITSDQFAHVALDCNRDKPAFSTPQQCLSDRNVRIVLPCFISI
FT                   SAVTSHRSDESLIVFLSSTYFQDYLTPKGCGYAANSRRRESKQRQMSYLVKAANWLFGF
FT                   GSSQKAVTKGTQEIQSSHEREIIRPQSDKKDPDEFDVNETMASGKTDCDAVVWQTDFWK
FT                   DDKYEDAHLSMRARLCYTGLSTVLGDGLEFICDISCFLSRAATDYPAALYPVAVVDVRS
FT                   SMEYSSCPITFPYPRLATYSALVAQCLRRDLNVRPGNVVAVLMRNSYEVMVVHYACAAI
FT                   GAQLLNLNTQLVANEMALILAESGAMTIVANPLTHEEVLQEVLRENSFERCTPSLVNVH
FT                   CMTRLSSTNHANTSGWLNRGEKLRWTEILAFSCHAAPLEFSSIAIALATPAHIYYTSGT
FT                   SGKPKGVSLTHAVVARHAVATCSEMHMNNDDIWLHVAPMFHLVDAFAIYSVTFVGGRHV
FT                   VVERFEASNALCTIEREGVTITNMASTMVAIICTNANAHHFDLSSLRVLSCGGCPLAPA
FT                   SVTKTFSTFGCEFFISYGMTECCGKISMSIIDRKFLRSNNHDVCLATMQTSGRPFFLMD
FT                   VKVVDLKANAGSHAHENGLKDASRIPRIGEVRVRGPTTFGGYLQQGDAQLEHFDDCGWF
FT                   RTGDLATVDSNGYITIVDRAKDMILCGGENVYCAEVEGTLFAHPAVGQAAVFGITHPLM
FT                   GEMVQAAVTIRPDTTDDQTEIITYCRRRLSRYKVPSIVFVVKELPTSANGKVMKQSLRE
FT                   QCQDVATPSRRNSTPSTISNAFSSPMKGSTSTHRRASTHNFLTAMNYPEFKYPSKKCIL
FT                   LGGSLIDALGHAELLFTGVTRTEATIVVQSNTAWNSIRDTCMFSEMIHRYFGIISKICF
FT                   VSDIRNHNCVQAAISIVQRTAVGAIVKVSTFTGTDEGHVGHNANRARQHRLECTEKNTK
FT                   ILENYDSVLNAVQLALRQICPKQYYLVAEGSVPLTNAGLSIQTLTQFQAVLEVNFGVSL
FT                   TPSIDSLTIHEISEHIYNLIQPAMTTQKSVARVIHNAIASTLGLALRDGDVPFDENMPL
FT                   MDAGLSSLGAVQLQETLSREFGEEMLNRPIPATLAFDYPSINQIKAFFIGSMIDGPNRS
FT                   EQSKNSVSEISGQGSKHITGMDALDITCHILGIECRAPGSQIEISSDTRLTLDSVSVTP
FT                   LSRWDLYFICAKDIGDLPPNFGGMLPNISTFDTGLVRMGKAETDNLDPQQRLVLTSTIS
FT                   LWIMDSSVARCQSAKFWATFIGMSRVEYPIIYQTNASVLGPHHATGSHLSVTAGRVAFV
FT                   LGLGGAAGVVDTACSSSLVACMIARSWTLNDMKLIDTFSNTQPRSFAGGINLTLCVFWS
FT                   LACTAAQMLSSEGRCKTFDRAANGYVRSEAIGILHLSGNSSLNICHQVVTSAPKYVQII
FT                   GVSSNQDGRSSALTAPNGPAQHDAIRSCLVICRIDPRQFSTLQTHGTGTALGDPIEVNA
FT                   AIAAFCCDSASRLRPLELAACKSICGHAEPAAGILGQFAAINELNLLWRHPLTHLRGQN
FT                   THIIAALKSTPSGTAESLISFSKQIAEHTDNSGYSSVSAFAFQGTNANSSLLAVNTLSS
FT                   NCKNGRGTLLNQKSYWHQPLWHAWLQRCSVDVVGPHPCILYRVHVSPAIANLKDHVVHS
FT                   RMFCPVAAYMEISVGILRKQDRNIQSATVCYSTIPCPMLLNKVNKCTTVDVHVCCKTSK
FT                   IQVKSFDDSNTRSSLHLDCTVHETIVSDNVPWNDTLKHITKWDDGIFINLPLCAVVSRT
FT                   SNVTSQPESTIMDPGSLDSLIHLPEGTGAHFRGILARVPVAIKAFRVSRQPVNPCFAWC
FT                   SASDDATGNDANNHHGMCGVRIIQLHITRPRARTDMSGKLRQQPFENMHQSVYAIDRLT
FT                   RPSKTATFAANTSNFRVCSDIYTRKLTYRQTSAFLELAVFNVDFKLISAGKFGDMLQGT
FT                   ARSLWHESVKGFSLRIDTNDVPLGNRHVSLSDPLIRETFSRGTINSAVLIKLNMAHREK
FT                   RGMSLSVAIEKVFTKTKRLCRCRLIKTSKTGTASVGVIFGGLGKLGESVTSHLFMNVSI
FT                   TFVMSFGRTGRSRSLLSDSYHMSAFRADTTRASEAKCAVNSVRLLGHILVFNLCGTLAD
FT                   AHSAQQCPGRIRPTFASKARCAFLEFFELQLWRISFHFAFSSLTALMGNAGQTGYAAAN
FT                   AALDADAEARRNEGTPCMSIQWGAWSGGGMASGLESRMIQVGVGLIHEKEGLYALQHIV
FT                   DGEFGCHATLSVCAFHWPRYNRAHKYVRDSKFLQNFQRNTSNHIKDLEGRCLWRPIADS
FT                   KVDELLPRQKITGCEITCMVKTAVSLILGHSISSSAPLIDAGFDSLSSLEFAAALDQSI
FT                   RSAGLCTIELPVTLIFDYPNQDAIIEFLSSKLSHEPNTSQVFSEVPSQHAANSECNFSK
FT                   LDPNLQVVSIFSLVREIASCSSPKTDKVVRLPLSRWDWDICSCLCATFGGFISNPASFD
FT                   NEKFSISHSESVTIDPQQRILLICCAVSIPKVHGVKFSLQQNMEVGVMIGMSTTDYYKL
FT                   ANDVGTKAAATTATGSAFLSVAAGRISFVLNTNGPALSIDTACSSGLVALHMATQSLLM
FT                   ESGHMSRCIVGGVNLVLHWSTSAMFASAGMLANDGRCKALDSRADGYGRSEACVVLFVG
FT                   SLFGVKKSQNSDGGSVAIVAGSSINQDGRSSSLTAPSGPSQKLSIQLALADLQYKHHIC
FT                   FSISTLQTHGTGTPLGDPIEIGAICTLIERDLTCAVLILGATKTSFAHSESSAGLVSVV
FT                   IAVMEQIRQDLHDGLHHVTHVNPHISSVLKIIPVETSIERQIAPAFRYSGCRNGKSTSL
FT                   PIGCNAFAFQGTNAHLILIQWPDAVIGLGLDGPQVPAWCAERFWLFPTPHRIIAHFSLT
FT                   GCKFACIAADLGSTSWIKDHIVRERIILPGAGALEIAQATACIACLSNTFSVAVGGVSI
FT                   AAPLELSNFRFDVKLDVGLGVVRIGSPVIGMTITGRIHTNTINHDNSNARCEFEIRTLF
FT                   FIKLYCFLTYDGCTPHETCAFRGAFEGNIFSRISCCTNDGLLMCPAALDATFQSLSATW
FT                   HTQSQEELTPVELNVPTAFATYAVIEKLRTNSSVNFARSQLDVMDDIHGAKISDHNILY
FT                   RCDVKGMASKPVCYELKTSNSPSSLTALIEERRKSTSPGHFVSNHNIVHRTTSDARHLL
FT                   CMLQAPMCIVRQIASANDYLLGGLRSVVMELPHMELNEEPGLQVACGIHILAVGFPEIY
FT                   DDGKYSLVNIISGPNNIWRNTRKFMTGGFRQRPLVVVGGLGALGQVITTHAAINWKNSV
FT                   IFVQSRVGRSVANIFPGVCLMVIYAADVCVASFRESCFPRNIQSPTVVNTAGVLRDTTT
FT                   ANIDAIKIRTVLASKCARQIGSNHSVQDAIHVSCLFSSIAVMLGSPGQAGYSAANARLD
FT                   ETARRYANAGLPVCSVQWGPWEAIGMADMDCVNVQRLRNRGLHSIQLYEGMQFFEAILE
FT                   LFETSHGGHAVVTSVSRTDWNRYVAAVPMARGCARLLFQNFVEIPKNGSEHHYPRKEVK
FT                   TSKTSQRLTLVQSCIDLNAITEQVISIVRQFIGGEFPLNLPFMEAGLDSLTSVELVYSL
FT                   SNAFSIKLAATVIFDYPSIDALANYVCGLLKPCTTLQYSDQMRSDATAFQMDNGERSST
FT                   SVQMKCWSLSGDDSCFDTTFYYDRPDKVPISRWDAEKVGSVKNLPSAFAAFISSPEAFD
FT                   QELFHISFLEASITDPQQRLVLTGTLKIITPNISREIGSAGRRGVYVGLASCDFSLLSA
FT                   STRDPGSHCTSAFAATAFFSSVTPGRTSYVFGLTGPSIAFDTACSSSLVALNSAFIDLK
FT                   SLCINKLSDVEHLHSALVGGVNVMLTSFVTGTFESAGMLSSSGRCKTLAEDADGYVRGE
FT                   ACIMLLLEKLKECQIDFCGTPIIASAAVNQDGRSSTLTAPNGHAQRHVISLALFYANEE
FT                   VSNQLQTSHTLEMHGTGTPLGDPVEIGASQSIFTKLISLVTAAKTAMGHCEPAAGMCGL
FT                   ICIAEKVINLHIGKVGVLHLRTINPHVAEATFEHACFRGSRELAAIAQGKESYKAGVSA
FT                   FAFQGTNTHVRCFQDCDQIIRRSHLHKIIVTNPHRVWMTPIRRASIFSSSVCNDANGLS
FT                   IVKSIALDFVSDCKPQASPYLDHVISGHILFPGSGLLHLAYNAVDAVLTKGSDQPEICT
FT                   AVIPAPLKIHATMQNTLTVSACLTHGEIRIESFTATHFVSCTHCIRADHTSLSKTYHMK
FT                   EISREALRAFHTKPIDSSFAYQCMVHAGLQCGPSFRLMCNIWYSGERGRAIASIRTLRS
FT                   QLCAMPSIIDSSMQLAAPPIGVSKCLRVPAAVGGYLQTTIKEDDTISIEGFGVALAFGE
FT                   KMTTADHVMTDHVVSNVHSNQEFSRLFEMKCKPVNSSPISRKNETQNLALNTLFSPHLR
FT                   AMPISNQNAHSTPTSLRMKTSSLRASLAAAAAAQAFKRERLSFHLPSSNLHRITGSSIA
FT                   TLLHCFEQENPLSCSSNRDERCIDGIQMLSVLLPDHSESIKNGPEISTGLFFNALGSGE
FT                   QKPHVLKAQRQSSSRYRTLIVTGGTGALGNTIVTDNEVIRNINHTKLTGRSGRTGKSSF
FT                   AKNTAHLTIVRHTNMTHEITMRLFTSPGSLIFKLDGKLCDCMLQSQTVGTFRTVFEPKM
FT                   CIRDPVSDVMLKFLNAPHALILFSSIASLLGSKSQSNYAAANGILDAIAEPSLQMGIAC
FT                   QVIQWGAWAGPGMASIGSKRLERIGIRLISPGDGVHSLWSIVDGCTSPPLPLGMNVILS
FT                   VDWANILSRQPQSSTLLGGKFSEIAELITPTLRSCSYLVSCEQHEGPGSLKPASTATTR
FT                   IDDTNPKYFPSEAEICTLVHEELATLLGKDEVDPNLPIMHTGLDSLSAVDLRATIGEKF
FT                   GHVLPATLFFDYPTVASAAAYIMSMLCDSKVGDVSLGQVNGCTNLMNTSPSSVRIVGTS
FT                   REALEPLDTVSPISSDRWDVERYSTYDDNPSTGIQFGSFVSMGRLVGVDFSFFCVGISL
FT                   EAVHLDPRQRLLVLDVASTMKAANNDAEHFALHAGLAGKDHSLLLEEWGHKENAYTGIG
FT                   VESSVPVGRASFLLNLRGPAISIDTACSSSLVAVNLSLDFTRKNQSSGAFTVGVSLMLT
FT                   IDMHKKLGRAGMLSSSGRCRTLDAGADGYIRGEACHTLLLSTSSMSRAFVALCGSAVNQ
FT                   DGRSSSLTAPNGPSQQEVIGKAIDDVSIFEDSLDYSCGVLQMHGTGTPLGDPIEFGAAS
FT                   IVLQTLQANTRFEASKSWNAHGEPAAGALSLCELTNNLSKYAISGLCHLRALNPLVMET
FT                   LTSDDNITSLAVIARQVSSMMSTNCQGGASAFAFQGTNAHVVAKTMNVEYSSARYEKSA
FT                   LLLHCQRAWPATRAVASLRACMLAVSLGVNSSPISSAIVASLKSTECLNALHAAFTAVR
FT                   AFHDADFFALISNTFISSSYALTNSITVEIGSSDGSAYIFKSSGSLAFRGAGSCLVQSK
FT                   KRIDHSHLFAHLKIFFHLKNGGMYSQFLDLSRITLCGGLSSALNILETYSIMRLQLKSV
FT                   GAFTAWEEFWRGDSADAVFTAKFLSISDSANCIDTHFEMNRDAGGHLGNKSTTLGYALE
FT                   WQCSCTDPELSIVPVNILFPASGPQQSESVKSTASVLETLQHRELAGIFGGQANAIIPD
FT                   LGGSITALMRAVSSESNVQISFKTGLNASPRLLPLQAKASIVALDRMHTVEIIGGLGAL
FT                   GMLVARWLATQTTVSTLRLYNLVGRNKAFKNLMMHPAMVIAKNFDVSIREFWNTITWHD
FT                   ALFGCNGILRDASIQGQAVGNVRCVFASKYVTPHHTDDLLPIKFKCQYSSLASLLGSPA
FT                   QANYCSANARVDHAAARDRLAGRLSLSIQWGPWIGVGGMAYVKQHTLRRLERDGVLGVT
FT                   KYEGIRFLSMMFSNCPASHPTFIVSKIDWPKLLKSRANAGPILAEFGMRCLSTCKSAAI
FT                   TPNFPIDINPNSTSSNEENKFNVSLMSVNNLVSRLVSDVLIRPVSFEEPLMDCGLDSLG
FT                   ILELHSALRIAFNHIIFPSTVMFDHPSISSIAAFIVNHDRHTVADSICKEMSQSAKNCT
FT                   GRAEVVSGDGSNIALKHLSTARDCCFAIPTIRWDPEFEASRVAHHIPMHFANMIECIDY
FT                   FDLKIYGVQLSEARQMDPQQRLLLDATLATTLWQTIDTANVAVAVGIQHMEYAQLCSNQ
FT                   STFGFSPYVATGSALSVASGRLSYVFNYGQSAISVDTACSASLLAIHICIYAVHHEGSG
FT                   GLSVAGGVNLTLSANNFTIINAAGMLSMDGRCKALDSVADGYGRGEAAGVFLISHLPAE
FT                   QRSSDSSKLLFNFESTAANQDGRSGSLTAPNGISQRQVISTAVTRAAKIDNLLHFSVHG
FT                   TGTVLGDPIEISAVGTVLVSMLSVNKPLVSVLVASKTALGHTEAAAGLAALMQVSQSVV
FT                   FRLSVPLMHLRNVNPYVVVECCNICLPRNMIQASLGAVGVSAFAFMGSNAHVIIRSEYM
FT                   GPNATKRSDILSWDKTWAWKLEGLQGTISLIVPRADVNFKPFQLCFERSPCFFSRSSFQ
FT                   HQMTMIDALCIATHLITCTVQYSRCAILLNHAIAIAPLSVPELKQLELDTIGGSVVMNR
FT                   IIRCQVHVYRIFKNVFHVLYACFGGYTKRNVSDTASLMPIRGSTNLVRNKLFAIHAILH
FT                   VGSISYSVPVAADAFIDSKTLENVHESASKSTADTGKRFHLKCTGTYVIGGILDRISYM
FT                   QGFDEVNSRDGGYCHCIENNYVPQCAPIASSADVLEVVLNAVAEFSGKSVVLDESLIDL
FT                   GIDSIAAVELALTLQERLGLRSLDVANIASCQTPMAMAQSLCSEIDKSKCIQKSETNVI
FT                   LSNPVHDQTQRSINHEIKNHELKVLHESAFTRPATLFLGAPAFGDGQLAYMRLVSSLYL
FT                   GAHPVLTLERNSHAEPWPMLAAGHAHQIAQHEVNAVKVNIPTVLGGHSLGGVLAMETAS
FT                   RLENDYFRKAVMLLFDAPHPVQFKPDWHNISDDCDGDIASWSTGLTYMGIALQSFHCDL
FT                   LKCGWFELSQNEKYSLFEDVIFQALGRVVCAREMDEQISAGPFAAQWNSGIVRDETNCT
FT                   CDVSAWKMLQGTFDSAEKSASLKSCFRKIQGKAICYKAGRESSALFETELFLKEGDKVL
FT                   ESMTGYTWVLSCDHVEIVHCQGSHMDLMTNESDCSGDLSFTISPHVNEELARAWIDLKQ
FT                   KYDQNPLWKKCIPSSSREAWEKPAFIQVASLPFWQAPCVMSQQLPCKSKKGKFSVRMDA
FT                   EDSLFMLGLNYFSNQGLLKFRGETQEEAKVTAVVFIQDLLSRMAEWLLPAFDTRLPCLA
FT                   CHQQERQKNIRTHFSDEIRACEVLKMVLDVMTIMTKKCTFGGKSTSLLRIILVALPETK
FT                   AAKIAFHVANLYRCAGGNAHAFVALSRPVPINSEDTRDSLLRQLSFDAKINSINPTSLE
FT                   PAIQSLATRYLEAETKLHISSTVFARFLQHLQGCSEGKFMEAFLALRPALKMRSEWTTT
FT                   ICRGAMTAAAAWEAAMNNLHLSMVSSHVTVMYDI"
FT   CDS_pept        join(complement(651065..651124),complement(650344..651003))
FT                   /codon_start=1
FT                   /gene_family="HOG000257188" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639716"
FT                   /orf_name="MICPUN_89455"
FT                   /product="Flagellar associated protein "
FT                   /function="heme binding"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO68803.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG559113"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI000199CAC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ7"
FT                   /transl_table=1
FT                   /translation="MDSSLHTSISSQLRYFAPSEVAAHNSRGDCWVSLHGNVYDLSNFS
FT                   FKNNRNILQPVLQLAGTDVSHWLDYDQTNTTESLQEKHRIKTYIDPINCLESTYAQDGE
FT                   ILRVISEEPRCNWQGTMPWWEDDSLIIGKLSSKACKISIKNATTGQEDVLEVPCEETIA
FT                   QIKDRYWAYNGHGDSYLWICARLVADEVMFEELDLSLTLEQNGVMGSLDVDGNLNICSE
FT                   KRMPVIYVQFADDLSVL"
FT   CDS_pept        652714..653607
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639717"
FT                   /orf_name="MICPUN_114045"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68399.1"
FT                   /db_xref="HOGENOM:HBG410862"
FT                   /db_xref="InterPro:IPR021325"
FT                   /db_xref="UniParc:UPI000199CAC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ8"
FT                   /transl_table=1
FT                   /translation="MQWTSSKCRGPSSSTSPSRFFRRAVAFAPRIRPHLPFIHRRPDDE
FT                   LKQTSNWISRAVRDEDFAIFRFTLGIPGIDDDEIPRVVGFLCTSLVLFNHVDSVHPPEA
FT                   QTCTELIAFLLALACSTAPSLGRRLSEATPHSVHLSKIEDEVFALSQTISDVAKADMAW
FT                   ATYALLTQTNAGGVLVIGNDEPRVLCARGHVQSAKGTANRSGSGENIICSLTSNIRDSE
FT                   LMEVAEKIYLSDRRSIDMAGANMWKLLPWGTESVFMQLGNGNLRVVLFSEQPRAFSKRQ
FT                   RDCVAAIANKLCPNSY"
FT   CDS_pept        complement(653693..655195)
FT                   /codon_start=1
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639718"
FT                   /orf_name="MICPUN_55052"
FT                   /product="Aspartyl aminopeptidase "
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="ACO68804.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG630643"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI000199CAC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDJ9"
FT                   /transl_table=1
FT                   /translation="MIARFASSPANRDLLSTSSSRVPPAAQELVEFINNSWTSYHATAT
FT                   TARKLEAAGFVRLNERDEWNLIPGGKYFFTRNMSSIVAFAVGAKYVPGNGIHIIGAHTD
FT                   SPCPKLKPVSSITKSGFLEVGVQTYGGGLWHTWFDRDLSVAGKVVLRRGKESGRLSQEL
FT                   VQVNRPILRIPTLAIHLDRNVNTEGFRPNVEAHLAPILATAIKGELGFELTASCPSEND
FT                   QDSALHEKEKKPAHHPLLLAVLAEELDCDADEIVDFELEVCDVQPSVIGGAALEFIYSG
FT                   RLDNLASAFCALKALLEAGGDGSLEEESGVRMIAFFDNEEVGSGSVIGAGGTVLADAIN
FT                   RIIRILCSNSQEEGIFERSMRNSFLVSADMAHALHPNYADKHESNHAPKLHAGLVIKHN
FT                   ANQRYATNAVTATLFRECASKSGIPTQEFVVRNDMGCGSTIGPILSANLGIRTVDVGVP
FT                   QLSMHSVREMCGTEDIDICYRHFKSFFENFAAVSSDCNDIDF"
FT   CDS_pept        join(658006..658043,658045..659146)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639719"
FT                   /orf_name="MICPUN_114046"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68400.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199CAC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK0"
FT                   /transl_table=1
FT                   /translation="MQYSLSSREFAESTGDRVFYITYYDATGPNSHVPQESPRFMVINE
FT                   ENHAWETFGIDAGKRIPENHHDGTDSTSYWQQLLGNNLTCGNCPVAVPNLWQVRAGRAD
FT                   SNRDKNNIKEHGYLWGGVVVPETDASVLAEGIRRLAAAGWPPVCIFVCDLAWSVTAHLW
FT                   DQAVAILGANDEVLLEPSLAAFKLDPSNDCEGRRYVGNNFGQPHRDYAYHDVFGLDSSE
FT                   TDEMPRVLSVWLPLVDVNLENGCMYVVPQAGDATGGRGEDGSSAPTFDIRAVRALAPAK
FT                   AGTFFAWAGNTVHWGSSCTEKGENSPRISLAFVFRKKCATSDLRRAPLMREELRAGIDL
FT                   NRRLELIEHSLACFEHWYGDTTTTRQRLHRIRSARGQFS"
FT   CDS_pept        join(complement(659933..660043),complement(659209..659865))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639720"
FT                   /orf_name="MICPUN_114049"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68805.1"
FT                   /db_xref="UniParc:UPI000199CAC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK1"
FT                   /transl_table=1
FT                   /translation="MVAVRRQVRNLSDKNVRRARAREVRDAEYALVQDVVMAFSLLLSC
FT                   AVVAAIYLYARHIDVAASHRVKVKHAKAELERLQWKDNPDLEKGWLMLSRQHEASINLL
FT                   KVMSADDQLSALKSFWYKMPETERSMRFEEARNGLMTEPGMASLLKSQGHGMTDALVPE
FT                   MFAEETFASDPSQLIKLVNLLLDGRENIKRISEEDFGKRMGQHGARDVYRSAILSRFVA
FT                   SFLLDLSVALAASEPRQGIQRAMLKEQNYVNTV"
FT   CDS_pept        661065..661727
FT                   /codon_start=1
FT                   /gene_family="HOG000264662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639721"
FT                   /orf_name="MICPUN_114051"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO68401.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG559116"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CAC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK2"
FT                   /transl_table=1
FT                   /translation="MFIGQMPYDTKVDDIVPWLKAIMQRHGCAHDIDAVRLAGSGNSNK
FT                   KFKGFAFVDFKTRKAANIVKKFHGTLFRGRKVSVEDCRRKVYVDSTTDRSSNGLKNGSG
FT                   FVKQLTGTDTVENLVNDICNTSDGVLKLTDFDDQLKSFFSVLPKDVLSAALQSIKKQAS
FT                   KAPPARKAQYFMVSQLLASFILWFYEQSSSCSTFSSQGITKKVSRQYWEKRAARRGE"
FT   CDS_pept        complement(662068..664554)
FT                   /codon_start=1
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639722"
FT                   /gene_name="SBE2A"
FT                   /orf_name="MICPUN_51374"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68806.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199CAC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK3"
FT                   /transl_table=1
FT                   /translation="MPSSTPAPAPPPVPPSAAAPQPPSPPAPAPSASIEYAPSPEAPVG
FT                   AAAPPPQEQNNFMAAAGGGANRPPTGGPAAARPGGRLDPKQIKDFQPVTPTRANTKPIY
FT                   GAEIKPIDEPKHRFDNFQYPPITDDGWGITALDGTLNQYRDHLGYRWSKYCGLRNAIDQ
FT                   NEGGMEKFSRGYEVMGFTRNEQGITYREWAPGAKAACLFGDFNGWSTGAEGVWMTKNDY
FT                   GVFEVFLPNLADGSPAIPHGTRVKVHLEVEGQEPVDKIPAWIKFAVQAPDEIPFNGIYY
FT                   DPPPEEVYQFKYARPKSPDELRIYEAHVGMSSIEPKINSYVEFADDVIPRIAQLGYNAV
FT                   QLMAVQEHAYYASFGYHVTNFFAVSSRCGTPDELKYLIDTAHSYGVAVLMDIVHSHASS
FT                   NATDGINMFDGTNGQYFHDGPQGYHWMWDSRCFNYGSWEVLRFLLSNLRYWMEEFKFDG
FT                   FRFDGVTSMMYSHHGLQMAFTGDYGEYFGMSTDVDAMVYLMLANDMLHTLYAGNCVTIA
FT                   EDVSGMPTLARPVSEGGVGFDYRLQMAIADKWVEVLSEWGMDDAWDMGNLVHTLENRRW
FT                   GEKCVSYAESHDQALVGDKTTAFWLMDAAMYTDMSTLTPDTPVITRGIALHKMIRQLTM
FT                   CLGGEGYLNFMGNEFGHPEWIDFPRGDRIEASTGEFVPGNGNSYHLCRRRFDLADMDHL
FT                   RYKYLNAFDTAMNDVAARFKYLCSDHQYTSLKCNNDKMIVVERGECVFVFNFHPVNSYE
FT                   GYRIGLKHGGPWKLVLSSDNPEMGGYSNLWTYTCPEIMSEEWDFNNRPASMCVYAPARS
FT                   VSVYAPSESVRMKYGA"
FT   CDS_pept        join(666648..666696,666757..666786,666845..666900,
FT                   667015..667119,667229..667256,667311..667402,
FT                   667511..667601,667677..667696,667758..667850,
FT                   667936..668076,668161..668223,668315..668468,
FT                   668545..668655,668722..668795,668852..668902)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639723"
FT                   /gene_name="TAF4"
FT                   /orf_name="MICPUN_114058"
FT                   /product="TFIID component"
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="ACO68402.1"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniParc:UPI000199CACA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK4"
FT                   /transl_table=1
FT                   /translation="MQLTDKGLRTGAPGRYGLVHFLTWCQPRCSSKSSNDLKKIYMKCK
FT                   ENYCPPVEFLYLAADVIEKPGLVKAMVGNRSLAIQSELLMPGATGEQAHIYKTNAPDHR
FT                   AFEDASIFTKPEKNFPEADDVLTLAGVDPNDEARLMLAQGSHDDQSFHGRRAKKNSSRK
FT                   LTELCIFARVIGQLPRSGICKVDNKAYDLLEEALQIHLRCLIMKIFNRALQRNDSKPSV
FT                   LGRSNTHSEPKQRIRQINVDAEVQKRERVDIERKALLRVGESILSKRRTRAGDDSHLKE
FT                   KVARIRQEEEERIRATIANDAARSALGDAKYLKWFVSSGGKEADRESQRKPSRELTCKQ
FT                   NDEKDSEIRFLKRSMDGRGARANWTVSLKDCRDVIGDEYKRFEAA"
FT   CDS_pept        join(complement(670067..670564),complement(669104..670006))
FT                   /codon_start=1
FT                   /gene_family="HOG000278604" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639724"
FT                   /gene_name="ADG2A"
FT                   /orf_name="MICPUN_78097"
FT                   /product="Adp-glucose pyrophosphorylase "
FT                   /function="glucose-1-phosphate adenylyltransferase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO68807.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0008878"
FT                   /db_xref="HOGENOM:HBG703946"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="UniParc:UPI000199CACB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK5"
FT                   /transl_table=1
FT                   /translation="MRLSKQVVASAAAHQTDENSAQSAISNSKSVAAVILGGGAGTRLY
FT                   PLTKSRAKPAVPIGGAYRLIDVPMSNCLNSGISKMYILTQFNSVSLNRHLARTYNFGNG
FT                   IMYGGNGFVEVLAATQTPGLGGKEWFQGTADAVRQYSWLFEDIKNKDVQDIVILSGDHL
FT                   YRMDYMAFVARHREVNADITIGCLPMDDKRASDFGLMKIDDTGRITEFAEKPNGDALKA
FT                   MEVDTTILGLTAEEATSSPYIASMGIYVFKKSALLNFLNAEYPKDNDFGGEIIPKAAAD
FT                   GYHVQAYLFNDYWEDIGTIKSFFEANLALAKNPPQFEFYDARAPIYTSPRFLPPAKVEK
FT                   CHVKDAIISHGCSLADCSVEDAIIGLRSQIGKGCTIKHAMIIGADYYETDEQKMALVEA
FT                   GGVPVGIGEGCSISNAIIDKNARIGKNCIITNAAGVEDLEDEENGIYIRSGIVTILRNA
FT                   TIPDGTVI"
FT   CDS_pept        673099..675162
FT                   /codon_start=1
FT                   /gene_family="HOG000024492" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639725"
FT                   /gene_name="GLN1"
FT                   /orf_name="MICPUN_112708"
FT                   /product="Glutamine synthetase, catalytic domain protein
FT                   protein"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO68403.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG285301"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="UniParc:UPI000199CACC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK6"
FT                   /transl_table=1
FT                   /translation="MPSTSTASVEGFGDHCFKGAVAKKYLSKYGETDKLLTDVSWPSQP
FT                   GKADIVAKAVLDWAVDNGASVYCHWFQPMASSGVRHGLSAQVHQTMFEFDKDGKPFFKF
FT                   TGEALLQGETDGSSYPNGGMRATHRAGGYLSIDPLSPIFLREDTVFIPAAFVSYNGDAL
FT                   DEKTPLHRAVEAMSKEGTRLLKLLGYEVDGLINNIGLEQEIFLVPRHAFYRRPDLQFTG
FT                   RTIMGKASARGQEMSDHYMAPISRATTAFDCMRQIQMECFKVGIPLKTRHREVAPNQYE
FT                   FAPLFGNVINQTDQNLMVMQIIEEVASENGLAALLQEKPFAGINGSGKHNNWSIGTTDG
FT                   VNLLNPKQINAASKNAEIFPIIMAAIVSAIDKHGDLMRLAIASPGNDFRLGAMEAPPAV
FT                   ISTYLGDDMTNYLMAFMDSGNVEAYVPSKKKLAFGANSISEIEVPAEDRNRTSPFPYGG
FT                   ARFEFRAAGSSQNVSLINTVLNTITAEAFAIVADRIEAGETPTAVAQDLLKAHSKVIFN
FT                   GNGYDPEWPDTAVEKGIWRIDSGVEAIKKFTDSKNTELFEKMGVFTPRECEARRAILLD
FT                   HYIGTVEMEALTMVDMINQHVIPSCKKAELGFVKKLEDAVKTLTKAVDEMHAAADEAEA
FT                   ASLARVLRLDTMIKIREVCDEAEGLCPPSLWTLASYSELLFLDTYPEGDLLL"
FT   CDS_pept        join(complement(677752..678154),complement(675459..677641))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639726"
FT                   /gene_name="BBS9"
FT                   /orf_name="MICPUN_55060"
FT                   /product="Bardet-biedl syndrome 9 "
FT                   /protein_id="ACO68808.1"
FT                   /db_xref="UniParc:UPI000199CACD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK7"
FT                   /transl_table=1
FT                   /translation="MSVFKARELWCSTCDAREIFKGGCLAIGPPDAFNQRGVTIFVASI
FT                   SGILRVFLLHGEGHAVNNLILETDLKLPVIQIEFGLFGEGGDEASIVILHPHKLVICTL
FT                   QVDEAAARDNLLHLLPLKIHRFKETGGQISAYNMVIGRFGGAATNRICVQSFDGKLSFY
FT                   DGEVLTLVFRLENVLLPGPLAYAQQDDVLLIASSSFELRCYQFTDVASRLSRDSCQAGF
FT                   DTTRGEFVVRQHWRLCIGEPVLQILPVSNNSADTRESARGKQSFDINPCNDVIVLAEKS
FT                   IFVVSISGALKTQRRLDFVPTACRVLSLSLGGSIGHFGVVVADSTGSIMVFRDSQLLWT
FT                   SKLPVKPVDLIVSYFPDTFGHIIALGRDAVLSISCLGTLPHDTSIRGHERNEVSYQMID
FT                   KEYGELCSDPFKRSSDAFATRAQQVEISVRFQKNTAYDVSEPTETHYESFFASSNVLTL
FT                   QVSVLYSGSGTLDDVGVSIVLPHPVVAARSTYVIPSLRGGTPEIICIHLRACGIRSRAS
FT                   IPASNVAVIMASYCTHTIENSISTQEVQLPLSLFCVVALPMKTAKHKITIEINRSLPCL
FT                   MDLFKDMIPIPQMDDVMTTTGNALGFQFHNGVNVTIVTSKTAGRFRIQSSDFNAIWLLL
FT                   SEFIYRLWAHVDLQTTSSSMDAPLKISLQEPLPLQNLFEIIEEYYSTKLECDMDNINIS
FT                   SYAHSFRAVQKQLLFWLKSKYPVSVSHLGDLLDMIVPSFDAVSENIRKREKGFSLVRQR
FT                   LAAAIQLLMNLVQHRFDMDVDQLRVLRSHIPTVSHVSLDHGWDNWTEAAISMLLSNRLL
FT                   KNGATKTMDSSLFKSEAEQGSVARGRKNAGKIKKSLFAVFELLRRSSLQ"
FT   CDS_pept        join(complement(680597..681523),complement(679533..680468))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639727"
FT                   /orf_name="MICPUN_55061"
FT                   /product="MYB transcription factor-like protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68809.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199CB46"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK8"
FT                   /transl_table=1
FT                   /translation="MIHQVATESECERDLFNDDVIQCIDVPELIPNEMSDGREVERGEE
FT                   NNTRALTVRQSLPEVSLQFSDTISCATPSNPKRAIPAWARLQLREAHFGHVFHDSIYHA
FT                   LRLNQRLQRLLRSTVQIVDVWLVGINASRRDLEADFRDEHRARKQLCITSAEEPFHLNV
FT                   RDSIEFNLTCEKGRQIEAIYTPPVPGNYFRTTQSCKTGSESTDPTTRLACHVVVPNHDA
FT                   FLSPWNLFRLLVPYNFRKVNSWSAADDRLLRQGVHYFLQRLRLRSRQRKSLKEFAGMGV
FT                   MGMTDLLDHSSGVQASWRDAESINWRDLVEVYLPSRQQDDCRLRWANCRDPRLEQVAFT
FT                   NEEDKILQELVQKGSDSDWLTIANSLSAPERGQEKKDFLLRSATQCAGRYQAYLNSKLI
FT                   RSTWEETEDSYLRRFVNRNGAGRWSEAVLTLPGHTHAQALHRWQKVLTPGRRKGTWGTN
FT                   EDIKLRLAVSAYAHVKGLNDAVNEHNTGHHHFVSSETENISDRSTWELQSKRTAIALPW
FT                   SKISSHVASRTDVQCRERWTNVLNPNLVRPATMTWSQRDDADLLDAVEEFTTASSGNMH
FT                   LNNSRAAIIAWSHVAERLGRGLTDKMCRNRYKRLLRVHKCVQPS"
FT   CDS_pept        join(682768..682863,682943..683003,683091..683182,
FT                   683334..683423)
FT                   /codon_start=1
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639728"
FT                   /orf_name="MICPUN_55062"
FT                   /product="Yippee zinc-binding-like protein "
FT                   /protein_id="ACO68404.1"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI000199CB47"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDK9"
FT                   /transl_table=1
FT                   /translation="MGRIFTSHLEGRVYSCKFCKAHLANVEEVVSKSFHCRDGKAYLFN
FT                   AVVNIRSGVPEERWMTTGRHKVVDIYCNKCMQAVGWKYIEAFEHGQKYKEGKYILERYA
FT                   EIAIGNFN"
FT   CDS_pept        complement(683536..684012)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639729"
FT                   /orf_name="MICPUN_112727"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68810.1"
FT                   /db_xref="UniParc:UPI000199CB48"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL0"
FT                   /transl_table=1
FT                   /translation="MTTARIQARFKQIDFGYNTLGYARYIKLVPKDARSCEVSRHPRTP
FT                   DPYQSCSKRNFDGQIKKWRRLLHAYDPKEDFEELQVGKLIRVQRARLCSADISVSRFRT
FT                   CRLSERDTATFDTTREKKTNKDCAAFGLCMDGRRGLRTGGLGDWESPTEFRGVI"
FT   CDS_pept        join(685146..685511,685635..685717,685798..685951)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639730"
FT                   /orf_name="MICPUN_55064"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68405.1"
FT                   /db_xref="UniParc:UPI000199CB49"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL1"
FT                   /transl_table=1
FT                   /translation="MGVVKKRDSCLSIRPKLIVWDFDLTVLSIHSWAAGIRQKDVADRT
FT                   LYDDVADLAFFRHFVQRALEQGFAVAIASFGQYEVIQAYMDRIVGRGVFNRENIATPSK
FT                   FGSKDGRALRGGKVPMLKSLACKMLRASPQELSLRKSDIIFFDDSWDNVCGAIENGFIH
FT                   SVLVDCRGFCEQLWNEVKCPLGMDNFCDASKLDDSLA"
FT   CDS_pept        complement(686149..688272)
FT                   /codon_start=1
FT                   /gene_family="HOG000259232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639731"
FT                   /orf_name="MICPUN_112728"
FT                   /product="Glutamyl or glutaminyl tRNA synthetase "
FT                   /function="ATP binding"
FT                   /function="glutamine-tRNA ligase activity"
FT                   /biological_process="glutaminyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68811.1"
FT                   /db_xref="GO:0004819"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006425"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniParc:UPI000199CB4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL2"
FT                   /transl_table=1
FT                   /translation="MSEVSMSAGKKAKANYEKIAKKKPDPEGLAIGEEAQAALIQKDYS
FT                   KAKALFEKARYICEASAIKATKTAKLVRKKNAGGEKLSESVELNDFEQDDKDRDIILPQ
FT                   PGSEGHVFAKHKANLPPGAENYAINTSARMAEHLNATGGKWQTRFPPEPNGYLHIGHAK
FT                   AMHFDFGVAAKFQGNTYLRFDDTNPAAEKQEYIDSILSSVSWLGHRPFKVTYSSDYFGQ
FT                   LHEFAVKLIKLGKAYVCHQAKAEVTASRQLLKEFQLHCARNNLSRHETPLPSGAESPYR
FT                   HRSVEDNLRLFEEMSKGVWEEGSCSLRLKGDLRSDITSMWDLAAYRIKFQEHPHSTDAY
FT                   CIYPTYDYTHCLVDSIENVTHSLCTLEFETRQAPNGPYYWLLHALDMYKPITWEFSRCN
FT                   ITYNVLSKRKLNTLVSQGHVSGWDDPRLLTLEGLRRRGYTPTAINRFCSEMGITRNDNI
FT                   QHLEKLERCIREELDDDTDRRFAVLNPLPITIRNHPGGSLPVECPSHPKFPERGTRVLN
FT                   FTSTVFIEREDFREVDDVSFYGLAPGKTVRLLFGYNITCVGLQKDAAGAIVSLEATYDR
FT                   NSLGSKPPKGTLHWAGSDYVHGEVRVYDKLFSVEVPGKRVATEIAADEVAEQLEDGGVD
FT                   WLTQLNPCSLVVHQNALLEPLIREIAGSPLTSRFQLQRLGYFTVDKDSSVQKPVLNRIV
FT                   TLKESKELTALRK"
FT   CDS_pept        join(690796..690873,690925..691104,691160..691257,
FT                   691314..691620,691715..691800,691859..691928,6
FT                   91992..692195)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639732"
FT                   /gene_name="CDKC"
FT                   /orf_name="MICPUN_77851"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO68406.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199CB4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL3"
FT                   /transl_table=1
FT                   /translation="MLQAATSRSVDVFEKLEQVGEGTYGQVYMARNRLDGEIVALKKVR
FT                   MDNEKEGFPITAIREIKILKTLDHKNVIKLKEIVTSKVRSPNKTSIYMVFEYMDHDLTG
FT                   LADRPGIKFTVPQIKCYMKQLLTGLTYCHLNNILHRDIKGSNLLIDNQGVLKLADFGLA
FT                   RPCALENSKTLTNRVITLWYRPPELLLGTQTYGPAVDMWSAGCIFAELLYGKPILPVRD
FT                   EVEQLDLIFKLCGSPVADEWPEYRELPWSKKYTKQKPFQRRTHEVFRRFPLSARNLIDG
FT                   LLALNPRKRMTAKDALDSDYFWEEPMPCSPQDLPKYEPSHEFQTRKRRQVRFWCPWCLW
FT                   "
FT   CDS_pept        693323..694582
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639733"
FT                   /orf_name="MICPUN_55067"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68407.1"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniParc:UPI000199CB4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL4"
FT                   /transl_table=1
FT                   /translation="MCNSLNKPFAPLPQKQSNAPTDSPSVQYSGMQIAVQRRHAFVATR
FT                   PDYIGKGSDKRSGEFRSEKGISGRGDAPQRITGKVGNLSVQTQIKLVEQYRSLKGKSGA
FT                   AQRLAPGKTSTHPQSLERSGYRKVKEDARYQEELAQRKAAKRAEAHTKTLDSSRPTILV
FT                   DGYNICGCAEGNDVAVQLKQLFQAGDLQAAQKYLIEELENFAVHCGYTIVCVFDADRAQ
FT                   TKEKSDQIYRAGAGIWVVFSVNNDADSWIEQASLAVLCGENSMEDFLQSFGQPRLGRSV
FT                   KVKTIKNFKTKPPGPAGSFPSRPNTLRQLILVATNDNALRSIVRSNGAYVISAKALIDE
FT                   MSMARKAEAAMLRDFAVKVKFGGERRGIGVFMRDSKIEDKLMALYLDAPDMDKGKIVKG
FT                   EFMGKRKKGKKNKSTKPKMS"
FT   CDS_pept        complement(694717..695760)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639734"
FT                   /orf_name="MICPUN_55068"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68812.1"
FT                   /db_xref="UniParc:UPI000199CB4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL5"
FT                   /transl_table=1
FT                   /translation="MQADLEAKTFFEAMPGPRRYQLTTTARCAKELTNLPVVTSNDAYR
FT                   LGNAVERQGVDWLGARRQVLEHPKSFQDSILYNFLMGDVEEQRAFLGCVADYKRKLDDS
FT                   PSRSMHHGDNRTIVVPLRLSDKVRFMVEDYPVVNSAIVRYKRMHCPWCDTLVIMTLLVW
FT                   GEDKNHMFAFSQREYKQSLAVLNSIAKTAQSKDGGNLRVIIRSTLDADSDFVYSAYSPH
FT                   LVLPVVTPSSWNRLLTFCNSAVLDRHREQSAIDFFDSAIKPKLKAAGRREEILTHYINL
FT                   ESHVPDDVVVNWFQSEVRRTGLAEHSVTIKQMSNWKDWPGRMRPYRVGLRAYDIGVRSI
FT                   QRAAQEK"
FT   CDS_pept        complement(698089..698748)
FT                   /codon_start=1
FT                   /gene_family="HOG000006075" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639735"
FT                   /orf_name="MICPUN_55070"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68813.1"
FT                   /db_xref="HOGENOM:HBG710097"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniParc:UPI000199CB4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL6"
FT                   /transl_table=1
FT                   /translation="MSGSAFSSSAAELEILQTPPPESGKGYIVDDGGLLSRAASGTINS
FT                   KLAALEKETGFHLNVITIRKLVFEQDPFAFGDKVLETWYPTLEVGNDKGNLLLVKNSKE
FT                   GAIVGGPAFLKGVGDDILDSILSKNIPYNLEDEKFGEALTSSVDRIVAALEGKEDPGPP
FT                   TKFIKDKSKTYKTKEETNEKREVFSNVVIGLLVISFVVPMVQYFGYVAGDPDFDDN"
FT   CDS_pept        join(700998..701055,701187..703555)
FT                   /codon_start=1
FT                   /gene_family="HOG000264343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639736"
FT                   /orf_name="MICPUN_55105"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO68408.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG315628"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI000199CB4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL7"
FT                   /transl_table=1
FT                   /translation="MIEHGTRIKFSPLYGVQGIGEDPFCYVLDLDGFKILLDCGWNDSF
FT                   DVNLLEPLAKVAAEVDAVLISHPDTEHLGALPYAFGKLGMRCKVYATLPVHKMGLMFMY
FT                   DHFLSRNANEDFRVFTLDDIDTAFSAFVPVRYAQRSALVGHGAGITITPYAAGHMLGGA
FT                   LWKVHKETDDVVYAVNFNHRREKHLNGTVLESIKRPAVLITDASNARRLPPSKTRENDL
FT                   IEAILRTVRQDGNVLIPIDPAGRVLELLLVLEERWSQKQLAAYQLVLLTKVAYNTLEFA
FT                   RSHLEWMGEHVGQYFDRERHNAFNTRHLKLCHSIDEFRALPQGPKVVLASFGSLDAGAS
FT                   RHIFVEWAPDPRNLIVFTDRLQPGSLSREVCRLSQLPPGARLPLRISLSQRLKLVGDEL
FT                   LEWQGKEISRSQALVPIKSSTKYRVLREPKPVIESCKPNLDTQCTTMHSQASHRGGRCY
FT                   VLDGINQVNNANVAIFDDESWYPNVLDFGETITSETFEGYVQIGLQNDHRSGDRIEERP
FT                   GEFGHTSDPGRVYPDTQFMGLEDSPTKILTETHDVYLRAAVHICDFEGNSDGHSIQTIL
FT                   THLEPRRVILVRGNPSDTDFLRMQLQKSLLRAEIHAPKQSQMVECISENTTFRLELSQD
FT                   LLSHTHMRDVAGYQVGWVEGNVLISRGGGDPAATLVPAKSGMICEAQRTGLQPNTGASQ
FT                   TATRETRTQDARVGLDFSREIDEQSTASELFLDELVVKKPAALVGSLKLSDSRLALAAA
FT                   GCATEFRGGALMCTGDKVRVRKTVNVMGAENLLLEGNLCDTFFSVRSTLYHHHQV"
FT   CDS_pept        join(704725..705015,705111..706904)
FT                   /codon_start=1
FT                   /gene_family="HOG000182446" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639737"
FT                   /orf_name="MICPUN_77618"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68411.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG630413"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199CB50"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDL9"
FT                   /transl_table=1
FT                   /translation="MRILIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQC
FT                   KARWYEWLDPSIKKTEWTRQEDEKLLHLAKLMPTQWRTVAPIVGRTPAQCLERYEKLLD
FT                   AACQQDSNDALDDPRRLKPGEIDPNPESKPARPDPVDMDEEEKEMLSEARARLANTKGK
FT                   KAKRKAREKQLEEARRLASLQKRRELKAAGIDTVKRAKRLKGIDYNAEIPFERKPAPGF
FT                   FDGSLERRALTLLSEETFEPKGLADFEGGRQHDIEENLRKQDVKRQRIVQRHGVPHVMQ
FT                   TVDNNDPGNHRLHSELNLPPPRVRESELDHAIRANGVLAHHERSSAHTVYQTLPDDKRF
FT                   GNLARIGMPSGPDGISVSSRSSPAQSIIGNEHLSSQFSQQNDDVWVGHDVVTAAGAVKC
FT                   AMASLPVPNNEYQIVLPTPKPEQNNADHLRDFDRMNANLNSSSSPIERATHLKSKLRCL
FT                   ARPSSFCIDSRTDTLRCSAEQIISRELGQMLEHHSLEHALHDTARLLTSPISLKQLALS
FT                   AALITREINALRCTSDQLVNSDEIIYASNYAHNDCIMDKSTSHVILSKIYGSYDTNTTP
FT                   PSGEHARACTSMMRDARRAGKIGHRIEIVTSGLQQRSAELHRRLSHIYAELVSMDHQYC
FT                   SYNTLLYREQETYVQRVRSQKNMITLASEKERQHQFLHTQRASLLRTSEPQVEICENKR
FT                   "
FT   CDS_pept        join(704725..705015,705111..>705301)
FT                   /codon_start=1
FT                   /gene_family="HOG000200867" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639738"
FT                   /orf_name="MICPUN_77618"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68410.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199CB51"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM0"
FT                   /transl_table=1
FT                   /translation="MRILIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQC
FT                   KARWYEWLDPSIKKTEWTRQEDEKLLHLAKLMPTQWRTVAPIVGRTPAQCLERYEKLLD
FT                   AACQQDSNDALDDPRRLKPGEIDPNPESKPARPDPVDMDEEEKEMLSEARARLANT"
FT   CDS_pept        join(717897..718711,718760..718845,718919..718938)
FT                   /codon_start=1
FT                   /gene_family="HOG000100765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639739"
FT                   /orf_name="MICPUN_51392"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68412.1"
FT                   /db_xref="HOGENOM:HBG559125"
FT                   /db_xref="UniParc:UPI000199CBBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM2"
FT                   /transl_table=1
FT                   /translation="MEGDFPETLLPASRLQDRYFHGASNFDVSHEAPWRGKHKPPINFG
FT                   HPRGYSEDPIREHCPSNFGKGGVRHYRRRLAGPISTSLETKLSYSAGGLCPDKGPIFYG
FT                   HRNTIGTKSPGKPNQRRIPNLIQRQKDNFVGMSLPPPDPLPKPPPCAPPPYARDSDKAQ
FT                   KPMQWRINATNASHLFRDETEYSDDIKQQQPIRGQRVGKFSPAYEAGKRELPSWGWNPK
FT                   KGKNDTSVPDVLGTHDFHNAGKGRKGRANSDLPEGEYAGATTKTIAGKEPFETVGVTPK
FT                   HLGLIAESPKKPSIALPAHPSTQLV"
FT   CDS_pept        join(717897..718847,718921..718938)
FT                   /codon_start=1
FT                   /gene_family="HOG000100765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639740"
FT                   /orf_name="MICPUN_51392"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68413.1"
FT                   /db_xref="HOGENOM:HBG559125"
FT                   /db_xref="UniParc:UPI000199CB52"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM1"
FT                   /transl_table=1
FT                   /translation="MEGDFPETLLPASRLQDRYFHGASNFDVSHEAPWRGKHKPPINFG
FT                   HPRGYSEDPIREHCPSNFGKGGVRHYRRRLAGPISTSLETKLSYSAGGLCPDKGPIFYG
FT                   HRNTIGTKSPGKPNQRRIPNLIQRQKDNFVGMSLPPPDPLPKPPPCAPPPYARDSDKAQ
FT                   KPMQWRINATNASHLFRDETEYSDDIKQQQPIRGQRVGKFSPAYEAGKRELPSWGWNPK
FT                   KGKNDTSVPDVLGTHDFHNAGKGRKGRANSDLPEGEYAGATTKTIAGKEPCKRMVKPEW
FT                   DPSRHNTFETVGVTPKHLGLIAESPKKPSIALPAHPSTQLV"
FT   CDS_pept        join(720727..720729,720767..721147,721241..721315,
FT                   721391..721495,721554..721634,721726..721776,7
FT                   21867..721938)
FT                   /codon_start=1
FT                   /gene_family="HOG000265369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639741"
FT                   /orf_name="MICPUN_55112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68414.1"
FT                   /db_xref="HOGENOM:HBG559126"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI000199CBBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM3"
FT                   /transl_table=1
FT                   /translation="MGNVTCIPILCRPFVKKSLKRARKVTTAFHNIHRQLENISAHGSK
FT                   VHKHLSFVKQTDGVHLRRELDGLGGRQAYQEASVLTTTRHRTCKWVFAMITRLGLRPGK
FT                   QSPPLRLLEVGAVNTQLMSVPWLAHPKIDQVDFFDLEPASTYDVVVLSMVLNCVPSPFK
FT                   RGRMLALAKRHLKLGGHFFLMARPQIPRRCLENSPFCTSNFLEQLLFALGLKVLKLKRS
FT                   PKVVFVCAKRVAGLHSSQLSDDFAVCCEEEDFA"
FT   CDS_pept        join(725558..726120,726357..727200,727293..729464)
FT                   /codon_start=1
FT                   /gene_family="HOG000222963" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639742"
FT                   /gene_name="ACR2"
FT                   /orf_name="MICPUN_107316"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68415.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG631122"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000199CBBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM4"
FT                   /transl_table=1
FT                   /translation="MSRYSMKCDGFDQGTGYLPEALRGVARNHLASFDYFLDHGLSDVV
FT                   RCLDNISIQPSGAQNTSSSPRFKMWFENISIGRPIREDTTAVRARDPRVFPRECRESSN
FT                   TYKAPMLATVAWTFGDVGAIFRREFRICMFPVMVASKVCNLFGFSQDELICRGEEGHEM
FT                   GGYFILNGNERIIRLLVQQRRHYIMGMKRKAYSSRGPIYTHYATAIRCSANDEHTSTVR
FT                   IHYTSDGSARLVFVHRRKEYFVPAGIILRALAEFSDSVVQAIVARGLTGLGAQVFAIER
FT                   IRIILGEAATFGIHNKVQALAYLGEHFRAQLDANPWETNFDVGKRLICEHIFIHLQSDE
FT                   DKFNLVLLMMQKLYALVAGQCSADNPDSLMHHEILLPGILMQIFVREKLQDALHKAKIA
FT                   LNREFEENPNHASADDGEWLSQVAIEAITKTNIGRLAEYFLATGNLSSRTGLGLTQTSG
FT                   FTIVADKLNYMRYISHFRSVHRGAYFAELRTTTVRKLLPESWGFLCPVHTPDGSPCGLL
FT                   NHLAASCYIHVACESTGEARDRARSQVLKVLSSAGALILHGSTSLGSAPPAHLTVMLDG
FT                   LILGFVADSDAKVVVSALRAAKVSGSNGVSSHLEIAHIPLSSCGYGGAFPGLYLFSTSS
FT                   RMMRPVIQQQNRITENIGSLEQAFMSIRCPDGRQKPTCIAEHAHEENGPGTILSVVASL
FT                   TPWSDFNQSPRNMYQCQMAKQTMGMPLHSFCYRPDTKIYRLHTPQRPVAMTGQYDKYQM
FT                   DNYPLGTNAVVAVIAHTGYDMEDAMIVNKGAMERGLGHATLYKTETVTLVAGSDENFGQ
FT                   CNVIQQKLGSPIAFTEKHPFDPDIDTDGAPRPGSIKQAGSTLCSVVDRSTGRVRLHKIK
FT                   GSDHVIIDRVSISSGKASKGQTETKMSVTVRCDRNPIIGDKFSSRHGQKGVLSFLCPEE
FT                   DLPYIEKSGSRPDILINPHAFPSRMTIGMLLESMASKAGALDGRFIDASPFQAANDETH
FT                   IISPTREYGEMLRKHGYNYSGSETMVNGLTGERFDVDIFVGLVYYQRLRHMVSDKFQVR
FT                   SLGPNNPLTQQPIKGRKAGGGIRFGEMERDALIAHGSSYLIHDRLHACSDRHVTSLCTY
FT                   CGSLLAPGANIQMAATHQVHASGAGNGQGRLHSFDDIFPRKVSCRVCNTGTGVHNVALP
FT                   FVFKYLAAELAAMNIRIGLEVGDDRV"
FT   CDS_pept        join(732396..732662,732827..733246)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639744"
FT                   /orf_name="MICPUN_107518"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68417.1"
FT                   /db_xref="UniParc:UPI000199CBBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM5"
FT                   /transl_table=1
FT                   /translation="MTAVPTLPPADFTARDAFSGGADILRASALKGPYVHFSRVGPPDA
FT                   ALDVDAYAPGTSSSGFELRQGRVMELAPLVEMRTPDAHVCPDAKVTLLQRATELVATPR
FT                   ERLKLAFGFRPTPYALTDGDKGAIPAALVNHRHFDVARAAANAAASGDDAVVAVAVAVK
FT                   AMGSVSKGEKQRHEKKEKKEKKEKKEKKEKKEKKDNKRRRKDVGPDASGLSGPTEISGD
FT                   TRITSQ"
FT   CDS_pept        732396..732668
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639743"
FT                   /orf_name="MICPUN_107518"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68416.1"
FT                   /db_xref="UniParc:UPI000199CBC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM6"
FT                   /transl_table=1
FT                   /translation="MTAVPTLPPADFTARDAFSGGADILRASALKGPYVHFSRVGPPDA
FT                   ALDVDAYAPGTSSSGFELRQGRVMELAPLVEMRTPDAHVCPDAKV"
FT   CDS_pept        738381..738935
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639745"
FT                   /orf_name="MICPUN_92943"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68418.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000199CBC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM7"
FT                   /transl_table=1
FT                   /translation="MGLLSVIKKVKANEKELRILMVGLDNAGKTTIVKRVNGEDIGSVS
FT                   PTLGFNIKTMRYKGYALNIWDVGGQKTLRSYWRNYYETTDGLVWVIDSADHRRLEDCKE
FT                   ELHALLSEEKLVGATLLILANKQDIPGALTKEMLTRVLDLRKMTSRRWHIEGCSALTGE
FT                   GLLQGLDWCAEDIGSRIYLCE"
FT   CDS_pept        complement(743712..745628)
FT                   /codon_start=1
FT                   /gene_family="HOG000224139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639747"
FT                   /orf_name="MICPUN_51395"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68815.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559129"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000199CBC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDM9"
FT                   /transl_table=1
FT                   /translation="MPLVAVRFSKICTEYVRFQHFSHRLKRPSPRTQVSVVRSCVPRVH
FT                   VSGRPILHADVDMVIEAKISSGSDSIGDAEGKNINMMWCSSCGGEGVVYSLSKKQKRER
FT                   RLEREAAAGASVECPRDLSSFEMLARAPPAKVAPCKPCMGTGLVPTPCGKPQKPHLESP
FT                   RVAIVGAGIGGAALALALQQRGVHVSLFERDTSFSMRKQGYGLTLQKYSGAAALKQLGV
FT                   LLDGVGSNANISLTAAGRELGRYGHGTRLYNDQKVAVNSASDAGRKNVHLPRQALRRVL
FT                   LEKLSPGTVHWGKKFKNYKETTCSTSSGVELQFEDGDRLSFDLLVGADGIFSAVRPVKL
FT                   AKNSRDAAVGEAYPLHYLGVFVMLGICHGVSHPLCDHKVFQVVDGTTRIYVMPFSRSCD
FT                   GDGCLALRQGDEVSTQNNKATVPLLMWQLSFPISEEKAIELAKADPAKLLSEAVERCGS
FT                   WVDPVPELISSTSIQNLSGYPAYDRACLNAGDLRNMSDEHSAASRVTLIGDAAHPMSPF
FT                   KGQGANQALLDAVQLARALFRTPTFSPSRSKHRQGLVWQSESCSAGLFDGDVATALSDF
FT                   EKTMCTRSKEKVRLSRDAAAYLHSNAALAEGNCVRAHAAARAAKSLTDDTTKLKVFDDS
FT                   SHT"
FT   CDS_pept        complement(743712..745250)
FT                   /codon_start=1
FT                   /gene_family="HOG000224139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639746"
FT                   /orf_name="MICPUN_51395"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68814.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559129"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000199CBC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN0"
FT                   /transl_table=1
FT                   /translation="MLARAPPAKVAPCKPCMGTGLVPTPCGKPQKPHLESPRVAIVGAG
FT                   IGGAALALALQQRGVHVSLFERDTSFSMRKQGYGLTLQKYSGAAALKQLGVLLDGVGSN
FT                   ANISLTAAGRELGRYGHGTRLYNDQKVAVNSASDAGRKNVHLPRQALRRVLLEKLSPGT
FT                   VHWGKKFKNYKETTCSTSSGVELQFEDGDRLSFDLLVGADGIFSAVRPVKLAKNSRDAA
FT                   VGEAYPLHYLGVFVMLGICHGVSHPLCDHKVFQVVDGTTRIYVMPFSRSCDGDGCLALR
FT                   QGDEVSTQNNKATVPLLMWQLSFPISEEKAIELAKADPAKLLSEAVERCGSWVDPVPEL
FT                   ISSTSIQNLSGYPAYDRACLNAGDLRNMSDEHSAASRVTLIGDAAHPMSPFKGQGANQA
FT                   LLDAVQLARALFRTPTFSPSRSKHRQGLVWQSESCSAGLFDGDVATALSDFEKTMCTRS
FT                   KEKVRLSRDAAAYLHSNAALAEGNCVRAHAAARAAKSLTDDTTKLKVFDDSSHT"
FT   CDS_pept        join(746772..746871,747012..747238,747297..749435)
FT                   /codon_start=1
FT                   /gene_family="HOG000223224" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639748"
FT                   /gene_name="CDC48"
FT                   /orf_name="MICPUN_77437"
FT                   /product="Cell division cycle protein 48-like protein,
FT                   expessed"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="cell division"
FT                   /protein_id="ACO68420.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI000199CBC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN1"
FT                   /transl_table=1
FT                   /translation="MVDSPDDKSGIRVKKDTSTAILERKKSPNRLVVDEAVNDDNSVVA
FT                   LNLQKMDELQLFRGDTVLIKGKKRKDTVCIVLADEFCEEGKIRMNKVVRKNLRVRLGDV
FT                   VSIHQCTDVKYGQRIHVLPFSDTIEGVSGNLFDVYLKPYFLEAYRPVRKGDTFLARGGM
FT                   RGVEFKVVETDPAEYCIVAPDTEIFCEGEPINREDEERLDEVGYDDVGGVRKQMAQIRE
FT                   LVELPLRHPTLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSK
FT                   LAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKREKTQGEVERRIVSQLLTLMDGMK
FT                   SRAHIIVMGATNRPNSVDPALRRFGRFDREIDIGVPDETGRLEVLRIHTKNMKLDEEVD
FT                   LEKVSKETHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEVLDTMAVTNDHFVT
FT                   ALGTSNPSALRETVVEVPNVSWEDIGGLETVKQELQETVQYPVEHPEKFEKFGMAPSKG
FT                   VLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPC
FT                   VLFFDELDSIANQRGSSSGDAGGAADRVLNQLLTEMDGMGSKKTVFIIGATNRPDIIDS
FT                   ALMRPGRLDQLIYIPLPDEKSRLSIFRANLRKSPLAPDVDVTTLARFTNGFSGADITEI
FT                   CQRACKFAIRESIQRDIEREQASSIDPDAMDNDSTYIDPVPEITKAHFEEAMKFARRSV
FT                   SDADIRKYQAFSQTLQQSRGFGNDFRFPDGNNRSNGGGGGDGTADHFGAGDSQLFTSGE
FT                   AQDDDDLYS"
FT   CDS_pept        join(752118..752319,752408..753317,753360..753432,
FT                   753520..754518,754614..754706)
FT                   /codon_start=1
FT                   /gene_family="HOG000264364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639749"
FT                   /orf_name="MICPUN_55092"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO68421.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG559130"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199CBC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN2"
FT                   /transl_table=1
FT                   /translation="MPALILFGRSWLVASDDLPIPMLCLMVVHTVWCEFSNHILALRAV
FT                   RDTMATYPSCAGALSFCLSTKVRAHQGLESRCDAGKTALAWLFGTFFCFLFSTCLEGLI
FT                   LRHSLKGCILQPGARQHVNGLLYLHFVVTIADLAFTILGTFLDYHVGNSCYVRNHVHAA
FT                   IVVVIVGNYFIIACNFLGIALIFSVYPDLSSEEKWNRMFTMLGCFLCLPQGNGHDRDSQ
FT                   GSLSHIANCFGEVFQGADLVPSDIAAGLALLALQHRRMLENEMLGRRASCSALPKGTLF
FT                   DVASKPWANKPLRASAVNDDEITPCSGNIDTPEELYITDESLANVLSEAAHYARWALAA
FT                   YGWLLYTWANPSGGLALVCSAQDAQNCCYHRTKGDDLDRSALKVCAGISDDDLFHKQML
FT                   HLTNWVGEQPYFIARDSARHAIVVSIRGTMSVQDCITDCMYKPVLLNADVIGLPHLSGC
FT                   QLHCHAGVVTATSFILSDLEKHGILHRLLLGNTCSLGSKQKRKHWHRDDVFGSNRFGGH
FT                   QGWTLVLCGHSLGAGVATVLSLHLRQTFPSVRVWAIEPPGGLLSAELAAACREWTISSI
FT                   HGSDLITRLSGPCLLKLRHDLVDSLVRCKVNKFTLLARLSCSPDIVEPDDFIMQPGDRE
FT                   NEANTFRQEFERFHIQQIKDRPLMVAPLYPPGRLLHLCRIPKNSGSQPVLGYEYEVRWI
FT                   SAKDLMAQGLLVSRNFFTDHFPDKVVAVLSELSMKFRTKDPTLDKINRLGTFIQTEGNH
FT                   AAPPT"
FT   CDS_pept        join(752806..753450,753547..754518,754614..754706)
FT                   /codon_start=1
FT                   /gene_family="HOG000264364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639750"
FT                   /orf_name="MICPUN_55092"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO68422.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG559130"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199CBC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN3"
FT                   /transl_table=1
FT                   /translation="MFTMLGCFLCLPQGNGHDRDSQGSLSHIANCFGEVFQGADLVPSD
FT                   IAAGLALLALQHRRMLENEMLGRRASCSALPKGTLFDVASKPWANKPLRASAVNDDEIT
FT                   PCSGNIDTPEELYITDESLANVLSEAAHYARWALAAYGWLLYTWANPSGGLALVCSAQD
FT                   AQNCCYHRSSRISMGGDRRNNRTKGDDLDRSALKVCAGISDDDLFHVSSTNGVGEQPYF
FT                   IARDSARHAIVVSIRGTMSVQDCITDCMYKPVLLNADVIGLPHLSGCQLHCHAGVVTAT
FT                   SFILSDLEKHGILHRLLLGNTCSLGSKQKRKHWHRDDVFGSNRFGGHQGWTLVLCGHSL
FT                   GAGVATVLSLHLRQTFPSVRVWAIEPPGGLLSAELAAACREWTISSIHGSDLITRLSGP
FT                   CLLKLRHDLVDSLVRCKVNKFTLLARLSCSPDIVEPDDFIMQPGDRENEANTFRQEFER
FT                   FHIQQIKDRPLMVAPLYPPGRLLHLCRIPKNSGSQPVLGYEYEVRWISAKDLMAQGLLV
FT                   SRNFFTDHFPDKVVAVLSELSMKFRTKDPTLDKINRLGTFIQTEGNHAAPPT"
FT   CDS_pept        join(757155..757186,757271..757400)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639751"
FT                   /orf_name="MICPUN_55127"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68423.1"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniParc:UPI000199CBC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN4"
FT                   /transl_table=1
FT                   /translation="MGIWIRVKFYLLKTCIAEVTNTPWGERMRINFFPRGARVPKCSHA
FT                   SPFLDMQG"
FT   CDS_pept        join(760581..760819,760857..761014,761089..761153,
FT                   761212..761419,761479..761526,761677..761761,
FT                   761829..761930,762007..762115,762170..762337,
FT                   762393..762500,762584..762643,762723..762793,7
FT                   62854..763067)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639752"
FT                   /orf_name="MICPUN_55097"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68424.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199CC45"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN5"
FT                   /transl_table=1
FT                   /translation="MHFSTAWYHQPCFVERWTLLSVVLLMQVELFSCVFTDALPEFHLY
FT                   PSKGSANTIFKIGGPDYLNSSRTRFRYGLLCGFHSIGNQIFLPFGFEKVGYESIVGLEV
FT                   SSLEGSFFSVQVTRNGRDFSDTGILFQYVHATLNDVHPVKVMKSGGTVVTIRGSGLSDG
FT                   YYCRSNGLPSILVEGASTSSVLMKCEISIMEHAERSTSRIFISANPDLGLLSEGQTLHL
FT                   LEEAKYSRLSDLEVQLQGSLFTDQSASVWCKLGNICSLGRIISATRMSCTDQIRQREGR
FT                   HLQISMNQESFTRRLTEASLENKRDREEEEHRISERKSRVALSRFLDAERVINARYTAI
FT                   SIANTMLQFHHYSDSSVSFTSMLPPTIDSLNPAVGTFGGAHMTWLTGKNFASSLINDDV
FT                   YKLHCSFGNISQSARFISSSIVTCDVPMVLKHGSVDLTILSSSTSSGVRTEAGLHYTLL
FT                   ARALVGSLAPKRGTARGGTVLHLRGSGFFNSWDLRCKFGSIQVNIAYVSEAEIRCFSPS
FT                   RAHGESDMQVILSGRHVCGASAYMFVV"
FT   CDS_pept        join(761975..762337,762393..762533)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639753"
FT                   /orf_name="MICPUN_55097"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68425.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199CC46"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN6"
FT                   /transl_table=1
FT                   /translation="MHVAHVRDTVRNKRDREEEEHRISERKSRVALSRFLDAERVINAR
FT                   YTVQNTVPIKPNIFMTPFSQAISIANTMLQFHHYSDSSVSFTSMLPPTIDSLNPAVGTF
FT                   GGAHMTWLTGKNFASSLINDDVYKLHCSFGNISQSARFISSSIVTCDVPMVLKVIFERK
FT                   IYCF"
FT   CDS_pept        join(762705..762793,762854..763067)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639754"
FT                   /orf_name="MICPUN_55097"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68426.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199CC47"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN7"
FT                   /transl_table=1
FT                   /translation="MVYVLQAGLHYTLLARALVGSLAPKRGTARGGTVLHLRGSGFFNS
FT                   WDLRCKFGSIQVNIAYVSEAEIRCFSPSRAHGESDMQVILSGRHVCGASAYMFVV"
FT   CDS_pept        767268..769670
FT                   /codon_start=1
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639755"
FT                   /orf_name="MICPUN_77748"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="ACO68427.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG746961"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000199CC48"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDN8"
FT                   /transl_table=1
FT                   /translation="MSTTGTTAGFNAGLPQSSGLASGAATQQNSFVEEFSSLQLGGGGS
FT                   MGDHGADPSQFPRPGDDVPVPNSELSCDPRYLRLTVNALPANQALKQRFALPIGCMVRP
FT                   LIPGEKVPTAQFGSTGIVRCRRCRTYVNPFVHFIDGGRRFRCNVCQLPNEVPVDYFCTL
FT                   DANGTRRDIAERPELRHGTVEFIASQEYMVRPPMPPTYFFAFDVSANAVSSGFLAKAVN
FT                   TVKETLDELPGGERTHVGFLTYDNAIHFYGLKPGSITPQMMVVAELDDPFCPAPEDLLV
FT                   NLGDSRGAVNALLDMLPSAFAATSQVDSCMGPAVQAAYMAMNHIGGKLMMFQCTLPSLG
FT                   QGRLLNRGDDHRNAGTDKEHLERAPADPFFKKMAAECSRQQICVDIFATASPYGDLASL
FT                   STLCRYTGGQLYHYPGFRPERDGLKLWNELRHNLTRFTAWEAVCRVRCSKGFRVSSFNG
FT                   HFFVRSMDLLALPATNADAAHAVQIAHDEQLPTGSVSYLQCALLYTNADGERRIRVHTM
FT                   AVPVVPDIAYMFRSIDGGAMSAFLTRLAVERALTARLQDAREFMQLKLSQSMREFRLLN
FT                   TSAARAFNCLIFPDRMRLVPLFTLCAAKSAALRGQTRDVNVDERIHSIYEIMSAPTEAI
FT                   LRRLYPAMYALHVMPPEAGFPNQAGAIVMPPRTVLAGERVDARGAYLVDDGRHCLLWLG
FT                   KMLDHGFLNAVFGAQGPPKPDVDFEPTLVEGIQLSKQVCGVIGEIRRRAANGCHCTLTV
FT                   IRQGDPSEALLFPLLVEDRGAGGAGAMSYADFLIQLHRQVAHAGGLQ"
FT   CDS_pept        join(complement(790781..790783),complement(790395..790649))
FT                   /codon_start=1
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639756"
FT                   /gene_name="ELF1_B385"
FT                   /orf_name="MICPUN_92934"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68816.1"
FT                   /db_xref="HOGENOM:HBG630513"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI000199CC49"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP0"
FT                   /transl_table=1
FT                   /translation="MGKRKSSKPPPKKVAPKVATAFTCPFCNHENAVVAKMDQLTGKGM
FT                   VECTICGQRYTTIISHLSEPIDVYSDWIDACDKINRGDGR"
FT   CDS_pept        complement(846761..847177)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639757"
FT                   /orf_name="MICPUN_55099"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68817.1"
FT                   /db_xref="UniParc:UPI000199CC4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP1"
FT                   /transl_table=1
FT                   /translation="MAGPMEEDVATPTLCGCGGANTGGINGPRPLLGADLTELPPLVKC
FT                   PKGSIGRSGSPGCLSDPGKPPTPRFAIWTVGGAVGWATPLESGPLGGGPMCCSPGTGGE
FT                   PDKFGNDGSIMLPGAPASPPPELFGCALVDIGPS"
FT   CDS_pept        complement(850475..851440)
FT                   /codon_start=1
FT                   /gene_family="HOG000264419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639758"
FT                   /orf_name="MICPUN_78283"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68818.1"
FT                   /db_xref="HOGENOM:HBG407373"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI000199CC4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP2"
FT                   /transl_table=1
FT                   /translation="MSARESRREGRPIYNPASYQDICLHASQSVLDGLRDGLRLMEVEF
FT                   PSVPGEDASYKAASDVYIDLNIQYALTIFNKVYRETGKTCEILVPDGPEYRRAKKVFLN
FT                   SLELSDGCALNTLDGKKTENIWSFFDNTFSGKGLRTRSSTDDDCQGFTADIFVVVNLST
FT                   VDLPGTEHFFSLLSDNRPLVFLNNELDTLRADLGLFSFPQKDLHYRFLSKIKPVYYLRT
FT                   RAYSRTISVSPFVINYSGAIFREYPAPWQVMVKQNTGELVCIAEDEDRFTLGEAKQEML
FT                   TAIGLSDADGSPLKTLRSGYKTSTWWEEDSDMEQSAAWRT"
FT   CDS_pept        complement(853009..854460)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639759"
FT                   /orf_name="MICPUN_55103"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68819.1"
FT                   /db_xref="UniParc:UPI000199CC4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP3"
FT                   /transl_table=1
FT                   /translation="MENFFINRYERRYEVIIRYGRALHAASSRRLGTRPVHGRNPSITA
FT                   SERKRVNAKTGVTQGCVLGSAFFCLAIQPIIEEALASTSVQGAHAYCIADDINPAGEPG
FT                   QLIQAAIRLQESLRLNADLTVKKIDILLGSQCRQIDTTELTGMDGQINIINTAGVDVGQ
FT                   ERGGDSGARIVGAPVGSPEYAAKFVADIVDKHRARLDHIAKFGEAGHAQEALLLLRLCA
FT                   CPRITFLLQCVPYNIAPQAFNDSYRDILGAFGRIAGMTEELDTADEVTRGRIALPLRHG
FT                   GQGLTETSHIADQAAVANWAACAPFLANTAHALSDIANENPGPRRSARNAAAHRRREHS
FT                   QSGPCHGHMRPAWDRIRNLGDEEQKILAAAVHKEFIPLVMDTYGRMGKPFPNLLKDVAA
FT                   PTAHRASGNANERTQAIYDSIDPPNELRNRIHLRNLALVHVALIISLMQRVAGSTVTND
FT                   RQHGARGGMYGAHEHYVQPYPVTNS"
FT   CDS_pept        complement(855321..858092)
FT                   /codon_start=1
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639760"
FT                   /orf_name="MICPUN_92955"
FT                   /product="Predicted protein"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO68820.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG330931"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199CC4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP4"
FT                   /transl_table=1
FT                   /translation="MPLRLDIKRKLVQRSDRVKGVELHPTEPWILANLYTGNIYIWNHQ
FT                   TNSLVKSFEVTELPTRAAKWVARKQWIVCGSDDMFVRVYNYNTTELVKAFEAHNDYIRC
FT                   VSVHPTLPYLLTSSDDMLIKLWDWENNWVCTQIFEGHSHYVMQVVFNPKDTNTFASASL
FT                   DRTIKVWSIGQSSPNFTLEGHEKGVNCVEYFGGGDRPYLISGADDKLVKIWDFQTKSCV
FT                   QTLDGHAHNVSSVCFHPELPVIISGSEDGTLRIWHSLTYRLENTLNYGLERVWAIAVMK
FT                   GSNSVSVGYDEGTVMFKIGREDPVASMDTNGRIIWSKHNDIQTVNVKSLPAEYDIQDGD
FT                   RLPLAIKDLGSCDLYPQSLMHGPNGRFVTVCGDGEYVIYTALAWRNKSFGTALDFGWSV
FT                   DSSEFAVRESPSKIRIYNQFKEKTTFRPHFAAEGLYGGVLLGLRSTDFICFYDWAESRV
FT                   IRRLDVSVKDVWWSDSGDFVAIASDSSFFILRYNAQNTTDALQKGDVDENEGVEDAFEL
FT                   LIEIGEIIRTAVWVGDCFIYNNADWRLNYCVGGEVTTIFHLDRPMYLLGYLAAQSRVYL
FT                   IDKEFSVVSYTLSLSLIEYKTLILRGEVDAAEELLPTIPTEQYNNIARFLESRGFVADA
FT                   LRVATDPDYRFELATQLGELSIARGIIENELASSVSAKWKQLGELAMSLGDIHLASSCL
FT                   VNAGDLSGQLLLCSASASAVKLEELATLARQWGKHNVAFICLFLLNKIDDCIELLCDTG
FT                   RIPEAAFMSRTYAPSKVSNVVELWKADLALVNRKAADALADPTEYKNLFPKFDLAMHAE
FT                   EKIRSVPASSRKLARCFGEHDNLPVSKNLIEKVDENIEVDVVPSDVDDATQICSLDTVN
FT                   SRPVATASSNAQLMSNSSVVGSKVLEPVESAPAGEAVNSDGDDWGLDEKDAT"
FT   CDS_pept        join(860237..860239,860347..860430,860527..860581,
FT                   860643..860720,860782..861128)
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639761"
FT                   /orf_name="MICPUN_55138"
FT                   /product="Ubiquitin carrier protein "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO68429.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199CC4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP5"
FT                   /transl_table=1
FT                   /translation="MDGNLSRATIRFISKQLKELHDSPPEGINVLLSEENITEITAEVE
FT                   GPADTPFHGGTFKMRLILPHDYPEAPPKGFFVTKIFHPNIRQPGGEICVNTLKKDWQPS
FT                   HSLRHVLMVIRCLLIEPFPESALNEEAAKLLLEDYDEYFRRAKMLTSIYASTLGHAESC
FT                   AKSSESSKAVLKGNMKHKKKSLRRL"
FT   CDS_pept        join(complement(861875..862186),complement(861297..861797))
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639762"
FT                   /gene_name="CLP1"
FT                   /orf_name="MICPUN_112702"
FT                   /product="Endopeptidase clp chloroplast "
FT                   /EC_number="3.4.21.92"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68821.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="UniParc:UPI000199CC4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP6"
FT                   /transl_table=1
FT                   /translation="MSFLYQGLIPHTTPRLLPASRSRKLTPKRFDSVTFHDRTSERRLS
FT                   VAMSRPHAGGPVVPRQDAADPFGLLLRERIVFLGNQVDDFTADAVISQLLLLDAQDPKK
FT                   DIKLFINSPGGSVTAGMGIYDAMQMCRADVSTVCMGLAASMGAFLLTSGARGKRLSMPN
FT                   ARIMIHQPLGGASGQAVDIEIQAKEIMYHKANLNRLMAFHTGQDVKQIDEDTDRDRYMS
FT                   PLEAKNYGIIDEIIGGDDAGLKIEGEPQQYLKTKASYISWGDEIDTLQ"
FT   CDS_pept        863480..863686
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639763"
FT                   /orf_name="MICPUN_55140"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68430.1"
FT                   /db_xref="UniParc:UPI000199CC50"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP7"
FT                   /transl_table=1
FT                   /translation="MPNCTSGDVKLTTGTERPIERTRQRRPTEGYSCIDYASSPSGFLY
FT                   LQKFIRRQNCTSINCKDIPNAVA"
FT   CDS_pept        join(complement(865273..865412),complement(865056..865155),
FT                   complement(864141..864962))
FT                   /codon_start=1
FT                   /gene_family="HOG000228588" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639764"
FT                   /gene_name="HMBS"
FT                   /orf_name="MICPUN_78011"
FT                   /product="Hydroxymethylbilane synthase "
FT                   /function="hydroxymethylbilane synthase activity "
FT                   /biological_process="peptidyl-pyrromethane cofactor linkage"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="ACO68822.1"
FT                   /db_xref="GO:0004418"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0018160"
FT                   /db_xref="HOGENOM:HBG624842"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniParc:UPI000199CC51"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP8"
FT                   /transl_table=1
FT                   /translation="MRARFSGFNASFPLVARGVSRNVRDRGALRVTAEVDTPVIKIGTR
FT                   GSPLALAQAYMTRDLLKASFPELGNDGALEICIIKTTGDKVLDQPLADIGGKGLFTREL
FT                   DVALLDGRIDIAVHSMKDVPTYLPEGTILPCMLPREDVRDAFISVKYDDLSELPEGSLV
FT                   GTASLRRQSQLLARFPGLKCVNFRGNVQSRIRKLQEGVVDCTLLAIAGLNRMDMTQHAT
FT                   KILDVDVMLPAVAQGAIGIACRTGDSKQITYLESLNHEETRIAVECERSFLAALDGSCR
FT                   TPIAGFARKDGDNLRFNGLVAALDGSEILETSRVTKWSYADAIAAGKEAGAELKKKAPA
FT                   EFFANLIEHGGSW"
FT   CDS_pept        join(866516..866700,866765..867920)
FT                   /codon_start=1
FT                   /gene_family="HOG000186884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639765"
FT                   /orf_name="MICPUN_113420"
FT                   /product="Glycosyltransferase family 50 protein "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68431.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG559139"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniParc:UPI000199CC52"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDP9"
FT                   /transl_table=1
FT                   /translation="MRSHALNSAHSSRYISCKLAPVVFQIAAILRALLIMWSVVQDAYC
FT                   ELPFTDLDYFVFTDAARYMVVGISPYERFTYRYSPVVAASLIPNVLSQPFFGKLCFVVG
FT                   DFMTGWLVLEILSFCGSSQRTKVASVICWLFNPFTLAMSTRGSFESAVSTAMLSILLLI
FT                   LSGNTFLACAVLGLVIHLRIYPVIYLIPLCCFLCLDCDVPDAHSWDRRIEGSKDRRANY
FT                   FTVAIKSSCHIFSAIASITFTRRLELLALCMSSISIWLLCFLFFGSEFQSETYSYHLGR
FT                   KDVRHNFSPLFYVEYIAPRIPFRAMYTFTPVLPQMVTVCLVGFKFAKDLPVCLLLQTIG
FT                   FVALNKVSTAQYFVWYMSLIPTALPSGIVQCSGCKSLASLAGQDLHRAAALRFWLSAQF
FT                   LWLIVAYHVEFCGTCAFLLLWFASVVFLCAHAWVGTHLMTARTKFMR"
FT   CDS_pept        join(complement(868433..868744),complement(868340..868374),
FT                   complement(868140..868281),complement(868005..868085))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639766"
FT                   /orf_name="MICPUN_113419"
FT                   /product="Ribosomal L21 protein, chloroplast "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68823.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="UniParc:UPI000199CC53"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ0"
FT                   /transl_table=1
FT                   /translation="MHFFSAGAFSLRRRLACTPRAPCGSTYQKKLCDLRSQMFDFASHI
FT                   KETRSSSHHTFRVLSTPASDSTMRQDGFGVVRIGSQQYKVFCGDLILVERLAHYNVRDE
FT                   VFLRDVMMFSSKDLTLIGRPTLKKAAFHATVEEHFREMEVPVHKQKRRKSSQRTTSERQ
FT                   VMTGLRIHGFALEGNPFLQATGGEIT"
FT   CDS_pept        869737..871179
FT                   /codon_start=1
FT                   /gene_family="HOG000030255" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639767"
FT                   /orf_name="MICPUN_55144"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68432.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559141"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199C419"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ1"
FT                   /transl_table=1
FT                   /translation="MAPRENINSASNADPIDRIGTNANERTPTRKYTVTEVEKHSTPDD
FT                   CWLIVRGKVYDVTPFVPRHPGGNMIWVKAGGDCTQLFDSYHPLRTRPLLEKYYVGELQR
FT                   RTDDKDKIITYEDDLKHGKFYLDCKLAVEGWFKDNKKDPRVHPEMYVKSVCILAGVIIF
FT                   HYCSFFLCASFPVALIFAVAHGICKAEIGVSIQHDANHGAFGKSRPFMHAMQLTLDIVG
FT                   ASSFMWRQQHVVGHHAYTNVIEVDPDIRCAPEKDLRRINEHQPHETYHCYQHIYLVFAY
FT                   GLLSLKSCFVDDFSALASGKIGWVKVAKFTNHEAMTFWGCKLIWAFYYLYLPTIYGTHS
FT                   ASHAALLIIVTEFVTGWLLAFMFQVAHVVGDVRFFKLTAQGSLKLGWGESQLYSSADFA
FT                   HGSWFWTHFSGGLNYQVAHHLFPGVCHCYYPHIAPIIQKVAKEYGLDYCVYPSFWTALV
FT                   AHFKYLKVIGQKSHVPSLQTVG"
FT   CDS_pept        join(872286..872394,872515..872655,872711..873450)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639768"
FT                   /orf_name="MICPUN_113389"
FT                   /product="3-oxoacyl-reductase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase
FT                   activity"
FT                   /function="NAD or NADH binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68433.1"
FT                   /db_xref="GO:0004316"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000199C41A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ2"
FT                   /transl_table=1
FT                   /translation="MATTAIISSTAAAVSRSAVTRFPKPCRASILPCTVRANTRSNRSS
FT                   RTCATFSSRGRGHVAVPRKIEAFATTRRQSLPIFASAEGPVCIVTGASRGIGAAIALAL
FT                   GKAGARVVINYAASSGPAEDVANQIKAAGGDAICVQANVAIEADVANLFKEAVDAFGEV
FT                   NVLVNNAGITRDTLMMRMKMHQWQEVIDCNLTGVFMCCQAGTKAMGKKKPVQGRIINIT
FT                   SVVGLTGNAGQANYAAAKAGVIGLTKTIAREYAGRNINCNAVAPGFIASDMTAELGEAV
FT                   EAKILQSIPLGRYGQPDEVAGLVKFLALDPAAAYVTGQVFNIDGGMVM"
FT   CDS_pept        complement(873854..875407)
FT                   /codon_start=1
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639769"
FT                   /orf_name="MICPUN_89537"
FT                   /product="Dehydroquinate dehydratase "
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="NADP or NADPH binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68824.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG553408"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="UniParc:UPI000199C41B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ3"
FT                   /transl_table=1
FT                   /translation="MAEALEEIDEAIVAGADIVELRIDFLRDFIAARDVRVLLDACSVP
FT                   CIVTYRPTWEGGQYKGDEQHRLSVLWTAVELGAAYVDCELRAAGHFFAAAPNGVRERST
FT                   TKIILSSHNYDDVPSEVELDEIHAQCVVAGADIVKIAAMVKDITQIARLENLLARAKSA
FT                   TGHKTIVLGMGEAGQVSRLLAAKFGSFLTFGALRSGAESAPGQPTLSQLRDIYRLQKQS
FT                   TNTKVMGVIGNPISQSKSPVLHNISLEAAGLDACYVPLLVSDIRKFLSTPLFVSDSFTG
FT                   FSVTIPHKESAVMCCEELDPVAKKIGAVNTLVRLPNGKFKGYNTDYSAAVRAIERAYTS
FT                   HLDGDMRDSETILRGKTIVVVGAGGAGRSLAFGAAFKGAGKIIIANRSFERAKALAAAC
FT                   GGEAVALDELRDGALKGDVLANTTSLGMYPDSVDETPVPKEALQAAGFKVVFDAVYNPL
FT                   ETRLLREAKECGCTQASGLDMFVGQAAQQFELFTGKKAAESLMRKAVLADMGLDYLVNP
FT                   "
FT   CDS_pept        877085..879517
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639770"
FT                   /orf_name="MICPUN_51440"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO68434.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C41C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ4"
FT                   /transl_table=1
FT                   /translation="MFGNPSRVLSRTRSAVDELVNDADFNDDLRIPSSGDDSSTSGSFT
FT                   GQRATKNTEIDNMLTEPMAKSKSHTYNNTFISCSPEVDVSCSRLDSKKTITPGNSRNGK
FT                   EHDSSVEHFEKLADQGNAKAALGLLYTTIHGSASWKDLDFRETSLTHHNLTLRACKRHR
FT                   PPYHIEARRVLLQMRECGPSPNLQTYHEVIAALARAHEWRIAERTFAELKRDFPNHNPT
FT                   IELHTSLISAYGKGGQWERAKSTFDALAKENVTMDTGIYNALLSAAVGAARYHEASIVF
FT                   EQMPKKGIIRNVTTYNAILTSLGRQRRIFDMELVHKNMRKSYVEPNETTLSLLITAHGN
FT                   AGDCYRAVEHLEEACKARWLKKSAVIFNSALGACVKSGESKLARDVLSMMHAEGVIPTL
FT                   VTYNTMLMSASARHDWNQVVNIYLELLQHGLTPDAITFDCICGIDKLQSATDAPGRALS
FT                   ATGSVPNAKTSCIRHNDYKSAETRNVHDKKSQLSVGNSLVTDLGTLPELLRSTLNELDM
FT                   LATESASPQKLTSTTCHVYDALLRALHLSGQAAEVETVFKAMVSKRVCRTVHTYNSLIA
FT                   SYEVRRQWKQAGQAMISMQEEGIAPDALTFDALINVCEEMGQWDRATAWLEHAQEQGHL
FT                   RCEDELGVLDLHRIRSAGTAQTVLRWWLRRMRSRALAPLDVRAAGQGTRIILESATRGA
FT                   TVSRKSNNVRTCSASLSEADIPLQIRDLPDQIQVVTGWGKHSTVFGYSPVKERVLALLG
FT                   GLNSPFIVPEYNIGCVVAERGEVRAWLVRDELLSLVRFLGGNRAALRRNFNPMGVDT"
FT   CDS_pept        join(complement(880501..880554),complement(879613..880413))
FT                   /codon_start=1
FT                   /gene_family="HOG000173665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639771"
FT                   /orf_name="MICPUN_113390"
FT                   /product="Pre-mrna splicing factor "
FT                   /protein_id="ACO68825.1"
FT                   /db_xref="InterPro:IPR005037"
FT                   /db_xref="UniParc:UPI000199C41D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ5"
FT                   /transl_table=1
FT                   /translation="MANSTDPLARNVRGTNPQNLLEAITRKKVYETLYWKEKCFAVSAE
FT                   SLVDLAMDLKTCGGLCAGKHKASEFLCLTLKLLQIQPETEIVLEFITNENHKYIRLLGA
FT                   FYLRLVGKPVDVYRYLEPLLYDYRRIRYKNSRGVCEVKHVDELVNDLLCKDNFCDVVLP
FT                   RIPRRPALEGAGHLMPKTGRLDLFNKTLIVRDNLGANPIHRASQGNAKQRPISKAECSG
FT                   ARDHSQGHLLPDDNEETGRGASAWSNLRDAFGDPSFVKKERSANVEIEPRPKKPRTKMQ
FT                   NES"
FT   CDS_pept        883186..883575
FT                   /codon_start=1
FT                   /gene_family="HOG000186751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639772"
FT                   /gene_name="IF4E"
FT                   /orf_name="MICPUN_107318"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68435.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG559144"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="UniParc:UPI000199C41E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ6"
FT                   /transl_table=1
FT                   /translation="MGTDFHLFKEGIEPKWEDAKCAKGGKWTYFFPKSKEPGALDDCWL
FT                   SLLLAMIGEQFCEPSEICGAVVSVRQKQHRVALWTKTASDEADQMAIGRHFKTVLGLAD
FT                   NEKIGYMVHDDAIRLERRAKDRYTV"
FT   CDS_pept        join(complement(886914..887117),complement(886775..886846),
FT                   complement(886626..886699),complement(886499..886568),
FT                   complement(886374..886434),complement(886149..886303),
FT                   complement(886057..886088),complement(885899..885998),
FT                   complement(885789..885839),complement(885649..885683),
FT                   complement(885505..885553),complement(885390..885451),
FT                   complement(885249..885322),complement(885123..885172),
FT                   complement(885032..885066),complement(884927..884969),
FT                   complement(884848..884867),complement(884734..884793),
FT                   complement(884635..884667),complement(884410..884567),
FT                   complement(884295..884337),complement(884142..884205),
FT                   complement(883842..884090))
FT                   /codon_start=1
FT                   /gene_family="HOG000029368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639773"
FT                   /gene_name="BOP1"
FT                   /orf_name="MICPUN_107319"
FT                   /product="Predicted protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68826.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG520747"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C41F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ7"
FT                   /transl_table=1
FT                   /translation="MENTTGDAPSEWYREEEHIGYDVDGRRISKRRWNDSIENLLHTID
FT                   DPSYWRKVFDEKEDREISLSRAHVELIQRLRSGAFPKSSSSSDLKHEQNHGIAEVAWQI
FT                   NHEPKRRFIPSKWEAKLVLRIVRALRAHATPNALQSNTVEQKMIWEAEDASQRSTRDHT
FT                   YLPAQKPKKPNHADSYNPPFEYQINDEDAPGTNGHDNHATRTLFNALRRVPSYSEFVVE
FT                   RFQRCLDLYLCPRVKKHRLHVRPQDILPPLPSPKDLKPFPSSNCLKFTGHEDKVLSIAI
FT                   DHSGQWLLSASEDCSIRKWEISSSRCISVWRFRDIVKSVAWCPSPMANTFSACVASDIV
FT                   LLKSTRASGSVPLLSSHHSVHSKVENSKLPEWKERDGEMIVHLASDVSKVTWHKKGDYF
FT                   ASFMIGGNNVMIHRMSRRTSQLIFRDQKFPIQSVMFHPYRPFMLICTRTCVYLYDLNKQ
FT                   SLIKKLSSGNQTLSCMAVHPGGDNLIIGTDLGRLAWFDLDLATSPYKVMATHASAVKGV
FT                   AFHAKLPLFASVSDDATTQVFHGMVHAELDQNTLIVPLKILRYTSESNCDGVFDCVFHP
FT                   TQPWLFTAGADRSILLVCDDN"
FT   CDS_pept        888908..>890766
FT                   /codon_start=1
FT                   /gene_family="HOG000252443" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639774"
FT                   /orf_name="MICPUN_51444"
FT                   /product="Glycoside hydrolase family 2 protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68436.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG670643"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C420"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ8"
FT                   /transl_table=1
FT                   /translation="MYSFPDVQAALRFWAAGGSWRARGKLPNVMLLNGSWDFILVSKPE
FT                   HTPHGFHESDFHDETWSEITVPSNWECEGFDRPIYTNVIYPFPINPPYANRRGVWTAKQ
FT                   KPHGSETGGELSHLSGWKWNPDVNDQNELENPTGCYRRIFKVPENWTSEGRRTFLLFEG
FT                   VDSAFYCWLNGRAIGYSQDSRLPAEFEVTDYLLSGRNVLAVQVMRWCDGSYLEDQDHWW
FT                   LSGIYRDVILYVKEAIFIADYNVYTEIPDSARDEASVSVDVFVHEAVSLDIDLPSDVVV
FT                   EAMLFDTNGQHVTGLASSVDDMMLCGNAEVHGQPSDKLSPYFTRKVSLTFSIPNARLWS
FT                   AETPYLYTLVLRTSILACRQHSNATSCVLDVRSDVEACRVGIRIVDIHNRRLRINRVPV
FT                   IIQGVNRHEHCPKRGKSVSEESMIEDIVLMKMYNFNAVRTSHYPNHPRFYDLCDEYGLY
FT                   VCDEANIETHGFHAGMHPTPYLSNDPAWRDAYVSRMARMIQRDRNHSSIIMWSLGNEAG
FT                   CGGAHISMANWARVHDPTRPLHYESGGSRTTCTDIICPMYARVQTCEHMLHEDVLDTRP
FT                   IILCEYSHAMGNSNGSADLYWECFRREGPIQGGFVWDWVDQGL"
FT   CDS_pept        complement(892880..894856)
FT                   /codon_start=1
FT                   /gene_family="HOG000264432" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639775"
FT                   /gene_name="LSD1"
FT                   /orf_name="MICPUN_107321"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68827.1"
FT                   /db_xref="HOGENOM:HBG559145"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniParc:UPI000199C421"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDQ9"
FT                   /transl_table=1
FT                   /translation="MFMLSPLQLASCAARSPPRPLSKRAGERLFCAGKRGRQASLMLRS
FT                   SFQAVQSPTIPTDSPTESTPLDKFPKSKVQSRQNVLPVTETFENQYADYSTGYASVPGL
FT                   AYERSEWITDIEGQIPTELEGTLLRNGPAMYVRGEGAERFEKSYLDGDGMVTSVAIKDG
FT                   KAYFRNKFVRTEDFDKEEKLGKYTEPSIFTAKDPRKPAFFWRLFNDILAGNLKRKQNGA
FT                   YNVLNWGGNLVAVDYKKPYELDPDTLDTIGHAASPLSSVMHTSHYRTVDEPDGSGRRCV
FT                   AFLNEVDWRSETTKAVFYEFDEAGNEVSRRAYDYPASYVHDLVVTDNYYILFDCPIKID
FT                   FPAVFTKYIFQKSCLSELICEDTDRRPLFRLFPRRGDSREVITIEADYWCYAYHHVNGF
FT                   ENSDGKIFFDTCTWDKFTLYFTDICSPNGQENFPRMKLSRFVIDVDSRKATHHCLSDLP
FT                   CELPITSWDYTGKPYRHMYLSSSVGTNEAGVNGPMQALTKVTLPTIDALGDALEQEWIP
FT                   GESKFAMEPFFVARKGAIDEDDGWVVALVHDANYAKSDFGGRGTEMVIIDAKKFEEGPV
FT                   ARIRLPVYIPFGVHGSWSTTYVAGCPKTAELEAIKARDSSRSHVPALIIDNAAISSVLP
FT                   RVEVTKIAVAAAIVCAILTVFQF"
FT   CDS_pept        join(complement(898144..898285),complement(896303..898011))
FT                   /codon_start=1
FT                   /gene_family="HOG000017376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639776"
FT                   /gene_name="DPE1"
FT                   /orf_name="MICPUN_89545"
FT                   /product="Glycoside hydrolase family 77 protein "
FT                   /function="4-alpha-glucanotransferase activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68828.1"
FT                   /db_xref="GO:0004134"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG704085"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C422"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR0"
FT                   /transl_table=1
FT                   /translation="MAWSLLSNAPSLSTHPSSRRFCLKWNDSPRSFRKIRSLRAKASML
FT                   EIGEPVHDGYTEMLPPRRAQRRAGVIMHPTSLPGHYGIGDLGKEAFAFIDWLADAKMQV
FT                   WQILPLVPPGRPIPGFREDYWSPYSGRDAHCGNTLIISLDELVADGLLTEQELPQPYNL
FT                   SGNVDFSRVAEINEPLIARAAKRLLERSDDDSLKSSLATWRSRPEIKSWIEEAALFDAI
FT                   CNDPNLVGKDWWDWPEDLRRRDPAKLEQKRASAAAHIEEFCATQFLFDKQWLKLKTYAN
FT                   SQGISIIGDMPIYVGGHSADVWANQSLFLLGDDFKPTSVAGVPPDAFSEDGQLWGNPLY
FT                   DWRSHSQENYRWWAGRIGRALQLHDEVRIDHFRAFAAYWSVPASAKTAKNGSWIVGPGK
FT                   SFFDGVEKVVGDAPIVAEDLGVITKDVVDLREAIEAPGMVVLQFAWGGDKQSPHLPHNF
FT                   CENSFCYPGTHDNQTTEGWYENLDEATKVKLANYAGISDAEGAAWGLIRLGMSSVSKAC
FT                   VFTMQDVLGLGDEARMNTPGVADGNWAWRIGPPGIFATCSPQAKKLASLATCFDRVSPE
FT                   HMINKKNIEVESPKANDDVTPDGDGSDANRPCRQKFFGVF"
FT   CDS_pept        899291..902344
FT                   /codon_start=1
FT                   /gene_family="HOG000264582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639777"
FT                   /gene_name="CCD1"
FT                   /orf_name="MICPUN_107322"
FT                   /product="Epoxycarotenoid cleavage enzyme/transferase "
FT                   /function="transferase activity"
FT                   /protein_id="ACO68437.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG559146"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C423"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR1"
FT                   /transl_table=1
FT                   /translation="MACPHARTGPLYPQKHATQRQLSQQQRSKYTVARTSRTETSSPSS
FT                   IIPSGEPTTEPVCSDTSFRKTGRAAGRPIGDLVAGPVLRNSDYGEHAAAFLSGNFQPII
FT                   YETSAVIEISHGETGQSSSLKSDRQPLDFIGNLPVDFPGGKFIYVGPNPKFSREHYKAW
FT                   GKGPGQAQAKEHTSSGWHHWFEGDGMIYAVDFGRRYDEREVGNYGRFDLQDNESVSKSG
FT                   PASRKLTFRNRYVRTKSWHDELRRGMRLFRPLMNASGEAFLPNAIANLIFGGNFLKDSA
FT                   NTALCFFANRLFALQDTMPPWELNQITLETTGPCDFDGSLPFFVPFTAHPKVAPGTGHL
FT                   LFFGFNPVYPPHCTIGSVSPDGVVGPLKPLWHNAAHGATFMHDFCLTEHYTILFEGSMN
FT                   IRPLRMLKGVHPLQYDRSQLARFGLIRRDKNANMSEVVWCKCTEAEMVYHFVNAWEDSH
FT                   TGEIVVIGVREDGFFHGALAATGTREWITKTLDQGTSVPRMHEWRIDPSRGEVVSERWL
FT                   FDDIVEVPRINDSFTGVQNQYAYAGRIHTASLSQEAQLKFDAVIKYDMNTGMKQVYEHG
FT                   SGRYGMEAQFVPRSSSVPDKDESTQHGESSSEDDGWLVLFVHDEGDANMSAAEGCSECI
FT                   ILDAKRIQEGPIARIMLPTRVPYGAHAMWCPLADDSDHHPASSKHESMLSMIPPEPRAF
FT                   AISEGQHRALLGAVMTGVLRAASGLFVNGWRPWIAIDDREQYAFIRMFGFRLDELNSLG
FT                   MFRKEQIETESKSGHIFGDIFALPAGIAIESALPSLTLFELEGCGDCRLVRETLSMLDI
FT                   ACTHRPCPHGAVRNRLAAAAAQTQTLGKRLDEYIYPEDAKLPYLEDERTGVRIAGADQI
FT                   IEYLYSEYLDGAAPPPMLSSGKLAAMFAQIAVDARGSAKGSDEISPFRRGPSGAFYSRP
FT                   ARTPEKPLQLWAYEASPFCALVRETLSELELSYVLQPCARGSPRRTHLMSRTGGTFQVP
FT                   FLEDPNTGVAIFESSAIINYLRSRYLQL"
FT   CDS_pept        904709..905374
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639778"
FT                   /gene_name="ERCC"
FT                   /orf_name="MICPUN_107323"
FT                   /product="Predicted protein"
FT                   /function="damaged DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68438.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniParc:UPI000199C424"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR2"
FT                   /transl_table=1
FT                   /translation="MLLTSTLESRNSELAKHANAGDLLIISRSQTGNGLVHRLHNVCWA
FT                   IDYINPDFVFSSSSCALFASLKFQSLHPTHLHTRVCGLSDSYALRIVVCLVDDEDENSS
FT                   LPEVNRSAGLGDCALVCAWSLDEAARYIEFFHGCERFIGSSKESYNDDYMTQLHEALSC
FT                   SHGVHRVDAATLATRFGTFACILRATHKSLLSSPGLGVTKVVRLSETFHTPLQLASHF"
FT   CDS_pept        complement(905572..907011)
FT                   /codon_start=1
FT                   /gene_family="HOG000241291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639779"
FT                   /orf_name="MICPUN_55157"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amidines"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68829.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0016813"
FT                   /db_xref="HOGENOM:HBG583284"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI000199C4A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR3"
FT                   /transl_table=1
FT                   /translation="MTPFFAIFFTFFFLRSAESLGLGATEAVDHEAWNRLQILGRISDA
FT                   QDGTLQRTFLSLGSRRAMATVENWMIRAGLDTWVDEIGNVHGRIEGAGCVGHKVLLFGS
FT                   HLDTVKDAGKYDGALGILVGLAAVKALVLESITEMEPVPCSLQLVAFSDEEGVRFSSTF
FT                   LGSRALVGTLPDNVFKAQDNEGHTFLEALRQNGFKGTLESIQTANISDALASYVEVHIE
FT                   QGPVLQQMKQHASPVVGISGQTRLLFTVHGTQGHAGTVPMTERKDALAASADIIHAIET
FT                   YCRERVLTTSRDNLLVCTVGAVSVWPGSSNVIPSSTNFTVDVRSKSDSDRNVVVEHVIE
FT                   YAQHVCRTRGLMFSFDRTHDAPAVDCDDQIINNFAESILHVTKDLIGTQDSADVAISEL
FT                   WSDSGSFNMKNTKYQHALTSGAGHDALAISQACPIGMLFVRCKDGISHSPQEHSTPEDV
FT                   AFAGRVLLDFLQSNGALFSAL"
FT   CDS_pept        join(908759..909027,909155..909447,909527..909723,
FT                   909797..910609,910730..910849)
FT                   /codon_start=1
FT                   /gene_family="HOG000001111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639780"
FT                   /orf_name="MICPUN_89550"
FT                   /product="Predicted protein"
FT                   /function="nicotinate phosphoribosyltransferase activity "
FT                   /function="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="ACO68439.1"
FT                   /db_xref="GO:0004514"
FT                   /db_xref="GO:0004516"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="HOGENOM:HBG292386"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR015977"
FT                   /db_xref="UniParc:UPI000199C4AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR4"
FT                   /transl_table=1
FT                   /translation="MHSSAMKVKTRKLPPCHNSLATALLVDAYQITMAYAYWKNGTHAR
FT                   IAAFDLLFRKNPFNGEFTVFAGLEECLRFISNFRFTGADIAFLRSEPFARTMDPAFFEF
FT                   LAQLDCSSLKVFAQMEGGVVFPRVPLMRIEGPLLVAQLIETPLLTLVNYASLVATNAAR
FT                   HRLIAGEGATLLEFGLRRAQGADGGVSASRYAYLGGFDGTSNLEAGRQFGIPCKGTHAH
FT                   SFVQAHIGFEDIADSTLNLPDGGLCPDFIKLVKEQAESLLEVVDMLPGSLRWAETNHSE
FT                   LAAFASYALAFPASFLALVDTYDVLKSGIPNFLAVALALRICGYQPLGIRIDSGDLSYL
FT                   SLQAREILTTVEAVLGAERAGGFTNLSITASNDINEEVLHSLNQHGHSITAFGIGTHLV
FT                   TCLRQPALGCVYKLVEIDGAPRIKLSEDVQKITIPGRKEAYRLYLKNGEPVVDVMLRID
FT                   EPQPREGERILCRHPFISSKRAYVQPAHVQRLHNLVWDGSTQGVCIGVDLSLMASRLRC
FT                   MQTINSLRADHLRYINPTPYKVSVSEKLYDFIHKLWLEEAPVGEIV"
FT   CDS_pept        join(complement(911561..>911913),
FT                   complement(<911071..911495))
FT                   /codon_start=1
FT                   /gene_family="HOG000260073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639781"
FT                   /orf_name="MICPUN_76105"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68830.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG713750"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000199C4AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR5"
FT                   /transl_table=1
FT                   /translation="YFLPKLFVSLLPRQNLKVKYGAEWALVTGSSSGIGKSLVDKLASQ
FT                   GLNVVIVALQNQLLDDAVAEMQAKFPTRVFVKVGVDLGTPGYLEIISEATKDIDVQLIF
FT                   NNAGFMLTGFFDKQALSKLLLNHECNATSAMQITHLFVTRMLAKNMKGCVVFTSSAAAC
FT                   QPTPFSALYGATKAYVSSFAASIAVELKSRGIDVCAVHPSPVMSNFYDRAHKLNSLAFF
FT                   MRFAVKPEVLPDEIFRPIGRVAWHDIGLVAVGFRLLL"
FT   CDS_pept        complement(912766..914712)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639782"
FT                   /orf_name="MICPUN_55160"
FT                   /product="Predicted protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68831.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI000199C4AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR6"
FT                   /transl_table=1
FT                   /translation="MVFISKNLHLTKIPSRSEADIVVAKKKLDSIREWISNSEQPGASR
FT                   IMLITGPSGSGKSAAVRLVAAETNLELHEWCAPVPTLWEDFRYIDLPSASYTSKVDEFL
FT                   AFIARAFRYSPLDLGLETRVGEHKDKGEQVSKITRKKFLLVDDLPFVNNLQQSERVRTV
FT                   LRQLMRQTMFPVIFVMTDAGRRKRTGVRSENGYLGSGETKYWCASPLSIDHCLSHELNL
FT                   AGAVTVSLNPVTVPRLVNALSVIAMNENLKVPHATLVDLAASAAGDIRSAITSLQFLAS
FT                   QDSEDNAHHDKQEHASKHADSSSAMNDTKDMSCLPAPGWSKLVQRHDVLSTFHALGKIL
FT                   HNKRMSGVCDNLRPHSFKIGKYFSKPFLETDTWGPELSGTTAQRKHLVTIMPVHPSLRR
FT                   EPTLYDPEMILSSSRLSAVSTIDFLFENYADFIPDAGIGDAVLALGYISDASLLQFWSS
FT                   AACVKMDVPPLSGNDRNFFAESDRISEHAAGSIVTRGLLFAPDPSRPEICKWFQIRAPQ
FT                   AGKVFRAASKNLFEVQKFVVTASKSVLTFWSHLATAAAETLPILRVIASTDPSGDSTAP
FT                   HLPKYWENVEGEISPTKNFADSQIRVSRAFPSEFGSSLSEGNNVTQNSLNAFPGRTAQL
FT                   APSTCEVDNIAEW"
FT   CDS_pept        join(complement(919793..919861),complement(919506..919628),
FT                   complement(919361..919462),complement(918350..919246))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639783"
FT                   /orf_name="MICPUN_55163"
FT                   /product="Predicted protein"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="ACO68832.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI000199C4AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR7"
FT                   /transl_table=1
FT                   /translation="MASSDATAVLRELQQTNENWVSMLCVDCGSRNPQWASVTYGIFLC
FT                   LECSGVHRGLGVHISFVRYKWESFRSVGMDSWSPIQLKKMQAGGNANLNDFLKDKGIAK
FT                   NIDPKIKYNSLAAKEYKDKVQAVAEGRLWTEHDRTTKATCVDSTSPAVREPFPKDFCHR
FT                   NDYASSRIAQGRRPQTSPRCEDVKYVGFGNRGVSPRRVEGSHVLLGHLSGGMNMLTQHF
FT                   ERVSLQAGRLVEDAVPEQLVDIEQLKERAASAAQASIGFGRRTWSGLRDVLQSTIERMG
FT                   VPSEQDQHAASEVTNELVEGNASYTSKEESARPHKSGTGSDTHDSFLHFNIKAQNSADG
FT                   VHSRSSLKCVGQMSSEGLSAVPKGAAPEATSGISSSGPYEWKTFEDDAWGDNEWGK"
FT   CDS_pept        920537..922465
FT                   /codon_start=1
FT                   /gene_family="HOG000264518" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639784"
FT                   /orf_name="MICPUN_55164"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68440.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG559151"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C4AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR8"
FT                   /transl_table=1
FT                   /translation="MNVTAHVPSKALSAQCRSTRLSRRAVISTLAARGCVTGRLYRMGR
FT                   ISFANASCSHDAQINQASRPVNAGIRSSSASSRNLANMTSTARTFPRPEIVSTTVSEDM
FT                   DSVLVRQVYRELTSRELNQELQTLGASQNWRFVFKIFDSLCENSSVSYSTRKERKGDAC
FT                   LLPNSYIATTVLSIAGRHGDLDRVRSTWTWMRAQGPGRSAPTAWTYTAYIQAVGAFGRW
FT                   EEAFDVYQEMRSEGVMPTSHTYSALIRAGAKGSRAGATAAVALVAKMRADGIKPDVPIT
FT                   SALICAYGVLGQYSNAERMLRAIGNRVGGSQGLQHAALDTCFIFTEGSEEVSADALSSF
FT                   SPDARLYTEFIIAACRCGRPSAAVEVFQSPNFPKTSYTCTAAIKAYGELSEWERAEDIY
FT                   VVMCKGGDCMAPNGITCSALLSAYEKCGQWRRAVVFLSRLRAARRSSPDENFNAFKIEE
FT                   IHYNIAISACGKCGKWTYAERLFDEMVKYDVSQSTITYSTLIAAYGRSGEQKRASARYT
FT                   EMLAKGLKPDDYTFVGLMLSPASCGNLDACLDIKEQMHAHGVVPSVHVYNELIRAADVA
FT                   RRYETAVEIFQEMVKKGIEPNSTTRELVQEIGKKGVEYYEDQQTAANFASFVAGLVGVA
FT                   GMMAGRW"
FT   CDS_pept        complement(<922593..923029)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639785"
FT                   /orf_name="MICPUN_107528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68833.1"
FT                   /db_xref="UniParc:UPI000199C4AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDR9"
FT                   /transl_table=1
FT                   /translation="MAGNDRNIATAASSLQNQEARSSMQMQVKTKNPKSKRVNQFNGFG
FT                   GDNPLNAPASRQNATFSTSAERQHRGSDAHPWLHYPPRFESSVEKITVKLKDTLAPTGV
FT                   LRALPAELRYSLTRNFGFFTRVFTQFFERDGADNVKQSIGL"
FT   CDS_pept        join(complement(925414..925440),complement(925199..925343),
FT                   complement(925019..925145),complement(924871..924960),
FT                   complement(924747..924807),complement(924640..924687),
FT                   complement(924508..924579),complement(924382..924453))
FT                   /codon_start=1
FT                   /gene_family="HOG000201538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639786"
FT                   /gene_name="MAK16"
FT                   /orf_name="MICPUN_107324"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68834.1"
FT                   /db_xref="HOGENOM:HBG522263"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="UniParc:UPI000199C4B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS0"
FT                   /transl_table=1
FT                   /translation="MQSDEVIWQIINRGHCSYKMKTGGATFCRNKYNVTGLCNRSSCPL
FT                   ANSQYATIVEERGIAYLCMKTVERAHKPATLWHRIALDGNYSKALKQVDSLLAHWSRFL
FT                   LHKSKQRLTKITQYLLRTRILMREKKPRLVTIPAREQQRESRREFKAQIAAQLENSIEK
FT                   ELLERLRSGTYENLHIKSLKNYSDQTQGLNFDSRKHLEIEYEDDLGPGLS"
FT   CDS_pept        926545..928284
FT                   /codon_start=1
FT                   /gene_family="HOG000016456" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639787"
FT                   /orf_name="MICPUN_55168"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="deoxyribodipyrimidine photo-lyase activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68441.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003904"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG286981"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR008148"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI000199C4B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS1"
FT                   /transl_table=1
FT                   /translation="MNRLVNEKRVRVLKEGKVGTGPVIYWCSRDQRVRDNWALIYACET
FT                   ANETGAPVVVVFSLVTRFLGAGARQFCFMLKGLREMEQALLAKNIKFVLLEGDPSLTVP
FT                   RFAKECGASLIVADQSPLRLGRTWRVAIASSVDCPLHEVDAHNVVPVWEASQKLEVGAR
FT                   TLRGKLAKLYPEFLVEFPETPVVKETWPCAAAAALPTIGIDWEALIVRARNDGAAVPEV
FT                   TWAVPGEFAAHATLEHFLTRRLKYYEHRNDPAKPQALSGLSPYLHFGQISAQRCALEAR
FT                   RYAKSSNKAVDVFLEELIVRRELADNFCWYSPKYDTIEGQKYEWAKETVREHSKDKRAY
FT                   LYSLQQFENGETHDDLWNAAQLEMVHGGKMHGFMRMYWAKKIMEWTESPDQALEFAIHL
FT                   NDKYQLDGRDPSGYVGCMWSIVGVHDQGWSERPIFGKIRYMAYSGCVKKFKVQDYIKRV
FT                   DELVTAVKAGEKDTAVVNPGRFHIEVSRSLDCDSLAVTGSRVCSEDELQRFVRVASANA
FT                   RSDTTRSLEALRALKSVDITAETLIKTGVGKELKKLSKQRENPSVSSAAAAIVQAWQKL
FT                   LLP"
FT   CDS_pept        929069..929221
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639788"
FT                   /orf_name="MICPUN_51469"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68442.1"
FT                   /db_xref="UniParc:UPI000199C4B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS2"
FT                   /transl_table=1
FT                   /translation="MTRPKSLSREPNIPVQSLGRHLARMGLELLFLFSLRKAPLVKKFA
FT                   APSIC"
FT   CDS_pept        join(930528..930595,930673..932404)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639789"
FT                   /orf_name="MICPUN_51470"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68443.1"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniParc:UPI000199C4B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS3"
FT                   /transl_table=1
FT                   /translation="MFPFSAWLQRRESKVALRKERKRKNDNSDGEKENLEREGTLDGRC
FT                   QSGRIFQEKTDHLQHGIMDSTIYLHVQDARGDIPANITESVVHTFRPSAALSYNSNLES
FT                   KAPDFDKERVACNVARPIHSTAVPTNNKADCTQLLSAPKIGHAGGIHEVAIFEASGGKY
FT                   QQSEIARRDATEATGSTQHLSNLGNRPLLGQSARMISSSAPKGGKYGIEAKDDRTQMTY
FT                   DPYTEPVQGEVPDRTPSIPCLREDMSYAQTGSLQTQSMIVNLSNFGRSGKDGHHLCGEG
FT                   LTKKAGWNFAPALSTGGRPNLNTTATSTDKLDRTTEDSSVTPLGTSGGIVERLQRALAC
FT                   RSRLEAENRRKLELSTRQKQDFRQKREQHATARRNAKVAAEVRSHEEKMQRQYKLQQAR
FT                   REQEAAQLAADEERQRMQMLLDEQDKIKNPVVDAKDRHVSQCLQVCHEEKIRTQDVDSD
FT                   DMTPRHAPLTRRKSALLSTLVSAQVSSRDVVCPDECISYEMSPYRSGSDSDEDIGANAP
FT                   RKAIPRWARTELLVPLLTKQATLDPDEIFRNPSKTCSLDAVFANTKEKIDGRRSSSGNW
FT                   FDDRLTWREELTYKRNMGFVARK"
FT   CDS_pept        join(complement(933981..>934367),
FT                   complement(<932742..933882))
FT                   /codon_start=1
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639790"
FT                   /orf_name="MICPUN_67532"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68835.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="HOGENOM:HBG721667"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI000199C4B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS4"
FT                   /transl_table=1
FT                   /translation="VTTPVYYVNDKPHIGHVYTSTVADVYARLQRNMGKDVFFLTGTDE
FT                   HGLKVEQSAEKRGIGTQQLADENSALFREVMDDMNISYTSFIRTTDTSHQVQVQRLVEI
FT                   LLQKGFIYLGKFEGWYDEGQEEYYTAKEIGYKSLISGKDLTRSSEENYYFKLSAFQEQL
FT                   LRFHEDNPYFLTPPARRNEIINRLQEGLNDIPVSRTNFTWGITMPGDDSHVIYVWIDAL
FT                   LNYITALNLAEGLGKDADESICHSEEGLKDFWPASLHVMAKEISWFHAVIWPALLLALE
FT                   LPLPERVHAHGFWIREGKKMSKSLGNFVDLEVMKRFSDHYGLDGLRYYLLTEGPVGSQD
FT                   ANFSAGRVHEVYSTDLANTLGNSLSRTTAMINKYYSEGGLPSEISSAGNRITWERFDWP
FT                   TLTAEAAADVVRHVEALELPKATNAAIGLVARVDLFISETEPFRMAKDESKAEELGAVL
FT                   YQCLEALRIACVLLEPFLPQKIDEVGKHMDLGNGNFKERVRWGSLKPGSKV"
FT   CDS_pept        940472..941341
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639791"
FT                   /orf_name="MICPUN_51473"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68444.1"
FT                   /db_xref="UniParc:UPI000199C4B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS5"
FT                   /transl_table=1
FT                   /translation="MLDCMPVIHSLVFWMLVRDPHWRPDVTQIRKKLSTIMATTFCKQN
FT                   ESREKSYPSSAGMSYHNLKCQSWPLPFPQGRPASVLHAPLIGLERQPTPGICDEFNMQN
FT                   DSSPLDHLQFTLTLLAKPRLEILVFSEALHKSFNESFFDAVLVCGKLPNDRGSCDFKSL
FT                   ECNNHAKLYSKAISCGIAAQAIDLPSPTARGHDVQLQFAAVISSAVSFARRIRLGPQAK
FT                   LAIICKQADVSVAAVVAIAIQVDMDGGDIRSTIFSCSNKDAYGKIHATDLARLCAWETG
FT                   LRATSNYH"
FT   CDS_pept        join(complement(942553..943566),complement(941755..942465))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639792"
FT                   /orf_name="MICPUN_51474"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68836.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C4B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS6"
FT                   /transl_table=1
FT                   /translation="MQPIAHAPSGALQIARRFVSLLHHVHAKEFLSPEEHAHVLRALFV
FT                   LGQISRFGADALEDSGEDDISPASLLCLFRHFLRRSGGSEFNIKRIALQACGYIFVSRP
FT                   RLMLSPDNDFGKASMDGIMCAALSRSSESGIKEQVLQNLAEFFREEENKLLVPTRDEAV
FT                   QDVYSGKVETEIISKANTPKITPHGDQRLCPGHHSQTQEHDRILLQGRFQIVNGERESN
FT                   LSNGLAQRYWPHILQLCVDSDASVRLQALHLVEVVLRQGLVHPMSCFPHLIALQADPNN
FT                   NIQKLALQMLRHQRGRYPDFFDNQLSAGMQMMFEFCRRLLHALRRANDDNQTCSDQEAI
FT                   KVANADDVSRGCANIYKLLHQNRNSRLKFIHAILRRFEGAASRSEIPYLCFLANVVSLL
FT                   PYTTNDEVMYVVFHLNRIVSLRAAILHDALRRHLEEFGRLAAGKITKVDDSARRDVELS
FT                   TILSLILVLKQYFVRYFELTDSRIHAYKPSQPLKTSEILRCNRVNDHLDVSWVDPTAGN
FT                   DLSGSIRQANIFFALMNENADHQPSLQCVNRSEQVETVDYEDVGRKTNSEGQLLLLE"
FT   CDS_pept        complement(947531..948706)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639794"
FT                   /orf_name="MICPUN_55161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68838.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C527"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS7"
FT                   /transl_table=1
FT                   /translation="MITIIMYVYIWYLHSYIYTYLYYLFITKVSIRRYEQKILAVDFSE
FT                   SPGEVFPVKGLQRTLSHLEHERRYKGLFQAASPEVSAAMHSLSSPHAMTWHRVCPFEPR
FT                   LQMASHLCKMRIRQELDLPMPCLTDAHNNQRLAHCCNPPHVALEPRHAFNHLICVHTSN
FT                   AGGNQTRTHDKVKFAVQAVCKLGGLITFTEPIGEIPGTTNRNGNTNNLRPDIRVDGLRD
FT                   TGITILADVSITHIMDSAVNHTSQPRPRQGNSAPNSDPIMRRETDKNNKYKAAATAVHK
FT                   EFIPLVMDTYGRMGKPFLNFLKDVAALTARRASGNVNERTQAIYDSIDPPNELRNRIHL
FT                   RNLALVHVALIISLMQRVAGSTVTNDRQHGARGGMYGAHEHYVQPYPVTNF"
FT   CDS_pept        complement(947531..947845)
FT                   /codon_start=1
FT                   /gene_family="HOG000100757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639793"
FT                   /orf_name="MICPUN_55161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68837.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C528"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS8"
FT                   /transl_table=1
FT                   /translation="MDTYGRMGKPFLNFLKDVAALTARRASGNVNERTQAIYDSIDPPN
FT                   ELRNRIHLRNLALVHVALIISLMQRVAGSTVTNDRQHGARGGMYGAHEHYVQPYPVTNF
FT                   "
FT   CDS_pept        join(948986..949075,949149..949452,949610..950255,
FT                   950405..951077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639795"
FT                   /orf_name="MICPUN_55174"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68445.1"
FT                   /db_xref="InterPro:IPR006886"
FT                   /db_xref="UniParc:UPI000199C529"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDS9"
FT                   /transl_table=1
FT                   /translation="MDACARRVVQRIPVKYNGHVSCHQSLCTLQYPLRLVENSYDNQKI
FT                   SAVRHKAHARKLEIALLREHECLELISTDTKVEDGHCIAVLREGILYITPIECAYQMRP
FT                   SMARLDAVEERRKVNDKSFDAELPKQVYLGVMSVGSMKLTPLHVHVKRRETERQAEFRL
FT                   HSHAHLKQLEDDEPWLQLKPSFPGEGEAEKIYNAITFSSAPHEVLEDYSQIKTNIVPVS
FT                   TYLDSICPMPSGILLADDTRHTAMLAASSTSRTEARSLREAIRAAFSDSRGSVLRFKQI
FT                   IEFIPEACEINDVMDALQTLAHLVQGCWVICSALSCGGDTRRERDRDRILLQFARRRTI
FT                   SSRDLMRQKQELLNEIAVPTSRQARWICGDNNCAKDTWTFIEPTDDYFMSYFPEVVQAE
FT                   SERWQNIESWFNNKMGQLGMPSPLSVPPCIYPGVSVKARSFICSLLQRCGIMRLSNIRT
FT                   CLEQQKVAGLDSVAFLCEAELLGIFGNNVMCIQGACVLRSIGDKHIDPFRRLLLELLDK
FT                   NDRSINRTALIEKALSLGIMPSNSAYIRCLGDLCVSRGNAWVLKCGHKSAGLQ"
FT   CDS_pept        join(complement(952591..954339),complement(951129..952496))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639796"
FT                   /orf_name="MICPUN_55175"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO68839.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C52A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT0"
FT                   /transl_table=1
FT                   /translation="MGSASTLDRCTCFSDASWLGSGPNSLLELLSRTSSELSERHSKAE
FT                   EHGLEQMALFLVDGRNDLMSIGEEGGRAHSELRDLFRAIVQNRLLSKAYRLLPTDSDCA
FT                   PPSCILRVLQCTRLFLRDQRFVKELVTIDGSVSALGKKYEDYASLLFAESNGEPSTGGR
FT                   EKLCFEILSEIASIFKKLASDRTACPWHLLVDCDAHRTSIALISVQEPSLLASALMTLS
FT                   SISSRSEESAAIIGQLGCVDRLLIILREYDSAFQHLASALLQSICKVKEIRRKTQNTGG
FT                   VYITLGLLSRKTPAAALESFLCLFRCLLSERSAVAEALSNGAVPILLAMLMPISTSCMN
FT                   ATDPRICDPAVTCLICSVLSKLAAEDEGALQIRRCGGVYLLGRLLTDTHALRVRKRWEN
FT                   IFQSMFEIQTHAFRALRFVFSAECNRKMFKCIFPADLYESFIDVGNYQHDVEKYRHLAH
FT                   DWCEMTSELVHNSLSALEDTNLNHGNHHSGSQRIINGYIVTEIIGAGAFGCVHRVFKTR
FT                   SITSQYAMKELDPGVEKLIFGESPDEITASVGRVAMEVQIFSQLDHPNIVKYYESFKEG
FT                   GRLYIIMELVEGVTLLDFIKSTSEKNERISEESIWDIFIQIVLALHYIHIVKGVVHRDL
FT                   SPNNILIEHGTQRIKLADFGLAKAHDGDWSKRRRDEQVMRSAVGTIAYSSPEMIKHEPY
FT                   GDKVDVWSLGCILYFMLALQPPFEGPNALVIASAVVEGRYASLEPLIRRRSRQMAPRIQ
FT                   SKGDVDCHRGDKIYSTTSAVAVCSKVGYYSAALVGLVGRLLIVEPCKRPSIVEVAAACA
FT                   PCLMRSVENLQSLNDGLQIKLRCLQESGQLEGMVEHRKREAIRQLRGLTRGSSIYPTRP
FT                   ASPYIEQRVGPNNTGSSLRHIVADDSSKDPPNLVSELGSSRHHRCNFKIASDRVRPIAD
FT                   PFLQVITVLHKLVYIDQLPPDLKKDPRQAVLQQYKRFLFGAGQPAATIKAEAVKLLVGS
FT                   HEAVLGQDASILHEVVGPQVDRSHELTYEELRSMLEEVSLSRDFYLGMK"
FT   CDS_pept        join(955104..955490,955596..956108)
FT                   /codon_start=1
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639797"
FT                   /orf_name="MICPUN_112695"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68446.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000199C52B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT1"
FT                   /transl_table=1
FT                   /translation="MEVPTVIGLGLGFDGTSNWINKYLVDRYLFGLDEFRPEAYGIMRK
FT                   FLVLWTFLTIFTFLLYFSLCPLVYYLLYTRRDAHGKNFASWDRKEGKDQVINEIKLSVF
FT                   SIIVMAGMTAPFELLVEAGLTKIYWDLPTTALGWFYLTVGSPLMFLLFSDTCVYWIHRA
FT                   LHHRLLYAPIHKLHHKYKETTPFSSYAFHPLDGWLQGCPYHIFVFIFPMHHISYFCALA
FT                   IVGLWTINIHDRTTYRIPFINGAAHHTIHHTGFTYNYGQYFVFWDIFGATFKDPYSCAP
FT                   YSQESRAGKNGSRETKSC"
FT   CDS_pept        join(complement(957197..957347),complement(956771..957011),
FT                   complement(956455..956701))
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639798"
FT                   /orf_name="MICPUN_55177"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="ACO68840.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199C52C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT2"
FT                   /transl_table=1
FT                   /translation="MSTVASTTVTSRLSSKVTLRDSRTRHFGVGLPRRRAGRYTATRAE
FT                   VTNGNGAATVVTDATFEAEVLKSDIPVLVDFWAPWCGPCRMIAPLIDQLAEEYSGKLKA
FT                   VSCPNFAIPSIFANCDTFSSARCASTSDFDSELRHLLWEDSEALHILTDQSENHNQVKL
FT                   NTDESPSVATEYGIRSIPTVMIFKGGQKLDTVIGAVPKSTLTGTIEKYL"
FT   CDS_pept        957878..958195
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639799"
FT                   /orf_name="MICPUN_112696"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68447.1"
FT                   /db_xref="UniParc:UPI000199C52D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT3"
FT                   /transl_table=1
FT                   /translation="MHHVSKQGATLHGRGKHGEAAQARCHGKEINSTSYEPSKVRRAFM
FT                   FFFCSPSRGQIFGLSAHWKRCAHTMCTAHGVARLFAGRRGAGEQLNAPSRAKTHRIIKN
FT                   D"
FT   CDS_pept        complement(959250..959507)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639800"
FT                   /orf_name="MICPUN_55178"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68841.1"
FT                   /db_xref="UniParc:UPI000199C52E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT4"
FT                   /transl_table=1
FT                   /translation="MAPSLDGERARQLAITLLGAKDGGRHHQERALVLTSLRRQIRCCA
FT                   LATTMSWFYELIDRQLAAETVAQAQRRFVRRKLVNTNARS"
FT   CDS_pept        join(959766..960236,960399..961547)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639801"
FT                   /orf_name="MICPUN_55179"
FT                   /product="Demethylmenaquinone methyltransferase/aldolase "
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO68448.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG559163"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C52F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT5"
FT                   /transl_table=1
FT                   /translation="MYSAIRTFVRRAFPAATARQPAVTAAHVQTICMNACRGMATGPAA
FT                   GGHISDELLDKLGSLSTQALIDGLWVMGWPTSHIMGARPLTEGQKKMIGRAITIQFAAA
FT                   RPDIAADKPSGTDSPEYEAFELVNGKEVIVMSSVGPWESVGGDIKFLRLFQRGCAGLVT
FT                   DGSVRDTAVLREYGFPVFSHSTTPRQGPHVHQPWSCNTVINCGGVVVRPGDAIIGDQDG
FT                   AVVIPASHAQQVYDIAHSREVIEEIVKEELTKNPGPPGKFYPFMSGKIKPNSPLGQLLT
FT                   SKGVKFVHCAARPGTRLGVPTVAPTGATLGSRRTVGGPCNMSTYTQTEAHYQSVLKQFA
FT                   EHKACAVLRTPIVGACTPAMNAAVDGGFKLVEFTLTTPGCLDSVAEYASRKDVLTGVGT
FT                   VMTVDDAKRALDAGAQFIVSPVLIPEVVEWCAANKIVCAPGCQTPSEMVQAWKLGAPIQ
FT                   KLFPGVAGGPAWVRAVSAALPMLRINPTSGVEISTAADYLRAGASSLGFVAPAFPPKLV
FT                   ENKEWDAISKIASEIQAAVKSA"
FT   CDS_pept        complement(961862..963772)
FT                   /codon_start=1
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639802"
FT                   /gene_name="NAD-ME"
FT                   /orf_name="MICPUN_55180"
FT                   /product="NAD dependent malate dehydrogenase "
FT                   /function="NAD or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68842.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C530"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT6"
FT                   /transl_table=1
FT                   /translation="MSDYTPALIDSWRSTVSALGFLAPTSTREYASSRPCGFAQRETNY
FT                   FADRTHTCRFAENDVMIMHADTNRGIEVLLNPIYNKGTGFSLAEKERLGIRGLTPPRYF
FT                   TIEQQCKKIWTNLTEKGKTGMFRWRSMQALQDRNETLFYRLLVDHIEELAPVIYTPTVG
FT                   EACLQYSRLFRRPRGMYFSADDVGHFNAMMYNWKNDVSVIVVTDGSRVLGLGDLGAHGM
FT                   GISVGKLDLYVAGAGIEPSSVLPCVLDVGTDNEELLADPYYFGLPQKRIKGDAFMNIVD
FT                   EFIQAVKNRWPKALVQFEDFSTDHAMPILKRHRENVLCFNDDIQGTAVVVLAGIYGAMA
FT                   AMGKSSGAITEQTFVVCGAGSAGMGIANFIHAALVHHGLSPQQAFERFYILDKHGLITN
FT                   NRELKEGEPGVDDLRPFAESRRDLPDGINLREVIESAKPTALLGASTVSGLFTHEILTR
FT                   MGELNKNPIIMPLSNPTSRAECTAEAAANATEGRAIFSAGSPFDDVSRGGVTMVANQGN
FT                   NLYVFPGLGLGSILVGSNYISDGMLNAAAEAIPKTLHDGAIRRRAIYPRIADIRDVSVK
FT                   VAAAVMKQAVDEDRENRGGKIAHMISREGIEGLERYVRSSMYYPEYRPTVFSPGSGRGT
FT                   L"
FT   CDS_pept        965342..966511
FT                   /codon_start=1
FT                   /gene_family="HOG000264620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639803"
FT                   /orf_name="MICPUN_55181"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68449.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG559164"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199C531"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT7"
FT                   /transl_table=1
FT                   /translation="MNINNLPSNDKTGCTGPPQTFKSRTSDDQTLPALFWDGGENWINE
FT                   DDCADFAALQSLKRETTTPKERAERYKAEGNEALKFMKNKLYVRKAVQFYTLALQEKFD
FT                   DAALRSILFGNRAQAALILGNYRKAHVDAERCVGLDPANVKGWFRAAKSAIELNDPVKC
FT                   MKMCTEGLELDPKNKELNTLLADARKTKKTKDMQLQRRQYRESHAKLYIREIVKRGLQF
FT                   GPPGFATGERFPELSAQNFLSYWVLFLYPEVMHTDVIEDFDERQKFSTQLDLMFGPDVQ
FT                   APEWDTAGAYKRDRLEIYYITNSAPAYPASVFEQKVLSSNCAGTCAAKDFELTERAKLE
FT                   MRKVLVDETCSLADILTADGHVICGHPVFYVVALGTKFRERFLKDAWKL"
FT   CDS_pept        join(complement(967962..968321),complement(967685..967876),
FT                   complement(967494..967599),complement(967232..967443),
FT                   complement(966740..967171))
FT                   /codon_start=1
FT                   /gene_family="HOG000198004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639804"
FT                   /orf_name="MICPUN_55182"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68843.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748611"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C532"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT8"
FT                   /transl_table=1
FT                   /translation="MQPLCHVTYRATGGLCRARRRTPIEQTHTTIHTMRLYKPWSFFLW
FT                   VYASAALIFLLFASAVPSLIFSAVADVPRPIAASSSISPWAAGYGQKDATALKEANQLA
FT                   SKGHARPEDENNSKNIPIFQEAKEGLAASSAKVKGELNRLDRGGVPQNFDPRNIQVVSL
FT                   DNPRAFMHIGFLSERECDLLVEYARPNMYKSGVVDASNGGSSFSNIRTSTGSFVPTVFP
FT                   LGMNDVVRRIERRIAAWTQIPAAHGEPIQVLRYQIGQEYQSHFDYFFHEGGMKNNRIAT
FT                   VLMYLSDVKDGGETVFPSAESLQVKPEPIHHACAKNGITVIPKKGDAILFWNMKVGGDL
FT                   DGGSTHAGCPVVLGEKWTATKWLHVSSSTEFDARQRVLREGRETNFGGCRNANIQCQVW
FT                   AEQNECERNPQYMRDTCHLSCGMCTGIWQEASYI"
FT   CDS_pept        <969526..>972885
FT                   /codon_start=1
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639805"
FT                   /orf_name="MICPUN_65205"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68450.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG330916"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI000199C533"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDT9"
FT                   /transl_table=1
FT                   /translation="ESSQHKEHRPPRTGGKAKQRGKSGKTKVIDEGKLQGKNPRAFIFK
FT                   SSSKAKKARTIAAEKQQRKLRVPVVDRQSNEPPPYVVVVQGPPACGKSTVIRSLVKHYT
FT                   RHALSEVKGPITVVSGKKRRIQFVEVGNDLNEMIDAAKLADLVLLVVDGSYGFEMETFE
FT                   FLNVLQVHGFPKVIGVLTHLDQFCDSKQLRKQKKSMKARFWSEIHNGAKLFYLNGTRNG
FT                   QYLKRDTLNLARFISTAKFKPLTWRSTHPYVVGDRFEDITPPREENDVQHSECDVAIYG
FT                   WLHGCNMRTGQLVHIAGVGDCTVDDIQTLPDPCPLPSSDKKQRKLVDQSKSIYAPMTDI
FT                   GGLLYDKDAVYVNMDDRDVNFSRRIKEGENSSGSLRFDAESTEHKKAGIDMVYGLQDAQ
FT                   ISLDDKLRASGIQFFVGRKTFKGDGVESLGYNKVDFQDKFQGFNSGNQAIDQHDSGNGP
FT                   DYKEIRMRRAANFAKNHAVVEKEGKKIEEPDGNNISGHMEINMVTKTTAREICLFGTAY
FT                   ESHQDAQENNTPVPSNNSGGFFKRAGHMTSDAFDASKSITFEGSKFQHLLFFDDHGLGS
FT                   RFVTGDWTAAACRNDHVTKSEAKLGRGKRGGDCADIYGNFEDLETGDFLGTTAGHPMTD
FT                   DCRKIDEIVDMENHQNCKSIVKGVFPCKTKSIGKDGTIENDTSVCTDVNNPLSYFDYVK
FT                   DALQERALKTHRELDRLPDTTREALEGYRPGSYLRLVLRSVPREWVVHFNPIRPILIGG
FT                   LLASEDSFGYQHLRFKKHRWFGKVLKNQDPLIFSIGWRRFQSIPVYSVKDANGRYRMIK
FT                   YTPEHMHCHATIYGPMIPQNTGVVAFQSLAEKVVSFRISATATVLEVDHSIKVMKKLKL
FT                   VGLPTKVFKNTAYITGMFNSALEVAKFEGAALRTVSGIRGQVKKAAKLGQSAPHLTKSV
FT                   HAGFHPHEEGTFRASFEDKLLLSDIVFLRSWVRVDVPKYFNPVTSSLVGKHGSWNGMRT
FT                   VAQLRHERKLSIPVNRDSIYKHIARPLRVFNKLHVPKSLQRALPFESKPKIETKRMQRT
FT                   LEQKRAVVFDSEEKSLATLVQQLSTIRNDRAGKVRCKAVSKREKRTKQIIKDEVWRKDL
FT                   SRQERKKRYREQG"
FT   CDS_pept        join(complement(975192..975269),complement(973320..975101))
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639806"
FT                   /gene_name="FTSH2"
FT                   /orf_name="MICPUN_104714"
FT                   /product="Aaa-metalloprotease chloroplast "
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68844.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI000199C5BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU0"
FT                   /transl_table=1
FT                   /translation="MLPSSEASAADDQGVASSRMSYSRFLEYLDLGRVRKVDLYENGTI
FT                   AIVEAISPELGNRVQRVRVQLPGTSSDLLSKFREKNVDFAAHTNAEDGSAVFLNLLGNL
FT                   AFPLLLVGGLFLLTRRNQSNGGGMPGGMGGPGGNNPMAFGKSKAKFQMEPNTGVTFDDV
FT                   AGVDEAKNDFMEVVEFLKRPERFTSVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPF
FT                   FSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIFVDEIDAVGRSRGTGIGGGNDERE
FT                   QTLNQLLTEMDGFEGNTGVIVVAATNRADILDPALLRPGRFDRQVTVDVPDVKGRIEIL
FT                   KVHAKNKRLTDDVDIETIAKRTPGFSGADLSNLLNEAAILTGRRGKDAITLVEIDDSVD
FT                   RIVAGMEGTRMTDGKAKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQAKGLTWFIP
FT                   GEDPSLISKQQIFARVVGALGGRAAEEVIFGHAEVTTGASGDLQQVANMAKQMVTTFGM
FT                   SDVGPWALNDPSSQGGDMIMRMMARNAMSEKLANDIDVATKRIADEAYVVALRQIKDNR
FT                   EAIDVIVEELLEVETMTGERFREILSQYASIPEENVPKEIAMV"
FT   CDS_pept        join(977535..977694,977789..977874,977966..978489,
FT                   978570..978987)
FT                   /codon_start=1
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639807"
FT                   /gene_name="HEMB"
FT                   /orf_name="MICPUN_93011"
FT                   /product="Delta-aminolevulinic acid dehydratase chloroplast"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="ACO68451.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG285270"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C5BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU1"
FT                   /transl_table=1
FT                   /translation="MSGFSQIRVGASVRNSSRLTWSDATRRTCSPSSKAADVDLAPPTK
FT                   RVPPKLPDGTPIVPPQDLASRPRRNRRSATVREAFRETILTPANFIYPIFVHDGEDDIP
FT                   IDSMPGQSRLGWRTGMIDKVREARATGVNQVVVFPKTPDHLKSATAEECFNPNGLAQRS
FT                   ISLLKDTFPDLEVYTDVALDPYNTMGHDGMVRSDGVILNDETVYYLCKQAVSQARAGAD
FT                   VISPSDMMDGRVGAIREALDAEGFTNVAIMSYTAKYNSAYYGPFRDALASAPRPGNEEW
FT                   RIPKDKAEYQMDPANFRECLREAALDEAEGADIMMVKPAGAYLDIIRALKDSTTLPISA
FT                   YQVSGEYSMLKAAAAAGYLNERDAVLESLISIKRAGADLTLTYFAVDAAKWLQEA"
FT   CDS_pept        join(complement(980159..980194),complement(979935..980031),
FT                   complement(979767..979860),complement(979610..979676),
FT                   complement(979448..979532),complement(979352..979365))
FT                   /codon_start=1
FT                   /gene_family="HOG000204097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639808"
FT                   /orf_name="MICPUN_107532"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68845.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG735443"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniParc:UPI000199C5BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU2"
FT                   /transl_table=1
FT                   /translation="MVRISVLNDTLKAMYNAEKRGKRQVLVRPVSKVVIKFLQVMQKHG
FT                   YINEFEYIDDHRSGKIVVELNGRINKCGVISPRYDLSHTDVEDWVGRLLPSRLFGVIVL
FT                   TTANGILDHEEARRKKVGGKVLGFFY"
FT   CDS_pept        981389..982195
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639809"
FT                   /gene_name="RN3.2"
FT                   /orf_name="MICPUN_55187"
FT                   /product="Ribonuclease III domain-containing protein "
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO68452.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG559166"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000199C5C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU3"
FT                   /transl_table=1
FT                   /translation="MFKTLGSCYVVQVNHVQEFSLLNFLCHRARRPLSRRAAQKYATGA
FT                   SREASWNTSCTNAVLSDVPAKLVDRAPSVALAYTYLGDAVWELYARRHMILQRATVASL
FT                   PYSTNVVLRPQEATKQGWSSSIAMCGHLRRLLNGTMITDDELTILEWGRDYGHECRSRH
FT                   NKVQHKEASALEALIAYWYLFDQNRLHSVLLHLGMSFHQQPLHEMFDGQVESTIFATLK
FT                   TSNARPPTKSEYAAVKGSVGAGQRERLGHLVKRMILLETRVSELEK"
FT   CDS_pept        complement(982234..984153)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639810"
FT                   /orf_name="MICPUN_113364"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68846.1"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199C5C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU4"
FT                   /transl_table=1
FT                   /translation="MPRAHSKAALPSVFLAVTLLTWSCFQYAFAHAGFLGVVVMPTANY
FT                   VSEGIALTVSGFNFINLGEHRVLVQAETVPREFYQDGLDTIACLFAQSSHGKPISSATV
FT                   IGEHSVACVLPLTLRPGFVSVGVSTNGIDSFFHSEVTVSVRARPELYHVIGSRIQSGGD
FT                   HAHVIGDGLEPRQAHSALPGHALLCGWHTPIGINSRNEKVSLGAGGTPGVFVSSAVRVC
FT                   EIPAVFGHTVKLFAAAEPGTSSEDVLATKEDYTTSHGPAILSSDPPIIVAVRPWQTNSG
FT                   GGSSLSIDSVRYCDDVSSLERLSFKPLLRFGTAWVDISPHSPPTSEQIQIWRSVSPAYK
FT                   PTDTEGAPLAIVSTHYTSKARNPCWQRSFEIETGLSAHYPLPLCVVVNAADSALITWIR
FT                   GEQFRPLSIEEVASYLVIGIGEPIGTEFHFSSQARAQSYHDVLGVAPSTGAEGGGGIVW
FT                   VSRPFSQLEASRKPAHHQGQMTCTFGLTEVSLVFISSALMACEAPTYSSTRFPRTVPVN
FT                   IGFDYMPALESIGTYTYLQHIFVSEPEPDAGPSAGGTKITVTTSKAEPLAALLVPICRF
FT                   GNIVVVGSFSDIGGVVACITPAASSSSISFFMDDNKGACAPSGSIFTDHRSRNYHYDYF
FT                   HEHE"
FT   CDS_pept        986433..986822
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639811"
FT                   /orf_name="MICPUN_51495"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68453.1"
FT                   /db_xref="UniParc:UPI000199C5C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU5"
FT                   /transl_table=1
FT                   /translation="MNLDGLDAMEVISPPRQTHHMLTRCARPPFRFHPQRVGTSSDPAL
FT                   ARVAGDKTAPVRDERQPGGGWAKARCSHAVLGARNRRRGRRVRLTDDGSARTAVEGAPT
FT                   CCRRGRLGEFVGRWGRRRTRSWTWT"
FT   CDS_pept        987476..988339
FT                   /codon_start=1
FT                   /gene_family="HOG000214294" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639812"
FT                   /gene_name="IAH"
FT                   /orf_name="MICPUN_107325"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO68454.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199C5C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU6"
FT                   /transl_table=1
FT                   /translation="MVASGRRRAFLLFGDSLTQRAFECGGWGARLAHLLSRKADIICRG
FT                   FGAYNTRWCRHVVRHIGSYRDYFSVVTVLLGTNDAALPDVEPVQAVPLDEYVENLDDIL
FT                   KYLRNRSEFVILFSPPSVGELGRLRAQHHKYVADAHDWLDRNNLHSAKYASVAKVVAEN
FT                   RALVCVDMFRLTSVQLFLGENMLIDGIHFTATGHLFLLKSLLHELRAEAHILSAENMRP
FT                   DWPYGPWMQNSAGSWREILTEHELEISHISGDKLSALADAFGIVSVFISAFLFGLSVSC
FT                   RGLATL"
FT   CDS_pept        join(complement(990430..990777),complement(990120..990374),
FT                   complement(989940..990053),complement(989780..989881),
FT                   complement(989513..989720),complement(989399..989430),
FT                   complement(989272..989340),complement(989072..989212),
FT                   complement(988897..989007),complement(988767..988839),
FT                   complement(988689..988705))
FT                   /codon_start=1
FT                   /gene_family="HOG000160386" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639813"
FT                   /gene_name="SKIP"
FT                   /orf_name="MICPUN_55191"
FT                   /product="Gamyb-binding protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="ACO68847.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG627562"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniParc:UPI000199C5C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU7"
FT                   /transl_table=1
FT                   /translation="MKTLAEPQSCAQQIVPVQTSSPAKKAAKKNVVRVPRYSARHGLFP
FT                   RASSHFGDGGAFPEVHVAQYPSAFETGNSDPKKRQGISFSDVSADVLSSCCGPAPSSGV
FT                   SRQTGALQDSLQVADRPSRQETEAVLEKTKAVLVMRVDKNAADQQPKVPGSLPAPEYVK
FT                   YAPCTLSEDLRSSGTCRLIKIHDVARDPLEPPRFRHKKVPRGPGSPAVPVMHSPPRSAS
FT                   SEEQADWKIPPSISNWKNPKGYTIPLDKRLAADGRGLQEVQINDNFAKLSEALYLAEHK
FT                   ARQAVDARAKIREKLLRRDKEVKEEELRKLARHARIERVNTSSLFERSSTRLDEQRLID
FT                   EKDSGAGKVDRAAEKQLRDSLREERKRERGRETRLEVSENNFRKRSKILREGDRDISEQ
FT                   IALGQSKIAFGHAQQTYDQRLFDKDQGLGSGLAGDDAYNLYDQPLFQKGNDDHLVGIAE
FT                   DEKLQMEFKRNDDSIKDPFGLHTILDEVKKA"
FT   CDS_pept        991925..992479
FT                   /codon_start=1
FT                   /gene_family="HOG000163579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639814"
FT                   /orf_name="MICPUN_55192"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68455.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG559170"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI000199C5C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU8"
FT                   /transl_table=1
FT                   /translation="MREAFNSLDESIWFTFWRDFKRAASNTKAVLFVFRENTAQVSTPE
FT                   VSVDWDLWGPLVSVLSFSILLSMSATGTPGVFSVVFSTVVLGSIMLTLNVLLLGGRVIF
FT                   LQALSWIGYCMLPTVVAAGATLASTNKAYRSCLLFSSVAWSSYASVQFVSASVSGKRKE
FT                   LATYPIILLNVSVAVLSLVNI"
FT   CDS_pept        complement(992612..993415)
FT                   /codon_start=1
FT                   /gene_family="HOG000010898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639815"
FT                   /orf_name="MICPUN_113358"
FT                   /product="Cdp-alcohol phosphatidyltransferase "
FT                   /function="CDP-diacylglycerol-glycerol-3-phosphate 3-
FT                   phosphatidyltransferase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68848.1"
FT                   /db_xref="GO:0008444"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG686655"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniParc:UPI000199C5C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDU9"
FT                   /transl_table=1
FT                   /translation="MSCRTGLAKKTSRASSRIRSSGSCIGHCTSRHHNRKPGALSRFLF
FT                   RMAAPRQTVFASSVDSAGPESRDGPTLNIPTALTLIRVAAVPLVTLIFFMRGAWVAPSC
FT                   CTIFICAAITDWADGFLARKLRLVSSFGAFLDPVADKLMVAAALVLLCVHAPPDVGGAF
FT                   IAIPATIIIGREITMSALREWAASAGGDVHDAVAVNSFGKWKTATQLVAISILLGARDG
FT                   FAWLGLSKDAGMLLTKAGSCCLWISAGLALLSMGIYMSGILKYMS"
FT   CDS_pept        join(997093..997464,997541..997661,997883..998133)
FT                   /codon_start=1
FT                   /gene_family="HOG000203818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639816"
FT                   /gene_name="VPS28"
FT                   /orf_name="MICPUN_113355"
FT                   /product="Vacuolar protein sorting-associated protein "
FT                   /protein_id="ACO68456.1"
FT                   /db_xref="HOGENOM:HBG559171"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="UniParc:UPI000199C5C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV0"
FT                   /transl_table=1
FT                   /translation="MDVLLLVDEDPFVSRTERLANLYSLIRSVERLETAYVNSAAHAGA
FT                   YEAACSELITKYKTLRNALVDTVPDVHRFMQVEDSPPAICCNAHDDLLCGVTLFIGCAS
FT                   VFCISSRILSWRISMSARDVFATARHRLQIGMPATVEHRVVHLGEPPSAVSVAECVHNY
FT                   IAKDQVAPYLSDLLTSLYKVRQLPTDFSGTTFVRRWTVQLDKMRASDELGEDEIRQLLY
FT                   DTENSYNAFMRLLGGHEQHVLQHQS"
FT   CDS_pept        join(complement(1001077..1001282),
FT                   complement(998368..1000885))
FT                   /codon_start=1
FT                   /gene_family="HOG000224130" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639817"
FT                   /gene_name="MCM"
FT                   /orf_name="MICPUN_113356"
FT                   /product="ATPase"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68849.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000199C5C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV1"
FT                   /transl_table=1
FT                   /translation="MQTVSSSADDGGEIARIFLAFLNTFSSGELDTDNARYGKLPFRDY
FT                   VEQLSEMCDRNGTTLYVDFKHLVKFDSNLAHDAIQPTFFKYEKYLRRAVREFVLEHRPE
FT                   SARWDRQREKDFWISFVNLPSILRLRELKAEAIGQLVAFSGTVTRTSDVRPELFLGSFR
FT                   CVDCGIDCPNIQQDCRFTTPSNCANTSCTNRDKWTLKREDCTFVDWQRVRVQESGEEVP
FT                   AGSLPRSMEVILRHEAVEEARAGDKMIFTGTLLAVLQGAPANMAGDRTEMGNGKAAHGE
FT                   GKSSLRNLGTRELFYKTVFIANSVINTTGPSATRGGHAHESADPFTHGIGMCGDETSSK
FT                   DVLQSFSREERRNLTLMADDPAIYDKFVRSIVPTVHGHMDIKRAIALMLFGGVHKETNE
FT                   GINLRGDINVLIVGDPSCAKSQFLKYISSFLPRAVYTSGKSSSAAGLTATVAKDIETGE
FT                   YCIEAGALMLADNGVCCIDEFDKMDAKDQAAIHEAMEQQTISLAKAGINATLNARTSIL
FT                   AAANPNGGRYDRSKKLKHNLSLPPAILSRFDLIHVMIDEPDEFRDYDLARHIVSLHQRQ
FT                   DEAMDVDYTLQQLRRYIRFARSVRPKLTPEARQEIVHAYMKLRQGDAQPGSQTAYRITV
FT                   RQLEALIRLSEALARLHCRSDVQPSHVKEARRLLSESIVAVEAGELTLEDVAPLSNIKR
FT                   SNPKVQDENLSAVSLEAVKIVHDHFSRVDGKHACLEGGITLPEPTERNGHHTSSPMETN
FT                   SPISEVRSLMKVPMTIPFNRYQQVRNMLVKHIRQHEVRSKDVDHAEHTTQHGCFAPGMK
FT                   QADLIRWYIDQVAVFEGITDSGKLLDELRVVRCIISRLVTQEGTLVIVQDQSGVEGGDE
FT                   GNGNPSLGSVVPQDERIAQGVDGRILAVNPNYSFED"
FT   CDS_pept        join(complement(1003425..1003757),
FT                   complement(1002223..1003362))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639818"
FT                   /gene_name="BOP5"
FT                   /orf_name="MICPUN_55196"
FT                   /product="Axonemal inner arm I1 intermediate chain dynein
FT                   IC138"
FT                   /protein_id="ACO68850.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C5C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV2"
FT                   /transl_table=1
FT                   /translation="MEHFVNASTQTVKQCSKCKNLSRSPPQSETLSCQSRPLAPLVDGF
FT                   HEEKQYHRPCRRAPLILRPGEIISGQSAWMPIANSQFNRATDVMERFLLQRSLHKGVLA
FT                   FGDFSEKGVGVEHLFDLVSSETSGQNVSCISWSKELPHILVAGHGDTGYHGQQKGLISC
FT                   WSLKNPARATWTAMTTSGVTTVDFSAANPNSLAVGLHDGSVFVVDINTKVRKKESGKTR
FT                   TILGKHGDPVGQVRWVRRKLQNDEILVSISTDGRIIQWDVKRQGEQLELMRLGGVDLGT
FT                   IRTNTAKHVSGGNVHSKGKGICFDFSRDNASVYVVGMENGMLHRCSCSSSEQYLNSYLG
FT                   HRGPVYQVCWSYHSADIFISASADWTIKLWRERSFQPIFTFNNAGEQVSDVCWSPSDST
FT                   AFACSTTQGKLEVWDISISILKPASSLRTGGTISCATLSTKLPAIATGGADGKIRLFCM
FT                   RGGSARGGSASRISKVIDQQSSSFIALFSHDT"
FT   CDS_pept        join(1005498..1005654,1005730..1006196,1006350..1006742)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639819"
FT                   /orf_name="MICPUN_51506"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68457.1"
FT                   /db_xref="UniParc:UPI000199C5CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV3"
FT                   /transl_table=1
FT                   /translation="MLGGTIFASGAAVVDHVLSEQLFQIVEEEVFRLIDIFDAGYELPS
FT                   RANALSSGTFWMPIERAEEPRCAIEYVISKMYSSGELFQRIGVKGMHFSGVEWWFQDVS
FT                   DGEQPKTFHTDCDLQTEVDRDGVLTRKRRNPSIGSVLYLSREGGATVAFGQRRNISIGS
FT                   AALCPRLPQELVVVHPRQNRLFMFDGDLFHAVMHPQHPAIMRGQRVTLLMNWWVDKPYS
FT                   PVAIPKSILTTLELERCSRPETFRPSLKGTARSARSYHGCRKLRTRRNFFEDLNDWQAQ
FT                   KLPQTLGKFGHQRAVLLKYSRELSCEMKRDFRDCGPSIEGDASDWPQWNISKAENPS"
FT   CDS_pept        complement(1006817..1008664)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639820"
FT                   /orf_name="MICPUN_55199"
FT                   /product="Bromodomain-containing protein "
FT                   /protein_id="ACO68851.1"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI000199C5CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV4"
FT                   /transl_table=1
FT                   /translation="MGGLKLTFRLGNRKNVQGEEESNDGFGRCGPNNKERAHCGSSRPE
FT                   TQVAKLRSSPVEQKAKDYHTTSTMASMKKIPEAFVMKGVPKALSAATQAERRNLPLKSG
FT                   REVKITRETPLSFVAGFQTKVSQDPNSKKDSTRHASRSSQQTSAAQKYIAAKDGGTTSG
FT                   KRRRDADAASTLKEKVSNLGEEVDEKVLSDDRIFARVLRTIPSASPPEKSTLNDLIKEL
FT                   QLGDENNIFSTEGTAPEVKTSFQLDFLTLSANVSAGKYIDWDGFIYDMERIFHNALMHI
FT                   PAASTHNKVVARMSLRSKMLIEQARMSAGILGSKHIQVKREGDGVSDIGGKGAIKMRTF
FT                   ASRVTDTFLEEEQEDRTFAHGMTRQEVGGNRVEGSTKRRKFPHFKRCTFSEARCPKQIS
FT                   VILPVSERYASSILASTKLVHPTNFYFQAQLLPESYREQMKRWCLSTRKHTNQVTAGVL
FT                   EETVGYISESVPDIVPPIPPKLPTCSRLKNLAVHGRESRMIPTGNPSVASIDAKATAAE
FT                   NNDTSVPHFATIVETTSQVTALRHAAVIAGRKAQVMANKAVTILSKDNDNQIHEARVNP
FT                   LVTILSKLSLTFTSRAGGLEDIVRAIHANLTQQMLRMKK"
FT   CDS_pept        1011418..1012452
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639821"
FT                   /orf_name="MICPUN_51507"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO68458.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="UniParc:UPI000199C655"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV5"
FT                   /transl_table=1
FT                   /translation="MGKAGRDPSVCVDPGCLIEGTNTLIVQGQDRRIFYVIMRLVKLRS
FT                   LEEVRNMVPAPVPFSLARFLLEQKLRGSDHQNDHDDDIVIQGNSVLSLRCPISGQMCKT
FT                   PARTRNCKSLAIFDLDTFLELNAKVRKWICPHCGSTGQPHDIVIDGYLSRVIGVLRAWE
FT                   QSIPTVFPKIDSIEVGPNGNWRPSSADAVCGAFAETWISSDALSGVVLGHSGSILHIPF
FT                   ELTNIVGNQCRIVDHAVFSSDSTHLGKESKDKALKVGRMVDSDEVVQPSYFAVDPGSHL
FT                   GISELAVSSKMHDVIVISDSDDDRDNADYGPTSKLKHFIAPEGQQSEQVLSSRPTLMFR
FT                   FRRR"
FT   CDS_pept        complement(<1014168..>1015878)
FT                   /codon_start=1
FT                   /gene_family="HOG000243844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639822"
FT                   /orf_name="MICPUN_65906"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO68852.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG616165"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C656"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV6"
FT                   /transl_table=1
FT                   /translation="IDPFKLIPGELVIHRKFGIGRFLGVRSIAMDDCSGKECHSTKECH
FT                   SASTRVGYLFIEYADATAKIRPEKARFQLYRFASPGTIKSGVKIPKLSRIKDRKRWEQR
FT                   ENIARKHIRHLVMGQMSIYLQRLQSVRKPYCPPSEDIYQRFNELFPHDLTPDQALAVQD
FT                   CYEDLTERDTPMDRIIVGDVGFGKTEVAMRAVFRVFSGGGQIFVLAPTTVLAKQHAATM
FT                   TARLRPFGASIDLMTRNVKEAEKKDIIERWLAGRIHVLVGTHSLLNLPSTMYDPLNLLV
FT                   IDEEQRFGVKHKDKISSLKSSVDVLTLSATPIPRTLHMAMAGFRDASLVTTPPPERRPI
FT                   ITRLQVYEQSVVHQAIQYELGRGGQIFYVVPRIQMMNAAKKRLKEIFQDIIILEVHGQM
FT                   KGEYLDHAMDEFASGRAHILLCTTIVESGLDIPNVNTIIVEEVQQFGLASLYQLRGRVG
FT                   RAGRQAYAYMFHAERGGMHNDAQERLLALEECCGLGEGFRLAERDMAIRGVGTLFGEKQ
FT                   SGEMDSIGADLYLEFLYEQLEKIEMLSLNPITPSEVHVPVFPTVPKLTREYVV"
FT   CDS_pept        join(1019130..1019182,1019316..1020336)
FT                   /codon_start=1
FT                   /gene_family="HOG000264342" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639823"
FT                   /orf_name="MICPUN_51511"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68459.1"
FT                   /db_xref="HOGENOM:HBG559176"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000199C657"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV7"
FT                   /transl_table=1
FT                   /translation="MFTKWFAEEGGPLETPAGRVFHEYPHPNNWKELVNELFSRFGSDG
FT                   VEIPLELCPCGKRKATIRRFLVARKYKIDDAEKMLRDTIKWRQSVTIGGVTGVRNIILS
FT                   KPRWDLLSMNRKIIPATPFLCYTKQGFPVYSLRLGKGDGSLATAAPDECHIYCSIVRGE
FT                   HLVNKIFPEAQKLHETKLSRRGITSSLDQTSALTRHENEPYTDDDLDVIDKQIVIVDLD
FT                   GISMSALRCLYVFKLINSVASCNYPELSKAIYVLNSPPVFDYIWSAIKPLLAAHTRNKV
FT                   RIFQMGPEQYGALQEILEDDDIPDYLTPQVNEENVKGRVGCVPDADEPDFRPEGVRDFD
FT                   AWLENSSEALDKTCPFP"
FT   CDS_pept        join(1021929..1022027,1022095..1022604)
FT                   /codon_start=1
FT                   /gene_family="HOG000005870" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639824"
FT                   /orf_name="MICPUN_93018"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="protein import into mitochondrial
FT                   outer membrane"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="ACO68460.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0045040"
FT                   /db_xref="HOGENOM:HBG317717"
FT                   /db_xref="InterPro:IPR010547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C658"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV8"
FT                   /transl_table=1
FT                   /translation="MELPRDELERMIFFEEARQRAELDHKENPLDPQVLTRWGGALLEL
FT                   AHFKQGKEAVEMIELAIAKFQAALDIEPKKHDALWCLGNALTSQGFLFQEAQKACSHFD
FT                   EAKTCFQRALNEEPTNEIYRKALEMTDKAPGLHAELQRQLAEQQIYHEASKNVQKSTKG
FT                   VVLDDRKVTADFWYGVGGWLCFMGVAFSWTLLLARQKAF"
FT   CDS_pept        complement(1022931..1023443)
FT                   /codon_start=1
FT                   /gene_family="HOG000040143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639825"
FT                   /gene_name="RRF"
FT                   /orf_name="MICPUN_77875"
FT                   /product="Ribosomal recyclingfactor "
FT                   /biological_process="translational termination "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68853.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006415"
FT                   /db_xref="HOGENOM:HBG533975"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR015998"
FT                   /db_xref="UniParc:UPI000199C659"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDV9"
FT                   /transl_table=1
FT                   /translation="MEKTIETVREKFNTVRTGRASPKILNRINVDYYGTLAPLITIANA
FT                   STPDSQTIVIQPFDRTIINDIERAIMLSDLGLNPSNDGACIRLSIPPLTAERRQELAKL
FT                   VSKLGEEGKVALRNVRRDAMKSIGKVEGVSEDDVKSLEEAIDTLTSDFVRKVGELVKEK
FT                   EDDIFKV"
FT   CDS_pept        join(complement(1026123..1026125),
FT                   complement(1025366..1025806))
FT                   /codon_start=1
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639826"
FT                   /orf_name="MICPUN_89585"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ACO68854.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG307515"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniParc:UPI000199C65A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW0"
FT                   /transl_table=1
FT                   /translation="MSEEDALIAAAPKKRTFRKFSYRGVDLDQLLDMKTEALVDLFRAR
FT                   IRRRFKRGLTRKPMKLVKKLRKAKKEASGGEKPETVRTHLRNMVIVPEMIGSVVGVYNG
FT                   KVFNTVEIKPEMVGTYLGEYSITYRPVSHGRAGLAGGKFIPLK"
FT   CDS_pept        complement(1026683..1027756)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639827"
FT                   /orf_name="MICPUN_55206"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /protein_id="ACO68855.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG559177"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniParc:UPI000199C65B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW1"
FT                   /transl_table=1
FT                   /translation="MQYFLLHLLLVCLFLGSAAQSVQVMQKADRAHTAAQLFVDGKDVF
FT                   GRDLHCRTCHVLLSNLNARLLPLLKKMKAKEGRRVNGNDAASRRFDYGLYEEVIESYVQ
FT                   GACRMNELWHKRDLRRQCEIILDDHGEEVAFAFTRWLETDMSEEGGPKTTDWSWNWEVC
FT                   YKATHSCSEELSMHSIAEFADDGSGEAERKYRSEPVPPKNSKKYGLFHAVASNFYEVFI
FT                   DNADEDSVVYVAFPKSRRAFHQSLMPALNKVQELFDNNPKTRGWLKIGIVDAELNDIPP
FT                   PYGSGQTQPTLSVYAAGIKNWPRYISDDNEGMLTVHDLLQFFMNTCSKRVSERSRVLLN
FT                   ELSYEILHHRVWDHDEI"
FT   CDS_pept        join(1028990..1029348,1029448..1030057)
FT                   /codon_start=1
FT                   /gene_family="HOG000116528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639828"
FT                   /orf_name="MICPUN_93022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68461.1"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000199C65C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW2"
FT                   /transl_table=1
FT                   /translation="MVRGLSSEDAAIHRYDDTQQIAIQQQKLWLRNPHFFKQVRVSALA
FT                   LFKMTLHCRSGSSLEVMGMLQGKTIGDAFIVLDTFPLPVEGTETRVNAQAEAYEYMVEF
FT                   VQTSRLAGRREYVIGWYHSHPGYGCWMSGIDCSTQMLNQQYTEPFLAIVIDPVRTCATG
FT                   TVEIGSFRTYPPGYNPPISAQPKYQTIPKSKIEDYGVHSSRYYSLSVHFFQTNILSIML
FT                   DALCNRYWSGTIASSPLLSNKPFITGQLLDLKIKMDSADLLIPGKAWDFVTGIGRTRGW
FT                   KTSVKTKARVKCDGARVAVEHAKDAALSIIKSTVFLCTLNR"
FT   CDS_pept        join(complement(1032232..1032342),
FT                   complement(1032076..1032168),complement(1031821..1032010),
FT                   complement(1031683..1031753),complement(1031535..1031617),
FT                   complement(1031378..1031471),complement(1030963..1031319))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639829"
FT                   /orf_name="MICPUN_51519"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68856.1"
FT                   /db_xref="InterPro:IPR009769"
FT                   /db_xref="UniParc:UPI000199C65D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW3"
FT                   /transl_table=1
FT                   /translation="MSLDKSRTTWDSEFINGSVVESVGEFDELVEIKMKNPFTIQNLRL
FT                   KRSWIRDRDGGFTIALANVVDANSSTGEPEGLFAGWKVARITPSRMHDGSALPRSRHTL
FT                   ARPCCLVTEASRIHPCGRQKINFGKMADLEEELLVSRLSALKQFCEYAMDMEANRTRSA
FT                   VDITAAEMVAREHGDSAANKGYRCYAPSSGCAFNLCDSQGKNSVQEGSLGKGKWPFETG
FT                   IKSTNCWCSPDGDGFRVRGSNYLHDGKKVPAGQPLAKLFAVDWFVDYKRMDDVCSRPAG
FT                   TCQRYLLVVDLFRFLFFKNNMALLSREQNVDQTPLLCSLSIYKCRVFAISR"
FT   CDS_pept        join(1033988..1034093,1034229..1034335,1034386..1034454,
FT                   1034523..1034722,1034771..1034931,1034972..1035147,
FT                   1035206..1035253,1035318..1035440,1035475..1035558,
FT                   1035624..1035698,1035869..1036177)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639830"
FT                   /orf_name="MICPUN_55209"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO68462.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000199C65E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW4"
FT                   /transl_table=1
FT                   /translation="MSATAARVCLKSQVIDFPRSTRLSRIKHVAKSICGDEEQPPGYLG
FT                   HLSSVRTGSREELFTLILKSSSVDLKKLRGSLWSGCPSHLRPLCWKISLGYIPPTFQRH
FT                   QETLLRKRAEYHSFSAEYFESNRVMNADELDILDQIQIDIPRTDSLRNLLHNERIKILS
FT                   PLRVIYLFLRAIERVLFIRAIRNPATSYVQGMTDLVTPFFSGAKTSQNNYEVFSSEIQS
FT                   GKSLTRANDETLLDNVEADCYWCLCKVLDTVQDHFTCSQPGIQRVCHRVNELVSRLDRA
FT                   LFEHLAREGVDIFHFAFRWATCLLLREFSGMTSPRAMASYNAFSFPIFFDTYISEGDNL
FT                   SDFLAYLCTALLLRWAEQLKAKKFHDVISFLQQPPSVSWKTTEHVSRPVAKVTASASVG
FT                   MVRVVGDLKTKLIMVCARHSPSENFIHFSRQKLKYVLNVTSKYFATYLNMDLMFEGLCL
FT                   SGKKLLTSNPNSTQILPSDIKTMHAFP"
FT   CDS_pept        join(complement(1036551..1036618),
FT                   complement(1036258..1036492))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639831"
FT                   /orf_name="MICPUN_55210"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68857.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199C65F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW5"
FT                   /transl_table=1
FT                   /translation="MSNEYRLRCDAYAAFDQPFILSRVAEISRRSEVRAAIAIQSHWRA
FT                   FIVRRNVGKLVSACCVMQSGFRGHRGRKRARKLEARVRQNISLLCLARSVITSLP"
FT   CDS_pept        1037177..1038070
FT                   /codon_start=1
FT                   /gene_family="HOG000255132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639832"
FT                   /orf_name="MICPUN_77816"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /protein_id="ACO68463.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG564941"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="UniParc:UPI000199C660"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW6"
FT                   /transl_table=1
FT                   /translation="MAPRRSSAYRVSVGDYAGGPKPAEGTQSSSSGANEATGPHLIESI
FT                   RGYEPPRFLWRTLYTLLLLGLVIKRVLWHRKLNMQQTLQQISRVGPDTLGVSMLTSSFV
FT                   GMVFTIQFCKEFSKVGLTRVIGGLLGLAFTRELTPVICAIVLAGRVGSAVAAELGTMQV
FT                   SEQVDQLRTLGSDPVDYLVAPRVVACAVSLPILSVISFTIGMAASILLADIRYGISPNA
FT                   IVDSAAKYLESFDVGVMCAKGFAFGSVISIISCGWGQTTTGGAKGVGESTTASVVISLV
FT                   AIFVVDFFLSMFFFKK"
FT   CDS_pept        complement(1038512..1038715)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639833"
FT                   /orf_name="MICPUN_55212"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68858.1"
FT                   /db_xref="UniParc:UPI000199C661"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW7"
FT                   /transl_table=1
FT                   /translation="MSLTFGRQRGYHTFSNTDTCFAPIILGRACFFSAWRPVRTASALD
FT                   NWQIRYSAPKMEEVIIRSAHRR"
FT   CDS_pept        1038952..1039464
FT                   /codon_start=1
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639834"
FT                   /gene_name="RLP24"
FT                   /orf_name="MICPUN_107328"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68464.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniParc:UPI000199C662"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW8"
FT                   /transl_table=1
FT                   /translation="MRLEKCWFCSSTIYPGHGICFVRNDSKVFRFCRSKCHKNFKMKRN
FT                   PRKVKWTRAYRVLHGKDASSDSVFQFERRRNRPERYNRHTAQSTLRAMKRVEDVRVRRA
FT                   ERLQLKRLSSKEHGRRHADKYELEQQLHLVRAVAPIPKENVENPRGSEQLKVAVSSSQQ
FT                   DRQASYA"
FT   CDS_pept        complement(1039891..1041177)
FT                   /codon_start=1
FT                   /gene_family="HOG000076274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639835"
FT                   /orf_name="MICPUN_55214"
FT                   /product="Methyltransferase"
FT                   /function="nucleic acid binding"
FT                   /function="protein methyltransferase activity"
FT                   /protein_id="ACO68859.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG732041"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="UniParc:UPI000199C663"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDW9"
FT                   /transl_table=1
FT                   /translation="MALGTCHASAFSWHVLLPRTAARFSSHVSRRSRIHGPLRTMSSSQ
FT                   ASCETPNELRFSRVPLVERSGKHISTTTEVLMWRQWARAHAALKKLDKSGLDDLPSLTS
FT                   LHTEIDWIVGDAIAATRPQVQGQRQSVWAKRVLIQVHEIPPEHDILLRESLPELRFSWL
FT                   KRLRERVPLQYITSTCFWRDLTLVVSPAVLIPRPETELMVEHVKGALTTRPVLCRGPWV
FT                   DLGTGSGALAISVAAEILKTRTLNALEIGCSESKPLVHAVDISSSSVQIARCNISRYDK
FT                   LAEGGKLGVQVHQGSWFEPLELQDIVHDRAGTLAGIISNPPYISSNEMRVLQPEVRYHE
FT                   PWLALESGKSGVEALEVLCKGASRYLLPGGFLLLETGGGDQVTHVVQLLHSFKKGNLRE
FT                   NGGAVPIFENIQIHADHRGFRRFISAWKC"
FT   CDS_pept        complement(1041733..1041969)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639836"
FT                   /orf_name="MICPUN_51525"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68860.1"
FT                   /db_xref="UniParc:UPI000199C664"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX0"
FT                   /transl_table=1
FT                   /translation="MSSDVAPSAKMSRGMVSTSKYTLHKIARLISTYGSTGIPRSSYPH
FT                   QNALQILHRTDTKEPSKKSRSGIRSKAVFETFE"
FT   CDS_pept        join(1042660..1042982,1043037..1043262,1043332..1043395,
FT                   1043484..1043566,1043639..1043722,1043787..1043898,
FT                   1043954..1044009,1044054..1044127,1044194..1044236,
FT                   1044305..1044373,1044431..1044608,1044663..1044734,
FT                   1044803..1044879,1044943..1045101)
FT                   /codon_start=1
FT                   /gene_family="HOG000274727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639837"
FT                   /gene_name="UHPC"
FT                   /orf_name="MICPUN_107330"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68465.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG559184"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199C665"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX1"
FT                   /transl_table=1
FT                   /translation="MIVAQISDIRPKHAGAKFGQAPVKRFRTPLRIVNAADKPARPSLI
FT                   NPPHRSKCRLRTRLRASCPRAIVSMQRRQVLANAASLPLQTFETKSGGYTKSFLLVRMT
FT                   VFLSILLGYACYYLTRNSLTFTAPAMVASPALGLDITSIGVITSIFPLCYGCSKFVSGV
FT                   VGDVLSPSIMLGGGLMATGLVNVAFGASSTLPVFCFLWAGNGILQGFGAPSCAKILTSW
FT                   FAAKERGTYWGMWNIAHNLGGFAAPILAGTAARTLGWNWGLWAPGIIALSVGLLIILTL
FT                   KDSPEARGFSPVEHLEAPETDLQKTIEGAAPEAPPFGMQERNISLLDNLFLNVLSNPFI
FT                   WGLAFTYFCVYVVRQGITSWSVFYLIKEKGVLDAGAAAVRVSGMELGGLFGSLIAGRIS
FT                   DWYIATSPGGAVGKRIQVVMAYLIGVAAMLAAFKAVPSGLPILQAIIVFMIGFFLYGPQ
FT                   MLIGLCGAEIVGRRSVGASEGFLGWIAYLGAANAGVPLSLLVQQYGWNAFFAALLLACA
FT                   AAIVLLAPITGAQSHVQRSMNQ"
FT   CDS_pept        join(complement(1046652..1046743),
FT                   complement(1046455..1046544),complement(1046283..1046367),
FT                   complement(1046124..1046216),complement(1045941..1046064),
FT                   complement(1045826..1045854),complement(1045661..1045765),
FT                   complement(1045537..1045596),complement(1045330..1045470))
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639838"
FT                   /gene_name="CLPP1"
FT                   /orf_name="MICPUN_107331"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68861.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="UniParc:UPI000199C666"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX2"
FT                   /transl_table=1
FT                   /translation="MSFSLPSTRLRPSLRGANTSLYQESRRSAVRTIPAEVVVRAKAFN
FT                   DESLQSTSVQSTSASRQIVAQQSKGPSPIVMERFQGVASQLMNQRIIRLGGAVDDDSCN
FT                   LIVAQLLWLDATDPKKDITLYVNSPGGSVTAGMAVFDTMRHVRPDISTVCVGLAASMGA
FT                   FLLASGQQGKRFSLPNSRIMIHQPLGGAQGQAADIEIQANEIMHHKSTLNGYLAEFTGK
FT                   PLDTVMQDTDRDFFMSAFEAKEYGLIDSVIEHPTDVAVRSSGIPMYAGEL"
FT   CDS_pept        join(1047574..1047579,1047642..1047764,1047820..1047867,
FT                   1047947..1048105)
FT                   /codon_start=1
FT                   /gene_family="HOG000167251" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639839"
FT                   /orf_name="MICPUN_55217"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="ACO68466.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG499936"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniParc:UPI000199C667"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX3"
FT                   /transl_table=1
FT                   /translation="MAYYELYRRSTLGMTLTDALDEMVTTGELTPTIAMKVLAQFDKFM
FT                   NGALKSLKTKLSFKGDLETYRFCDNVWTFMLKNVTFDVSGPGGDKRAASVDRLKIVACD
FT                   GKAVLGV"
FT   CDS_pept        join(complement(1048908..1049271),
FT                   complement(1048640..1048806),complement(1048218..1048559))
FT                   /codon_start=1
FT                   /gene_family="HOG000193685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639840"
FT                   /orf_name="MICPUN_112705"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68862.1"
FT                   /db_xref="HOGENOM:HBG735314"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199C668"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX4"
FT                   /transl_table=1
FT                   /translation="MPSPGASFVSPGESNLAAHLGKGSLFGHGFQVSLSDDVTSNVCGP
FT                   LALVNKLISARPLRSQYLPEIGDVVLGRVSEVLAKRWKVDINIPHDAVLHLSAVHLPDG
FT                   IQRRRNYDDELDMRARYGDRDLISAEVQGCFSDGSVALHTRISAYSRKFNGQHIQVLPT
FT                   LVKRGKRHFCDFQGENYGCTDIEVIYGCNGLIWVGQSSKEAPGRSSFDADTARVDEAHD
FT                   RFSYVQRAVRELICRVANSVRVLAALGMVVDPHNIIDVCQHSTFLGLQPKDMMISSFLN
FT                   HLVRERGLV"
FT   CDS_pept        join(1051283..1051299,1051443..1053051,1053220..1053894)
FT                   /codon_start=1
FT                   /gene_family="HOG000200748" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639841"
FT                   /orf_name="MICPUN_89596"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68467.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG693845"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C6E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX5"
FT                   /transl_table=1
FT                   /translation="MFPYPSGAGLHVGHPEGYTATDIIARYKRMTGHNVLHPMGWDAFG
FT                   LPAEQYAIETGTHPRHTTNTNVGRFREQLKSLGFSYDWEREVATSDSKYYKWTQWIFLQ
FT                   LLERGLAYQAEVPVNWCPALGTVLANEEVIDGLSERGGHPVVRRPMKQWMLRITDYAER
FT                   LLDDLDGLDWPESIKEMQRNWIGRSEGVRLSFRLPGAEEKVEVFTTRPDTLFGVTYLVL
FT                   APEHPLIHTLTSKEQAAAVREYVETSSRKSDLERTDLAKEKTGIFTGAYATHPLTEEEI
FT                   PIWVADYVLGSYGTGAIMAVPAHDERDNEFAAAFELPVIQVVTPPDGDCTCYAGDGFMQ
FT                   NSASEAIDVNGLTNSDAGQRILEWLEENSVGTKTINYKLRDWLFARQRYWGEPFPVVYA
FT                   DNDRDKPVPIPYSDLPLTLPETDNFKPSGTGEGPLANISEWVNTVDPRDGVSAARRDTN
FT                   TMPQWAGSCWYYLRFIDPMNDDAFVDGDLEKYWMPVDLYVGGAEHAVLHLLYARFWHKV
FT                   LYDIGAVSTKEPFQRLVSQGMILGEMSKSRGNVVNPDEIVRDFGADSLRLYEMFMGPLR
FT                   ETKVWQTKGVEGCSRFLARAYRLFDSYTDETPSDDQLRVIHRCIAKVTEETENMRFNTA
FT                   IAAMMEFTNAATKWERRPKVILESFALLLGPYAPHLSEELWERLGNQSTNAYETWPVAN
FT                   TKYLMDDNVTLAVQVNGKMRGRIELGMDSPKEDALAMAMQQDNISRFVPDKTAIQKVVY
FT                   VPGKVLNIVAQPL"
FT   CDS_pept        join(1058086..1058137,1058206..1058978)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639842"
FT                   /orf_name="MICPUN_55221"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68468.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199C6E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX6"
FT                   /transl_table=1
FT                   /translation="MSSPTDQRSAVHYVTGMKFSSREGQKLCVARVAPSLPNLRESIAS
FT                   FTALPSAFGVSVILQFSIELFDLFYKKSQSFPSGKLKRVLHKLSRQTDCFLVPGWSCDP
FT                   MYLQMMHCARNPHIQCVGRYNVDMGTRQSVHKVARQKGVSSGRTYTSKYRGVHQTFPTR
FT                   RWEAQFRRNGKPTSLGCFDYEDEAARAYDRMMVWCELHGQDSRGGKVGAHRSHIAQLSL
FT                   NFDYNDYEGDLIALRHVSQDDLVQSLRRQGRMQASNNTGGSFSGASTHKKLP"
FT   CDS_pept        join(complement(1061627..1061658),
FT                   complement(1061465..1061541),complement(1060663..1060946),
FT                   complement(1060287..1060593),complement(1059454..1060241))
FT                   /codon_start=1
FT                   /gene_family="HOG000136704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639843"
FT                   /orf_name="MICPUN_55222"
FT                   /product="Predicted protein"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="ACO68863.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C6E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX7"
FT                   /transl_table=1
FT                   /translation="MEHPYKFSTMWTTGSVAQPEVFFNEQGPQLAQPQRLAVPTQQFRS
FT                   RSLSFSFSCNQPIRKASAIKVSAVASDADEIALLEKMLKLARERKEKETIPATPTSGEY
FT                   DGKGFTIKTFNAISPVGLDKYPRGKYILDDVPPTVRAIVRCGAGTNNIPVKEMTERGIP
FT                   VFNTPGANANAVKELVICGLLLASRGIVEGNFHVNNVINKEENGDYDRISKRIETDKAM
FT                   FGGQEIQGKTIALGLGMKVIGYDPVLSLEAALQLPGDRMKRVTELDELFAEADYITVHV
FT                   PYIKGVTHHLINSEALAKCKPNVHLLNFARGEIIDGAAVKSGYDNGALTGKYISDFSDP
FT                   DLMGHPQHIVLPHLGASTEEAEENSAAMAAATMMDFLETGTIRNSVNFPTTILAPQKNS
FT                   SGARLCIVNRNEPGALGEITTFLGSKGLNISQQINTSRGDIAYTVIDFTNQPEDAEALQ
FT                   VELAAACNFIISLRFLGMVFNDELGEPGTYFYVSWAQ"
FT   CDS_pept        join(complement(1064191..1064197),
FT                   complement(1064047..1064060),complement(1063831..1063968),
FT                   complement(1063658..1063774),complement(1063501..1063551),
FT                   complement(1063325..1063430),complement(1063117..1063247),
FT                   complement(1063048..1063056))
FT                   /codon_start=1
FT                   /gene_family="HOG000257095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639844"
FT                   /gene_name="DUF667"
FT                   /orf_name="MICPUN_89606"
FT                   /product="Duf667-containing protein "
FT                   /protein_id="ACO68864.1"
FT                   /db_xref="HOGENOM:HBG317430"
FT                   /db_xref="InterPro:IPR007714"
FT                   /db_xref="UniParc:UPI000199C6E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX8"
FT                   /transl_table=1
FT                   /translation="MFKNTFQSGFLSILYSIGSQPLQIWDKKCRNGHIRRITDKDIQSS
FT                   VLEIMGTNVSTIFIACPGDEKQTLGIKLPFLVMIIKNLKKYFSFEVQVLDDKNVRRRFR
FT                   ASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIR
FT                   RIYFSDRLYTEEELPQEFKLFLPIQKS"
FT   CDS_pept        join(1065230..1065390,1065820..1066345)
FT                   /codon_start=1
FT                   /gene_family="HOG000223754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639845"
FT                   /orf_name="MICPUN_93045"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO68469.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG512729"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="UniParc:UPI000199C6E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDX9"
FT                   /transl_table=1
FT                   /translation="MARRPAKCYRVIKNKPYPKSRYCRGVPDPKIRIYDAGMKKYSVDA
FT                   FPTCVHLVSFEKEQVSSEAMEAGRIAANKYMVKNAGKDQFHLRVRLHPFHCLRINKMLS
FT                   CAGADRLQTGMRGAFGKVQGTAARIAIGQIMLSIRTKDVHGAKAVEAFRRAKFKFPGRQ
FT                   KIVTSRQWGFTKFTREDYVAWKQEGRIQPDGVNAKLYENHGRLEARPTGTLFLQPARVY
FT                   KDRVGA"
FT   CDS_pept        complement(1067490..1068791)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639846"
FT                   /orf_name="MICPUN_55225"
FT                   /product="Bromodomain-containing protein "
FT                   /protein_id="ACO68865.1"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI000199C6E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY0"
FT                   /transl_table=1
FT                   /translation="MYNKNRLIRMYQRFGAQLQVNTMMKDLLGVVEADCLEPTHNKQTF
FT                   NTTDIAYSKCQKYIEKCMNDYYFGVQNVRLAGIGTGMKRALSARRKTQNGAKKHEKMKP
FT                   ANKRRKQTALRDGDEEESRHGRGFDVDTQRIVSSSTPNKSLDPFPKILRKLMNNRLSWP
FT                   FNEPVDAEYWGVQDYYEVIKTPMDFGTIATKYDIGDYNTENSGHGALKFVTDVRQVFYN
FT                   AWTYNQPGHQVYQYAQILARIFETELSKSVGIDDKWGLLSGSTMGMTLGNQEKIDKENA
FT                   DMNSVKIAEEKGFADGSLNKNEDMRRGEIKTAQDDVRSQEYILNRDAIKFMAETCAARA
FT                   VAEANEARDNALAKLQEERVAREAFEAELEAQTRTLFQTARHEEQARYHRFEVERETLM
FT                   TCLSDSNNMKKLLQDRIETLEAEIVMLKNKSRSH"
FT   CDS_pept        join(1070766..1070972,1071065..1071120,1071222..1072125)
FT                   /codon_start=1
FT                   /gene_family="HOG000013357" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639847"
FT                   /orf_name="MICPUN_51542"
FT                   /product="Predicted protein"
FT                   /function="NAD or NADH binding"
FT                   /function="NADP or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO68470.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C6E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY1"
FT                   /transl_table=1
FT                   /translation="MQLIYLPQSLDARSSYGVRAFRSHFARPVVFVPRRPRLPLLSVKA
FT                   AKDPSGPKVAIAGISGAVGQEFIRVLTERNFPYSEIKMLASSRSAGKEVEFDGETYVIE
FT                   ELTEDSFDGVDISLFSAGGSISKKFAPIAAAKGCFVVDNSSAFRMADGVPLVIPEVNPE
FT                   AMADYKLGKKKGGIIANPNCSTIIALMAVTPIHRAVGVKRMIASTYQAASGAGALAMAE
FT                   LEQQTRDVLNNDPVTMNIFSWQYAFNLFSHNSPMTENGYNEEEMKMVKETAKIWGTDAV
FT                   SIAATCIRVPVMRAHAESINLTLCSELDEQDAKAILSKAPGISIIDDRANNRFPTPLDA
FT                   SNKDDVFVGRIRQDISQPGKSGLEIFVCGDQIKKGAALNAVQIAELIL"
FT   CDS_pept        join(complement(1074180..1074529),
FT                   complement(1072963..1074058))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639848"
FT                   /orf_name="MICPUN_55230"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO68866.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI000199C6E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY2"
FT                   /transl_table=1
FT                   /translation="MVDGKALRRFCMMATVGFPQIQSQTPTESYRKRISSCICDSRSGR
FT                   KNVNPGDVLVRRFHLEDSSRRLRGSVRGRHLVARRSGYPANSTGGSDVDNELSSIKNLG
FT                   LQEIGVDVDGLSSDVGIVDSTETLSLHREFSIPGSVRVTDGRCGIPKVNLTHPGGSFCD
FT                   VYLRGGNILSWVLANGGEVFYTPDGTDLASDALSDWGTSLCFPQYGGEHQLAGTPPGKK
FT                   LLPTDGLTKTANWTIAQTGLYEDTEGEYPYVIIETADSEATRAVWNNGFHIVMEIALHH
FT                   SALDISLTVKNTGDRRLKYSFALKNHIAVADIEDPSANYVGFNDCLYIDSKLHESKSRV
FT                   RFSKQLNKQGPLHLKKAIDRVYFQTQNDTGVDTGTGCTVYVRNLCSAEEDGFLDRAIFN
FT                   PWKEQDPVNYRWYAGLAIGAIGEPIKVDAGMTRTHQTRIEVHDVSSIVPVTERMNAYNN
FT                   YSVLNMASHKSNSPDDNLPHDFQ"
FT   CDS_pept        1076982..1078832
FT                   /codon_start=1
FT                   /gene_family="HOG000264340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639849"
FT                   /orf_name="MICPUN_55231"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68471.1"
FT                   /db_xref="HOGENOM:HBG559190"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199C6E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY3"
FT                   /transl_table=1
FT                   /translation="MVTARVLQKSSPGPPSAEKPTRAFRAEDDIMVENESESLPRIEAF
FT                   ATRPVTTRSGFLDTPSSDSKSEFAYTGGTLERVVFITPAFISILMISFVTLWGARLSRA
FT                   LTVTFICCYISYGWVKGIHSALFALFVGIPRCHAYKKANWRELAKRAEHQSPILQRTFG
FT                   PHGPMFKLRKSDSQPGNDASDGRKVKEGLTARFDSIVHVCVIPTYKEPLGTLRKTIDTL
FT                   RSQTCAREKLIVCIATESRDRDAPEKVRALLAEFGDSLLGFFYTSHVLNPGEAVGKSSN
FT                   TAWAVRCVKHQLVDVWGFDLEDVLLTICDADTYFDPQFMDCLAYHHVQDPTPYNTTYQG
FT                   AECFFPNIWAVPIIVRIKALIDSVGFLGQLSSPFSHPFPFAIYSQSLRTAVDCGYWDVD
FT                   IIPEDWHHFLKCWFRRNGNFRVVPIFLFMGNDAIEDDNWLAANRARYTQAKRHAWGAID
FT                   LAYIVCQYVSRRHNIPFHKVYKLFVHAAEHHISWTLYWITVMLGSLVSTLVNPELDTFP
FT                   FGIGLRKLAVLCFLPMTFATTMFMIGDFYIRLFLVNDRSHFEANAAPMWWQALSQIQWL
FT                   LMPVADLFFGSLAGLDAQLHMAFQPTMKYEVSTKVAKVLK"
FT   CDS_pept        join(complement(1084305..1084360),
FT                   complement(1084159..1084222),complement(1083901..1084059),
FT                   complement(1083746..1083841),complement(1083468..1083677),
FT                   complement(1083325..1083405),complement(1083114..1083269),
FT                   complement(1083015..1083056),complement(1082872..1082924),
FT                   complement(1082762..1082780),complement(1082661..1082704),
FT                   complement(1082433..1082595),complement(1082263..1082398),
FT                   complement(1082151..1082209),complement(1082068..1082097),
FT                   complement(1081923..1082009),complement(1081799..1081852),
FT                   complement(1081684..1081741),complement(1081491..1081621),
FT                   complement(1081412..1081428),complement(1081288..1081357),
FT                   complement(1081114..1081221),complement(1080978..1081052),
FT                   complement(1080855..1080923))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639850"
FT                   /gene_name="COG4"
FT                   /orf_name="MICPUN_107332"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68867.1"
FT                   /db_xref="UniParc:UPI000199C6EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY4"
FT                   /transl_table=1
FT                   /translation="MNADSLFLEETMDVGAINRLLHEAAHSHRALAMRLLRASHVGQFV
FT                   AGAAHDESDGTRDEADGAHYKANIIHVESLRLLAKIITQTSRSTIIATAQELCTERQNI
FT                   SAAQMTVNHNVRTASTCSAMMECLHRNEYEATVQHAHTLQSMNHYSEALKISVNDIETQ
FT                   HLYTRVRLSISEVTKRLKENLDVAIARGDEDSVLRFAKLFATLGLPDQGLKSIDRVVVM
FT                   RACAQKGNDVQIKHQIFNMLDTLFDYFECNWRDILATFGLRALNALVVSVHEACESHTE
FT                   SMLATHLQNFDNANESGVEDQLGFSNIENVIVEMVEVITRLAEYRSYIEEFCRSIDKVS
FT                   ASGDTNCTHQRKIAMIFSRILSKFERTYSDLEVRQVQSEKKTRLLGNNYQILIPTKKGI
FT                   LGLKNLDAFVDDFFFLTMSSINRAVHVGYQECTILLLNLFREAALRHVSLDDELNNKIK
FT                   PMEERMWRLRFLHIFLSNLFEVIDFVKHLKRNDKSQAYVGLPDLEELSKVLQEKLLIER
FT                   DLYMKGLFSYFDATFDCLASTNYVMSEEDMKWKSARKSWSAGLIDRMHEAFDMERVFSS
FT                   ELNEIISDPIITHIARRIEENVFNRLQFNHLGAILFEGEIRKITVALTKMFPNSKVREI
FT                   FSRVLSISTVLNAETYEGFFNDINSNFFLHFELEKLASLRNDL"
FT   CDS_pept        1085161..1086276
FT                   /codon_start=1
FT                   /gene_family="HOG000198068" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639851"
FT                   /orf_name="MICPUN_51552"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68472.1"
FT                   /db_xref="HOGENOM:HBG559192"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniParc:UPI000199C6EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY5"
FT                   /transl_table=1
FT                   /translation="MSSRQDDRTTQCKRTTRRLVTLIGVLAAGNFFSYLLFFILWQPSQ
FT                   FVEVRGTSSSIGFLPYVKDSMLSLSTIDSNIEWRQPYLHEDVLARQLGDLDSDTPFPIF
FT                   RGDPDLYTYEVLRKFPHDPSAFTQGLLFRPPDTLFESTGAFGGPSTLREVDLVTGTVRK
FT                   QVELPGIYFAEGLTYHDDKLLQIFWRNNTGIYYDPKTFKSLGTFQTPLSDGWGISVVDD
FT                   SLVVSDSSTELHFIQPSTKDEGTLRLLHSKTIRDGNTKIRFANELETVKGEIWANVLER
FT                   ECVMRINSKTGEVVGWINLSGLSHNLDRGTLRPGVLNGIAYDAEGDRIFLTGKNWANLF
FT                   QVRIIRENRTSLDTVRHICHPANSLPQYGYP"
FT   CDS_pept        join(complement(1086708..1086756),
FT                   complement(1086608..1086652),complement(<1086428..1086555))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639852"
FT                   /gene_name="GRP1"
FT                   /orf_name="MICPUN_107333"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68868.1"
FT                   /db_xref="UniParc:UPI000199C6EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY6"
FT                   /transl_table=1
FT                   /translation="MTVASSRAIQGRGVGIGLGVGCGFGVGWGFGGGNLGCLGLGVGGG
FT                   CGIGIGVGWGFGVGWGSKYINQHFVFRET"
FT   CDS_pept        join(1088843..1088953,1089034..1089162,1089284..1090315)
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639853"
FT                   /gene_name="SCS-beta"
FT                   /orf_name="MICPUN_104715"
FT                   /product="Succinate-coa ligase"
FT                   /function="ATP binding"
FT                   /function="ligase activity"
FT                   /protein_id="ACO68473.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI000199C6ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY7"
FT                   /transl_table=1
FT                   /translation="MFRIAFRAACHRYSPATFLFGAAVRLQNRQLNIHEYQGAEILARH
FT                   GVRVPLGIACQTADQVHAAAEKLRSDDGDVVLKSQILAGGRGLGHFKNGLQGGVHIVPS
FT                   GKAQAVGEKMLGQLLVTKQTGAAGKPVNTVLVAQKMKLVNEMYFAILLDRASAGPLVIA
FT                   CSEGGTSIEDLAETHPEKITRMKIDIRTGLTEAQARDIVAHLGVKGSVSDAVAQVKALY
FT                   NVFISSDCTMLEINPLAETAEAKLIAADAKLNFDDNAEYRQKGLFALRDHSQEDPREVT
FT                   AGKFDLNYIGLDGNIGCMVNGAGLAMATMDIISLHGAAPANFLDVGGNASEQQVVEAFK
FT                   ILTSDTKVQALLVNIFGGIMKCDVIASGIVSAAKQVGLQVPLVVRLEGTNVEAGKEILE
FT                   KSGMDIIAANDLDDAAKKAVSALS"
FT   CDS_pept        1091664..1093160
FT                   /codon_start=1
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639854"
FT                   /orf_name="MICPUN_77518"
FT                   /product="Predicted protein"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="ACO68474.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="HOGENOM:HBG724395"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI000199C6EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY8"
FT                   /transl_table=1
FT                   /translation="MVYAGPGNARQPGDNLGKYSLVMKFGGSSIASSQRMREVAEIVIT
FT                   VQDDLPVVVLSAMGRTTNNLLDAGELALKCDNSDEVANLEPIVEIRACHISAMHELNID
FT                   SDTFQEVCKLLDKMEQLCTGIALMQECTGRTRATLVSFGERMSSRIFSSYLRSLGLRSR
FT                   QFDAFDELGFITSDQFENGVIREQTYSNVKAALTRRSDEPASIAVVTGFLGRGEKTGAI
FT                   TTLGRGGSDLTATVIGSALNVPEVQVWKDVDGVLSADPREVEGTIPLTFLSFHEATELA
FT                   YFGAQVLHPQSMRPAMDSDSLCVRVKNSYNIEAPGTLIGHVRSTRDSDWILTAIVRKKN
FT                   VTLLDVVSTRMLGQYGFLARVFAVMEKARISVDCIATSEVSVSLTLDPAKLWSRDLVKE
FT                   ELEALVRDFENNGIARVSYTTGNSLVSLIGNVERNNEIMERSFRALGSAGIRVKMVSQG
FT                   ASKTNISLLVSESQGAQAVRAIHAEFFRARQLSEDQNKSK"
FT   CDS_pept        join(complement(1095398..1096316),
FT                   complement(1094514..1095274))
FT                   /codon_start=1
FT                   /gene_family="HOG000264659" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639855"
FT                   /orf_name="MICPUN_93055"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68869.1"
FT                   /db_xref="HOGENOM:HBG559193"
FT                   /db_xref="UniParc:UPI000199C772"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDY9"
FT                   /transl_table=1
FT                   /translation="MTENEDAFDPVIVSAGVVAIAIVGFLAFQRKTVKRHVDAGSPDSL
FT                   QLGCPPANGFSASRIGGAGNDFSSSSRRGPDEDLPVGNISFEGLPIITDDAASFSTPPP
FT                   REIHGEFKRQLRDMMSEMRRYNTVDFHGRNLGDNGSAYISEALAFNDVATCIDLSANGM
FT                   GEAGVFAICEALKSNSALEMLSLASNNLQDAGAVALANYLQSDSSINTLNLNSCGISDT
FT                   GAIALAEMLKKNTSLVALELNNNNIDYEGTCAIAEALSENATLTTLSISGNYIGGLGAS
FT                   ALAKGLVKNKGLKGLIINGNDIGNIGVEALCKAISARETKLTNLDMGNNGIGHESGEYI
FT                   AAYIKTDKELASLNLYMNELCDLGAIAVCNALRQNTAIQILDIGGNNILQAGAESLGDA
FT                   LKENISLRTLEIGYNPIGPKGGAALADAFKFHSKLTTLRMGWCKITKEGARHIADAMKY
FT                   NEHVTTLDLRGNELGDEGCAAIAQSLGMVNENLTSLDLGYNEIKDNGAFALAQAIKNNA
FT                   DASITSISLNNNYITKFGEVALTEAVELVQELNPGRDLYIQL"
FT   CDS_pept        join(1098267..1098596,1098649..1100493,1100588..1100866)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639856"
FT                   /orf_name="MICPUN_55237"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68475.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C773"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ0"
FT                   /transl_table=1
FT                   /translation="MFLEAGSHDCFALDRFGHVPHSDVNSWLSLRQKQMDELRTCHREQ
FT                   FLSLRSKIRSLEIEAGIASDANPFLRERQQMLLTSKKYGEAYEQLKVITDIVLSNFELL
FT                   SNDFFGKNALLVHRKTQRSSTERSIKRLLEQHIQQEEHFHKLFESELNSLELKKTRAPQ
FT                   SQLSHKHGSEKHVDAKEPLPKSIFEDVPNDQEVGGGEFRGAHYSEEHGNGTTAPNLREE
FT                   PSINAHMDQRLTVNRAGYALFDGKTRPAFSPSLPVDCKPTSGPQLMASAPNCRGGPSAF
FT                   RYKLHDLADKLYRTESSLSPRRVLRKCSRVDDEFGQAHDDSDDFSARAVNDPNKSESSL
FT                   YISNGLRKIPGCWQIPCVYPQSTSEPRCSDGDHGSTSVGRLENAAEALLSAASALLGSR
FT                   VTGTNISTAVNESIQGKPKFGRASLEDDTFEIDPVSKTNPDSRFQTRRSHPLVSEIDPG
FT                   VHNACAKTLGFKVSKSSPDIFSEDISGDDVLALPTSCPVSTCTVPRLEMKKLSFVAESP
FT                   DLATGSADHVLLDKNDRGLEHLNRTQRSLPRSTQITERRSAKETKYVFGGDSPTPAGPN
FT                   GRAPAARLLIDRARPSAENTEHRKCQTDPWGQSKGSHIPENQKSQDAASNEADLQPDSP
FT                   QARIPCLLDFRTSYLPHLYLSMIHSNTDKYLFIYTSSRFKRSTIQAIQDRPESAQLSIP
FT                   CSRHLMQIVGSPQKIFATFFHMLDMGSTSRSVVELLKGGCPAEGRDQFGNTPLIIACQN
FT                   GNARIVKALIRHGALINSQNKQGCTGLHYCIAYGFNALSDYLISKGANDKILNKLGLSP
FT                   YEGIK"
FT   CDS_pept        complement(1100981..1102423)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639857"
FT                   /orf_name="MICPUN_55238"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO68870.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG559195"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C774"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ1"
FT                   /transl_table=1
FT                   /translation="MWNALRCHEIKVVTFLKTIPGHFTLNDAVSNDMPLLDIPSLAKDI
FT                   CDTLVYLHGAGFAHRDIKSNNVLLTWCPERQRICAKLCDFGSAAPVNKLPRRPAKPKWG
FT                   GFERLLGLSGSWRPIGTMLWMAPEMLEPPVEGSIPPEGYSGEKVDIYSLGVVLWELFEW
FT                   RTPWTEESAFSRKEIIDLIVRREKRLPIPGHSVPKLARLMSLMWASRPLDRPSAREVLS
FT                   TLESVGSSWDMLDTFLDVQELAHIHGKAIMGALERSSVTQDERREENVEQDSYPRGIPN
FT                   ISHSEESSHSSGMVRYPKQMDKLSRRVEKADEIQRNREGLVLKEMTELGTSASMNPEHA
FT                   MESEFNPTEHAIFIESVGSLSLSDLNEDLARMLFRHVQFLTSDEMIVEELETLRSKIAD
FT                   LQSSVGELQSRTKFDPLAAFTADARHKEIKKLTNTIELITAEEKVKVWRNTRGILRQQL
FT                   VQAESEYNRWQRKCRSIERDGK"
FT   CDS_pept        complement(1102892..1103158)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639858"
FT                   /orf_name="MICPUN_51565"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68871.1"
FT                   /db_xref="UniParc:UPI000199C775"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ2"
FT                   /transl_table=1
FT                   /translation="MTASSMLDVRSMARGCLQLRVLSSVHRYAPCVASIRTPHNNLRPC
FT                   KLSRRFGSRVVQSSLQEGRLNVRDIDEEQLAIRLQGLEHHAGR"
FT   CDS_pept        1103907..1104692
FT                   /codon_start=1
FT                   /gene_family="HOG000244007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639859"
FT                   /gene_name="TL30"
FT                   /orf_name="MICPUN_107334"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO68476.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="HOGENOM:HBG589691"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199C776"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ3"
FT                   /transl_table=1
FT                   /translation="MLSLQIPSIPMPTAFRHLQGRQTCRVYNAGAKTNLEPKNVSRRHF
FT                   GGAISLAGTIFSLTADPTVQPASAVMGMTAGRVPGLSPANADGVRHYTRPEGKSGGHGV
FT                   GWTEITPYSFDVYDGWEEVPVSIADPGGTEIDARFSSEQDGGLKVVLAPVLRFANIDEG
FT                   LNPTIEELIPLERFMAGFGPELTQSPVEEVDIIDKFVEKRGVLTYYNFELRDHTLVAAT
FT                   VWKKRVFIICIKASARQWRNSAEKLRNTMKSFNILTELA"
FT   CDS_pept        complement(1104739..1106115)
FT                   /codon_start=1
FT                   /gene_family="HOG000198003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639860"
FT                   /orf_name="MICPUN_51566"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68872.1"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI000199C777"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ4"
FT                   /transl_table=1
FT                   /translation="MQPPVDDFAAFRDTEIDVPLPGEVPASVVAPAPEAASRDLLKTLF
FT                   GEDDDDPSNQISASLNVRNTSPSFAKSFAGKRKFTRPLSAASDDRSVGVINASKNSEAP
FT                   DSQKDCNQQRASNDSIHRDRNKQNFRRSFNERGYPDCVDVDRDDASALTPDSPFASEAE
FT                   EDCEDINMIFGSSGARSTRKERSEHEVRDHVNTFLARMEVATEQDRECIKKKQPAIFKL
FT                   RMLQEVKETLKNVDMHDHLLRHGLMKVLANWLALLPDHNLPNATIRTAVIDVISALPIE
FT                   TDLVDRKEQLKSSGLGQIIMFLSQLPEETQANRNKCQKLVEKWSRPVYELTSHYGDLRR
FT                   REEECLGEEKFHESDATTSKNKECATEDPDVVRNTTLGLKHGEFGFRHHALVPEPEAMD
FT                   YILRPKLLSDPNDIKARTQNADQQRVRKLVGKVVKRKDGVKNGKAHLPSIEGRGMVTYH
FT                   "
FT   CDS_pept        1106761..1107717
FT                   /codon_start=1
FT                   /gene_family="HOG000264781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639861"
FT                   /orf_name="MICPUN_77396"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68477.1"
FT                   /db_xref="HOGENOM:HBG738639"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199C778"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ5"
FT                   /transl_table=1
FT                   /translation="MSALTFFDGAISREIAGHKKKVHCVAWNLSGRRLASGSVDQSARV
FT                   WDVEHGTCLGKELELKGHSDSVDQVCWDPTSGDRLATVSGDKSLRAWDVRSGSNCVAAI
FT                   NTSGENINLAWHPDGVTIAIGDREDLVSFVDTRKLRVVSVRKFPFEVNEMRWSPDGDIL
FT                   WVTTGTGTVEVHAWPSSRKMLSMKAHTAGCYAIDVDPLGRKLAVGGADTLVSMWDTEEY
FT                   TCLYTVARSGKPVRVVRFSMGGDFIATGSEEHFIDIADSQTGACAAKLSTGAATNSLAW
FT                   SPSEHILAYVGDAQPGKIDRHARTSIRIWGVPSGAMA"
FT   CDS_pept        join(complement(1109711..1109874),
FT                   complement(1109581..1109656),complement(1109349..1109529),
FT                   complement(1109130..1109293),complement(1108959..1109057),
FT                   complement(1108774..1108884),complement(1108472..1108716),
FT                   complement(1108281..1108380),complement(1108105..1108219),
FT                   complement(1107828..1108039))
FT                   /codon_start=1
FT                   /gene_family="HOG000239591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639862"
FT                   /gene_name="MGDA"
FT                   /orf_name="MICPUN_107335"
FT                   /product="Glycosyltransferase family 28 protein "
FT                   /function="carbohydrate binding"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="glycolipid biosynthetic process "
FT                   /biological_process="lipid glycosylation"
FT                   /protein_id="ACO68873.1"
FT                   /db_xref="GO:0009247"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG601852"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniParc:UPI000199C779"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ6"
FT                   /transl_table=1
FT                   /translation="MESPPFALTLDCLLAPSPARRAWPNLSSTPTRSIIFASYAPDTKS
FT                   NSGRVHKPAELGRTNYFEMSTMLVGSEMSIRHLVQDAGQGNPAVPNYGYVPQRPIDRVG
FT                   MSSTQDRKRVMCLMSDTGGGHRASAQALKDGFEVLYGNYFDINVVDLWSSSSPWPLCNM
FT                   PKSYFFLVKNPWLWRMSFRCSEPEVLHEALFTGYTAIVGRRFAQAFEDYKPHLIVSVHP
FT                   LMQHVPLKVLSRMKAAVSFTAAKVPFTTVVTDLTRCHRTWFHKDVDKCFVATQLVAAQA
FT                   MNAGLTSNQLSCHGLPIRPAFNLPSKPKDEICDQLGIDSAAPTVMLIGGGEGMGKLEAT
FT                   AEALAKTLSSSHQLIIICGRNIKLAEKLSSRAWPLRVLVKGFVNNMSEYMLACDCIITK
FT                   AGPGTIAEALICGRPILLNGFIPCQEEGNVSFVLDNGVGSYSEMPEEMADIVADWFRGD
FT                   RQELINMSRRAKLLGRPEATFDIVRELSGM"
FT   CDS_pept        join(1111625..1111726,1111781..1111979,1112147..1112234,
FT                   1112294..1112467,1112525..1112590,1112675..1112795,
FT                   1112846..1112950,1113001..1113114)
FT                   /codon_start=1
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639863"
FT                   /orf_name="MICPUN_93062"
FT                   /product="Predicted protein"
FT                   /function="phosphatase activator activity"
FT                   /protein_id="ACO68478.1"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI000199C77A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ7"
FT                   /transl_table=1
FT                   /translation="MSDFVMPQKLVKRPADMRAFEVSQAARRLIHFIQSLNLAARCSTL
FT                   STETHPRSAVTIERLIAVLCVVECWAVDFPPKKQLSRFGNASFRDWHRRLTISSHDLCY
FT                   DMLFLSLFGRYSTAAVTELAPYFLQGFGNASRVDYGTGHETMFVCFLLCLEAIGLLNKS
FT                   DHRVIVTRVFSKYLSVVRMLQTKYWLEPAGSRGAWGLDDYCFLPFYWGSSQLVHHDAIT
FT                   PASIHDDRVVQENANEFLYLDSLLFIKTVKRGSISETSPLLFDISGVMSWEKVNRGLLK
FT                   MYQVVECLGKFPIAQHFLFGTILRMDPASEGEHVSNRAPLA"
FT   CDS_pept        join(complement(1115498..1115523),
FT                   complement(1115231..1115390),complement(1114707..1115168))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639864"
FT                   /orf_name="MICPUN_51571"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cis-Golgi network"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO68874.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR007265"
FT                   /db_xref="UniParc:UPI000199C77B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ8"
FT                   /transl_table=1
FT                   /translation="MGAIRLHLGFLKFRSNVIRRKSTKVASKKQRLRDIASIIRKRLRC
FT                   FSNLNVASRSLSACISQVDSRDFVDILKILEACSTFIDAHAEYADYTAQSIKCEQLQVR
FT                   ALSAVRARVVAVVCEAALLPLGDLGDFKIAFTEAKNLNGSFLNAKFRSELSSLRHIIDY
FT                   IDARGKRDVTPRNQNIYTRVIIDCCSTYCEQRISLILDPIRTQLLVSYTPHE"
FT   CDS_pept        join(1117145..1117201,1117254..1117309,1117370..1117466,
FT                   1117525..1117626,1117697..1117744,1117808..1118056)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639865"
FT                   /orf_name="MICPUN_51572"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68479.1"
FT                   /db_xref="UniParc:UPI000199C77C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FDZ9"
FT                   /transl_table=1
FT                   /translation="MMTGLHEPSPANDLSAIRVRARRNARDAMLSFVQNPNRGSSNSKQ
FT                   AAQLLTRRKIKRNSRTSQISSHEFNELVVALSSWHAICIRRRRVNVHRAILSPVTKSVM
FT                   IPGEWKSCVLLDTFGKGTKFFHSSKFLTPRKFGALQWYSQQVVDHEIETAKSSQMCSTG
FT                   CKCFSLRPLFGLSMSEKFIYGKKLFGSTGGCQVQDSHAE"
FT   CDS_pept        join(1122083..1122198,1122405..1122687,1122881..1123123)
FT                   /codon_start=1
FT                   /gene_family="HOG000239964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639866"
FT                   /gene_name="ATPG"
FT                   /orf_name="MICPUN_104717"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="ACO68480.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG708402"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniParc:UPI000199C77D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE00"
FT                   /transl_table=1
FT                   /translation="MTTISAIRCRFDTGTKFIAARRNVRARATIPKTPRAAFSSNNKSE
FT                   LSKVVKPTVATILTNAVIVLPSLAGEPGKIFDFNLTLPIIASEFLLLMVILDKTVFGPV
FT                   GKALDDRDALIRSQLAAVGDNSTEVANLIAEKEQVISNARAEVAKEVASTKAKIDADIA
FT                   EAQAKAKADVDKQIAAALAKLEAAKAESAAQVETKAKELSDQIIKKVVEV"
FT   CDS_pept        complement(<1123417..1125787)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639867"
FT                   /orf_name="MICPUN_51579"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /protein_id="ACO68875.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="UniParc:UPI000199C77E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE01"
FT                   /transl_table=1
FT                   /translation="MLVSLDAASGGGALADLGYLWGSAADHFYHSQAARQGPGVKSHDL
FT                   SGNLDVHLNGIDLSKLHADAVATALRATATPDPRQCAISMLHLACSHRPSSITFVPTFG
FT                   QIEQPVSQNIPGYNPAWVLPFALRAIKSQAIELRDCVAWGLIPLAFAATSSTDKHLRCV
FT                   AYAVISAAADAANTGRSFKERTQLVALFSTFQNSITKKEPLRRLSTITAIFAAETAFVC
FT                   MHPENEMYISLQRAVIRRATLDTEAFPIGFLNFLNGSLLTDDSMASRNNRRMLRVWLLR
FT                   LLTVSLCDASDAHLFRKSFAIEVLMSHRFAAFFLDPYAQKLAFDVITRAAQLSLLTKPL
FT                   IEGSALLSWLAATAKCACHPIRSSIKNTNIGAITAAAAASALTDVVSARGAIYGGPTGT
FT                   AADSLSALRIIRSTLFPAAATENNIFFSKGNAHGSAFCTVLLSALKFQATLAKQLSNRR
FT                   VEVFDISELVELCRAVDNVDTMSVDATLILLVNSAVLDMIVTTAGAMRKNILVFGSDRC
FT                   MQTTMAIAKSILTVVIWAASAVTKGGDRFLMEEYASIILKWATSFLLSEKEEVIAQLVD
FT                   PDGGVGATQVALSLGSLHNTAGPRHRCATVSELVRAQAELLRALSNRCRQFPCRVSKSD
FT                   EHVCIVMSTPVYTVLLSNGGALEELISEVKSGHFKAATPISARGTVKSSLREFKVHAVQ
FT                   DMEDKISQANNFVHSNVDPSAPEELEVQQEIRGKKLTAARLAAILLQAVFTAMPPLAFL
FT                   ESATRINRTRISAGCSAKISYQFRFEKHLEGFMFGKN"
FT   CDS_pept        1133001..1134707
FT                   /codon_start=1
FT                   /gene_family="HOG000036164" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639868"
FT                   /gene_name="SRP54C"
FT                   /orf_name="MICPUN_107336"
FT                   /product="Type II secretory pathway family "
FT                   /function="7S RNA binding"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="ACO68481.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000199C77F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE02"
FT                   /transl_table=1
FT                   /translation="MEARTKQARAPKGSIWCAQRARKDLRARGCRGLGSRISKGQPFSP
FT                   LTLSTPAVTEIGFGTLLYGSRLSAGGSRRGETMLRRASAFGSLTERLNSVWATLKDEDD
FT                   LSLENIKGPLKDIRRALLEADVSLPVVRRFIKNIEQKAIGTRVTKGVNAGQQLTKVVAD
FT                   ELCELMGGFGGDSLAFKDPSMGPTVILMAGLQGVGKTTACGKLALYLKKQGKDSLLVAT
FT                   DVYRPAAIEQLKRLGEQVKTPVFDMGVRVDPPEVARLGLEKARAEGIDVVIIDTAGRLQ
FT                   VDVHLMEELRATKIATAADEILLVVDAMTGQEAAALTAAFDEAVGITGAVLTKMDGDTR
FT                   GGAALSVREVSGKPIKFTGVGEKMEALEPFYPERMASRILGMGDVVTLVERAQQVVKNE
FT                   EAEQMRDKILSATFDFNDFIKQMEMMGQMGGMDGFMKLLPGMSGMSEREMQEADKSLKV
FT                   AKSLILSMTSKERQFPDILVAGASAKSRRKRIIEGAGRSEKDLSQLIVLFGSMRVKMQK
FT                   MTAEITGASAEVGLTPQLSEEDMNTLANEGLRKNVSPGMVRRLRIRRLTGS"
FT   CDS_pept        join(1136297..1136333,1136441..1136751,1136824..1138251)
FT                   /codon_start=1
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639869"
FT                   /orf_name="MICPUN_55251"
FT                   /product="CTP synthase"
FT                   /function="CTP synthase activity"
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="ACO68482.1"
FT                   /db_xref="GO:0003883"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="HOGENOM:HBG597806"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000199C814"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE03"
FT                   /transl_table=1
FT                   /translation="MKAPMKYVVVTGGVVSGLGKGVTASSIGVLLKAGGWRVTNIKIDP
FT                   YINIDAGTMSPFEHGEVFVLDDGGEADLDLGNYERFVDSTLTRDHNITTGKIYQTVIAK
FT                   ERKGEYLGKTVQVIPHMTDEIQDWIERVSRLPVDGSPGQPDVCIIELGGTVGDIESMPF
FT                   IEALRQFQFRVGSDNFCLIHVSLVPVVGAVGEQKTKPTQHSVQALRSAGLSPHMLACRS
FT                   QAPLEQSVMDKLALFCHVTPDCILNLCDVSNIWHVPLVMQEQGGHLAIMRQLRLDFRKL
FT                   ELDSWAHRANKWDTVTLPVKIAIVGKYTGLGDSYLSVTKALMHSAISADRKLNIVWVEA
FT                   GMLEGATLAEDPTAHAEAWENVHSADGILVPGGFGERGTEGKILAAKYARENQVPFLGI
FT                   CLGMQAAVIEYARNVLGMKNAHSTEMVPDCADPAVIFMPEGSTTHMGGTMRLGSRRTIF
FT                   QTQDCKAAKLYNSMPFVDERHRHRYEVNPDIVDRLEKAGCVFVGKDETNRRMEILELSG
FT                   HPFFLATQYHPEYKSRPGRPSPPFMGLVLAASGQLDQYLTSEAIGMRMNAPGGFLQSPL
FT                   KALKGLAKEDESDSP"
FT   CDS_pept        join(complement(1140404..1140475),
FT                   complement(1140254..1140328),complement(1139000..1140154),
FT                   complement(1138426..1138920))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639870"
FT                   /orf_name="MICPUN_112692"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO68876.1"
FT                   /db_xref="UniParc:UPI000199C815"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE04"
FT                   /transl_table=1
FT                   /translation="MNVPPLSELPLDDIAGHHNSCVIQEVKDLAEELASLWRDNRLMRE
FT                   SNDQLKRHNDEMRLAYSVLSAEYESIRADSHAAEVLFEEHAAISRKEIEMRRQQFEEAN
FT                   KCILRPQEIEKLRQQLLEELELPTREAMNELEYEVEDATQSYAKAVRALRSLRAQHDVE
FT                   VARLLSENESLRRDHSQELRVLHKELRVMEDILKFKSQEVKQLEKQLRDSTHVLARDDA
FT                   LATQSNLRKLAVLAAEKAEERLAAQISLTGQLERRLSSTVAQITVREDHIERLMSSLNE
FT                   AESHKVILLRKVETDQRKHLEEVKRVTAHANLAIAELKARFDVERVEAANATRSISLKL
FT                   TSHEDCLKIIQDECDRRARSAEASSRRAHQSATASKLESDLKLDASATELIACKSELLK
FT                   ASGETEGLRRALAAMDGGSGKQLPTYFNLLEQCKSDLKREQLRVVELRNALHLIKTQNF
FT                   EFEAAISALDNESRKLLMLLEQSKIAHAKETMNLKHKWHADRRSFLKRVKKVAVICETR
FT                   RRTTSRKAKRKITRQQRRMLSLSPDPVLARLDSNRSTSRQGINVYTTNSVLRPAPMEFS
FT                   DEFVALEKRQIQFVHMISSDLK"
FT   CDS_pept        complement(1140693..1142309)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639871"
FT                   /orf_name="MICPUN_98545"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68877.1"
FT                   /db_xref="UniParc:UPI000199C816"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE05"
FT                   /transl_table=1
FT                   /translation="MLLLKVCASPRLVFLLSLVPYDLAADHFEQAHLDIINTFAEITNT
FT                   KAALDGLNNSDTFAEVKTATTTVDRISLPHRHGGFGLTKPSDIADNALLSTWLACAPWL
FT                   ADTVPALRDITFRTRPQPAEPTGSRTRAVVRRHAEAQQAANTIPNDDIPEENGPLRGYA
FT                   ERCFRRVCDRGEEEKKLICPTAGSFSSSTAAFAGKNISIMQLQKKLTNEFHKRTLAKCI
FT                   TDANNPTGTNYGIDRTDIATHMTSLDGPHTVTWANVPPVSPAFRLRADTLSHLVHYLLN
FT                   LPHPDFTNLKRDRYKTHCCARAHTINDARNIYSHILRTRTGNSGGSRKRTHDRTYAVLA
FT                   RHAARAGFAVYTEQRGVILAHHTRTNGKIPDFTIAREGGALESVDFTMATVLSCTHDAT
FT                   KPTPARHNRERANAHAGVGIKIAEARKTLEYPRELPANNKITIIATECTGRFSKSALEW
FT                   CKDIARHQAERQRPLHLPGQNTTNEQGTYDPEDIKKFHYNVAEAQLELHRQNKEWCIGT
FT                   IAKARHRHVDVEPEFDEMIWG"
FT   CDS_pept        join(complement(1144244..1144294),
FT                   complement(1143828..1144076))
FT                   /codon_start=1
FT                   /gene_family="HOG000242252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639872"
FT                   /orf_name="MICPUN_107550"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68878.1"
FT                   /db_xref="HOGENOM:HBG606506"
FT                   /db_xref="InterPro:IPR010530"
FT                   /db_xref="UniParc:UPI000199C817"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE06"
FT                   /transl_table=1
FT                   /translation="MSGVAAKTWREIWIRPEVYPIVAAIGGAVSLCTFFCARQISSSPG
FT                   FRVWKDGRAHEGIPEEKFRVKEGVNWREHFVRRAMRDTKPAIFPGLNDAMTSPK"
FT   CDS_pept        join(1145452..1145892,1145959..1147170)
FT                   /codon_start=1
FT                   /gene_family="HOG000265181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639873"
FT                   /orf_name="MICPUN_51586"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol phospholipase C activity "
FT                   /function="signal transducer activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO68483.1"
FT                   /db_xref="GO:0004435"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG559203"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000199C818"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE07"
FT                   /transl_table=1
FT                   /translation="MNDPLSHYFINSSHNTYLHGHQLFSNPSAAAIKRALLHGCRVIEL
FT                   DCYDGGRNGPIVMHGRTATSPITFRNAIRIINEFSHAMSNYPVLITLENNCSHWKCSEL
FT                   AQILLEELGEKLFVPPEEVRESWLSPAALRGKILIRSKLKYREESRVNSSCWCSSSSGK
FT                   NTANTDCAAHLKLLAWDRSAVDAVQKIIDRCFPVCGAQNVRSCALSPSDETNTSATSAT
FT                   EFSSLVYVENVKLPTPHQSTSLKSLHSCSWSESKLVSQVEEIGRELIAGFAKRHMLRCY
FT                   PSAKRITSDNYDPSLAWSVGAQMAALNFQADDISMWINRGKFLANGGCGFVRKPEYLIG
FT                   SKLGPPNVPACTLNITVVACSGWTTFERFHSYETPTTYIRVSLAGSILDNKSCVTSAFS
FT                   KRKQFGPYAQPFFNETFSFDIFEPRLSTLLFSVHAKESTAHDAFVAQSCFPVTLLRPGT
FT                   RLVPLYDQYGKYVGEAGPLCARDLFLHMLLFHVLSEIVSTDSWTSSSILPRFLDSCNAP
FT                   RRCHGLHHFVTLVLGGQGKTACMVVKIKILDSV"
FT   CDS_pept        join(1147681..1147717,1147817..1150671)
FT                   /codon_start=1
FT                   /gene_family="HOG000196498" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639874"
FT                   /orf_name="MICPUN_55256"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="MutSalpha complex"
FT                   /cellular_component="MutSbeta complex"
FT                   /protein_id="ACO68484.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="GO:0032301"
FT                   /db_xref="GO:0032302"
FT                   /db_xref="HOGENOM:HBG315065"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="UniParc:UPI000199C819"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE08"
FT                   /transl_table=1
FT                   /translation="MCTLSEKCSALDESDRKGFVAFYRSLPADPKIIRIFSRKDNYSVH
FT                   GDNAVLIARTFLKTTTALHYLGHGESALPGLTLNRNLFESILRELLLDRTEHLVELYEE
FT                   TSRQVWKLSRTASPGKLDAFEEELNRSDDLFDTPAVAAVQVKVRMDQQHVGFAYFNPVT
FT                   RHFGACEFVDDDQLRILEATICQLGIKECVLQLQAIETPNGRRLRDLISRCGALASQRA
FT                   TSDFDINHLEHDLSCLLAHEASENIRTVNVVNAPNAAALEHHRAILTKELAAGALAATL
FT                   RFSDALADSNHRGRCTLALHDTGKYVRLDSSALSALNVLPERRVLSPSTASAAADAISN
FT                   FSLYDLLNKCRCPMGRRMLFRWLKQPLLDTVEIGRRHDVVEAFVNNPEVRDALRGTHLR
FT                   ALPDIHRITRRIERRRANLADLCKLYQASAALPYIAGAVSQIDTCHSRALRDMYTDKLI
FT                   KLSDNDHLGKYEALIEAAIDLNKIPEEYVIDASYDLDLEILQKRKDAANEDLQKAFQDA
FT                   ADDLRMQAGKALKLESNNMYGWYLRLTKKDETTVRRQLSASYQILEAKKDGTKFTNKRL
FT                   HSLSSKCMELDKAYECQQRVLVDRVVDVAASFVDVFLEVSNLCAEIDVLASFAEVAVSA
FT                   PLPFTRPSVHPKQSNADSIREEIILKDSRHPCMELQHGVQFVSNTCTLQRGKSWFQLIT
FT                   GPNMGGKSTFIRQVGICVLMAQVGSFVPCAEAKIAVRDAIYARVGAGDSQLRGISTFMA
FT                   EMLETTAIIKAATPSSLIIIDELGRGTSTYDGFGVAWAISEYIMRNVKAPCLFATHFHE
FT                   LTALQGPLGVTNYHVDAEIDERSGKLTMLYCVSPGVSDQSFGIECAEYAKFPEQVIKNA
FT                   REKALELEDFSAKATAFAASKNTCLEASLLGMKRSSSDHRLRDTAGRAVVSQTLTATLF
FT                   LDSFCTVHLDKLSKEDIFHHTKRMKKELVLVAR"
FT   CDS_pept        join(complement(1152336..1152554),
FT                   complement(1150947..1152203))
FT                   /codon_start=1
FT                   /gene_family="HOG000264288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639875"
FT                   /orf_name="MICPUN_55257"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68879.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561538"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199C81A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE09"
FT                   /transl_table=1
FT                   /translation="MHKKVAHPNEIHNTTTILWHILQACKGGDDVIAHSCSPHNPEMGK
FT                   GGNASMVKNRSPAREANRCRKVTQIRGQVYDITDFAESHPGGAQLLALAVGRDATILFE
FT                   SHHIRTEIVDRVLKTLPKVDDIDKLFPDEEFPAPLDSPVYRKIQQRVRDEILAPLERTK
FT                   GRAATGRGGCLLDMAAVVAFFFTSLSLYIACPSIMTGIILGLAGYWSGTGLQHTANHGG
FT                   LCRSSYWNQFWGWFGSDVVIGKSSLEWRYHHTVSHHSYCNDINRDQDVYTSFPLIRLDE
FT                   TQPWSWYHTFQPIYTPFIWPLLYLAAQIGDFVNIFIYKASPGVEYTGITPIEVALYVFG
FT                   KIFHVSITLAIPVYLHGWAKIWAPFVVYSCFGSFVLCWFFIVSHNLDGLRPHQFSHTTR
FT                   NDWGRWQIETSASWGNVFWSFLSGGLNYQIEHHLFPGVAHNLYPLMQPIIKQECVNEGI
FT                   QYNGFDGYFGIVPITFKMFCFLKKMSLNPSKTK"
FT   CDS_pept        1153486..1154112
FT                   /codon_start=1
FT                   /gene_family="HOG000265946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639876"
FT                   /orf_name="MICPUN_55258"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68485.1"
FT                   /db_xref="HOGENOM:HBG559204"
FT                   /db_xref="UniParc:UPI000199C81B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE10"
FT                   /transl_table=1
FT                   /translation="MAQQRNDDQYSSDAGSGSTDFSVMEMCPLEARCNPSLDGAFDKSA
FT                   VLERVRQLSAPELASLSELCMCPKACKYKTAVDSDAAWWPHCAKAWYEPGQAPEKPGKP
FT                   PRQRKTWKNAYLALRPEEGPNPEEIASRLDKIARHEAKMARWDLERKAGRMSVRGRTLG
FT                   GETLLSPVEGKEDKSAMRQFYKTVRSKPKGKTSKGGGGCLASNFG"
FT   CDS_pept        join(complement(1154950..1155272),
FT                   complement(1154574..1154883))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639877"
FT                   /orf_name="MICPUN_55259"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO68880.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199C81C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE11"
FT                   /transl_table=1
FT                   /translation="MWDSRQKRRPRCQQAQEKTTARQAAKLCSLTPRASQPTVLTTTTL
FT                   HQPQTVCRHWLRGLCMKGNGCGFLHQFDKRRMPTCRFFAKYNECREPDCPFKHSLEDVK
FT                   DCNMFKLGFCIHGKLCRYRHASLKAPPMPTFEAALIGTPGHLHGAPSFVQRYQLGLVNE
FT                   ETISGNIRPTSTLGPGLPPLPPGPPPQRSKVVNRPLAINANPALDDE"
FT   CDS_pept        complement(1156440..1157954)
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639878"
FT                   /orf_name="MICPUN_93072"
FT                   /product="Cytosolic pyruvate kinase "
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO68881.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199C81D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE12"
FT                   /transl_table=1
FT                   /translation="MPESGFVPTHILHNPRPIYSHSEYNFKSKIICTLGPVSREVSVLA
FT                   DMLRAGMKVARFNFSHGEHAYHQQTLDNLRKACASTGLLCGVLLDTKGPEIRTGFLKDG
FT                   CAVTLEARSEVTLTTDYGVKGDARTIAVSYPSLAKDVKPGSKILAADGSITFTVLSCDI
FT                   SAGTVRARVENDAKLGERKNMNLPGVIVNLPTITEKDKTDILEWGVKNKVDFIAASFVR
FT                   KGSDVEYIREVLGDSAKHISIISKVENQEGLDNFADIVDKSDGIMVARGDLGMEIPMHQ
FT                   IFLAQKRMIKRCNEHGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDCVMLSGE
FT                   TAAGDYPVHAVHSMAQICGEAEAHIDPVSVYRRILERQEIPMKNFESVASTSVRAAEKV
FT                   GARLIISLARTGMVAHLMAKYRPAVPILMVVLDENNDGSAQSLARRSLVYRGIIPLVVP
FT                   SVGDYRTQLIEAIDHAVKLGLVVTNDKVIGVHALGKDSVMKVLDVH"
FT   CDS_pept        join(complement(1160833..>1161698),
FT                   complement(1160648..1160802),complement(1159239..1160512))
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639879"
FT                   /orf_name="MICPUN_78285"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO68882.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI000199C81E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE13"
FT                   /transl_table=1
FT                   /translation="GATNAPQSQPEEELSALERFCTDVTDEARQGMLDPLVGRDDELRR
FT                   LTHILSRRTKNNPVLLGASGVGKTAIVEGLAQRIIAGDVPISLRGAKLLELDLGAVGAG
FT                   CQMPGEFEERLSIVISEVVEATQKGPVVMFIDDIHNLCPPPPASNNGAAILKPALGRGL
FT                   LRCIGASSVDKFKKSIEQDAALERRFQQIHVAELDEEETISVLRGLRPRYEAHHAIKIN
FT                   ESAVVAAAKLSARYVQGRCLPDKAIDLLDEASAAVRMQKTLKPEDLDAVDRRVAQLTKE
FT                   RDQVKAKLGKMTAACLQNLNEELSKEKAKQIKITSEFSKEQKISREHNRAAADLSFAER
FT                   QADVARADKEAAELVDLVAKAKTEYVRTEQEILTIANVSGLMGKEEVTEADIAAVVSRW
FT                   TGVPVAKLVASEKQKLLQLEAQLHQRVIGQEQAVTSVAEAVQRSRADLSDPNGPIASFM
FT                   FLGPTGVGKTELAKALADYLFNSDNALIRLDMSEYMEKHSVARLIGAPPGYVGYDEGGM
FT                   LTDAVRQKPYSVVLFDEIEKAHVDVFNVLLQVLDEGHVTDTQGRTVSFRNCLIIMTSNL
FT                   GSDEIAFGDKGRRGRRGPRDIKEKVMSHVRSHFRPEFINRLDEFIVFEPLTHLQIMEIV
FT                   QLQCKKLAERVAGQRMALDLQPSAIDYLARKGFDPTYGARPVKRAIQAELIQVIANNLL
FT                   RGIYQEDDTIVVTANGDGVTLSSGPKLVRDLPGPDHDGHNEIFGVAAVSSTETRPIIFG
FT                   EGSSGNFLQNS"
FT   CDS_pept        1163483..1164445
FT                   /codon_start=1
FT                   /gene_family="HOG000240020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639880"
FT                   /orf_name="MICPUN_89639"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO68486.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG559207"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI000199C81F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE14"
FT                   /transl_table=1
FT                   /translation="MLKWLFAHAHCIGEIPGPGHNGGPPSQDVTGVRKLAATPDLPLPV
FT                   KYEELQREIMMSLKADHFEGGRFDFNKQLNQNFFLSHSVLLGSIEVPAQGNQIIKIPNA
FT                   TYEFGANVVDAKYMLVGRVLTDGRMSGRIKYDVSDALSAKLQTSKEPGFSQVMFDLDFR
FT                   GSDTQAQIKLGNGQFYGLNYLQSVTGTLSLGGEAFWLGGQKKSGVGLAARYADNRSVAT
FT                   AQVATTGLVSLTYTSKVSEKAMLASDFMWNWNARQAQASVGYDYILRQSRLRGRVDNSG
FT                   TVSVFLEERLNTGFTLCYSAEIDHANKNHKFGFGMIVGE"
FT   CDS_pept        join(complement(1166573..1166820),
FT                   complement(1166003..1166486),complement(1164718..1165941))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639881"
FT                   /orf_name="MICPUN_55263"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO68883.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199C8A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE15"
FT                   /transl_table=1
FT                   /translation="MKPDTQSSPTGPNEVSGHKYATIADRTPPAPDANLSKSQDFSARG
FT                   VRTSASPFVPRASGQHQNATSIAVTPVQSSLPDQAHISVILGRKSGRQEHDFDQRAAIH
FT                   RFRTAAVPFNPTATLNDKTADVRLPSEDDFTSGPADPSSESPKRPFPHHQSASVHANAV
FT                   PRSINSQGTRSSSISPASIRVKSNKIGHSKMSTRFITEQLYEELRRRRYLENSQMDESR
FT                   VHSGSLPRVGSLIVSGFPFTLSVLNQYHSLVPLDDFSLKNSAHAFGLHSILLRGISSVD
FT                   GMPYALRRLHHRYVVPSAELTLAARVAVDRWSRLVDHPHIAALHGTFVSADMWDTPALF
FT                   FAHEYHAGAVSLESVHCGESDDCLAASEAEIWMYASQLCCALKAVHDIGLAVGGSASLA
FT                   PNKLLLCSKGAFVDGPGGAHGCRIRLAAVGVIDVLRPEAVGLHGGRARTIAQRDDLRAV
FT                   GISMANILCGSVNLSSADALAIASRRCSPMLNRVIMGLVSGGIADSSTFSQMLVPIIFD
FT                   SLKFERALCDQLKSELAKELENGRLLRLLIKLTFINERPDGDMDPNWAETGDRYILKLF
FT                   RDFVFHQHDNDGNSITDWGHVFECLNKLDTGVAEKVLLVSRDEMSMLVASYADIKRCTE
FT                   VAYAELIIESKRVDRF"
FT   CDS_pept        join(1167256..1167549,1167625..1167747,1167800..1167875,
FT                   1167944..1168032,1168091..1168208,1168283..1169193)
FT                   /codon_start=1
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639882"
FT                   /gene_name="ATPB"
FT                   /orf_name="MICPUN_107337"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO68487.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI000199C8A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE16"
FT                   /transl_table=1
FT                   /translation="MAWRYLRVSSRLSRPFFSFAGPAISRGCSLGNILANRHFVCSTRE
FT                   LSKGAMQTRGFAAAGGTSAFDGRVTQVIGAVVDVQFDGELPPIMSALEVDGHDVRLVLE
FT                   VAQHLGENTVRTIAMDTTEGLVRGQGVVNTGSPIQIPVGRATLGRIMNVIGEPIDECGP
FT                   IETSSTLAIHREAPPFVDQSTEMEMLVTGIKVVDLLAPYQKGGKIGLFGGAGVGKTVFI
FT                   MELINNIAKAHGGFSVFAGVGERTREGNDLYHEMIEGGVIKLGNQASDSKCTLVYGQMN
FT                   EPPGARARVGLTGLTVAEYFRDFEGQDVLLFVDNIFRFTQANSEVSALLGRIPSAVGYQ
FT                   PTLATDLGGLQERITTTTKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAE
FT                   LGIYPAVDPLDSTSRMLSPLALGEEHYATARGVQKVLQDYKNLQDIIAILGMDELSEED
FT                   KMTVSRARKVQRFLSQPFHVAEVFTGTPGKYVDLMDTISGFKGLLGGQYDDLPEMAFYM
FT                   VGDINEVVAKADELAKQVA"
FT   CDS_pept        join(complement(1170039..1170374),
FT                   complement(1169799..1169954))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639883"
FT                   /orf_name="MICPUN_55265"
FT                   /product="Mid-like protein type b "
FT                   /protein_id="ACO68884.1"
FT                   /db_xref="InterPro:IPR003035"
FT                   /db_xref="UniParc:UPI000199C8A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE17"
FT                   /transl_table=1
FT                   /translation="MRATILGGVFESIRPARKLLDWSEEAPRSWRRQDETATEQSLHPF
FT                   TYSCQCFWAKITRWVVEDSICICAYFFPSEYLVGRLNSRVYSLATLQVLEEPTLLASSE
FT                   NKPRGIDRITSYFHQSIDTAATNLNTCATMLKRICRLHGLHRWPGRKVSTSQVTVLDSE
FT                   "
FT   CDS_pept        1172708..1173382
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639884"
FT                   /orf_name="MICPUN_55266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68488.1"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniParc:UPI000199C8A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE18"
FT                   /transl_table=1
FT                   /translation="MSLHLSSHHIRSSKRRTPCRSCSKQLHTWLAPCSTRAIKPRCEQA
FT                   CSTWRQVHVENLLLLETNIDDSSPQVLAYTMEELLLAGGLDVWSAPVYMKKGRPGTTLR
FT                   ILCKACDAEDLVHLLFKVRRQFFAEPRYPYLAFVSKKETSSIGVRLQNCERVSLRRHIE
FT                   TVQTRWGSSVRIKVAKIGEATVNAHAEYEDCAEVARSEGVPLADVFREATAAYYFNNPE
FT                   IV"
FT   CDS_pept        complement(1173902..1174252)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639885"
FT                   /orf_name="MICPUN_55267"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68885.1"
FT                   /db_xref="UniParc:UPI000199C8AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE19"
FT                   /transl_table=1
FT                   /translation="MVFSRVDAMISIFPKTTSFQGHSSQAGGVKKTSVLVSEESEDALF
FT                   RHRLGDVVVSYHKIFSGAAILQTSLRSIELSDQVRGLVVPSMNMKRQPSQCRKKRKGKK
FT                   ERNKSPVSEKRS"
FT   CDS_pept        join(1176555..1176672,1176734..1176886,1176954..1177246,
FT                   1177319..1177381,1177450..1177555,1177618..1177664,
FT                   1177725..1177745,1177806..1177885,1177946..1178078,
FT                   1178140..1178271,1178337..1178429,1178483..1178587,
FT                   1178646..1178768,1178843..1178875,1178939..1179006,
FT                   1179061..1179197,1179249..1179361,1179423..1179452)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639886"
FT                   /gene_name="TIM"
FT                   /orf_name="MICPUN_107338"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68489.1"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniParc:UPI000199C8AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE20"
FT                   /transl_table=1
FT                   /translation="MYSAITFAEAHLQSLVSSLGRRRDSRLRDSPYVKDPMCHETLQDI
FT                   LRFLRHDQSHERPVAFLLHSWDFLQTHLLPLVLTYHGSESLILDSVKLLVFLTLPADAS
FT                   AKNVSEQRRYLSHTLENLLQRREIFPILFSCLRGPLERLESSNLRLKDDDGKTIQLFLT
FT                   FIRNCLLTDERHRLCTDVKFTCHVKERIIQMLFETHVIDVLIQVAKDVRKKQLSDDSAL
FT                   LTEIFHLIFQSCTPRQLLRGFDGLGLKENQSGQRDTFGSVRRLSVRHSHFGGRNSTSNA
FT                   SPSITNRPVATSRQYFGENISLDESSVTPIQATTLERLVELARTLVKGALNEVLLASWI
FT                   SIRHRQQLETESEEKALRVKSFLCLSYFFVSYTQISCEVNEMDAPNSAGISNLFDKEVF
FT                   AWLQTTWAEHEQTKNVWGVVLVSGLVKEMFAMMTTIMSRGVQYDRFACEAVLSEIFVKS
FT                   NSDDLLQRASSVVRSYRTGEAPLIYLANATEVMHLGYGLKRLIDPRFVINLKDIFYEKT
FT                   ISNHIRLLAFTNLNSKRLNVMLLNYVDEIMERGMENTLHDVSSLETLFAAAGNNEISAF
FT                   LVPKGGISAAIVNFMNGIYMDERGEHMDYKRSKFLGTVC"
FT   CDS_pept        1181386..1185078
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639887"
FT                   /orf_name="MICPUN_55270"
FT                   /product="Lectin domain-containing protein "
FT                   /function="binding"
FT                   /protein_id="ACO68490.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG608543"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniParc:UPI000199C8AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE21"
FT                   /transl_table=1
FT                   /translation="MRRVVVVALSGFFSLIASGAEATIELSVLTADSPVTYSGASVYYN
FT                   KEYDICGLCDGDSTSCQGCDGIPNSRLVLDACGRCGSDFSSSFLFNSTCGSCTEDGNAG
FT                   IYESLHSSGVIDDCGVCGDPAGQLFSRQGAPNYFTGGCVGCDGAANSANELDSCGVCSG
FT                   LSCASTDPLKRSWCCDCAGTAFGQSLVNFCCECVNREPHWKGLSGSVFNGPPVSHSFAE
FT                   HMWSTARGLMKSASELAASFQLDLGNRTGTTPYVRDKAIYRTYVEAKEYFTQGWHAMKD
FT                   RLISDDNSSCYYDIYVASNTSNPRDICGVCHGDNSSCAGCDPRDTILLGEPVPDDGLFP
FT                   DDCMICGGHNLQVDQCGICFGDNRTCLGCDGIPNSGRVIDRCAGSSDFRFLSFLGELGE
FT                   VGSGCSEPAEFETACNAGEGGCCGCDGVPNSGKTLDGCFVCMDQKNPNYTHLVNASCSG
FT                   CDGIAFSGEVYDHCCTCSGSETYNDDCYKNLLVNMTATVPFDPYVMDYSAYFNLEGRRL
FT                   FDECGECRGFGYNGSTCIGCDGKYGSGLVVDGCGVCGGDCSTCRASETGILYDCAPPGN
FT                   GWTGMDKTCQFVRTEGPDKWKNWIAFPNGTDGEGRKTITWFERVNQPGVPNFTDYAKGE
FT                   CRMFLEPPPPPSLRERREWVVMVYGKEEGPYTINELETGSIPVIDSTTGDKVNIPLLPA
FT                   TLVSQMTSYTQKQTIHYGYTSQYQARVQDWQERSASKLIDSPGQAGVDNAVIVEGQASE
FT                   LWNGGVFMPIAIMPGMERIIYPYCTGSTWRGKNHRLHGKKLPGNSLGMITSENITDTNG
FT                   QSDRAWNPLDEYIYDVSGDWIDQKCTCSTEWQYDSQPLAPTCLKVWYPWEGQTGDGWPI
FT                   VRTRYVNDTGRFSIHQKRSWEGGSWRLSGGWWIQDYGGGSAQQSSQTPRLLDSFRSGDG
FT                   FGSDAMRGPVRSDAIGTVSWITFSPDNYDEYDGKNMGISKNRTCYSAARLSHAKRHSAG
FT                   AVWGNSRETVTAHWECSFAFLLSEPAERCEDVYQVSRSFSEAVHIHTHRTCSTVGGDGF
FT                   AFVVRDDKEKPPAITDVGDLGPGIGYQGLRHSLAVEFDTWHNPEMSEPFGHHIAVHTNG
FT                   AGTNDAHHNAHLGFTLNIPNITNGEVHNVRISYEPAPSYDHVIAAIESGYLKGSSPKLV
FT                   DFVKDNPALLSIFVDEMSIPVLTVPLSIETILRPNQSTAWIGFTTGTGEAWQAIDILSW
FT                   NFSSY"
FT   CDS_pept        join(1185875..1185927,1185993..1186043,1186107..1186212,
FT                   1186283..1186441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639888"
FT                   /orf_name="MICPUN_55271"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68491.1"
FT                   /db_xref="UniParc:UPI000199C8AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE22"
FT                   /transl_table=1
FT                   /translation="MSLIMGVGSGVLALALLLIGAFALCYLGQGGRHSSRVTAIVSIIF
FT                   VMIAILLLSSPRGDTRRTDIEAEIEGYDNRVTQRALMMSSMTLAIVSAISALGAFHILP
FT                   PAYAKTIDEHSGIVKIKS"
FT   CDS_pept        join(complement(1187906..1187986),
FT                   complement(1187657..1187851),complement(1186615..1187517))
FT                   /codon_start=1
FT                   /gene_family="HOG000165630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639889"
FT                   /orf_name="MICPUN_51612"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68886.1"
FT                   /db_xref="HOGENOM:HBG738415"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="UniParc:UPI000199C8AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE23"
FT                   /transl_table=1
FT                   /translation="MVLEATMLCIDNSDHVRNSDYLPSRLQAEGDAVNLLAGAKTQSNP
FT                   ENSVGVLSLAGKVPRVLVTPTDDLGQVLNAVHGISTGGSIKLSTGVQVAHLALKHRQNK
FT                   HQRMRIVLFVGSPVCASKDELTSVGKKLRKCNVAVDVISFGDIEQNSEKLEAFVAAVNK
FT                   NDNSNIVTVPPGAIIADVLLSTRVFMADDNITNGASSFAAAAAAASSQAAVRGYARDGA
FT                   IADGADDPALMLALRVSLEEERARQEAQMKDTDDASSEEKNAAAHLICAQDTIAKGSGK
FT                   PPSPIVDPLSLDEEALLQRAFALSMAEEHAITTGKTGNDNQDTMTGSDAGLQMESQENT
FT                   ISLAAHAADFQDNEPCIDPILSSLPAGEGDEEKDSPRESRRSQQESKHSKTS"
FT   CDS_pept        join(complement(1192428..1192691),
FT                   complement(1192334..1192378),complement(1192224..1192274),
FT                   complement(1192102..1192167),complement(1191993..1192043),
FT                   complement(1191881..1191940),complement(1191788..1191817),
FT                   complement(1191666..1191698),complement(1191503..1191607),
FT                   complement(1191411..1191447),complement(1191315..1191353),
FT                   complement(1191236..1191257),complement(1191154..1191178),
FT                   complement(1191023..1191064))
FT                   /codon_start=1
FT                   /gene_family="HOG000239829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639890"
FT                   /orf_name="MICPUN_51618"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68887.1"
FT                   /db_xref="HOGENOM:HBG380182"
FT                   /db_xref="InterPro:IPR004388"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniParc:UPI000199C8AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE24"
FT                   /transl_table=1
FT                   /translation="MYMKQSRYCIYICTFEGTFIRTFVRNKFRDISIHLLIKPEHVLAP
FT                   VKTKVDLTIILQLSRPWRYFRLLMIIRACQLRILPATSQRVTDAVDALRRERIIAVPTD
FT                   TLYGLAAGAHSDKSIRRLYAAKRRSETVPIAICVSDAKDVERYADTKHLAEGLLDELLP
FT                   GPVTVLLSQKSSADLPSSLNPNSRLMGIRIPKSDFIRAVARQYGHALALTSANQSGSAS
FT                   TLDLNEFTELWDDCAFVFDGGRIVSGRVGSSIVDLSLPGTFSVQRRGDKYEDTRKTLMK
FT                   FGLRQLPD"
FT   CDS_pept        join(1195036..1195994,1196082..1196529)
FT                   /codon_start=1
FT                   /gene_family="HOG000264595" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639891"
FT                   /orf_name="MICPUN_51621"
FT                   /product="Glycosyltransferase family 2 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO68492.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG559215"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199C8B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE25"
FT                   /transl_table=1
FT                   /translation="MKSLIQHADIASVMQDINSRESNDKSFPSVSIIIPVHNSIEWIEE
FT                   CLVSVIDQTYVGRIQVSLYDDASNDGSDIMIHAWRSLFQQFGISTVASGRCWGYHQNNG
FT                   QLLFCNIHDYHSCHAGGIGHGKNMATCQSTGSYLLFLDADDVMFPTRLEKQLQLAAKNP
FT                   GAILGGCWKRLPAGSTEHYESWANVLEYERLWLEQFREVTVQMPTWCMSRSVYDALGGF
FT                   VESPPGDGEVGIDYDCGLVQLIARTCPYLLFECHPVNHPSNMNPKSYLRTLLDPLHLGE
FT                   DFIFFQSFLDSFGPINYDGGHSSIARAGTPENPTLMYRWSPESGTSRVSRRQLARIRVA
FT                   AFERRILSQASWSHFSIWGAGRDSHVFFSELSKKAQSQVVAFVDLDSGKCGTAYTNHHC
FT                   GTPTTIPIVHFKEFSEYLRKERAALNDSGSVPVVACVAKRRKGEGCAGDLESNIGTLGL
FT                   LEGLSLWYCY"
FT   CDS_pept        1197027..1197659
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639892"
FT                   /orf_name="MICPUN_55278"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68493.1"
FT                   /db_xref="UniParc:UPI000199C8B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE26"
FT                   /transl_table=1
FT                   /translation="MGTAGTPMVDNAGDEDEESSDEEEEVVMETARKLECDSAWKNHAR
FT                   VQVTLPAGMQPNVVHINTFCSNENNKLWGEIGYTEVAALPHTATNRFKITDDLVKAYAK
FT                   IAARANDLGLSKPAEDGGSKVMLMPLVTETLQRQGMVRRRSRRRRRRWRRPPHRRRRHT
FT                   RLWARRMTPSPSTSTSLSETRAPSRDGWDGDGCFESRSKAARSVIWI"
FT   CDS_pept        1198377..1198964
FT                   /codon_start=1
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639893"
FT                   /gene_name="YVDD"
FT                   /orf_name="MICPUN_107339"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68494.1"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI000199C8B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE27"
FT                   /transl_table=1
FT                   /translation="MKFERICVFCGSASGTRIEYARATVELGQELISRGYGLIYGGGSV
FT                   GLMGDIAIAVSSGGGKVTGIIPKSLEPVEISGHSVGDVVIVKDMHERKARMFKDSDAFI
FT                   ALPGGFGTLEELLEVMTWRQLGHHDKPIGCLNVAGYFDLFLSFLETAVDEGFISSSAKK
FT                   MLITARTPAELLDEMEKSTKNLRESRRALVKN"
FT   CDS_pept        join(complement(1200651..>1200722),
FT                   complement(1200485..1200571),complement(1200299..1200415),
FT                   complement(1200087..1200224),complement(1199960..1200028),
FT                   complement(1199839..1199892),complement(1199671..1199784),
FT                   complement(1199352..1199570))
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639894"
FT                   /gene_name="CLPP3"
FT                   /orf_name="MICPUN_107340"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68888.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="UniParc:UPI000199C8B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE28"
FT                   /transl_table=1
FT                   /translation="RRSSFMRGSSPARFKSNRVLHISAVIPSLQGDASTQAPPDLPSFI
FT                   FKERIVYLGMTLVPSVTELILAELLYLQYEDKTKPIYLYINSTGTSKEGQKYGYDTEAF
FT                   AIYDTIKYVNSPVHTVAVGTAWGEAAMLLASGEKGNRAALPSASIMIKQPIDAFRGQAT
FT                   DLEIQRKEMRNTKKQTLELLSKGINKPIEELEKDINRPKYFNPWEAVDYGLIDKLPNKY
FT                   GLFRTFYKVFIPFLLHVLLQARARLHSLVAIWNLGAFLPSRGKKALHNRLSRLQLILKN
FT                   ARHIYPRA"
FT   CDS_pept        complement(1201185..1201415)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639895"
FT                   /orf_name="MICPUN_55281"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68889.1"
FT                   /db_xref="UniParc:UPI000199C8B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE29"
FT                   /transl_table=1
FT                   /translation="MRDAVLGVSTSTSQRVNELTIYRESAGILDFRQLWTPRRYYYYYY
FT                   YYYYYYYYYYYYYYYYYYYYYYYRMGGLTQE"
FT   CDS_pept        1203552..1205126
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639896"
FT                   /orf_name="MICPUN_78168"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO68495.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI000199C929"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE30"
FT                   /transl_table=1
FT                   /translation="MHSPIREAIIWPTLHAEDARALGAKFPRGVLVHGPPGVGKTSISL
FT                   IAATDVGASVHALNAGDIFGPYVGDTEARMRAAFRSAQRDAKRGRPSFIMLDEIDTLCP
FT                   ARVISRDSAPHGSRHVTQLLTLMDCGLSSERNYKNDKPGDSYPLVLATTNRPDVLDAAL
FT                   RRPGRFDIEVEIKLPCAVEREIILRQYTQLLLMGSDVCLKTIAERTQGYSGADLSALCR
FT                   EAAMLAISRRNTDKPFESITASDVSVSDGDFSEACRRMRASLIRGVDVDLNPVKWEDIG
FT                   GLDDVKEQLQKTVEWPLLHADAFLRLGLSPPRGVLLYGPPGCAKTTLARAAATASGATI
FT                   ISLSAADVFSKYVGEGEVLLRDTFSRAQRLAPAIILLDEIDGMVGSRGSDHASNNSEIG
FT                   ARILSVLLTEMDGLDQSKAGIVLATTNRVKSVDPALMRPGRLDVKINIPKPGETARFAL
FT                   LRACSRNVPLDDDVDLFAIASRAKVFTGAELSNVVREAAITALRENIHAKSVAQRHLEA
FT                   ALVAMIP"
FT   CDS_pept        join(complement(1205526..>1205648),
FT                   complement(1205333..1205422))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639897"
FT                   /orf_name="MICPUN_112735"
FT                   /product="Type II secretory pathway family "
FT                   /protein_id="ACO68890.1"
FT                   /db_xref="InterPro:IPR005609"
FT                   /db_xref="UniParc:UPI000199C92A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE31"
FT                   /transl_table=1
FT                   /translation="LGGLRRRNAGSRVSGSSGGAVNSMSMLRYYADDSPGLKITPVVVL
FT                   LMSVCFIAFVTVLHAVAKIYQFRSS"
FT   CDS_pept        1208751..1210406
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639898"
FT                   /orf_name="MICPUN_55284"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68496.1"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="UniParc:UPI000199C92B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE32"
FT                   /transl_table=1
FT                   /translation="MGHPEYPRRTKHPKWRNEKLRISFSRLAVHDADFVHKYSHSRALC
FT                   GSESSASDDQSAGPRRAEPSKNWAELSNLSSTMMGGRGMRNLKSEKELLAVKALAKVRL
FT                   SAKGRSPHERRTSSFQAAPIDCSTAASVFCPSDLPYGASKRGSQGQRFSTCLATSGSDM
FT                   HKFVDALDRTRCSLDKNSAHNPTELIPGPSISGANMGIREWDSMIDWKMMEHQDYETLP
FT                   DDQFEKLSDKLHIKENWRPTVSYLLSLGLSTSELEKVLVNCEELFRRPVATIMTRVDYL
FT                   QNDVGFGYPELRKLIDKEPKILLQRNRHSVARCRYLTDLGIPCESLPKLLRRQPQILQL
FT                   SVAKGLAPRVNYFKKSLLIPETDIAKLIQRNPAVLTFSIENQMKPRIEYFKNLGIPQHG
FT                   VVKMIVKHPHLLHYSFEGLEEHINFLFSIGMSEEDVVHTVTRLSQIFSLSVEESLRPKF
FT                   RYLTEELGGDVKTCVKFPAYFSLSLDQRIRPRHTYMQRLNCAPDPFPMKYLSENDKAFA
FT                   GRARRSLDDYASYKVRQFFPPRPIKILQRCPFPC"
FT   CDS_pept        join(complement(1211599..1211668),
FT                   complement(1211436..1211506),complement(1211212..1211336),
FT                   complement(1211078..1211138),complement(1210958..1211011))
FT                   /codon_start=1
FT                   /gene_family="HOG000196242" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639899"
FT                   /orf_name="MICPUN_107564"
FT                   /product="Predicted protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="ACO68891.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG559219"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI000199C92C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE33"
FT                   /transl_table=1
FT                   /translation="MSAIGALRDKISLEANDLHSMQRDLSRNVSSRRQFSHQYSENDLV
FT                   HKELERLDNDAKVYKLIGPALIRQDKVEAISNVAKRMGFIEHETSRLDKAIKGLESKQD
FT                   GKQKVVAELQKKLQHMHAYEQS"
FT   CDS_pept        <1213035..>1213645
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639900"
FT                   /orf_name="MICPUN_71140"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO68497.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="UniParc:UPI000199C92D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE34"
FT                   /transl_table=1
FT                   /translation="PASANPGASYSEHKPKTPPPDLPSLLLDSRIIYIGMPLVPAVTEL
FT                   IVSELLYMQYTDPARPCYIYINSTGCQRADGEVVGFETEATSIYDTMKYIGNEIFTVGT
FT                   GVAIGQACMLLSAGDKGKRFMTKNATAMLHQPRVPSTGQRQAIELHIKWKEVLEQKKTM
FT                   VDILSQTTGHSKEQIDKDIQRPMYMTAEDAIAYGIIDKIV"
FT   CDS_pept        join(complement(1215436..1215460),
FT                   complement(1215234..1215279),complement(1215110..1215171),
FT                   complement(1213967..1215039))
FT                   /codon_start=1
FT                   /gene_family="HOG000225091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639901"
FT                   /gene_name="CHLI"
FT                   /orf_name="MICPUN_107341"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="magnesium chelatase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ACO68892.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016851"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG553490"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="UniParc:UPI000199C92E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE35"
FT                   /transl_table=1
FT                   /translation="MTFASFLTVPSNASNVAATFASNRIRRRPNTEDKRTIISKVLAQA
FT                   ADRETKEDTAARPVYPFSAIIGQEEMKFAAIMNIIDPNIGGIMVMGDRGTGKSTTVRSL
FT                   VDLLPLIDVVKDDPFMSSPTDPNLMSPDVLAAFRAGENFETVKIPINMVDLPLGATEDR
FT                   VCGTIDIEKALTEGTKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVE
FT                   REGISICHPARFILIGSGNPEEGELRPQLLDRFGMHAQIKTVKLPEERVRVVEERTAFD
FT                   TSPKEFRDKYKEEQDQVIEKLSAARTLLPSVEVPMDIRLKISQVCAELDVDGLRGDLVT
FT                   TRAARAAAAYRGSTEVTDEDVYSIITLCLRHRLRKDPMATIDEGTKVLEVFSSVFGYDS
FT                   EE"
FT   CDS_pept        join(1216992..1217167,1217231..1217350,1217410..1217495,
FT                   1217556..1217610,1217667..1217741,1217816..1217921,
FT                   1217977..1218066,1218128..1218244,1218310..1218408,
FT                   1218460..1218626,1218685..1218766,1218823..1218945,
FT                   1219048..1219218,1219279..1219389,1219443..1219613,
FT                   1219674..1219901)
FT                   /codon_start=1
FT                   /gene_family="HOG000224126" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639902"
FT                   /orf_name="MICPUN_77461"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68498.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000199C92F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE36"
FT                   /transl_table=1
FT                   /translation="MLIADERQLYLRQRFIDFLDSSLFGNYHKVIEDLIESNERRLAID
FT                   LNALRQFSSDLATGLLREPGDYLLALKQAVEELVGAIDPKFLGHGDIHVTLTGGFGYHR
FT                   ISPRELLSPFLGKVVSVEGVITKCSCVRPKVARTTHFCEATGSFITREYRDSISTTGAP
FT                   TTSIYPTRDQNGNLLTTEFGLCSYRDHQTLGMQEMPENSPAGKLPRSVDVILEDDLVDA
FT                   CKPGDRVSVVGIYKAIPAKSMGSGITGVFRTVLVALSVYQLSKEVAAPALNHEDIQKIN
FT                   ELPRRMNPDGLLELLGRSFAPSICGHEEIKKALVLLLFGGTEKNLLNGTHIRGDINCLM
FT                   VGDPSVAKSQLLRCVMGVAAYAVSTTGRGSSGVGLTAAVTTDQESGERKLEAGAMVLAD
FT                   RGVVCIDEFDKMNDSDRVAIHEVMEQQTVTIAKGGIHASLNARCSVVAAANPIYGSYDH
FT                   SHGITRNINLPDSLLSRFDMLFIVLDRSDSKVDRAISSHVLDMHSRENPSLSTKLMLQR
FT                   DVTLAQGKNELESSMYMSHGALGEVLSKRFLQKYIYYAKHRPWEPTLTPGAENFIAEQY
FT                   SRWRVDKATESRARRTLPITARTLETMIRLSTAHAKMRISKSVDVVDASVAIDIMRFVV
FT                   EAEGLTVDKTNGTGPEYHQKDEG"
FT   CDS_pept        join(complement(1222614..1223198),
FT                   complement(1222496..1222552),complement(1222325..1222435),
FT                   complement(1222191..1222262),complement(1222012..1222128),
FT                   complement(1221867..1221956),complement(1221549..1221794),
FT                   complement(1221397..1221476),complement(1221270..1221335),
FT                   complement(1221086..1221212),complement(1220962..1221030),
FT                   complement(1220733..1220897))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639903"
FT                   /gene_name="HEC1"
FT                   /orf_name="MICPUN_107342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68893.1"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="UniParc:UPI000199C930"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE37"
FT                   /transl_table=1
FT                   /translation="MKDPVRSRSHLVALGASKRATVNGHNQSVGKQLDDYSVGSGGNGS
FT                   ACTFNREIYGQRIDFGRDCNAHVFSGHIPRVDPRPVGEKAFTNLCARQLISYLSTHGFS
FT                   SSLSPKAMTSPTTKEFASLVSFLFKVLDENFKLGSKSEEDITTVFKQLRYPFQISKSSL
FT                   YAVGSAHTWPYLLAALIWLVHVYIYEDEVKKVEQSKGRDSNFLNHTYRAYAYFLAGDDK
FT                   ASTTLEREFVSAQTEISRDLANGIQALESDNSDLHHALTEMVWKDDETVPLDKDYLLRE
FT                   ADVYDSSANALRISIENTESRHTHIITCILSNKTSIQDAAVVTAHLRRSAFIHGSDGPS
FT                   QSESNSGQGETESLVFALKTKRTTIENISHATNASIELDFTDWENGVSLLRDHAWNVQS
FT                   ASGVIGAPADSSSTSDHLHVPLEALETMDSEFFVSFRLAVNRVHNDKVHMQKNWCIERE
FT                   RLFAQNLQESQKNLQERMVLVNALDLNVCRHEHDYVAERNRIQSLLKVLMSNIAEIEEQ
FT                   IELQKRFPKNIVADVESILRHCQASCDLHAQRLRQEKLLTQNSMLAALDALMGHKQQVQ
FT                   DTFDVFHGNQHASSQSRN"
FT   CDS_pept        join(1223702..1223932,1224058..1224933)
FT                   /codon_start=1
FT                   /gene_family="HOG000264655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639904"
FT                   /gene_name="LAG1"
FT                   /orf_name="MICPUN_107343"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO68499.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG559221"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199C931"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE38"
FT                   /transl_table=1
FT                   /translation="MFSRSVFRRKLTRILRVTKVAFEGATQRFDVDIGRIPGRGWNYNF
FT                   HMSNIARWSIVINETLRLLNALTCRIFADELKGELRTPVFEGQTDFLVFLLLSLGLFVI
FT                   NWGLRLAIVEPLAALLLGSRSTRSRVQKFAQSSLEMIFYGAFSVFGASVVPKQEWFWPS
FT                   KLWWSEFITGESLFMTDELKLYYLLYAARYCQGAVSVFIEHKRKDFWEMQVHHFVTVSL
FT                   IGVSYAYGWNRVGAVVMVLLDPADVPLHIAKQFKYIGDARGGNTQKFMQAGADFFFVVF
FT                   MLLFGIMRLGLYPYVVWSAHIEARRYFVYGYGAWTCVVLLYVLLMLQLYWFALILKVAI
FT                   KVITSGTAEDVRSDDEDEDRNKIPKKNN"
FT   CDS_pept        join(complement(1225926..1226501),
FT                   complement(1225673..1225822),complement(1225524..1225604))
FT                   /codon_start=1
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639905"
FT                   /gene_name="CK2B"
FT                   /orf_name="MICPUN_107344"
FT                   /product="Predicted protein"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="ACO68894.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI000199C932"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE39"
FT                   /transl_table=1
FT                   /translation="MSTVERSNSRDGNVNTLAATTVDTIEERFPNKPTYLNQDTESTDD
FT                   ASTGNSSADEDEQSWISWFCSLKGNEFFCEVDEEYIQDDFNLSGLSSMVPYYDYALDLI
FT                   LDVESPNDDMLTEQQHELVESAAEMLYGLIHARYTLTSRGMVAMLEKYKQCHFGRCPRV
FT                   YCNNHPCLPVGTSDVFRTATVKIFCPKCEEIFFPRSKYQGNIDGAYFGTTFPHLFLMTY
FT                   GYLKPQKSSSMYVPKIFGFKIRDQNDGNNQSNDRHDLFGEKMHNRK"
FT   CDS_pept        complement(1227799..1230042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639906"
FT                   /gene_name="Mus81"
FT                   /orf_name="MICPUN_96848"
FT                   /product="Ercc4-like protein"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="ACO68895.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI000199C933"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE40"
FT                   /transl_table=1
FT                   /translation="MAARHAGEVVREATLERLRTERERKKRSREAIGANDAIDPFRPSR
FT                   AILTEGKLMIWDGAGWTGGSVGAPSNALNAGGHLCETVDNTLLAKRAKKAKGGPKAPWE
FT                   PGYRTAAFAIGCTLHRLYLEGRKIVGIKELQDESEASGLSNQGIKIRGDAAGVQNMADP
FT                   TARYRGGRGGGRRFEYNGWSCFDSSFIKAPHGHNVPLAMRWSNPVKIKLTDEGVEWCAE
FT                   WHAVAHRRGDCACVAFERNAVDAAIDNGPKARWEREVLEPWKREREKGAAISAAPGRAR
FT                   AAARMEQRSDVGSIAMTPIRARVDEQTSTRRGVRTADEFSSMSITQLKHMLELAHIQIA
FT                   GCSEKSELVELAFQHCASDTALATPGGRRSDDEVICIEDSDNDNDDQKGCEGVADHALV
FT                   PARDGTASRNLENVLLGHAPRLPTLLPGQRFGDVYDVVLVVDQRENMGGRTSRVKINRD
FT                   VVTDLCLQHDIRACVMHMEIGDATWVARKKDAARVGLLDDGEGCGDCHMLDAIVERKRL
FT                   DDLSNSIRDSRYPEQKYHLKSLGLRGVSYLVEGDFRHMDRFDRNEASGRAVKSATVQTE
FT                   AQDGFEVIRTFDTHDTLQLYARMTRALADMYAHLTRDDSSEVLCDASTGPNQAADWDFV
FT                   VQEEVVPRPPTLWEFNQRMKHAKQQKLTVKNVWGSMLMQVSGLGVEIATAIIRRYPTPG
FT                   HLRRAYDRCMPDSTAAANLLAMLPSSKSRTVGNTVSRAIFTQLFGCVFTPAIK"
FT   CDS_pept        join(1233040..1233056,1233120..1233180,1233265..1233321,
FT                   1233374..1233428,1233495..1233586,1233640..1234008,
FT                   1234072..1234164,1234225..1234264,1234334..1234767,
FT                   1234819..1235004,1235053..1235133,1235205..1235303,
FT                   1235370..1235609,1235672..1235849,1235927..1236072,
FT                   1236153..1236683,1236746..1236934,1237007..1237067,
FT                   1237148..1237470,1237547..1237665,1237752..1237863)
FT                   /codon_start=1
FT                   /gene_family="HOG000255527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639907"
FT                   /gene_name="WDR35"
FT                   /orf_name="MICPUN_107345"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO68500.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG358323"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C934"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE41"
FT                   /transl_table=1
FT                   /translation="MFAFLSKKIALPNSVQVNCIAWNSTQGWIACGGKNGMLKVLLLER
FT                   MSDGGSNLSMNQTLQGHEGAVMTVSWNENYQKLTSSDQNGLIIVWTLHKGMWFEEMINN
FT                   RNKSFVRDMKWDGSGMKICIVYEDGVIIVGSSDGKRLWAHEQNKKLTLVEWSPDGQLIL
FT                   ASTAEGECYVYDAFGHLCDEFILFPSDRHTVGPLTCMTWHLQNSSCSEISRPSLAFGFE
FT                   KGLVQLMRDEKDRDPLIIDVGISIVHLKWNIDGTILAIAGVSSNSSDPREISKVKFYDP
FT                   RGNLLHILRLPGKAINSIAWERTGSRFAMAVDSFVYFADIRPSYRWGNLQNVIVYAFTK
FT                   LGREEDCVMFWNHESLQKHAKYIKSLIAICTAGDNCVLVSKSTIADNFLLILCDSMGTL
FT                   INSTRVKVNPLFTAMTEQYMVVASQTCVYLWSVDGLGESGILSSRFREEERKEHDSLES
FT                   SASMRCAMDRYHNQMPFVDPTLRSCDDHICALAVSEQYVLIGMQSGVLECYRLPPLNNL
FT                   TVKYKLTSRPRHMSFNCNSTKFGVIDVNGLLTIFAMDTESLDEPCKTLNPVLINHRNDA
FT                   WDLRWSDDDPNLYAVMEKSRLYIFRGNSPEEPIVSQGNICSFCDLRVTAVLLDEVMKDP
FT                   ERPKKEHLILNFETKSLRDMRRLLNRNVYFREMNFAVANDHHCLWRLLSKSALGKQEYV
FT                   NAYQCFVHCGDYHGVQLIKRLEMIDDENVREAVLITYFQQFEEAEDMYTHNNQLEHAIN
FT                   LRSKMGDWFKVEKLLHNICAEGKALAWIWDKIGHYFYERQKWARAAPYFSRSSNITKLA
FT                   ECLYLQENFTSLERAADRINEDCNASSALAHLFTSAGMCEQATTAYLHANDAESAISTC
FT                   IVMNRWEHATTVVGSLEFHQDMDMVINASAGMQGERRHLVTCDLLRKANRRTDFLLWLC
FT                   RMFSESFALKSNALHMKKINVLLAMEATKVEQIPSTEISHGKLKRGGDLSNKDLFQMSA
FT                   NYFWRQAEAYHFWILAHRQLYEGQFEYASRTSLILEEYEDVIDLAHTQSLIAMASYCCR
FT                   NFSRCSRSIMKLGRLDASISLTSRQFSDMTSPIFMQRSPAHHNMNQDHEAFTSIAYALS
FT                   YAQLDSITSNVCFASGRQFGAGHDSEKCKTCSRSSIVSKLGVRVACPLCHSVM"
FT   CDS_pept        join(complement(1240393..1240539),
FT                   complement(1240264..1240331),complement(1240192..1240205),
FT                   complement(1240046..1240128),complement(1239868..1239990),
FT                   complement(1239780..1239807),complement(1239672..1239715),
FT                   complement(1239515..1239610),complement(1239434..1239449),
FT                   complement(1239360..1239373),complement(1239263..1239297),
FT                   complement(1239127..1239196),complement(1239043..1239072),
FT                   complement(1238918..1238962),complement(1238687..1238860),
FT                   complement(1238521..1238622),complement(1238309..1238465),
FT                   complement(1238181..1238251),complement(1237955..1238119))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639908"
FT                   /gene_name="RPC3"
FT                   /orf_name="MICPUN_107346"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68896.1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniParc:UPI000199C935"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE42"
FT                   /transl_table=1
FT                   /translation="MSHQRIHDQYEISLACGIVTESFGKDPGKICRAMLYHGSRTLRET
FT                   VQETGLSPSRSQRALLILAQHNVVLVIPESRDEDECQYYTKLGVILERLRYPQYLLFAQ
FT                   EHYRGSHNLLIECLLENGRLDEHQLMAGIASKTESDRIGLKRAIVSSSRQALAQLAEDQ
FT                   LIISVPLFIESNGTSRSNFVTRGQTSVSQNSVPSQTVKKIDDAGRKTEDDIKEGKQNNL
FT                   WLINCDEFTFRLRRDACAAVFREKVGEPARHLLLEEVEFNNEAFLLSNKIDTPRKSVHG
FT                   SSFRDYSGLVQTLPNLKYSTCQSCINNNEAHFHNIKLKHVMSLVRSKEIEAVVRERFGG
FT                   PACRIFRLLLMKRNLEQKQIAEMAMIPVKDTRELLYKLLKAKYVQIQEVARTSDHAPSR
FT                   TFYLWRVDLPYVEEQVGREIHHATFNVRARLMFEMSREQETLLLLGKAQHTNDFPLTMK
FT                   QRDSLIRMKTVAARLECSMMRLNELGLFFNTRADE"
FT   CDS_pept        1241215..1241637
FT                   /codon_start=1
FT                   /gene_family="HOG000100757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639909"
FT                   /orf_name="MICPUN_98547"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68501.1"
FT                   /db_xref="HOGENOM:HBG558963"
FT                   /db_xref="UniParc:UPI000199C9B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE43"
FT                   /transl_table=1
FT                   /translation="MDSAANHASQPRPRQGNSAPNSDPIMKRETDKNNKYKAAATAVHK
FT                   EFIPLVMDTYGRMGKPFLNFLKDVAAHTARRASGNVNERTQAIYDSIDPPNELRNRIHL
FT                   RNLALVHVALIISLMQRVAGSTVTNDRQHGARGGMY"
FT   CDS_pept        join(1242959..1243036,1243094..1243597,1243657..1243908,
FT                   1244020..1244274)
FT                   /codon_start=1
FT                   /gene_family="HOG000264413" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639910"
FT                   /orf_name="MICPUN_51651"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO68502.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG559225"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199C9B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE44"
FT                   /transl_table=1
FT                   /translation="MQTLSAPKSLGATVWHRKRFAAQPKLCHLPTRISGKPRVESYAGN
FT                   HPANADGLDARPTFPNQNISRRAFAFSGAVFVPVKAARAIGFTKQLKKAQVSEEDYAVS
FT                   QPFLFRAKSHDGVKYFDTQPGSGGKLQLGNIAVVHFTCKYRGLTALSTREARTLGGNRT
FT                   VAEPMEFTYGVVPSEFSKPLVRKTVVGIGAEVRLDPELQELYIVSTVFNGPADRAGLQV
FT                   NDVIVSIDGLRNLAELPISRIGTLLTGDTGSTVEIEVKKLNGPMRGTFERMILTRQATT
FT                   VVAKKRTVNVETGGGLFAGTSGPKPPPIVYIPEALAGMRTGGRRVIIVPADVGYEDTGE
FT                   GEIPPGAEFKLEVELLETRNAA"
FT   CDS_pept        complement(1244664..1246616)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639911"
FT                   /orf_name="MICPUN_55300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68897.1"
FT                   /db_xref="UniParc:UPI000199C9B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE45"
FT                   /transl_table=1
FT                   /translation="MPTIQRANFHTTRSHRRFDIYTVYVNNISKFLKSFWSSRRQLASS
FT                   ATFPQRTLFPQYLPLERQLEERLLSCPVDSEIVRDIVRQRPYFAIYRVPFIYSPPSEQA
FT                   EYCVTTRGTETRLNAMNLNTFPGLGEDFQNSDLRSKLPLNGAKKVKIPKKRPDGTHAEN
FT                   LWVQDAVSPSIVYPKKNPPSGPPVTLDDIVGLDVGQRVPRLSSPRSIKACLEMGVDPVD
FT                   LEMPVVDDFHDEKVDAAIWLLKYDHALKRREQILSQLQTMRENYLTEDVLEEYRPSIGA
FT                   LAKTELNDAKISGSMQMAYGSKTSFDEHQRRLERVLERNYLSEIQSIKENERKYVPQYK
FT                   EEMERELRKTRARHAALQQRNQKEEQWRNKTRDILDWQQARIDAKKMAQDEDDKRWEHM
FT                   MQERKEHFENTKRVLSDAYQNKINRARAIANDRLNTRIRGILDREEKRTSKMRVVEEER
FT                   ERRASQDRFQMRQKEEDRIRAYECAMQTQKNREERFQAEYESSMRLSEEVRAANEFHRQ
FT                   MRLTERKLIFEDRKMKSEMKQNQDALYRFKLKQKIDRETAKVQFIKRLKEDLKSKAVKS
FT                   NVAQAFKKEQQREQAQKMLHASYRHEATPQSFTKGSKVYGRHGTARRESTRSSLLAENT
FT                   SPNAFYERGITKSSE"
FT   CDS_pept        join(complement(1251608..1251769),
FT                   complement(1251286..1251537),complement(1249152..1251188))
FT                   /codon_start=1
FT                   /gene_family="HOG000176133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639912"
FT                   /orf_name="MICPUN_93101"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO68898.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG718069"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C9B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE46"
FT                   /transl_table=1
FT                   /translation="MPSGEDLLFEEELLRTPDSVQLWARYLEARKEPDCPRRRLIFERA
FT                   VRTLPGSYKLWHAYLKERCEATRDLCITSRVFDSLNNTFERALVTLYKMPKVWELYLGI
FT                   LVKQRSITKVRHTFDRALAALPVTQHERIWKMYLVFVKRDFIPIETARQIYRRYLKFEP
FT                   GHAEEYIEFLKARHLWSEAASWTAEILNDDTFQSLSGKSRHDFWVDLCEIVTRYPNDME
FT                   VINVDATLRGGIEKMDFETGRLWASLADYYIRRGLFDKACDVFEEGITSVNTVHDFSLI
FT                   FDAYAHFEESTLNAKLVIAREDGDRADAKSNEDHGADFLKGDTGDDVDLRLARLEKLVG
FT                   RRPELISSVMLRQNPHDISEWKKRVSIFEGDPERQILTFTEAIRSVDSLKAVGKYNMLW
FT                   VEFGKFYERHDDIVNARVVFEKAVRATYRKVDDLATVWCEWAEFELRQNNFSHALTVLR
FT                   RATEEPPKHAGDVVCVSRAKSLHVQQYAFKSLKLWTFRCDLEESVGSFLSARDCYDRMI
FT                   NLQVATPQTILNFAAFLQEKGLNEDSFQVYERGVNLFNFPHSRDIWRAYLHEIVKYFGG
FT                   DRIEHTRDLFEQCCVNAPANHAKFFYLEYARLEENFGVARRAMDIYKRACQSVPDGEKL
FT                   EVYRIYITRAMHFFGIDMVRSIYQKAIEEVISRDLAVDLSVQYAHLETKLGELDRARVL
FT                   YVHASQFGNLAERTGFWDEWNRFEIHYGNEDTFREMLRIKRSVSANVRQMHFNVAVTDI
FT                   SSGGTTESGGKGEGQIPAEIMPVVRDVDGQRAADPLVESSSRIQASLVSGHNPDEIDVD
FT                   ITGE"
FT   CDS_pept        1252902..1254335
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639913"
FT                   /orf_name="MICPUN_55304"
FT                   /product="Predicted protein"
FT                   /function="selenium binding"
FT                   /function="thiosulfate sulfurtransferase activity "
FT                   /biological_process="selenium compound metabolic process "
FT                   /biological_process="sulfate transport"
FT                   /protein_id="ACO68503.1"
FT                   /db_xref="GO:0001887"
FT                   /db_xref="GO:0004792"
FT                   /db_xref="GO:0008272"
FT                   /db_xref="GO:0008430"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="UniParc:UPI000199C9B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE47"
FT                   /transl_table=1
FT                   /translation="MTKRIILLQPFPERGSFSQRTNFPNFCPELLRSKVMNGIKDAEIG
FT                   VETLIRELRAGAILIDVRSPSEYAKGHVPGAANLPLFDDKQRGKMLTVFAKQNHELALA
FT                   MARRVLRPELQHFLTRVMGMVRSRRRVEYSRGSTSKMPFVIYLYCWRGGMRSRTLAWFL
FT                   MHSARPGLLDCHVIRNGYKAFKHFVSSRWSTLTQEELKGDSAAEASSGFRRMEPCIEGP
FT                   WICIIGGRTGVGKTRVLHALRDAGERVIDLEGVARHRGSAFGWVGHSSTQPPSEHFSNL
FT                   LAIQWVSQTTPKWIFIEDEGPHVGKCSVHPALFQRMRCAPLVINIVAEKQTRLHVLLED
FT                   YVTDMRDADNTWSRAMLESVGKLHRRLGRDQTEALQLFLHARNYMAFADGLLQYYDNMY
FT                   DMHLGKSRADGRALRRIGADVEAVRRRQGKIKEVHAFPVGRHSEKLVTNPHPGSLDIHR
FT                   LTKDVLTAVLDFVTNRTSP"
FT   CDS_pept        1254840..1255085
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639914"
FT                   /orf_name="MICPUN_51654"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68504.1"
FT                   /db_xref="UniParc:UPI000199C9B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE48"
FT                   /transl_table=1
FT                   /translation="MFPIYLCYLSSYGVIGFYTIHRVGPSLTARPETLIHGREGRVNTG
FT                   WPSPHLVQKVFICDTTINFRGGPLLAKLTSISRRPW"
FT   CDS_pept        complement(1255541..1255945)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639915"
FT                   /orf_name="MICPUN_55305"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68899.1"
FT                   /db_xref="UniParc:UPI000199C9B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE49"
FT                   /transl_table=1
FT                   /translation="MAHPWTALGVDPDTDGGIAYLFGSSDDAGSSSALTEADPAAKASA
FT                   SRSSGAATAERVCSSSPQLLPERTDGLSEDAPRAIGQRVERNGQWPHGRGVAPASQDHQ
FT                   DRQEHFWRPSGGLQGRYKRSGVEGLLRVLL"
FT   CDS_pept        complement(1256078..1256365)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639916"
FT                   /orf_name="MICPUN_55306"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO68900.1"
FT                   /db_xref="UniParc:UPI000199C9B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE50"
FT                   /transl_table=1
FT                   /translation="MGGNPAREEEQALTVEALNDQIYLMDAQAEAVNALEAAFSVDDAF
FT                   KDDSVDELETEEDARSENMKKALEDIRKIFVVSDIPEEDIPDEFKPRDMK"
FT   CDS_pept        complement(1257091..1299540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639917"
FT                   /gene_name="PKS1"
FT                   /orf_name="MICPUN_107347"
FT                   /product="Modular polyketide synthase type I "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="phosphopantetheine binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO68901.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199D590"
FT                   /db_xref="UniProtKB/TrEMBL:C1FE51"
FT                   /transl_table=1
FT                   /translation="MQMTFASSIDFRGQGSSFFDSLRRLPPNPDEDTSVQKYFRSSVLD
FT                   ARTVIALDQEQDNVETNDLKTNTRIHHCASSQDSSAFIFADGGHIMYKSGWLTQDLDRF
FT                   CVRSCDRALNASAEDFKRSIEVRNLPASMSSSPFALSEYISDVNDDACYVNCADGAAKK
FT                   IDNHDDVSYAYVWSSPVSIPHIFVRQMIDFNPFFSGNFFCKQIVNPDAQGYSKCMLQCG
FT                   VKLQVTTTQIQFGLGNLKGMTEWTRGVSMVSVSSSSWLALYWRLHKLNSCLPHGDRLGI
FT                   VLQNKNQSFVVCGSRVGIYRLIGPRSVSSKSTGMRGFPSSIPLHSSPFLGNAIFNIFYK
FT                   VVDHVKRCYASSHRQAFAALSKPIPDNDCGGFITAVTLYLICNAVSWPESASLTRIMID
FT                   MFQRYVSSTEILDCRWPVRVARHGSSKAISTSQSETCAVFKNTKAMQYATILLKRISIL
FT                   ACEQRLFWTQNIVFPSSCAYNKGFITRLSTNDVDEIRLLNAAINMFNLHPSLYERKNRS
FT                   DYPHLHMQNYEAPNVPKIQIFSLEEYGLATASPEEINAEHPAVIAACSEAIDTSTGAFF
FT                   RVYLAGKHAVLVLVHHIVCETMSLANLAERFSEAYLSPDVSWTIREQSTSFECSSFTQD
FT                   KLDFIFDASAQAYYSFALLSHKLDTWHRMLTNEDRTFTLFSLKNDYICRSTGIANGCGT
FT                   IPQRKRPCCNIKLNISTEFAIALRKCSNMRERNVFATLASSWSLVVRRQSGYDCNNNLV
FT                   DSLTFGSSVDLRNLSGLNEFHSIGCFSAMLPTRCEFASVHNGLFDGLAFRIHIFCQAVF
FT                   ELMDVPLMGIIDRIDLGSKRCKTEGNPLFTTCFSFVSHSQLQKASGIDGVISDKKASLA
FT                   RFYEAAFDIWLGIGEMGTASMMGNLMYDATIFSRRSAASLLMSLKASLKQVACKPNISL
FT                   SAADEWIIKSNIDMHALNSGTVSNFDTNYAVRTLCDMKLGYKDSIRLWRPSQFLESGLL
FT                   SSSTSTVSDIGGNVTLSFKTVHFQASILASKLKSAYEGTRQPRMSLFSGNSWCSLIVHY
FT                   AASLVGGIIGNHNVHLAGSEFAYQLKLFDPELVVVGAGDRLKTVFDDAIGTNQVELNNL
FT                   YPEFLRLPWSIEASHAMLSIETGNFPVQTTDVTVHPINKPYMLYFTSGTSGKPKGVVLD
FT                   QNAISSHAVGTVCEMRLNSHDIWLHVAPIFHLVDAFSVYAITAVGGHHVMQAVFEAAAT
FT                   LRVIEREGITVLNLASTMVALMTSQATAEIVHLDLSSIRVLSCGGSPITNSTVLQAVGL
FT                   LCSEFFVSYGMTECCGKISVSLLESDMRENPNYRTKDHINAICTSGRPFRVQMVRIVEP
FT                   NGKLIVPGNHRIGELQCKGITLFSKYVESCRASDMFDSGWFTTGDIAMVDSNGYIIIVD
FT                   RKADMVIVGGENVYTNEVENALLTHCAVNQAAVFGMDAELLGQVIYACVVLKPQCIGNV
FT                   KEEDLKDHVKETLSSYKVPSKISLLKSLPHGGSGKVLKSELRKLALLGRSGGQRCSAEI
FT                   DFCNDKANACSLEDAKVASHSQNLRKCLIILESNMDILVLPKVAQLVTKIHGFETLVIW
FT                   LAPMLEANISGQDFYRLFLPSLNNVNVTVHVMVIDMRDICQITASCCSIWQLSTKATKS
FT                   VELVMKIDHGCRHTTCSEGVFYPEALNHYFSRLLLYVVCGLAANLVDINLANYGIQQFR
FT                   CHANPSRLMFHDMAEVQRRTCVVLESVFGKKEHQEISLQTRLWDFGLTSILALSLSASL
FT                   EDEFNHNFPAGVVFNHESVSQLAKFIYDEISVAVPSKEHFDLSRQVPTMICSSETFVVS
FT                   ASQVESLYSNQPIKSSADVQTSLGSNLCLDNLCDDDIAFDAVTMIILSAIHKVFLVADG
FT                   AYDHRPNTKEVIHKNRAILKSAFEGTIKDIINIDEAFWLIGLTSKAASQISDDLSIGFH
FT                   KDIPAVAVFDYPSINDLSAYIKRRIGSDHEYSEDKNKLDISSKLEPYGIKGSVLSSLLE
FT                   HCGRQGVVVNASHLTTGMAESLDYNFICHHSNADCITSIPRSRWDPDPNHSRRLHRHFG
FT                   NLLTTIDDFDSDYFRCQRAEAELMDPQQRLLLHRCTLPAIDIRSNDTKCGVFVAISHID
FT                   YAIELYSLRRPLSPYMATGSANSVACGRVSYTFGLTGPCASVDTACSSALVGCHFLNGC
FT                   ILHENLDYGIAAAMNLCMSQERYMIFYVAGMLSKEGRCKTLDAAADGYVRMESCCAVAL
FT                   VRSQHREHCKQAFCASVSLPSSVLNQDGFSSSLTAPNGPSQQALICRAMHISKADPKQI
FT                   TTMQMHGTGTPLGDPIEVGAICDAFTMIDRDIFGFALHSIKSILGHAETSAGALGLLQA
FT                   TQSLINARSFPLTHLRSLNTHVSLSLQRFYKITKGGDIISPSQDSQLATLCRLGCKTTE
FT                   LHFPSHQMTGVSSFAFQGTNAHLVVASTSSEQTVKNHLKEKSACLWRNEKVLIKPHLHA
FT                   FIQCAVQHLGNKSEYEFCIGFSSPCSSWLMDHRVGQYAIFPCTASLETADAAVNFGRCN
FT                   RFSSCSTYCSFSLATLANMTLPFPIVLGKSTEENSIIFVHLDNNSGEIIMQDRKPMIFF
FT                   KACASEAILEYRRASKKVQAINSIRCRGLHMFDLTSLKNHNNFSQTSVKPSTFDGQVEA
FT                   HKTDQIESQMKIIHRRAGFGQIVIRRDYAADGTWTHPAGTDCSLQVAFCISSKKIEKTI
FT                   IPVSAQGYTVPEQYNRQGGVMLSSVFIDISSKATHVLDGPRAYRSGANVIINSLASRNV
FT                   LSFTARQATCTIKKPSILAESTDSDIMYIMSWHAVPARTTPLQRSFRQNCNTLGTYNHR
FT                   NVSLKRINANGLASIAILQSLNSQLTEANLNTHARCYRVSPEISFVALHASVRMAWCVA
FT                   HVELPTKTRLVSLRWSPNYQLARSLLPEEISCPEHLTRPARIDNADERTLSAHGIANDA
FT                   NVQFTPAVRLCMTISGLKPKHVIETSFLIRSIFKKQQSVNKVVEHAPPGKRKQQSVLLT
FT                   GGLGGLGYLLTSYMIHVARSRNVLVGSTSGRASKLNPASTFSHALYNIIRSNIGLTDET
FT                   RCALVGEGSFLASQLTTIIHAGGRLNDATISNQTVGKFCSVSSPKFIGLQRMAEAMMNS
FT                   YALDNFLLFSSIASLIGSSGQINYAMANSAMDEFAELMQNVGTPILSIQWGAWGEDFDG
FT                   MTSGDRRVLTKMRHHGFGVLKPEEGVLALDHFSTPSVAEPSSAIRIITPLDHQKLCEPK
FT                   SLASKLSIFDQFSQNMACVPGDRTITPFKYTDVECKVANLVTEYIGIQVSSNDILANKG
FT                   LDSLGAIELCNSLAQTFAVTLPSTLLFDHPSIECVTRHIRGLLDLSDRTSVEPDSVSPG
FT                   VRGYSDENDHRSCQLQDLMKSCAQKILQTPIDVSRSLISAGLTSSTAFKLSQEISSKIG
FT                   FQVPSIAFFKYSTIHELSGYLRGHDLLVQKFQSADPFLLEQKRLIIASKSNYCMSVNER
FT                   LDNVGCSPFSRWQVGDNDLFSCVPRFGVHMLEIGTFDMSVFEITFAELSRMDTQHGCLL
FT                   TTSYNALTALEAHHDLQLRKGYEVGVYVGISSTDHHVLCRKNHLTSSLSSSSFDATGGA
FT                   HSVAAGRISFTHGFTGAAMAIDTACSSSLVALNTASAMCHRFCFSNNVACVASVNLLQA
FT                   LYTTMVFERAGMLASDGRCKTLDSVADGYTRAESCIAIYLTDAIEHVVTAAMSAGTILS
FT                   SAVNQDGRSSSLSAPSGVAQQKVICNAINLAGLERDITGILLHGTGTALGDPIEIGAII
FT                   LVLKSMQERERDFSDLFLVALKSSLGHSESASGMSSVIHAISSIAQSNVCPTVHLRILN
FT                   EHINAHYGTHHLLNRVKTSFGPRLFRIPASLVANIKQDVTKAPRCCSHRKVLSMSGFAF
FT                   QGTNAHALVSTLQNNSCPHSKTVAGLDKSPNLLNTWHMSSRCKEEPHPFISSLELTAGA
FT                   SFSIQLYSRLGFPFWHAFIFDHAVHGRVIFPAAGFLELSAAATTFSAKGIYSGIEHVTI
FT                   PTPLILRSKKWDTPAVINVLFSKVLIGFGNIEIRTKKCIHVNAACTLNARVKSVAATSR
FT                   TSLNFFEKTSMNETGSYALKTDTVTCQARVQLSGVSNRESSEYSSFWMNPSVLDAGLQL
FT                   ASTCSRAGGNIARLKIPA