(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_13

ID   MICSR_13; SV 1; linear; genomic DNA; GRV; PLN; 1276107 BP.
XX
AC   CP001575_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 8, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001575.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1276107
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 8"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        complement(462..1496)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640212"
FT                   /orf_name="MICPUN_84418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69332.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C4C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF90"
FT                   /transl_table=1
FT                   /translation="MENDGRVVELDLEDVDLTAALPAELGRLSALRELNVSRNALTLLP
FT                   VEIGQLTSLVKLSLTENQLTSVPAEIGQLASLRVLDLSDNQLTSLPAEIGLLTALQELY
FT                   LYGNQLTSVPAEIWQLTSLRKLLLDDNELTSVPAEIGQLTSLEVLGLTDNQLTSVPAEI
FT                   GQLASLTESGLSGNRLASVPAEIGLLASLTELFLSGNQLTSVPAEIGQLTSLQELWLDD
FT                   NELTSVPEETGQLASLMVLSLRDNELTSVPAEVGQLTSLKSLYLYGNQLTSVPAEIGQL
FT                   TLLTELFLDDNELTSVPAEIGQLRSLEKLYLDDNKLTSVPAEIRELRAAGCNVELDDGV
FT                   TVDE"
FT   CDS_pept        complement(2209..3675)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640213"
FT                   /orf_name="MICPUN_112715"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO69333.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C4C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF91"
FT                   /transl_table=1
FT                   /translation="MRDLAARALGANHVWVSLFLGVCMQLCAGTLYSVTAWGVTLKEVA
FT                   GWNSDESLGVAETVGTMGINIAFHNGFLVDRLGSRPMSAVAALALFSGWHLLANVASSG
FT                   GSPSAAALALWLVGQGSITAFMCSLDANVGNFSEENQGKAHGLLLSGFGGSAALFATVY
FT                   RSHFAGVPTALPSFFRGAGYVTAVVCIAGALLLKDARHGDKSKARRVVCEEGEEGEGPE
FT                   LVGSRERSDGIEMSTMSKDGGMSRAQMESFANLHATTHGTDDGEDETTWQYLRGVAGRP
FT                   LYWVIFVIVACTIGTALLWVNEAGSFTHVLTGSRKGLSNMVVAFSLGNVFGRLGAGWAS
FT                   DVVELSFGAPRSVFLTFGGGLFSVSMAALAGSERTSSSSRMFSAIGVGLAEGTVMSSWT
FT                   AIVRRSFGAERFGLNLAVYNFAMAIGSGILNGLAAAATETEDEQKEINNLRLVFWVAAV
FT                   FNALAAVIGIVATRILREENARMGYQMTII"
FT   CDS_pept        join(3786..4566,4617..4633)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640214"
FT                   /orf_name="MICPUN_60434"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69040.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C4C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF92"
FT                   /transl_table=1
FT                   /translation="MEAGEDGSELIGQLAALMEQLTRGGGLEGIPQELVEAQRADRRRQ
FT                   KEIEDRRVAEAASAAANAPPERVWLDAVMPSISCLSCIDEMLHTGEDLCPRCRREGRTG
FT                   GGDLPLVVKVAVLYQAADWNRRETISRILETDVDVDQVSAQDGDGRTALMVAASSGSLD
FT                   ACRELIRRGASARAMDAEGLTPLLHACWGRSPGCVKELLESAGADPNQADFCGETPVMV
FT                   AARLGDVESLNLLISHGCDLSLRDENDWDALGKAKARGGGDRG"
FT   CDS_pept        complement(4709..8308)
FT                   /codon_start=1
FT                   /gene_family="HOG000216677" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640215"
FT                   /orf_name="MICPUN_107017"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69334.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG396780"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199C4C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF93"
FT                   /transl_table=1
FT                   /translation="MFLYNLTLQKGGGVQCAVYGNFSAPKAQEIVVSRNKVLELLRPDE
FT                   SGKMQTIVSTEVFGVIRSLAAFRLTGANRDYLVCGSDSGRIVVLQYDKERNRFDKVHQE
FT                   TFGKSGCRRIVPGQFLCVDPKGRAIMIAAIEKAKLVYVLNRDTEANLTISSPLEANKSH
FT                   VVAFHVAALDCGLDNPVFAAIELDYADADQDSTGEAAAEAQKHLTFYELDLGLNHVARK
FT                   SSEPIDNGANHLIAVPGGGDGPGGVLVCAENFIIYKNQGHPDVRAVIPRRNALSGDRGV
FT                   LIVSSATHRTKQQFFFLAQSEYGDIYKVTVEYQKGTEFVSEVKIKYFDTIPPCVSICVL
FT                   KTGFLFAASEFGNHALYQFQGIGDDEDDVESSSATLVETDEGYQPVFFEPRALRNLHPI
FT                   DDVESLCPVLDMQCHNLVAEETPQLYALCGTGPRSTLRVLRQGVALSEMAVSPLPGNPN
FT                   AVFTVRKSASDEFDAYIVVSFTNATLVLSIGETVEEVSDSGFLGTVPTLSASLLGDDSL
FT                   LQVHPGGLRHIRADKRINEWRTPGRKTVTRVTTNARQVIIALSGGELIYFELDQTGQLM
FT                   EVEKLETSGDVACLDIGPVPEGHLRNRFLAVGSFDSTVRILSLGAEDCLQTMGVQALAA
FT                   APNSLLMLRDDGSGSIYLNVGLTNGVLLRADVDSVTGQLSDTRARFLGARPPKLSAVSV
FT                   QGKAAMMALSSRPWLGHFDLANRFALSPLSYEPLEHAAPFSSDACPEGVVAVAGNTLRI
FT                   VAVERLGEQFNQRTCKLRYTPRQMSVNVDRNTLAVVECDQSSVPYDERTGLEGAAGEKD
FT                   TKMDVEGEEDDEEEDEVTMTPAEQFGAPKAPPGSWASCVRIVDPASASTKQIVEMTGNE
FT                   AALCCCHVYFPQADELFLAVGSAVSLTFSPRDSEGGFIHLYRYTQDGGIELFHKTPLDG
FT                   VPGAMCGFKGRLLVGVGNTLRLYDFGKKKLLRKVENRNFPNFIKTIHAQGERIYVGDVQ
FT                   ESFHYVRYKREDGSMYIVADDVQPRHVTAACPLDYDTIAGGDRFGNVFVSRLAQDVSDE
FT                   IEEDPTGGKTAYGQGALNGASHKINQVTQFHVGETVCALTKGTLQAGGLESMIYATLMG
FT                   TLGALMPFGNREDVDFCTHLEMHMRQELPPLLGRDHLAFRSSYFPVKDVIDGDLCEMYT
FT                   VLPHEAQRRVAEDMDRTVSEVLKKLEDLRAKVA"
FT   CDS_pept        9288..9965
FT                   /codon_start=1
FT                   /gene_family="HOG000070724" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640216"
FT                   /orf_name="MICPUN_84119"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69041.1"
FT                   /db_xref="HOGENOM:HBG600305"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniParc:UPI000199C4C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF94"
FT                   /transl_table=1
FT                   /translation="MSRYFVVYKYGSVVFFNMGRRERDECLKLARSFTKTPIAVPCTDD
FT                   YRVMVRPGMEGWAEFAADHVVLKRLDLNNISVIGTVLAQTVALEHHELKVDNMIEIFSG
FT                   LNKTTEETGEMDISKARLFKLVAENNNTLTELVTRMRLLGRSDTAWQYSQYDKVWSGLR
FT                   ADFELEERFDHLDYKLNLIQTQSKFYLEILQNRKSDTLEWIIIVLISMEICVSLYDMYS
FT                   KLG"
FT   CDS_pept        complement(10028..14074)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640217"
FT                   /orf_name="MICPUN_60437"
FT                   /product="E3 ubiquitin-protein ligase "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69335.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C4C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF95"
FT                   /transl_table=1
FT                   /translation="MEPGSSDSDEERDGDLAGTLRAALPDVSRSAVRGDDAFRRARGTA
FT                   PVDDQRSVRSASSMTRVPLPTRAPAPTRRPSPPPHPPASCSSSGAPTRRPDTVMTHVAS
FT                   ASFVLGPAHHGSTRILDETGARGRRRGHGLGPAIAAAAERRRAAELQAARHLHERHVAL
FT                   YAWGRCDAGQLGFGAGGFGAPTSRDSSEAAEAYPTPRSVSSLDGRDVTHVAGGARHSVA
FT                   VTSAGEVYAFGDCSGEGKALSAPTRLREAVIDPPEVTATTNAMPRVATVACGQRHCAAV
FT                   TTSGVLLSWGNEEFGQLGQGPPRDSSSKGDAKSLIRRRADASMMPRLVGSGHVKFTSVA
FT                   CGAGHTLALTANGRVFSFGRGAFGALGHGDRLNCDVPRLVDALWGVGVAQIAAGDNHSA
FT                   SLSASGRVYTWGRGKYGALGHRDVDNRSRPTPVQALDDAGVRCEQIACGGDHTLAIAGG
FT                   GSGVLLAWGRGSSGPAGTGATADVLTPTIIDRALLGDEKVFQISAGSKHSVAVTEGGCV
FT                   YTWGARTQGQLGHELGDAGTSEHGVWKLSTGGGAAVSAVAKVAGLPAGRDVLYAVAAGD
FT                   HTFAAVAPGKGAATTRGRAPWSGAHGWSLRAIELPPILELAESITALDPEVDADECHRI
FT                   VPELIRAVEDVFSSPGFIVEGFAAPRFAEESESDARTSGLDVTSVEAVYSALCSCGRPE
FT                   IIAALANASAKLLEALLDALQRAKTDLEDVNDTRVVVAAMIVLWMSPLNGDPALGDTLV
FT                   PRLVAVTEQLTATGVGDLLIPWLAADIDADVFERRLVSPLMGFLTRSLGKDLARKHHKG
FT                   RGLVGSIGPSGRTSPGGGMDVFAVRAAQMLGMLHAANEIRQKQTGEPIVPASVFYSQSL
FT                   SDSLNLREEYMRLIQLDADGLGTGTWGGDRMNSYPACLRPGELVTFCQLPFLLTAEAKG
FT                   RILQGEANLQKRHEMRMSHLSAIQNGQFSNDLPFGSPDAPFLELVIERGNLLKNALDAV
FT                   ASKTPADLKKPLRIKFKSDGVEEEGVDEGGVTKEFFQLMVREMFKDARTFVEFSEHGSE
FT                   DKNSSLAPPMFTLDEESRYHWFNPAASVSAESLARFRLFGAALGLAIYNGVCLDVHLPP
FT                   VAYRRLCGMEPTLVDLCELSPSLGEGLQTLLDYDGDDIEEVFYRDFVVERFDAETGRTL
FT                   TTELKPGGEHTAVTGGNRKEFVKLYVQHALDKSVSAQFGAFKAGFEQVCGGPALGLFTP
FT                   TELELLVCGDPEIDMKALERVTKYDGGFDADHRAIRDFWSVVHSLPIADQKRLLFFATG
FT                   CDRAPVGGLENLPFVVQRSGPDTEHLPTAHTCFNVLLLPEYDCQEKLRDRLAVAIANAE
FT                   GFGLQ"
FT   CDS_pept        14484..16154
FT                   /codon_start=1
FT                   /gene_family="HOG000007134" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640218"
FT                   /orf_name="MICPUN_101714"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69042.1"
FT                   /db_xref="HOGENOM:HBG611533"
FT                   /db_xref="UniParc:UPI000199C4CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF96"
FT                   /transl_table=1
FT                   /translation="MELNPFAMPKGDTVEEMRETLRRMELREKAHQQSLSVFEKTTFVS
FT                   RQGGTMAAALAEVSSPRGIGDGENLIGGTRTNEELIADTLRRGEGHGRENLKDFISKKR
FT                   EIFLTQMSLDVKQAEIRKLEERALRREEALTRSEQMLEEDALRFEGFLKENDLKVQEAI
FT                   RAGEAETKQKNDRVQEIKRINAQMTVIKTELSKTRDRLDDCRRYKTFLDDITDPEFFAA
FT                   VGDAKRMRREERRRKRQAERDAYAAMVDAIGLADQEIPEKERALEEAKRKGRKAEAAAQ
FT                   LELEAAIKAAQDAREAVDAEPSPPGTPENDDSDSEVPMYFTSPRQLPEIYGQLEEANLF
FT                   LIQNAQETEDILEDLKNKEREVRARMDAENASLRTQVEQLEAQIEREEAKADALLNGAA
FT                   KTRSKKKSGPLSNVAPAPGSDVSLERLDEKTAEVYARAGFAPDPSISTIQMLTNMEMRL
FT                   ERYLADADVMPAAFVAEEEKRLERDRRAKQRIINLELEKIAAEERRAKSIAKANEPVKK
FT                   RTGKPLMTRSLPPSRKKKEATEKLDPEVEELNRFLAMDF"
FT   CDS_pept        16726..20673
FT                   /codon_start=1
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640219"
FT                   /orf_name="MICPUN_113348"
FT                   /product="Oxoprolinase family protein "
FT                   /EC_number="3.5.2.9"
FT                   /function="5-oxoprolinase (ATP-hydrolyzing) activity "
FT                   /protein_id="ACO69043.1"
FT                   /db_xref="GO:0017168"
FT                   /db_xref="HOGENOM:HBG285674"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI000199C542"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF97"
FT                   /transl_table=1
FT                   /translation="MGTTKQRDFRFCIDRGGTFTDVYAEVPDGSPPSEGKKSSFRTLKL
FT                   LSEDPANYESAPREGIRRILEEVTGETIPRDAPVPTDRIEWIRMGTTVATNALLEREGA
FT                   RSALVVTEGFGDLLAIGNQARPDIFDLEIKRPSRLYERVVEAAERVRLFSGVDGGGSSE
FT                   SEATTEGLKIVTGVTGEAMLVERPLDVESLRPKLQALLDEGIRSLAVVLMHSYAFPDHE
FT                   AAVGKLAAEMGFTQVSLSSALVPMVRAVPRGHTASVDSYLTPCIREYLDTFLRGFDDGL
FT                   RDGVKVSFMQSDGGLTPAERFTGYKAILSGPAGGVVGYAITTRAETTQPVIGFDMGGTS
FT                   TDVSRFDATYEQVTETETAGVTVQAPQLDINTVAAGGGSRLTFRSGTFRVGPESVGSQP
FT                   GPVCYRKGGANLAVTDANLLLGRVLPEYFPKIFGADEDEPLDAASTRSAFEAEAQKINR
FT                   ELGLTGTDQEMSVEEVALGYVKVANEAMCRPIRQITESKGFDTASHVLAAFGGAGPQHA
FT                   CAIARSLGMSTVFVHRFCGILSAYGMGLADVVAETQRPFAGSYPMIGGGVKGVNPAPAD
FT                   ARAAADELAERCLLELVSQGFDREEECECEVFLNLRYEGTDTAIMVPEPEDGDFARAFG
FT                   ERFEREYGFKLVGRDLLIDDVRVRGIGKSTLLQRVKIPNLSEGKFPGNLPDPDSVARVY
FT                   FEGGWREAPVFLLEQLGAGALLEGPCVVMNGTATCIIEPGCVAEVTEYGDLKIAVDVVK
FT                   DEKSKDDEKSTEVVLDSSKKDQKDSSKIPDAVQLSIFNNRFMGIAEQMGRTLQRTSVST
FT                   NIKERLDFSCALFGPDGGLVANAPHVPVHLGAMSETVRWQLKHWAENGGLDEGDVLVTN
FT                   HPRAGGSHLPDITVVTPVFRNGELVFLVASRGHHADVGGITPGSMPPFSRTIADEGAAI
FT                   EAFKLVRGGTYDEEGITALLTSPSTGSPGTRKLADNLSDLNAQVAANRRGIGLIQELMD
FT                   EWGERTVTDYMGHVQDNAELAVRDMLREAAERLASRFGTVPGDPSKVALAAEDKMDDGS
FT                   VVRLTLTLDRTEGGAVFDFTGTGGEVLGNWNAPPAVTCAAVIYCVRCLVNQEIPLNQGC
FT                   LKPIEIIIPEGSFLSPSETAAVVGGNVLTSQRVTDVCLAAFEACANSQGCMNNLTFGDD
FT                   TFGYYETIAGGAGAGPAWDGASGVQCHMTNTRITDPEILERRYPVVLRRFSLRRGSGGA
FT                   GEHAGGDGVVREIEFLRPVTVSVLTERRVFAPRGMNGGEDGLMGRNTLMRALDGKEVNL
FT                   GNKNSVKVRAGDLLRIATPGGGGFGAKPKEK"
FT   CDS_pept        join(21376..22125,22405..24978)
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640220"
FT                   /orf_name="MICPUN_94794"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69044.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C543"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF98"
FT                   /transl_table=1
FT                   /translation="MAAQDKRGSTLFVGEDPSVSAPLKIHEKPIEDVIAEFQTNAETGL
FT                   SAAEAAKRLEEDGPNELEKPPRVSLLVLFLIQLNSVIMYLLMAAVVASAAIKATGDDKD
FT                   KFLSYVDSIAISIIILINATIAAVTENSANDALEALSSLQSPMCTVIRGGEEVSIESKN
FT                   MVRGDIVKLGTGDVVPADCRCIKANDFRVNEMLLTGEPEDVAKNTKIKARVPGQPEKLT
FT                   ADNMAFSSCNVKAGTCIGLVVATGMRTRAKKEGCLPDTKAGQTPLQANLEALSIKLGYM
FT                   AIAVCLGVFIVGASMGTKDPEDPDVPSWLFMIMVAVTLTVAAIPEGLPLCVTIALSSGC
FT                   ANMVKENVLMRKIAAVETLGSASIICTDKTGTLTEGKMTLVAMYAGKVDYTVTGKGFDP
FT                   TVGKITTTKGDEPANDAGGVRATLGSAVLCSNTTLKLETDPDSGLAKWTPRGNSSEAPL
FT                   VVAGHKCGIKLEDLEASLTRVYEIPFSSSRKMMVTITKTTGATSLSHVAASGEHTAHVK
FT                   GAPNYIMEKCTSYMAADGSIVDFDEAAKAEFTAKVDELSSQALRVLAIATKDLGAKLPY
FT                   GEEEETDAKFDKIVNGLTLCGLCASIDPERDGVKDSVLQSRQAGVRVVMITGDYLKTAI
FT                   AIAKNINILNRHTFTEGNGEATDCGALRPHKEGEYLSNPEIDALTKTTSVFARAKPEDK
FT                   LEIVKSLQRQGFVCAMTGDGVNDAPALNRADIGVAMGLEGTEVAKGASDMILTDDNFCS
FT                   IVKAIEKGRTIYAGIQKFVSFIMSVHFAEVLQIFLCIVSSIPVMRQPLQILFLILVTDL
FT                   PPSIALGFEPGEALTMKRAPRPKTQPIVMNWMWRGIVANGLILTVCIFYTYMIALWAYA
FT                   GAFTSDEITDPTRTSCAIWEKEKMTPTLKIDCGLWTGCNTSAAAGDALYNAACTTDYLN
FT                   QWSSVIGTSVAETAEANAAAAITGANGAFYTPHGNPDCAVCIEESIRRARTATFISLVW
FT                   AEGVRAYCSRSFENPIWVNMFSNMSMNKAVLLAQVTLIIALYLPGLNHVLGLYVDEIHG
FT                   WGWFIAFQGAVACGVGCELYKYIAKQFIVEAELAGYEEDEDGNVKGSVKTDEVAITVDK
FT                   "
FT   CDS_pept        25613..30157
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640221"
FT                   /orf_name="MICPUN_60441"
FT                   /product="Isocitrate dehydrogenase/citrate hydrolyase "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="NAD or NADH binding"
FT                   /function="aconitate hydratase activity"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ACO69045.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI000199C544"
FT                   /db_xref="UniProtKB/TrEMBL:C1FF99"
FT                   /transl_table=1
FT                   /translation="MVELTAGEIPPELGIKKSAKIWWTLTDEAPALATHAFLPVVRRFL
FT                   GPSGVSVETADISLAARILAAFPERLTPAQRRVDVLAKLGELAKTSRANIIKLPNVSAS
FT                   VYQLEQAISELNRKGFDVPKYPSGDALSPEDAAIKARYGKVIGSAVNPVLREGNSDRRV
FT                   AGPVKDFARANPHRLKDWSGDSKTEVKSMPGDDFFGSEKSSVRTNAGSLRVELHAADGS
FT                   VTVLKDSIPVEADEIFDAARLSRAKLTDFVEAELQRAAKDGVMVSLHLKATMMKVSDPI
FT                   LFGAVVATYFKKAFEKHADSLASVDANPNNGLKSVLDAVKSLPNAAEIAADFAACYTQP
FT                   DRPKVAMVDSDKGITNLHVPSDVIIDASMPAMIRDGGKMWNKDGELEDVVCLIPDRSYA
FT                   SVFQTCIDDCKANGKFDVSSMGSVANVGLMAKKAEEYGSHDKTFQISADGVVKVVADDS
FT                   DEVVFEHDVAAGDIWRMCQTKDEAVRDWVKLAVQRARLTNTPAVFWLDSSRSHDSVLID
FT                   KVNAYLKDHDTSGLDISIKTPKEAIEFSMARARKGEDTISVTGNVLRDYLTDLFPIIEL
FT                   GTSAKMLSIVPLLAGGGLFETGAGGSAPKHVQQFTEENHLRWDSLGEYLALAVSLDDLA
FT                   LKTRNPKIKILAKGLTSATGKLLELNKSPGRKCGEPDNRAAHFYIAMWWAEAVARSFPS
FT                   FKALASKLKESEDVIVKEMTDCQGKAVDIGGYWLPDVEKCTLAMQPSATFNALIDEAVL
FT                   MSALDPPGSKTVNEIYSSIEENLRIVRRKLGNKPLTLAEKIVYGHLDDPEGAPAPERGV
FT                   SYLKLRPDRVAMQDATAQMAILQFISSGLPKTAVPTTIHCDHLIAAETGDVEDLGNAKT
FT                   ENAEVYDFLSSCGDKFGMGYWKPGAGIIHQTVLENYAFPGGLMIGTDSHTPNAGGLGMC
FT                   AVGVGGADAVDVMASLPWELKAPKVIGVNLKGSLTNWTAPKDIILKVADILTVSGGTGA
FT                   IIEYFGEGVDTMSATGMATICNMGAEIGATTSVFTLSERQLEYLRETGREDVARLAAKN
FT                   RANLVPDEGCEYDRVIEIDLDMLAPHINGPYTPDLCTPVSELGARAAKEGWPVEISSCL
FT                   IGSCTNSSYEDMAKCANLTRQALAAGLKYKIPFFVTPGSRAVQVNIEKDGFVKDFEDAG
FT                   ATVLAKACGPCIGQWKRKMPPGVKNTIVTSYNRNFAKRNDGNPDTHAFVTSPELVTMLA
FT                   FSGRLDFNPYADTLPTPDGGQFSFKIPEGCPAIPPSGWDIDDSIFQAPKADGSGVTINV
FT                   NPESKRLELLEPFKEWDGKDYVDCPVLIKALGKCTTDHISMAGPWLKFRGHLTNISDNM
FT                   LIGAVNAENGETNAVVNQFTGKVGKVPEVARQYRDAGVPWIVIGDKNYGEGSSREHAAL
FT                   EPRYLGGVAVVVRSFARIHETNLKKQGMLPLTFADPADYDKISGNAKVSIIGLENFQPG
FT                   VPLALKVTNPDSEPFEVAVNQTFNDEQISWFRHGSALNFMKWQNARATRSNVA"
FT   CDS_pept        30512..31678
FT                   /codon_start=1
FT                   /gene_family="HOG000264454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640222"
FT                   /orf_name="MICPUN_104906"
FT                   /product="Cysteine endopeptidase"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69046.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG410501"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="UniParc:UPI000199C545"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA0"
FT                   /transl_table=1
FT                   /translation="MQRSSFFLAVLVAIIAAFAATASAARLTPPLVLGASGRASNNDVT
FT                   TLKSRPTDAKPKVFNAFKRMPGHDKREHVVSARPHEYIDATKLPKSFTWSDVEGVNYLT
FT                   KMLNQHVPQYCGSCWAHGAMSSLADRIKIAKGPHAKGPDVNLAIQFILNCGTEVAGSCH
FT                   GGSATGAYQFVKEAGFVPFETCLVYEACSAESSEGSCAAGDVSRYECKPENTCRTCSTF
FT                   SDMGGFCSALDSFPNASIAEYGEVSGEKEIMAEVYARGPVAAGIDANLLDEYTGGILDQ
FT                   PADYEYEINHIVAIVGWGETKKGEKYWIVRNSWGEYWGEMGFFRIVRGKKALGIEDECS
FT                   WATPASWTTHNQGCYEDGSNCVAAAAYVDPATAGVRPFGEILGAGAKP"
FT   CDS_pept        join(32434..33044,33162..34547,34668..35325,35443..>36750)
FT                   /codon_start=1
FT                   /gene_family="HOG000100091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640223"
FT                   /gene_name="CAV3"
FT                   /orf_name="MICPUN_84447"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69047.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557219"
FT                   /db_xref="InterPro:IPR005445"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199C546"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA1"
FT                   /transl_table=1
FT                   /translation="MIRRACIKIVESPWFENLILAAILINTIILCTMEPLKMEGRGCEE
FT                   GGYQGSPGNNKAIEDSEAFFTTLFTLEAVTKIIAMGFILDRTSYLKDGWNVMDFAVVVI
FT                   SIISAMPGMGTGVSSLRVIRVLRPLRAMSILPGMRVLIGTMIAAIPMIANVMLFCVFFF
FT                   TVFGILGMNLYMGVLRNRCFTVVTESSCADHADHESNAFCREGMMCLKASNPNRGITHF
FT                   DNIAHSWLTIFQCITLEGWTPIMYHAMDAVTGWSVIYFVLLVFTGGFFLLNLALAVITE
FT                   VYDEENTEAKEDAAEEAAEKEAEQDKKEAEAAKRRKELGLDVVSEDDEDDVDHLKALNL
FT                   SQAGPSPLQKLCQAIIEHRFFGPFFVGCIAVNTLVLAMEYDGMPSSYAEGLDVVNLILT
FT                   IAFILEMATKVIGMGFEEYAKDRFNLFDAAVVIMSIVELALSAGGGLTALRAFRILRVL
FT                   KLIRSWTSLQNFLYTIYLTVMELGNFTFIVILTIFIFALLGMQLFGGKMCGLDDGDTPR
FT                   HNFDTLIWALVTVFQVLTGEDWNAVMYDGMASNGSWSALYFVALLLIGNFVVLNLFVAI
FT                   LLTNFSEVEVQTEYESTKTLMESVSFFKYLSKKKGQREKTKEELEKQKWWDELPDKDFP
FT                   PRVLRGWERLADAALDKAWQEEKERAEEEASATAEAATSGCGPMPGAAPKPLHKYSGKS
FT                   LKVFDVDNPIRKFCFKLVDDKQFDYVIMTFILISSLTMAFESPKAMENSKTKEALEGVD
FT                   IFFTIVFALEMVMKLIAFGLYFEDKDAYLRDPWNCMDGFIVIIGILGKMISGNLGWVRS
FT                   LRTMRVLRPLRVISRVPELKVVVNALFASIPGMGNVFMVSLLFWLIFGILGMQLFMGSF
FT                   ARCDDEDIDAKAECCTGTFNSTVYVERTWKSDDMNFDNIFLAMQTLFEMSTTEGWTAVM
FT                   YNGVDARSPELAPKRDHNPPIAFFFVAFEIVANFFILNLFIGIILDNFARLAAESADGS
FT                   NGLMTKAQVMWVKTQRRLQQQSEPTKADYYPEDQTRKTVYKIVEREEFDWFIMAVIVAN
FT                   ALTMMMEHYNMSDAWTGTLLGLSIFFAIIFTFEAAAKLYAMYPEAYFSSRWNCFDFFCV
FT                   AITLIGFMAGGGGAASVFRILRLARIFRVVKKLTGLRMLFNTLIISLPGLLNIGALMFL
FT                   LCFVYAILGMNLFGKVKFGENLNEDANFTNFGNSLLLLLRMVTGEAWNSVMYDCMIDTD
FT                   CDSAADCARGECCGNDGAPFYFITFVILGTFITLNLLIAVVLDNFSNNKKEEGTNVTDA
FT                   HIEDFAQAWSKLDPHATGFIPCTRLVSLLKLAKTPLG"
FT   CDS_pept        37569..38243
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640224"
FT                   /orf_name="MICPUN_101718"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69048.1"
FT                   /db_xref="HOGENOM:HBG592341"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="UniParc:UPI000199C547"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA2"
FT                   /transl_table=1
FT                   /translation="MPFGLRVPAVLLALAGLLLTAPTAIDAIDAKCSACAAVAGQLQTA
FT                   LEAEKPRNHVDLRGRLDSKGVRYGKLIPYDVSEQRFTELMEGVCEGLGRYTLRTVKPSE
FT                   GPSAGTDVMRWENIGRVSKNPRAKTLRDELNDYCHRIVEKQEEDLQKALYAKELNSTNV
FT                   AEKMCIQFSGECEDREDLTSAQSPAMEEEKKPKKDKEAKSGGKKRKKGAKKPAKGDDKK
FT                   EL"
FT   CDS_pept        complement(38306..40102)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640225"
FT                   /orf_name="MICPUN_60445"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69336.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199C548"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA3"
FT                   /transl_table=1
FT                   /translation="MLGDGADDDLGDRDGGFGRRDGYRSRSPRGGGGSRSRSRSRSRGA
FT                   KRDFPRSWSRSRSRSPRRRRRGSRSRSRSRSRSGGGRGYARDDRRRGRRRSRSASRSPR
FT                   GARAREVPPPPPRDGGRHRGDPRDSQAPLSTAGRGPGVCYAFQRGRCTRGDECRFAHVI
FT                   SDVPPPPPGARSGGNRGGDASAATLHPPLHSIQKGRVATVRPFGLFVRMNGFVRDGLVH
FT                   CANVSDELTFRREDGDDAKVMAMEYFHPRDSEVYAKVVEIRRDGYSGDVKVGLSMKLVD
FT                   QSSGEDLDPDHSRAKALLEGGFGWNGHGNGDGDGHRDSRNLSDDPPALNSTHRAVVKEV
FT                   KPYGVFVSMAGFRRNGLVPHHQVSDYLEFSREDTDEDKVKALEGAVGKGDEAWVKVVEL
FT                   KEPNYPGEGPVKVTCSIKLCDQRDGSDLDPGCSRYFPQGERGGDRDGVGGNIPRRVGDG
FT                   AGEAVKRGGVIDWGHHLGDVKQYGDGGRYDLVTDDVGEGLERREDGQTGVPQGRPGHGP
FT                   PRTVPPPPSGAAPASARDQQIGSVEEALAILAKHKKEKKERKEKKAKKSKKSSKKERKE
FT                   RKEKKGKRSRRDLSDSSSDSES"
FT   CDS_pept        40231..>40805
FT                   /codon_start=1
FT                   /gene_family="HOG000200870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640226"
FT                   /orf_name="MICPUN_71095"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO69049.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG379346"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199C5D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA4"
FT                   /transl_table=1
FT                   /translation="MSEGDPSPRGDGAGGDGSSSKFNTRNPAVKRILREQREMLASDED
FT                   ENDWALHAEMCEDDIFEWHFAIMGAEGSEFEGGIYHGRILLPPEYPFKPPSFMLLTPSG
FT                   RFETMTKICLSITQHHPEHWQPSWSVRTALLAVRAFMPTPADGAVGSLEFNVDERRALA
FT                   ARSRSEVPSFGNAARRELTNAVHRRMLA"
FT   CDS_pept        41605..42150
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640227"
FT                   /orf_name="MICPUN_60447"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69050.1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniParc:UPI000199C5DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA5"
FT                   /transl_table=1
FT                   /translation="MAGRSAASAAVIALRRALVFTLAESRAVQPPRVHLLAWSVPPREW
FT                   ITRDFGGSRTNRGHSTWHRSSAPRRVPSRGLHASASSRSHDAEALNRGDQSWAITTPII
FT                   SDQVSIPDGVVGDVVEIPVGVGDVVDEGTHAVIIETHKACLNVKATGHRRMRVVEVLTR
FT                   IGQEVKEGDRLLMVEKAD"
FT   CDS_pept        join(complement(43608..43654),complement(43319..43481),
FT                   complement(42420..43109))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640228"
FT                   /orf_name="MICPUN_105904"
FT                   /product="Heat shock transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69337.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199C5DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA6"
FT                   /transl_table=1
FT                   /translation="MGVRGVEIAAPFLRKVYSIVSNPETDDIVSWSGNGKQFTVHQLND
FT                   FSTKILPSNFNHPNFSSFVRQLNSYGFRKVEHSSWTFANPDFYEGGEDNLKKISRKTSQ
FT                   KKQEEIRRGAWDDESAFGVGGDPRRTALDLHMRQELQICRLEVAHLVHRIGTVEHIQEQ
FT                   LLALLINPQNSAQRAASSGMQQQGGGANAGQIGDVLESLYKQISESRHSGDATNLGGWG
FT                   AYGVNAAVARHPGLAGAAAMGGLGPQARHDLGGGVNGGLQFGYDALSGLGVTGAGTGGV
FT                   SNGAGRSQLEALYHQATK"
FT   CDS_pept        44153..45670
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640229"
FT                   /orf_name="MICPUN_60449"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69051.1"
FT                   /db_xref="HOGENOM:HBG562257"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000199C5DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA7"
FT                   /transl_table=1
FT                   /translation="MATCASSATSMPRVATRVRARIGGGGATGRVALRPRARAVPRAAP
FT                   VTTTTTPHPFVDFDTTGCGPFPLLDPTRGYTHVSPGVCDTCADSAEARRAWVELLLGQL
FT                   PSHRANAERTAKFLGDECPPDYTERYRAWEGDYEAYLEEVSKDGVPKGQGATLLDMVDE
FT                   KERLLRRRGLDDMFAGLKAGEDAIASVLFHSIASEIDNIWSPDERDTRDDDDAMAKAAM
FT                   IRAVIECCLAGNLFDAGAAAAVQGVQVGDFCEPCVVEPDSREMSEEEAGRYRLDADQLA
FT                   EVFARARARVSRDASPGGWRFDSFSEICERCVATEHPGWRRVVIFCDNAGADVMGMVVL
FT                   ARALAAIGGEDTKVALVANTHAALNDVTHAELRGFLSTVAGWGESSTGDRAGGPSDPVL
FT                   AAQMERGRVTAVPSGQFSTLLDLNRTGPELNAWVEEELKSVPAGGEWLVVFDGMGRGLE
FT                   SNWNPAPYFKDGVNALNLAMVKSEINAKRLGAEVYDCVVKLSVGGSK"
FT   CDS_pept        join(45977..46102,46217..46414,46455..46460)
FT                   /codon_start=1
FT                   /gene_family="HOG000231339" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640230"
FT                   /orf_name="MICPUN_60450"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69052.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG750455"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniParc:UPI000199C5DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA8"
FT                   /transl_table=1
FT                   /translation="MVKPLKGVVVSNKMMKSVTVMVERIYKHPRWGKYVKARKKYMAHD
FT                   ENNMCGPGDKVLMVHSRPLSKNKKWVVTEILRKERVYDHDNVGKRKELRVFDGDLGPAN
FT                   ANAGS"
FT   CDS_pept        join(complement(50399..50449),complement(49945..50087),
FT                   complement(46572..49794))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640231"
FT                   /orf_name="MICPUN_60451"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69338.1"
FT                   /db_xref="InterPro:IPR007714"
FT                   /db_xref="UniParc:UPI000199C5DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFA9"
FT                   /transl_table=1
FT                   /translation="MFSTFQGGPFVEVFTPQGKDPTEGWKMLGGKCVKRMYEKGVKGYV
FT                   HHVTGPPGLKMQLPADERRGVGLKQPYLVFQMLLPSGQYVSLEIVVADQEGTRRRLILS
FT                   TSFTDVKSTPLHAQVPLPSALVPYDRWVNLALDLPSLTAALWAEQRAEFKSVEGVGVGA
FT                   TCAIRKIFTAKSPPQEHGVDPSVQREAARIKDTMTEGGRACVGTDGSLGIRGFGCGPGD
FT                   ASRSRTGAAAFFGGESTQFSQTEPAPEPVPRAADFLPGVERTTVCLDPAKLMACRVAGL
FT                   PNADVYDVLGGSPKRASSREGCIDERFGGLGVAGLRIGGNTAGGGHHHHQHLSYSAPSS
FT                   GRKQHADHRVSSRGASRDGVHLAFGTRVASTPPSRGRSRPASQPEHNRRWSPTNGNGNG
FT                   GVHSRDGTPGTSGRTRAERFNEDLASYFAAQGHGRSSGFIDRLNRRNSVDNNGGGGPGA
FT                   IDLPHVDARPKVSSPGGKPGGLISHGSREWDDDVAALGDLGGHLSVSPKGGASGRRSVT
FT                   FGASPKTPGGARRTQANAQPRAHTVGGASPRSRGSRLSTGALPALSPRGRERSSSRGLD
FT                   FGPSLRSREGGGLDECDLGGSMRVSSLSHSFDAGGEGGVVNHFPARHSRRSQRSSGPGS
FT                   PIGSLNASSRSVSDGDEESATAGATAGATAGATAAGAGSFTPQPPPGAYSSRRYADDRF
FT                   ENRFDPGFDDDDMPNMRHSELGLSNSSLDRFVGGGNAPPPRLVVPGGPEDDDAVVVTVE
FT                   PPTRSIASPMHPHGFGGYDDDFQLAADLNSPSAGLDGRPGRRTYGGRGRGARGGRGSVE
FT                   RTIQTPSKLHGAPRAARGGEADGVEKEGEDGGGVYMDGEGPGANAARGHPSTTVIRASR
FT                   AASEVGDEDPAEGGAEGGADLNDDDDDDRGIEPIAETFEPHRDSNGIAYYPNGSAPTRD
FT                   GDDDDGLGLSSDDESGQLRMMRESQIIGVSDMPSRGGHSRGADSSTSGDGGWGGIGGAG
FT                   GWSSRPGTGSSSIWGKQTNSRGFSTPAGLRLFTPDLILSGGERRSTVPPPMGAHDVTGG
FT                   TRTTPDANAKEPSVTNGSKEPLHVVNGEANVARAGPIGNSKPNSPSFAGKNEIKSEGEN
FT                   KEEPAELDLIYDPVLNYYFDPKSNTYYELKT"
FT   CDS_pept        51740..52534
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640232"
FT                   /orf_name="MICPUN_52974"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69053.1"
FT                   /db_xref="UniParc:UPI000199C5DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB0"
FT                   /transl_table=1
FT                   /translation="MKASLEPGEAELASAEAELKIIAGLGRTAAREAAATAQIAETRAV
FT                   IAEQKTLIERLTGVSIVTSDPSAGSLVLRLVTRVDATPAFAMAMDDAGAHPKHPVPVPA
FT                   HDETHTLTVTFHPGTTAVKDAVLEPTGVPMDDIVQAARASGAAEANLQKLTAELKVRIN
FT                   ATHARCEALGALANTLSMDWSASLSQIRVGLYGGAGGAVAAVDVPLEWPLNGAKCRVVG
FT                   LAGLAPAVVAAAAQRVEASGYATVTEALRATRDALAASGHSA"
FT   CDS_pept        join(complement(54005..54060),complement(52606..53857))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640233"
FT                   /orf_name="MICPUN_60453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69339.1"
FT                   /db_xref="InterPro:IPR018797"
FT                   /db_xref="UniParc:UPI000199C5E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB1"
FT                   /transl_table=1
FT                   /translation="MAGLEDAAEDLLERLGDIGVAVEDATVADVTGRHRANATVFNRIA
FT                   QALAQDVVAVLPTAGADDPDGCEAAASAVHRSVASAAAAGDVAGATRRVEQGLRRLGTA
FT                   IDKTSPAAACETHELLEMLATYVQAGTMLARTKAQNRDEGRAGERLQKMEVEALVQSET
FT                   SPMDEVQSERASRATWRLADALAPLDPRVAVAAPDAPAVAASALACVKRALDALPTDHL
FT                   RPLFPESRDGSTGDASFPGLDGDPVIRSTVDAIANELAREYALRKETVARRAGLTVTSF
FT                   SYSKRLRAQPEVGRDFLRRVGAGGTQAQGRDGLPGIGRSVTLADARRARVADLARCVLR
FT                   TNAEAHRTLDASVKRVLIGNVPDRGGRTEEARGGLGGNMPAFTARVDHGGATHRRGGGR
FT                   GRGGRGSGSQGGGGGRGGSQGGDGGRRGGGGRGGRR"
FT   CDS_pept        54378..56597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640234"
FT                   /orf_name="MICPUN_60454"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69054.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG318792"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR022087"
FT                   /db_xref="UniParc:UPI000199C5E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB2"
FT                   /transl_table=1
FT                   /translation="MPTPPSRGVERSRLDPSPPEPDLTPGDPPFRSAQALAESRAASAR
FT                   DSPDAPRPLPARPRPPPGGAVELGVVESDEAMAQRLQREERERANASSRDAFYPNMPYD
FT                   PARRAPPPSTVANDPRPSFLAPVPHPAPTPAFSFPRPPGPHPPSAPPPTTESLGRRAMN
FT                   DEIALNTGKPEGTWTAPVLRDGSYPEPSRGTRDPPSPYYPGGTGSGWGDRPGAVDPIGA
FT                   ASGANGGGGSADDDEALARALQAREEEEERRVREARRRAGAGVGDGDAALAARLQAEED
FT                   AAAAAGASSAGPRAGDVVVDDEALARALQEEEDLAAGGGGGSTSRLNRHRRTPADSVPP
FT                   GACPGCREQVSAFGGYVTAMGARWHRGCFTCGACGGAIGGGTSFATRDGAPFHRSCYRE
FT                   KFAPRCGVCDEFIGSSTGGTNEVGDTSVRFMTHPYWGTVFCPEHEFDGTRRCDGCDRME
FT                   ARGGKGVATGGYGSHGVTRGNHSSSGEFAELPDGRAMCLECASTAVIDADHDGAPLYDD
FT                   VCVFFSKRDLPLLPERPPLHLVSQDTLNDADDKEGWHRGRTARTRGLCLFEEHVVYTVE
FT                   RTPDFAGGFFPVGFKERVVGQSRGATVVNAVVVLYGLPAVCAGAILAHECTHAYIRMAG
FT                   GYPRLRPKVEEGLCQLMALLWVEHVAAHGIETMGVGGGNKDKVRSGGGWEEHNLAAMAG
FT                   FVANQIRTDPTEVYGDGLRDALAAYQKHGLGAAFEHVRRTGELPR"
FT   CDS_pept        complement(56702..59191)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640235"
FT                   /orf_name="MICPUN_60455"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69340.1"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="UniParc:UPI000199C5E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB3"
FT                   /transl_table=1
FT                   /translation="MFHPNLGLGRGPQPRAAIRAVVALTLALLLQVALASPQERETATP
FT                   DTPDVAPAAAAAAAGPVRHLSTATDPDTGLVTDTYVKPLGTTTPGEVRNTRPWGEVGLL
FT                   QRPSPDASIVIVNVAFDIVDPDTLEPYPLDRIYNHHLVVHSRDDETNESELRRAVAEVL
FT                   RKTIPAEDLPAAATFLERIPRAAIRAAIRGTLDAAVRRTRGHSSLLSPCGVGVGVAGAG
FT                   AEWRGQQLNVAATFPNDPYLNGTSLWVEPPGTTWGVNAHLIDLRDVENLADAVQCNCEA
FT                   YARRTPGTPQNWDHGPLPGGGIQCCGDGALAPLAPGSAAFADHTAFAAPLGILYNVTWF
FT                   PNTPEALANVPEAIRTLAAKAPMQTTLMVSSNRAVDGAACAGEYNARACAADPRAAGDP
FT                   AAEERLWMEALDRAGDVAPAPRNQTCEPGESPPSSESSGNGAGPRVTVAWSHPFKLPDG
FT                   AAYDVRSMYGHQHVGGRSVRFVNVTDPSTPVAICDSVPRYGAAPGVVGDEAGFIVDIPG
FT                   CRFDPPLRLRGGETYAIRSEYGADPTSHAPAAFLGLEGVMGYVILRFTVPDDAPVATFS
FT                   ASGERTVASDVRRALASGGAGLCVAAASSGGESPGGDSPGGDSPVGPAAGPMAAFDSNG
FT                   SDDAPDDAGSIVTDADAAETDDVTTGDDSSAWRSVLLSAEDNFTMSWRFTDDANSAVEF
FT                   KLRMDRPSWMSVGVHRPGGHGMPDADMIVVQSMDGGANFAISEVWTQAYDRPRPKAFYG
FT                   FAASAAALSSGRCAVEVSPEGAIEASFTRTAAAAAGDETGADIVPGVPTTVVWAHGEDG
FT                   FAMDYHARHRGTVSVTW"
FT   CDS_pept        join(58775..59044,59948..60899,61319..61863)
FT                   /codon_start=1
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640236"
FT                   /gene_name="EPRS"
FT                   /orf_name="MICPUN_84342"
FT                   /product="Bifunctional aminoacyl-tRNA synthetase "
FT                   /function="ATP binding"
FT                   /function="proline-tRNA ligase activity"
FT                   /biological_process="prolyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69055.1"
FT                   /db_xref="GO:0004827"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006433"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniParc:UPI000199C5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB4"
FT                   /transl_table=1
FT                   /translation="MVVDAIQRVRLEGVRVHDVEGDVDDDDGGVGRGALQEPDLAPRSG
FT                   IPHLSRCGRPEGFDVRVGDEAGVGVRRRGQVPDGSGGGGGGGGGDNAKAKKETGLGLDA
FT                   TIEDDFGAWYSQVVVAGELIEYYDISGCYILRPWAYSMWEQIKDFFDKEIKKEGVENCY
FT                   FPLFVSSARLEAEKDHIEDFAPEVAWVTRSGQSELDVPIAVRPTSETVMYPVFANWIRS
FT                   HRDLPMKLNQWCNVVRWEFKHPTPFIRSREFLWQEGHTAFTNKADADKEVRHILDLYRR
FT                   VYEELLAVPVIPGVKSEKEKFAGGLYTTTVEAFVPATGRGIQGATSHCLGQNFAKMFQI
FT                   EYENKNGGRSMVWQNSWGCTTRTIGVAIMVHGDNKGLVLPPRVAPLQVVVVTIPNSKLS
FT                   AEDSKKLNDTAKAMSDGMIDAGLRSKLDDRDNYTPGWKYNHWELKGVPLRCEFGPRDME
FT                   AGHCVVVRRDTGAKETVKLVDLPVRAKEMCEEMQADMLKRATEKRNASVVTCTSWDGFV
FT                   EALDDCKMILTPWCETKESEELVKKKSQEDSDGGAAKTLCIPFIQPPLAPGTKCFITGA
FT                   PATTWVIWGRSY"
FT   CDS_pept        complement(61972..62922)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640237"
FT                   /orf_name="MICPUN_60457"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69341.1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI000199C5E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB5"
FT                   /transl_table=1
FT                   /translation="MSGGGAELASRSKNAGGVISRAKTGLQRLARRMALLVALTCVVLF
FT                   ALRALLNFDVSGATYGLIAWLRDDINVSTGCMVLVIATAVATPLMLSTTPINIGAGAVY
FT                   GVVLGTFVTLVGHVAGAWICYVWSRWWARDWIARKMRSSETLTALNHALAKGGAGIVML
FT                   SRLSPLFPFAMCSFCFGACNVGTWDYLMGTTVGLAPSTLMLSWVGVTIQSYSKKGATQE
FT                   GHSAADYRRLWGVILLTVVSSVLLGWRVKAVIKAQAREAERSGLVIGTAGVGGTPGKGR
FT                   GTTGLKRLTESRMGAKGGALSRGNSGERLLVAAAV"
FT   CDS_pept        join(63095..63309,63499..64489)
FT                   /codon_start=1
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640238"
FT                   /orf_name="MICPUN_60458"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69056.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199C5E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB6"
FT                   /transl_table=1
FT                   /translation="MPATLTMSAVAPRVAFARPRTCRRPAKAARLVAVASGESSGKATK
FT                   DFKATWSTDRSLRGDQKVDLNRGEKMTITVPATSANMGPGFDSFGFAVDLENELVLERG
FT                   AFKVDIIGEGETSLPRDESNAIIKAVKDGYAAIYPDEHLPIDDIKFTSVNRIPPARGLG
FT                   SSSAALVAGLAAGLALAGQDLAKPQTKQLLLQLAADAEGHPDNVAPAIYGGFQVSINTG
FT                   KQWVTQAIGLPKGMQAVLFIPEFESLTSETRAALPKEIPVADAVFNISRAAMLINSFAT
FT                   DNFEALRYACQDVIHQPYRGAAFPMQKMIDAALGMGAHGAFLSGAGPTVLALTGGHGSD
FT                   VDADTMATFLAVEVADAMLAAAKEDGCEGRAVISAPSTAGVRCKKEETLLRRMGKTSGS
FT                   VF"
FT   CDS_pept        join(complement(65532..68192),complement(64700..65251))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640239"
FT                   /orf_name="MICPUN_60459"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="ACO69342.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI000199C671"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB7"
FT                   /transl_table=1
FT                   /translation="MVHYRRMVAAALHKLEEDARESGAPIDLGTGEGGGGGGERGDGVD
FT                   DHVDDGSFHGSTAQQVGAMVLKLHAGDPQLDREDWYQRVRAALRGLTKDGEVDMLNLNR
FT                   FRLAVEEEGDGVTWKLNVRFNDEDLMQVEVEVRANPDSDTPRLDPRREDARVATQRPIP
FT                   PFSFAPSERFFSTSLPASRYSPSPPAVIHPSQPTCTCAQIRELVRTKFGARMTSERVRL
FT                   RFNGAEVGTRRGGDASNLGGDASTAPARPEATRLAEAGVTDGSTLDLMIEPVDRDPEPD
FT                   PEPEPEPEPEPEPEPEPEPEEPAAAPVVNREEKDTRYATHCACRLCGEMREKADFTATV
FT                   WKRSQADRICKRCVGKEMTCRLCSIPRLWRYYTGWLHQIKRECDVCTQSGQCALRFCSG
FT                   CKQMKLMMDFSNNQAQKKNKVRMCQVCMGNAKEDKSIGLKLREGDVIVIDSKRQPGEGV
FT                   KQCSNCGEFKPNDQFTKSQLKRSASARRCLECLKTCLKDVPHSTDSTSKPPESTSNPPE
FT                   SDTDEQLNRHEVVEKEAVGDGGWNEGGDGWVNLVKESGDEREDDVEEEFIEDDGFDDYY
FT                   EEENEERNGDSRRASVNASLGLPDEEDAEFLDASDYERDSLSGDSHENCELYGTLHSQV
FT                   SSFASTAGPDDSDLQDRLVVQKKVSEAITALYPEARLEVFGSGATGLALKCADIDLVVL
FT                   GVGPEPSAGGGGFSRNDREDLVRMLRKIEKSLRREKIVWKANVISTAKVPIIKMNAGRY
FT                   AVDLTVGASNGLSAVQWIKDRVNDFVAMRPLILVLKKLLKTHHLDDASTGGCGGYLLVS
FT                   LVVSHLRQSGEPGRSANPNLGALLLGFLRRFGNEFDYSRMAVAAGRPSGVIRAKDLVVG
FT                   PGAFGMRPMILAEDPQETGRNITGAAYRFKEVRALFRSALEYMSAVGELAFLQELASPA
FT                   PLSRGPQAPPPRPSGGGGGGGPSWLQDKRSFSLKRPREEGAGVEAREPNKKGKSPPKKG
FT                   KSPPKKGKSPPTKGKPEGQKKGQNRKGQRYTNKNPATWTPHKVKIEAAKARIAAGGKSN
FT                   KGVKKSPRIAAKKKSRGGWATE"
FT   CDS_pept        join(68843..69592,69786..70122,70271..71073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640240"
FT                   /orf_name="MICPUN_60460"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69057.1"
FT                   /db_xref="UniParc:UPI000199C672"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB8"
FT                   /transl_table=1
FT                   /translation="MARAPWVREPGVAVDSATNKRKRRKITSRRQFVLLAQDIGERRAA
FT                   ATADPLLSPADEFATQQELARELVDVSREYTNEPMGFTPIDIGDNEWGPEGLLRAFSVL
FT                   AGHFETLELCLFGVLRALRDNAGGFDLKSRVWGLVKTALGPANFGSLVIFNVVCFSATY
FT                   NIGRKIVAHLPHEVSKELNALQVAALNTLGTPTNFAGFGKAVSLAGDRGIAQVGHAHLL
FT                   PARRCRSWRTRGGSAAAAQLAGVASCAGVETWTKKEIPEKGKAAKNRTLWNDDKLKVHR
FT                   KKCVHLSMFTQARWVRIVLCRPEWLEGFQHLVTFLGGAPDAADKLRAALVKEMGSEWDE
FT                   AYAIKIEAYRRDWLKRHGLYGTEWSATRRRWFRRHMQKWGRFGRNVDPVTLEKRLEAAR
FT                   EHLSKWGYCRGSEWTDKELADQKLKAAANLNLHGYGRGSEWTDKELADQKLEAAANLRE
FT                   NSKKGSDAQVAARQARGAFPTTEHVGVSWNNTKDKWDAGFHLRGVDGKKRTHVNCGTFA
FT                   RDDVNQAAAAIATKRTALGLPPAGTGEKVSDELIRAATKMVEKTKRKRPACPKSGCTGV
FT                   VWCNREKKWIAKVPARHGGHLGYFKDVKKAIAAVEARHEQEGLPPAKKKRTAL"
FT   CDS_pept        complement(71193..73316)
FT                   /codon_start=1
FT                   /gene_family="HOG000294940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640241"
FT                   /gene_name="SSIIIC"
FT                   /orf_name="MICPUN_83891"
FT                   /product="Glycosyltransferase family 5 protein "
FT                   /function="starch synthase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO69343.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0009011"
FT                   /db_xref="HOGENOM:HBG596384"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniParc:UPI000199C673"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFB9"
FT                   /transl_table=1
FT                   /translation="MQPLAHDHPARVEYWLDSGGGDWWIADPIYIHPEAKVLDFVFSNG
FT                   EGQYDNAGGRDYHAPVGLEDGTLPPEEDHVAKREELLEEEQGPLDATAAHRAGQRAERK
FT                   FLARSSFAPRPPEDPATAKVVTVPAIPVAGKPVDVFYRLDRSDPKCPLRTNDVFIQGSW
FT                   NRWTHSDGFGPTQMFPADPSMLPGGPNAKPAYTAKIFVPKNAHVMDFYFKDTQANGQGN
FT                   YDSKYGLDYHVNITGAAGGGDPIMRVVNIAVEMAPIAKVGGMGDVVTALSRAIIEKGHN
FT                   VEVILPKYDCMDHEQIDGLHLADEFTCNGVEINVWKGDVEDVPVTFLQPENGHFDVGCI
FT                   YGRGDDHIRFNFFCECALEWLKVTDAKVDVVHCHDWSSAPAIFARRSRLPAGCATVFTI
FT                   HNLNFGQDLIGRAMERATFATTVSPTYASEIADQGAIRVHKEKLVGVRNGIDIEIWDPM
FT                   TDECLEQNYNADSWKNGKAVAKRQLAERLKMAMPPADHSVPLVGVVARLTHQKGVHMIK
FT                   HAMYRTVENGGQVVLLGSAPDGNVQREFNQMAEDIGNRFPGQSGFVFAYDEPLSHLIYA
FT                   ASDILLVPSMFEPCGLTQMIAMRYGCIPVVRRTGGLRDTVFDVDDDRERAAEQGLTPNG
FT                   FSFDGSQHYDIEYALDRAMRMYASEKTNWDTLVGTTMRQDWGWTDPADTYVEHYWKATK
FT                   SAKYQAAQGLHRD"
FT   CDS_pept        join(77499..77591,77809..78393)
FT                   /codon_start=1
FT                   /gene_family="HOG000042712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640242"
FT                   /gene_name="VAMP"
FT                   /orf_name="MICPUN_60462"
FT                   /product="Synaptobrevin like protein "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69058.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG736701"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000199C674"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC0"
FT                   /transl_table=1
FT                   /translation="MPLIYAFVARGTTVLAEHTGHSGNFATVAAETLPKILEKLNSQKK
FT                   FTLMADGHTFNYLADDGYVYLVVADEAYGRQIPFACLERVKDEFKSQYGDRARDAIAHA
FT                   LDRSFGPRIKAQMEYCANNPDELSKVSRVQAQVSEVKNIMMDNIEKVLDRGEKIELLVD
FT                   KTENLRFQADNFHRTGRQLRQRMWWNKLKMQLMFASAFVAFVLVLFLIFCYSGGSDCTK
FT                   KKE"
FT   CDS_pept        complement(78493..80940)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640243"
FT                   /orf_name="MICPUN_105905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69344.1"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniParc:UPI000199C675"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC1"
FT                   /transl_table=1
FT                   /translation="MNAARASVGSLPELAHSLGAESEESDDDGDAGEEIASLLHQGEQS
FT                   EQMRLFDLAVRMSGEVDVRDHKRNLKKHKACFTGRVAVQWMLTNGVARTVDDAVATGQK
FT                   LSDAGLVKPVAAGRAFLNRSFLYRFGDGMDRYVQAARWCLSQEMGKIRGEVKDVCAVVD
FT                   RHTAATRAISAEHAAAMERVELVMFEMRTQLAWTRAAVFMLAVACLFLTFVCVPASEDD
FT                   VKEGGLSGLFSGLFQGLFRGSSAAARLHAILPRATHALVTLVASALSFSAGVFVVDRKS
FT                   FDAVLYTADHRYFLDGTGTDASDDDEPDSDDDESVGGSIGDPDRGFLAGPGSSRGVAGL
FT                   RRRLRRRGSAQNLRIDVDATEPSGGTGSRRAEVAGVAAGRVSDGTYADKYVPLGPGLRS
FT                   LSQRGGFRDVDSPRGTSHAPGTPTRRLVRLTSFGRFFGMSPRAPGSRSGRGEEGLDGGV
FT                   RPEDQALPPPAASSAVFGDVGSKPVGLRLSPEYPRQWIPSGPSRPSDGVSLPAQVPFEF
FT                   ETELFKGKAVIYLRGLSNTPERVFKGKARAIQFSVQGRFKREVAMDDLHFGLSLARPLR
FT                   NLPTRWLLNLCTRVVQSLGAQYSMDLSDPTADRPYMLAPIILAAQTVSCAAPGREPDLT
FT                   LAPIEENARLTFLGHSGKGVGANERRRKIAKIIRDAKHARRKAGVGDVNPGELTRDGRV
FT                   PSFDVDSTWTFSFWQSQIDVSKYSVDLGVGKFDLVPIMDGQPIALLCQTSDASRVGFRF
FT                   EVWHERLLQRAHSHQSPDNVERRPPRDADEDSSRGDGDATQTAGRGEAPEEAPEEAAAR
FT                   PAS"
FT   CDS_pept        join(complement(82189..82455),complement(81436..81969))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640244"
FT                   /orf_name="MICPUN_105906"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO69345.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG751935"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniParc:UPI000199C676"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC2"
FT                   /transl_table=1
FT                   /translation="MSVNAATVARPTAGLASVPVAPRASARRPVACATARGGAASTSSG
FT                   WSASSSSRNLAQRRSGAAGRDGAAVLAVRARSPIAIARRRRFVQTNASLFGVGAPEALV
FT                   IGVVALLVFGPKGLADIAKQLGQTLRAFQPTIRELQEVSREFKETLEDEIGLDEIRNDI
FT                   AQVAAPVPTKRQAPPPGTTPEASAPGTPGPTDQSTDTVTEEMRAAAAAAAWGGDEPVAV
FT                   AGPDDVATDADAKETAANGDVPGELAAPEGTGAAPTAGEESVQA"
FT   CDS_pept        82713..83375
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640245"
FT                   /orf_name="MICPUN_108722"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69059.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199C677"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC3"
FT                   /transl_table=1
FT                   /translation="MASATTIGKDSAHDHESDSGHDRENTPAPSEGGGGGGGGDETQPG
FT                   PFSLKRKKAHPCDKCDKSFHFPARLIEHKNLHTGKTPFKCTIENCDEAFPTSDQLRTHA
FT                   QRHLLRFRCEICHKRFQTESIRRTHMLTHSTVRPFACEDPECDKKFKTARALEKHADVH
FT                   RPEEPQVCDVAGCDRSFKRKDGLQRHKRNEHGIRFKKRRSARKEDGPGFEDANVVAQ"
FT   CDS_pept        83545..85686
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640246"
FT                   /orf_name="MICPUN_60466"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69060.1"
FT                   /db_xref="UniParc:UPI000199C678"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC4"
FT                   /transl_table=1
FT                   /translation="MSRYDDDDDKYNKAKRGGRPAAFSAAKAPHSARGAGGPGSSRAPA
FT                   SSSSFNDATSSPAVFGGFGGNGDDADALAAKVRAKLDFVSTRASFDDEETEAERVKASL
FT                   DRLAFASQVKGVRSAFGAAINDAADEIDGLAHKAEETVAAFQAMQYAAKWMPVDTRLSM
FT                   KPTYVKVPVQAVERIKFWEQEKLAMIASQHAEEKEKILAENAGLRSMMGLEEANSPAVE
FT                   EMRETEDGVNRALLISAVEEIKRLKTRVAVLEGEAARTRISSGGFGSFFGGDGGGGGVD
FT                   SAQMAKLTTELARLEEDNGRQKWMIGEKDKQIKEVQGKYAASAAYALQEKLQESMEALE
FT                   VMANLQAEQLQYMEDHALRKLDAQDTQIADVQDDLDTKRAHLTQLKTLMAGYWETGDDS
FT                   LVPPMLSLAGFTKTEALQIASHRERLADAGIGGLVRGLGRRGYGFYEKFLVACAPPAVK
FT                   PPKRGDAVTGADGGADGGAEGADASPAPSTAPPTAERMALETDDDGSESVERFNRRTRQ
FT                   TENPFATSETVPESAAPTPEKASNDGEAEAGPMTLPSPPEASAAPQSAPNSAPDSAPDS
FT                   APDSERPKQTKLPRRRDGETPSERVAREAEKSARRERQRASTSASGSSASVLGSATRHR
FT                   GGGVNVVGGHFAGFDDEEHRDKERRERAKARAPLPAPKLKGRAAEAEARRRKEEEARRA
FT                   TGDGFAGFGSDETNDSDSD"
FT   CDS_pept        complement(85747..86307)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640247"
FT                   /orf_name="MICPUN_60467"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69346.1"
FT                   /db_xref="InterPro:IPR012891"
FT                   /db_xref="UniParc:UPI000199C679"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC5"
FT                   /transl_table=1
FT                   /translation="MFGALTTMLWGGDGEDRVEDTAPVAVVREDEAGASASESGGAARE
FT                   AKKDDAKKEDGKKEDGKDGAEGEEGKEGKEGKEEEEEEEECGFCRFMKGGSCKATFVAW
FT                   EDCVDAAKDAKEDFVEKCAAQTAALRDCMIANPGYYGDMLEGAGEDDDGDDQLDDQLDD
FT                   PIDGEKEEEGEPKQGKKQASASS"
FT   CDS_pept        86436..87404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640248"
FT                   /orf_name="MICPUN_52980"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69061.1"
FT                   /db_xref="HOGENOM:HBG621254"
FT                   /db_xref="InterPro:IPR019312"
FT                   /db_xref="UniParc:UPI000199C67A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC6"
FT                   /transl_table=1
FT                   /translation="MPPSRIRRATIARGAGSACGGASRAGHGGLLARGSSPPVMCGAAN
FT                   STEDVHASTDASLPDAHPSSAPIPKPSSSGDDADNAEELEAMLAALRELRGEMKSAIES
FT                   PLMPNRQQRVLELLRDRPALAHRCGVFPDVTPKLAENNPPVAAELLLCLARDHPAPSHN
FT                   LPAHFDALVAMPTSLHSMEVVNRLVSEASELLPDDFVRAYVAQCISACRDGAGSTGAGP
FT                   GTSPGGEGGALSSASGLSSGTPSPGTGSRMVRLVCMFLQLLVRRGRIRGGTDVAAEVSS
FT                   FCVERMRTKEAAALYRLLRAAEEREGGDAGEGGGLGEIGTR"
FT   CDS_pept        complement(87503..87760)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640249"
FT                   /orf_name="MICPUN_60469"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69347.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199C67B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC7"
FT                   /transl_table=1
FT                   /translation="MEKLLRRVPDPVVYVAGAVAAVFAALRVKKIANGGSFADEQAAYR
FT                   RCNRCGKKGAPVRCNKCRRAYYCSKHCLKDAIKLEICECC"
FT   CDS_pept        87965..88855
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640250"
FT                   /orf_name="MICPUN_60470"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69062.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="UniParc:UPI000199C67C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC8"
FT                   /transl_table=1
FT                   /translation="MATSTGLKITFKAAAVESAGDEPAAKKPRPSAGGGAPWHAPSWAD
FT                   QFKALAPPPPRPERSALVELRTGGAPPPAPVRDAPAAHAGTGALGVVPVAEATTMSKRP
FT                   AGGHDEYLDDVERDFRDDLAHFLQFRSRHDLYSPIFLGVPLPFRKVFKKVRALGGYAKV
FT                   CEQKLWMRVCREAAGGKDLSGQTSASFAMRKNYEKTGMLEWERHLDGTSLPQDRAPDPD
FT                   AGKTFEPVAPTDVLPPGKRVRVLWMEPNGESAWYGANVKSHDAASKKHHIAYDDGTEES
FT                   IDFGEEKVEAVVDGD"
FT   CDS_pept        join(complement(90414..90905),complement(89031..90314))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640251"
FT                   /orf_name="MICPUN_60471"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="positive regulation of transcription
FT                   elongation from RNA polymerase II promoter"
FT                   /protein_id="ACO69348.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0032968"
FT                   /db_xref="HOGENOM:HBG609733"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI000199C67D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFC9"
FT                   /transl_table=1
FT                   /translation="MAAPVAVAALARVPIPSRPSAGHLRGFDDDKCGAPPRVGRARCAL
FT                   TRARLAPLSRRPNARAAAAAAAARATESSDAPRDDGADGAPVDGTPLAPRFLDIAGDAD
FT                   AVRAGVDALSAKEIKDELKHFGVAIAGKKDQIVERLVECYSLTVRALHPDPPTPSTQTL
FT                   PAAGEDVVAAMRTRTMSKVKAVSEERAAAAARRDARRARVGVYEQVSDKTAKKLAATRR
FT                   RAVAGAQGARASGVTNGRRSRAAKLADIADVALDPDVLGDVGVGLGVDAADDSARENAR
FT                   YSMANPREDATRKTKLNVARRDLDRQADFQGAMNDVGWYMCEVPEGREQQAADKIDAIA
FT                   RTEKTEGEPITTWVPRVPNDDFCVARSDAEGKTRIDLLRSVPPAGDGPGDETLPFPGYV
FT                   LVHMKLSQTTLNSLEEIYGVKGFASSGVTKYGSTRRQTGERPRPVPAMQLETMMKMCDV
FT                   RVVSDAEHAKITEALKRRREAEEKAAAMGTIPAADDGDVQTHKSADPTADSNAEPIVGE
FT                   EAMALRDAAIRPGAATATGAGAASIEVVAGPFKGFKGYVTSADKPRGDGAVDAKLVIFG
FT                   RETDVTLEAGEFETL"
FT   CDS_pept        join(91730..92034,92415..93381)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640252"
FT                   /orf_name="MICPUN_60472"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69063.1"
FT                   /db_xref="InterPro:IPR006502"
FT                   /db_xref="UniParc:UPI000199C6FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD0"
FT                   /transl_table=1
FT                   /translation="MKVMRDLPRAFGMSPPRVRLQTPGTPDHSSEQWRDEATALPPRPF
FT                   DGVPPADHPASLGFDLLFDTIDDQTPNESGPMPMLLEEDSGTSSSDDGHDVHAQYVRHL
FT                   RNLTKHATDAEADTYKRLAAACAAVGPGEVGDFAHADALRAAFNAVDVTDAATNAPPTK
FT                   PAKKSSKKSSEKSEKSGGFTGGDGASSSSDAFVATTPGAAGHAALLNLRHSFLWVKTDQ
FT                   NEAGTKDDDGAGTKDDAPVDDDDNRPRASATATPMKRDVATETGVMVMEPYLRAHFVIS
FT                   RPTERYQRLLDTLPPHFVGAHERLARLVDFMSEQMLASFKERGMPVPPWRQNKSILSKW
FT                   FLPTAKSISQPNTPAGSPPMSKGRSTGRRASVNFDVVGGRGVFFGVGYGTQELPYESSR
FT                   GVEGKVAMGSLSSSVRLLRDAMMA"
FT   CDS_pept        complement(93657..94412)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640253"
FT                   /orf_name="MICPUN_101737"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69349.1"
FT                   /db_xref="UniParc:UPI000199C6FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD1"
FT                   /transl_table=1
FT                   /translation="MAESPATALRRYQTDLRKLVRGGFNRYADAKKCWVVWTDDARNAL
FT                   TDAANGAIVGDVGASNPLPERLSSIPGLERALRARRRESSAGQLRELKAVHAAGCAAVF
FT                   DAIGQCERVVEEARTRVEAWSNQSEGAGDDRDRREGHPLFGSLRAGDMIDLLSAAIGMI
FT                   RRDCEAKAALLEETIRALEESDPALAALRAKVATSRDDGNDDGSDGEERLALSREALTT
FT                   IVATWILSPYVNKEVLAEIDAVAALEMRD"
FT   CDS_pept        join(94522..94625,94751..96008)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640254"
FT                   /orf_name="MICPUN_60474"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69064.1"
FT                   /db_xref="HOGENOM:HBG562423"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C6FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD2"
FT                   /transl_table=1
FT                   /translation="MGHPAPDPVVLRGHGADVQSVSFAVVDGVPCVLSGDGNGDVVAWD
FT                   VRARRPLWRLPAHTPFSGALHAELAPGSSARVLTQGRDGTLKCWRTSGGGDGGDPPTPP
FT                   RAPPSWTLSSGSYHYCKFATRQSAGDDGTGALVAVAGETQSALDVCEMPSLSDDDDDDA
FT                   DADADTPRMGAPRRIASLIAAADREHASAPSRVSPQNPSSSESRDRLGVVMAVAFLPTR
FT                   GGRVALLAAHEEGTVCLWHLGDRRACDEPTNERIDEPLWRTRAHGDAATCLAADERGDG
FT                   FVSGGADGACVRFRVAWGDDDVASGDGTQVGTQVGTQVGTRVTVETVRTHGPFAPRNPN
FT                   VDAAGDVRALRGVAAVAVRDDQKIFAAGYWDGRVRLFEYGARSLGRKLASLGYHEHAAT
FT                   CVAFAPTHSLRGVLWAGHAGWLASGSRDGTVAMWAVYPPKETPAKGGEGDGDDG"
FT   CDS_pept        complement(96157..96507)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640255"
FT                   /orf_name="MICPUN_60475"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69350.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C6FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD3"
FT                   /transl_table=1
FT                   /translation="MPAIWRPNVSGPLPDVDVEVGVAEGAPSKGTKRKRAHSTKGPCEH
FT                   GVKYRSQCKVCSACPHGRERSYCKECGGGAFCEHGRQRYRCKECGGSQICEHGRERSKC
FT                   KQCRAAKAKRSL"
FT   CDS_pept        96664..97599
FT                   /codon_start=1
FT                   /gene_family="HOG000048758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640256"
FT                   /orf_name="MICPUN_60476"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO69065.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG514900"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR017506"
FT                   /db_xref="UniParc:UPI000199C700"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD4"
FT                   /transl_table=1
FT                   /translation="MSAASRACRAAPALLRLASSSHEPRRARIVARAAKGAAKRDASSG
FT                   LLSGVHPESIAAVSAIAERAQAASDRWGTEVTEFLDPALAADARVVIDRMADCEARPWG
FT                   GYDRAERVRLVIGRREVLDGDGDDSFAALTDATNGCVALLQVSGNFMFDAADHRDFLGA
FT                   ALGAGIERDRLGDILVQGERGAQILATRPMAAFLSSAMTSVRKVPVATSIAPLTDLRVP
FT                   PPRVDTFASVEKSMRLDAVASAGFRMSRSKMSDLIAAGAVKVNWREGAKPKTECKSGDV
FT                   ISLRGKGRVEVGEVTTTKKGSFNVQLTRYL"
FT   CDS_pept        97933..98865
FT                   /codon_start=1
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640257"
FT                   /orf_name="MICPUN_84234"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69066.1"
FT                   /db_xref="HOGENOM:HBG317546"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199C701"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD5"
FT                   /transl_table=1
FT                   /translation="MPNPSVVLATAGYDHTVRFWEATRGVCYRTLQYADSQVNKLEITP
FT                   DKRYLAAAGNPHIRLFEVNTQNLQPVTSYDGHQGNVTAVGFERDGRWMYSGSDDGTVKI
FT                   WDLRAGGYQREYESRGAVTCCVLHPNGTELISGDQNGNVRVWDLTQNACSCELVPEVGT
FT                   AVRSVSIAGDGSLVVAANSSGTCYVWKLQRGAKTTAHFEPLHKLQAHNAYVLKCLLSPD
FT                   CRLLATTSSDKTVKLWNLDGFKLERTLEGHQRWVWDCVFSVDAAYLVTASSDTSARLWD
FT                   CASGEAIRIYSGHHKAAVCCALNDSAVDA"
FT   CDS_pept        join(99103..100084,100165..101183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640258"
FT                   /orf_name="MICPUN_60478"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69067.1"
FT                   /db_xref="UniParc:UPI000199C702"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD6"
FT                   /transl_table=1
FT                   /translation="MSAPGGASCLSFGRRAPPPAAAAPAGDRDPPRPSPSLAASSASSC
FT                   ADGAPKPRTAGLEADDDKRADGNGDDAELREILALAGIKLDDEPRDLFAPDVLRRVGED
FT                   AAAPVDPRVASAVDALHRRCFPEGEDGAPPSWWRPGWGDDVFPPNDPPSSVDPANGEET
FT                   AGETNGTRDGTRVPFEDDDPADDWHKRVGAALRDLAALNDSHRAEPSASPPASASPQAS
FT                   TATGRDLDRMLGACKVVLAWYAGVLDEGHSCVPTPPLGTHVIRRRSIGDTDDLDDAHRA
FT                   HMANLASTWKPGDPQPFSPGLPTSLYIQDQCSYHYDRVRTADHFLDGTKQRVRASVKVV
FT                   IAPRVTSGGATNVVVDLSNAPPPMPPPRPRVGLQPKSFFDDPSDPDWCRDCVCFVELGG
FT                   ASGHPDFLRRLRGKGANPSVQESGTETEVYEFTPPGVLVGDFLRGPDDCQAVPWGRCTV
FT                   ECKSTGLRATLDCGVGEAEYIRVGAVSGAIKRDGTNVAMVLGNLRGVGFHVARLDSPPG
FT                   TDAPPPTVAEVIPPDPTKAGEIPRGFRGLYVPGGYANRRLWHACADAARRNVDWDVEHE
FT                   GDVDQRIHAYALFQMKQHWQRLEAAKVPLFLSTGIKGREMRYEFACVVADSPGPDQEPP
FT                   LPRFWEDRKAPPLVDPEPDGLFNHPAAAPKG"
FT   CDS_pept        complement(101434..102162)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640259"
FT                   /orf_name="MICPUN_84408"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69351.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199C703"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD7"
FT                   /transl_table=1
FT                   /translation="MDAKNLTLGIKGQKPYIDNEPLTATCYEDDSTWEIDTFPGKGRCV
FT                   RVTLRKCVPDSWEFLLKRDNKPPDLTFTSKCFFDISAGGEALGRVVFGLYGNVTPKTCE
FT                   NFRALCTGEKGEGKMGKPLHYKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGEKFADE
FT                   NFRVKHTKPGLLSMANAGPGTNGSQFFITVTETPHLDGKHVVFGEVCEGYEEVVKKCEE
FT                   LGSGGGKTEKEIVIDDCGEL"
FT   CDS_pept        join(complement(104662..104870),complement(103075..104434),
FT                   complement(102484..102807))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640260"
FT                   /orf_name="MICPUN_60480"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="heat shock protein binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO69352.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199C704"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD8"
FT                   /transl_table=1
FT                   /translation="MAVLTAEQLSEPLTRLRIGYDPALVPAGGAEVIGQCASPLADAMP
FT                   SNIEAAGRGFHEKILIKTGAFASREELHRSQSAARLSRKASVASFQSDADAQENDPNYK
FT                   GPKPDIKIGTMVWEDHYDIMGLGRERHLADAEAIRVAYRTRSLMLHPDKLITPDTTEEE
FT                   KERLDDRFKALNTANELLNDAKKRRVYDSVDAPPTKLPMKFETEDFFDKAIPAFHSLCR
FT                   WFDGKGDAAKFIESDPDAPYEKVRKMYEFWAKFKSWREFPHEDEEDLESAEDRWGRRQI
FT                   EQENKKKREKSKKEDTDKIKRFVERAEEKDPRVIKKRMEDKEAREAKKKAKGAGKREAE
FT                   EAAKKAAEEEAAKAAAAAEEAKAAKANAKKELDKQKKALRKEKARLREQSARADGWVGH
FT                   PGEDDVEELANSFDVQRCDEIKALNDELEANENEDAIVAVLTRELAKLEGAKSEERKAA
FT                   ADAAAKRAEAETKEEQKSAPWDDEDEIKLLDKACNQKFPMGTKDRWERVAEYVCEHGAR
FT                   PRTAKEAGVKPTGDDYVKFQAARDKKGSAEVKDAATERKDSFTDVDVKMNDPNAWSQDQ
FT                   TKALAAAIEAVPKTAAAKDADRWKMIATAVPGKDAKQCFTRYKEMKEAHKAAKA"
FT   CDS_pept        105290..106387
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640261"
FT                   /orf_name="MICPUN_60481"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69068.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C705"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFD9"
FT                   /transl_table=1
FT                   /translation="MVKPRSSLRDLVVERMIDGLQTNNMMKAVAAGIEVVEHYDGCFSD
FT                   DNAEKNVGLRLTLANLLVSVRRAPGDLALSARLNRKSLTMLPPSMDNQRFRINSDLSAT
FT                   LSSLAQEGGALEPGAEVTVSGLKARPELNGGTGTIVVWYPDRGRYAVKVGDAEEVALKP
FT                   INVGQTAEMFDEAYLARVREATDIAKALDPDAGGQEETYPNELRELKCEALEKAYTALD
FT                   AFTRVRTHGAGDDVSVKATSAERYVKVHDDERFSGLKIEICEALDGAAFKPAEQVQARY
FT                   NWGAALCRAGRIEEGKERYEQALEMLTNPGASGAERLRKDISGSILLCDRQISGEQPRT
FT                   GAFIELATGDGPRYARVVNGGERKE"
FT   CDS_pept        complement(106717..107544)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640262"
FT                   /orf_name="MICPUN_60482"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO69353.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="UniParc:UPI000199C706"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE0"
FT                   /transl_table=1
FT                   /translation="MRNWSVAPPHYVGNARFVCICVDRSAQRRAKEFQDLYFDGGKVLN
FT                   TFIDCREDFPTFQAQLGCQGLIVLDANGIFATSKSPPFLQFRGQAFEYVEKLLRQLAKE
FT                   ESHSVDKEGGSLEAQAPMRPPPAVACCDGSCARTTDDTDAVAPQSYDLPSTGHDAMDAE
FT                   HAELTAAMIAATSLSTLAAVTTLRDIFAAHASHEERLMRDSLFGESHHAEFSVVESHAK
FT                   DHAAICDAATHAMKEADVDGIVQKASVRALCARIVEHAEMYDALYEGRLAVAM"
FT   CDS_pept        join(108015..108076,108226..108532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640263"
FT                   /orf_name="MICPUN_60483"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69069.1"
FT                   /db_xref="UniParc:UPI000199C707"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE1"
FT                   /transl_table=1
FT                   /translation="MSTVTRILCKPIVPSTSAVRGLSGNKRVFYHAFSVNNTVARHKAG
FT                   VTYDDRGELGHTASACETHAWGPWGLEPVGHTSLCGSCGDMHARGTACDPAKRNRFIRT
FT                   CVTDGGASLMPRMKFSRQ"
FT   CDS_pept        108835..110121
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640264"
FT                   /orf_name="MICPUN_108724"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69070.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199C708"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE2"
FT                   /transl_table=1
FT                   /translation="MTTTSKDTRVPVTILTGYLGSGKTTLVNHILTNKDHGKKIAIIEN
FT                   EFGDVGIDDALMAKNTKAHIEEEIVEMMNGCICCTVRQDLVVVLNKFAGRIASGNLKLD
FT                   CILIETTGMADPAPVAQTFFVDDSVQEHFRLDGIVTLVDAKHIEQHLDEEKPEGAENEA
FT                   VEQVAFADRMILNKMDLVDKADVERITARLKSINSSAPIITAEKSKVSVDLVLDIHAFD
FT                   LKKTVDMDPEFLNTDNEHEHDDTVSSICVVEDKPLDLDTLQRWVNYLLVNKGTDLYRMK
FT                   GVLNVADSEERFMFQAVHMIFNGNFDEPWEPSEKRESKFVFIGKNLDHAELKEGFLACI
FT                   QTPDLVAKRKLALRFAVGDAVECRTADGYVPGKVTQHLYRDDFMPPGVTAPYQIQLDDG
FT                   KLIWAPEDDDKYIRAKDALFAEKKAKTEA"
FT   CDS_pept        111189..111944
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640265"
FT                   /orf_name="MICPUN_108725"
FT                   /product="Zinc permease family"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69071.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000199C709"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE3"
FT                   /transl_table=1
FT                   /translation="MILCGFITSPVIAIVLKFFLPQLEKDDEFCEATKPGNTVIGAGNA
FT                   QKMLHSAEMGRATDNCCNYEHSTVEDCEKSITNPNVRARFLMSLIAGDFFHNFTDGIFI
FT                   GAAFQCNTTLAWRIVAVTVAHEVPQELADFAVLVNSLGFSVPTALAYNVIAGASVMLGG
FT                   IVIMLADVSNLDTGMLLAYGAGNYIYCATVHMFSMGSKNILHDAKRLLAFAVGAVAIGL
FT                   ILLDHEHCEAGADAGGGDAHAHDHRRLFY"
FT   CDS_pept        complement(112349..115333)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640266"
FT                   /orf_name="MICPUN_101746"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO69354.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG562506"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199C70A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE4"
FT                   /transl_table=1
FT                   /translation="MGARRPVAMGLLFGFMVALWRNYLDAREIRHRIGATTAADLGAGG
FT                   NSGFSRGFGTDDRIPNADPTPAVTEASSAASSDPTRPKELQNRQTTPKPKSTPKKSRIA
FT                   SAITPPAVRAVRLSYPDPFARPFVEPGCEPKPPDPALPGPRRLDWIADPLDTADADWPV
FT                   NCGGHETLCDVLRKTAIDREVLAAVADSHAPGVYEFVDGIKRLGVENFMIIALDDPLHR
FT                   RLTDQGVASYRVVNDAQGSHKISAQKFRIIQEFVERGCSVLLTDTDVAWMRNPFPFLYR
FT                   DADVESMSDGWDNSSAHGFLDRVDDPSMGPDGRKRARAFRVAALNSGMWYVSATEASRR
FT                   LMAIMAHRMATEDKLWDQAGYNLELWFASRDAHGTAGATVRVMDPLCFVNSKVMFRFIR
FT                   HNQPALGKENHRPVAMHANYHTDKAHKMKLVYQYYTNGAGIDVLNCDVGCGPNLKTTHE
FT                   LESKVQHSINDGIVGSKKWTDATEGMWAARPGGPPGSKRPSEDPSHCAPPTPWNGAVAG
FT                   VDRASTLHVVKRGRGGECGAGVDDDFAVASAAVCAAVDNLGDPNAPELILVTVGDDINE
FT                   EAAFEALLRDGVTRLGLKGRVLVATTSSKAASAARSAGVKSVALVAAQLSSQPSKSKSA
FT                   PLSSTALKWLAARLVLSQGWPTLLLDPRTALIRDPSGYFSRDSDVEVASDGWDDVTAYG
FT                   YDHVVDDPEMDWSRFCHGGRVLTSDPGFALLMPTEEAAKLAGLVFGRIAYQTSLSNEAD
FT                   FEHLAFNEALFLPSHGAYVSPGVTRRTLNYMCFANSKHVFRFLRKDRRFKDRAEHAPVA
FT                   VRLSYHPNEPARLGDVYAYYLKGKSGALNGWGDGVGRVKGGDAGGSGVGSKACAQSKSL
FT                   KPGQGVDEARNEALASRLATNPNWSWGGVTPFVFEPGGALSTPWGPGEWGFVPAGSDGP
FT                   GVVMAKFVGTPHVLSFETAGEGAGAVRHGMFVSERCTDGDMIVGRIYAELTDEDRKKLA
FT                   SARGG"
FT   CDS_pept        complement(115385..115600)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640267"
FT                   /orf_name="MICPUN_60487"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69355.1"
FT                   /db_xref="UniParc:UPI000199C70B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE5"
FT                   /transl_table=1
FT                   /translation="MGILSQIASQVVITGVLIGVARRAGVITLNPRAIKGETARKAFEV
FT                   YVSTAEWAVKKAEDVLLSSAKSLTSK"
FT   CDS_pept        complement(115927..117894)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640268"
FT                   /orf_name="MICPUN_60488"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69356.1"
FT                   /db_xref="UniParc:UPI000199C790"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE6"
FT                   /transl_table=1
FT                   /translation="MSDLNVTAPPFAPTSAKASDPAARDAADASHPAPPRVGAPPEEKE
FT                   KEKEEGAGEGEEEAALDVASVDPTLTLTVDAATRSARENCALVHALCSLLTSTRGRVAQ
FT                   LEARLASLQLELERTGGRRSGSSESERSWERAGADAPPTTPASPPEPSPVANGLAWADD
FT                   DDDSLPPPPLAPAPAAPVAARRPPAPPPSSPRTLAPHPRSHASSPTPTAEARASFSSVV
FT                   EGPRAPTHDDDDAFPKLGAARDEDGDGDVKSAPGDGDGDGDDEDERDADDVGFYDERVR
FT                   GYEPAHADDGSDTIDPRNPVVNIIRLPDAFVERYLWDLPPATNFANGSDDEQSHPDLTT
FT                   AVSAVSAVSVVDGDEDVRTDVREKGDLDDEGFRSVTGPSHHRRDRTRGEVFARACAALS
FT                   LLCEAVGIGVPAAVKVKIRRAPVGHRSRMKFHASVRFARWHHEGIRCALANASLDDDPG
FT                   GFVRVRNFYAGDYVDLRRDRDQRLRPRGPSRLKVFGFGHPTLLHHKIAEFDLGGDGFVT
FT                   AADAEFAGWRADGAGGANVVHFDDVDSARHPRGHHPRTTLGGPGVLPPRPPAEPSGAPK
FT                   SKSSVASTTREYFPETRRGWVETDERRDTRWRPSAKVWEGPCSTCGEPGLRVPFRPVVG
FT                   GKPPRCVTCVGDEAARRRLG"
FT   CDS_pept        118298..119833
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640269"
FT                   /orf_name="MICPUN_96517"
FT                   /product="Non phosphorylating glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69072.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000199C791"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE7"
FT                   /transl_table=1
FT                   /translation="MGSGHEGGAGAPGGGEFYSPLYNPDTGAYRFLIDGEWRDSASGQL
FT                   VHNANPSKGNERCFGFQACTRDEVDAAYAGAKAAQRQWGRIPLNKRASMLKAAAELMRQ
FT                   HHAPIADALIREIAKPKKDATTEAKRSADLIEYAAEEGCRSLAKGDMITSDSFPGAERD
FT                   KLCMAHKVPLGVVLCIPPFNYPVNLAVSKIAPALIAGNACVVKPPTQGCVSALMMAQCF
FT                   KKVPGIPAGLVQVVTGRGADIGDYMVEHPGANCISFTGGDTGLAVSRKARMVPVQMELG
FT                   GKDACIVFPDADLDLAATAIVKGGFSYSGQRCTAVKIVVAFEEIADALVAKVEEKTRKL
FT                   TVGQPEDDAQITAVVSAASADFIQGLVEDAVAKGATMRTEWRRDANLIWPCLVDDVTAE
FT                   MRLCWEEPFGPVVPVVRVGTEEEALRYVNESKYGLQGCVFTRDIDRAIGIADRMETGTV
FT                   QINGPPARGPDHFPFQGVKDSGIGSQGIVNSIEMMTKVKTTVINLAKPSYATA"
FT   CDS_pept        complement(120000..120686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640270"
FT                   /orf_name="MICPUN_60490"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69357.1"
FT                   /db_xref="UniParc:UPI000199C792"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE8"
FT                   /transl_table=1
FT                   /translation="MPGQTMGNGRWTRERRETEYYRLSRLRAERKLAAIERRRSVREAK
FT                   KSIRVMKDEVAKQIAQIVEDRAFATRPTYQIPPNWKATHIERPQAFYKVVACKDDKFVS
FT                   VYDGETEFALGKTYKTQRGTPSGWPPKAECFFAWNSPLGALNAAFPVGSKAGVLPRVLL
FT                   KVEGRGNCYEEHEVFPGGSSRWTGSVALSSVKVCRIMTDAFREASADKVLLPDFTLPRR
FT                   PPPLPP"
FT   CDS_pept        join(120842..121201,121330..122145)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640271"
FT                   /orf_name="MICPUN_60491"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO69073.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG562526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI000199C793"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFE9"
FT                   /transl_table=1
FT                   /translation="MDPAACGDRPNFLDFSFQKTVVVSSARALRERAPETRKMTNPADA
FT                   TQVDIAEKENAPSPAVKASPKPAANGDGSSKFVNVDGKVKHRRVVKADGVDAMTQADAT
FT                   VGAEQEHVNDYERQREERIRRNNERLRALKVLDTAKALEASAAAASNAAAANVVKRPPG
FT                   KARGGRPKAPPPPPRAKSRRLAVVANTDAALAAKLQAAEDDGGFMDSIDDDDDATPAHL
FT                   TCEEWCEKRGLAPGPKMDGHFRGWVAPDLVQSLGLAASAAEAWESNGGGSFAKAGKAGK
FT                   GENAKEFARKMIKKNPNCYFYRHNAPGQDAWHGDWAEDEIQRFVQVAKEHGCGDKWGLF
FT                   ASYIPHRVGYQCSAAYRHVIIPRGLLLDDQFVMSRSGEAVYVGKKGSKGSA"
FT   CDS_pept        join(complement(124963..125117),complement(124767..124857),
FT                   complement(123226..124374))
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640272"
FT                   /orf_name="MICPUN_60493"
FT                   /product="DEAD/DEAH box helicase"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69358.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C794"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF0"
FT                   /transl_table=1
FT                   /translation="MAYQMPPQGYGMPPQGYPQQGYPPQGYQQMPPQGYQQMPPQGYPQ
FT                   QGYPPQQMMQPPPQQQQQGSWKDQLALPPRDERYRTEDVTATKGNEFEDYFLKRELLMG
FT                   IFEKGFERPSPIQEESIPIALTGRDILARAKNGTGKTAAFTIPVLEKTDTSKNVIQAVL
FT                   LVPTRELALQTSQVCKELGKHLNVQVMVTTGGTSLKDDIMRLHQPVHIVVATPGRLVDL
FT                   ASKGVAKLNQCTMLAMDEADKLLSPEFQPVIAQLIDFLPRNRQILLYSATFPVTVKSFK
FT                   EKYLRKPFVINLMEELTLKGITQYYAFVEEKQKVHCLNTLFSKLQINQSIIFCNSVNRV
FT                   ELLAKKITELGYSCFYIHAKMMQSHRNRVFHDFRNGACRNLVSSDLFTRGIDIQSVNVV
FT                   INFDFPKNSETYLHRVGRSGRFGHLGISVNLITYDDRFNLFRIEKELGTEIQQIPPTID
FT                   PAVYCR"
FT   CDS_pept        126749..>127207
FT                   /codon_start=1
FT                   /gene_family="HOG000007269" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640273"
FT                   /orf_name="MICPUN_84415"
FT                   /product="Predicted protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69074.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG756502"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000199C795"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF1"
FT                   /transl_table=1
FT                   /translation="MCYVGVGANERLELTRCSVVGPDGSVIYDKLVKPAEPITNYNTAH
FT                   SGITEEQMRGVTTTLEDVQRELLELIACETIVVGHSLENDLKRLRLIHARCVDTVALYP
FT                   HQRGPPYRTKLAHLTERYLARKIQEGSHDSVADARATLELAMLKFVFGP"
FT   CDS_pept        complement(128046..128402)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640274"
FT                   /orf_name="MICPUN_60495"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69359.1"
FT                   /db_xref="UniParc:UPI000199C796"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF2"
FT                   /transl_table=1
FT                   /translation="MQVPGRPPASGPLANPGVRAVGGVVATFAGAFGGLAAITALATGV
FT                   SRKIVVSRLRANGQVCYLCEGRKFVTCRTCAGDKAIEWQPLANPGMRRLCACPTCGGKT
FT                   GLQKCNNCVGLGYA"
FT   CDS_pept        <128936..>129337
FT                   /codon_start=1
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640275"
FT                   /orf_name="MICPUN_76600"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69075.1"
FT                   /db_xref="HOGENOM:HBG618397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI000199C797"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF3"
FT                   /transl_table=1
FT                   /translation="SDDDPELIVHVPFTSDVKVRGVMVIGGGSGSAPSKLKCWVNKAPG
FT                   EIDFSNADRKTPTQQWDLAEDFAGELEYRTDFTQFQAVSSLTLYFPTNFNGDGATEVWF
FT                   VGLRGEGTLNRRDMIVTAVYEARAMPQDHK"
FT   CDS_pept        join(130629..130854,131109..132019)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640276"
FT                   /orf_name="MICPUN_101752"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69076.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199C798"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF4"
FT                   /transl_table=1
FT                   /translation="MRLAVRRSLSARDGRGSVLVPTASAGLASMTCAALKMSDADAHTA
FT                   ASVAEETLGACPTLPPSAPPPSSPSSPFCAWAMKRRRGSDAPAVAGEESDPSIQLPSLP
FT                   DDILARVFAIVEREAGPKYLAALSCVCSTWRTAFAQSAAWRVLLEQHQRAPRHPRRSWR
FT                   DLYFAQLRKDAANVAQRHETMLLRLIGGGKNLGPMRRDSPKGLRRELLALGRDLDVDYA
FT                   FASVRGRTLLGLCAAMGRLACAKELLSRWAPRCNVMDADGFTPLMEAAFRGNEHMAHEI
FT                   MLARPDGDDASVTSSVTRPTSNDDAEARRGRNAPLDAPDEPFRGERSVNGCTRKLSAIE
FT                   WATFRGNVRLAGLIEAREAGAAYDAEPRTRTNVTPWTV"
FT   CDS_pept        complement(132177..132575)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640277"
FT                   /orf_name="MICPUN_60497"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69360.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C799"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF5"
FT                   /transl_table=1
FT                   /translation="MPAIWRPNVRETLDEDGEVEDTESGGGEVAKQGTKRKRAPPTKGP
FT                   CEHGVKYLSNCKVCSACPHGRRRSRCKECGGGSICEHGRRRSHCKECGGGSICEHGRQR
FT                   SQCKECGGSQICEHGRLRSTCKVCRAAN"
FT   CDS_pept        132724..133785
FT                   /codon_start=1
FT                   /gene_family="HOG000023913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640278"
FT                   /orf_name="MICPUN_84028"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69077.1"
FT                   /db_xref="HOGENOM:HBG635091"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniParc:UPI000199C79A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF6"
FT                   /transl_table=1
FT                   /translation="MITGITAPSPASGLASRRGTFAGGGGGGGGGVGRGPLSRVAISVR
FT                   RSPSSLRVAAGARAEPGSVREWIERNLDAGAVTDVSRGGSSGWAEFSTYTTESGKRFFV
FT                   KTSRRDPSMFIGEGAGLNAMFETNTLAIPRVYYAGATPEGSREGNSFIVMDHLNFGGRG
FT                   DQAEFGRQLALMHAATPAVEEARAGKFGFTVDNTCGDTPQPNGWMDDWVQFYLERRIRH
FT                   QLRLARDSTLTELGEKVCERAPLWFEPCGAIKPSILHGDLWSGNIGTVDGKPSVFDPAV
FT                   YYGHSEAEFGMSWCAGFSQKFYDAYFEVLPKVETHFEERRQLYLLYHYLNHYNLFGGGY
FT                   RGQCVGIMKGLLA"
FT   CDS_pept        join(complement(135567..135626),complement(133915..135357))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640279"
FT                   /orf_name="MICPUN_105911"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO69361.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199C79B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF7"
FT                   /transl_table=1
FT                   /translation="MMASSSARPLSWVNRVANGRDAGLARNRRASASAPTRPHRHPGPA
FT                   PVTAIFNFGQDNRTEETQKTEEATAPDGEQSNNVTNGGGPGGFFENAGAMFRSKSGGVG
FT                   DVLEQNTGEGSDKNYGGDVAGVSNDDPIDGVLVDGHAAMDEAALLAADLKAGASPASSE
FT                   DAMDDLYNEIAAKNGVNLDEQAIDSGIPPSSFEGSHASSASDPNVMFQPPPVEPMKPPA
FT                   AQQTVYADPEVDVIDPEVSHLAENSPIAQPGAEKLATVTPSPMDALFDDLMLDSSLYDD
FT                   DNMVETVQVVKVRFTIKKAVEFGEVLRMVGGHESMGSWSLRRSPALKWTTDDNWVSEDI
FT                   ELPIDGVYVYKYVVTEAGDASKPVSWQKGNNQVLTLRPEDSPALLVQDSWSGDPSKAYT
FT                   SKMDGSDKMQSETRLVERIGVADKKLHEARLEVMDLKVEVRTAQLQSAALREEARLSSN
FT                   VRLKLKQQLSAEKKRSEVLEEQVTEWKNKFKQLGSGSKPPPS"
FT   CDS_pept        join(<136408..136842,136972..>137205)
FT                   /codon_start=1
FT                   /gene_family="HOG000015113" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640280"
FT                   /orf_name="MICPUN_69866"
FT                   /product="Predicted protein"
FT                   /function="5'-3' exonuclease activity"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO69078.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008409"
FT                   /db_xref="HOGENOM:HBG595625"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR020047"
FT                   /db_xref="UniParc:UPI000199C79C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFF8"
FT                   /transl_table=1
FT                   /translation="GHVVLVDGMSMIFRSFYGWKNRAEPLLNSKGEDVSVQYSVAHAIL
FT                   GVLELDPTHLAVCFDAKGKTFRHEMFTDYKANRPPTPPELKETIPRVIEMVRRMGVPLL
FT                   MTSGVEADDIIGTVARRSVERGLHVSVVSPDKDFFQLLGPRLSARGLVPYTERDFRAEF
FT                   GGLDPAQFVDLLAMVGDSSDNIPGVEGIGPKTAPKLLGEYGNIEGCVANAMEIRNKRVR
FT                   E"
FT   CDS_pept        complement(137746..138096)
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640281"
FT                   /orf_name="MICPUN_108622"
FT                   /product="Histone H2B"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69362.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000032C773"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM8"
FT                   /transl_table=1
FT                   /translation="MAKPTSKKPAKKTVKGAGGKAKKSKTETYKIYIYKVLKQVHPDTG
FT                   ISSKAMSIMNSFINDIFEKIATEASKLARYNKKPTVTSREIQTAVRLILPGELAKHAVS
FT                   EGTKAVTKFTSN"
FT   CDS_pept        138293..142261
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640282"
FT                   /orf_name="MICPUN_60502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69079.1"
FT                   /db_xref="UniParc:UPI000199C79D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG0"
FT                   /transl_table=1
FT                   /translation="MCPRMKRTSRPDLGQWEIRIRSRCRWLAARDSEIRSFRSTKKSGV
FT                   TTTQCIGRGAVPIHRISVSSAFRHTDTRPAHEERAGTGSRASTRVSSSGNSHASPALAP
FT                   LGAERSQTHARLFRGVSSSHPSARMFPRGVITPASPAAANEARALLAPEEERLLESNAS
FT                   TKRSGALTWTLRGLGAVAVVSGVVAVAAIAPGGRDATAAVLARLGGPATVLGRAPAVAT
FT                   VRPEPLPKDAKDEYARKHAHEAKYRSASARARVPTKRSSDDAADTSKTDPVEEVDPSDA
FT                   DVVPDAGASDKHPARVKRLSYANPQVQHMTEEMRAKDAEIEALKFQLRRQAEELDARRE
FT                   ASGEIDSPTPASSKEEEKASSASSERRHRSSRSSRSSEKKAKAVDAAEETSTGAISSAA
FT                   HHLGGGEPEDIPERTRAEDIPEETPDEETPDEETPDEETPEDVPERTRERSPPEETPEE
FT                   TPEDADYDPTTGGEGPPLDDPSQALENCEDVCEGHDFTEAVCVSKQGCEWDDGQCWSEV
FT                   GPNPCDFVEPEAHAHENCELVCEGHNYGLKECVAIRGCEYDGGACWSAVGPHPCDSGPD
FT                   PIEFPDDASGAWAANKPWGDAYGNKWGETYGPKTDDDAGVFEPVADAAEAVTEGVENAA
FT                   EAVGDGVEAAGEAVSDGAEAAGEAVTDGAEAIGDGIEDVGEGISNILPHFGDDEPGSKK
FT                   ASSKKASKVRGSEATGKLGKDEKAKGPYVASAATKYTDGSLENGAVDSAYVPVPTEADV
FT                   AVEGEAEKTPYVASATKLTDGTFDGAVDSVYPKVPTEADVPDENAKGPYVAASTKFSDG
FT                   TFDGPDQFDPTGVYPTGGYEKSPEEIETEAARVEARASEAGAYKKAYAAAAIEEEAVGD
FT                   EHTDVAEEDTGYRGGYVAASTKLTDGTYSAALGKHHKYTAAPTVNPYGVKDAEESAAAD
FT                   AEEAQEADDELESEADAYKKAYAAADAEEQAAGDEHADAADDDGYRGGYVAASTRLTDG
FT                   TYSESALGKHHKSAAAAEEDEDEKPKGYQSSYTINPYGVKDPEETTELDEKEEDVPVEK
FT                   PHGYVASSTRLTDGSMHTTDDVAAMGSQGVVASAAASDDVDWANFQPEPTNYHDEPADD
FT                   EELELVRKQEAERAAEFEDKEEKERLEAAEKAMSWTAYQSENGKIDHALEAAEEEAADA
FT                   AVVDDAASEAESSADEDAEAAAAEERYESVAAEEESASASAYASSSSVPSEDAEQEKKH
FT                   GYRAPATHLTDGSASAADPAPGAPAPHGYVAAATRLTNGSGNKARPQDQPGYVAPHGYV
FT                   AAGGRAEANNVQKEAYAVDDAEEQEAPSGYVAAGGGRL"
FT   CDS_pept        complement(142412..145225)
FT                   /codon_start=1
FT                   /gene_family="HOG000100074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640283"
FT                   /orf_name="MICPUN_101757"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69363.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561426"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C82F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG1"
FT                   /transl_table=1
FT                   /translation="MTKIAPDGRLEPEDGGGLLSAVGVPNVLEKIGLSDAPARYQDASV
FT                   AKKEVLRSARDLPRNMTSRISRLDRLGYKLENRIAANPNYPFKLVVIFTSVVLVLVGLL
FT                   YHYLAARPAVAQFDVFGSNSWADGIYLALSLVIAAGVDDSVPDKMGLRFVYVSLIIFGL
FT                   VIFAVVVGFITKQIDDFLVTIAEGHTKVAEDKHTLILGWNEATLRVVVQICFLRRQYQQ
FT                   TNERRFLNMFPFAWIKRFTFLLETPSTSLAVSNVVLMTNQLSKAEMHEQLEQILAERGI
FT                   DPKRTRIGRDIICRVGDPTNVNDLIRVGAHKASAILIMMSKMDQVEEEESDGTIHNGAT
FT                   LRVLLALRHVLFTNSYTHAKGTGLNPDLRVVVQMSNPSEYVDAACFAHDNGNPAVIPVD
FT                   LTKFSNALMFNCAAQPGLSAILLDLLDFEGPAIRRRIAKNLRSGRFNVKGDCVGKTYGE
FT                   TLKQFTTAAFIGILRPGMSEKDMRSQGFGLCPRMDIVIEPDDLLIFIGPRVNPVHHYKN
FT                   LGVFEEYAGEALKMHSMHPKIEAKRMENGPVNSKKKRNLLVCGWRSVWEQYPQRLRSRL
FT                   NEIVRQRLPGSIVIFVNAVTCEDFENLMEKIELKPVGDNQYCVDNVSSSTEALWWKGIV
FT                   VKHIQGDAAQLETLRPVITDNTVDAAIVLGTQANHNLAGRHRDTRVMNIILMLRKLWNE
FT                   KDEGVPMHIVGENTEDMTARLALAPPRHGQNRIHNGERFIEYEPDFVNQMAVIARALVQ
FT                   TLAYPLIDSARSELFDDDPDSTQLVTVHASEYVPLDTKLRYGVVRAAVYRARGEHSICL
FT                   GVLWADGTSDLLKKHDEPVSFVEDDRLIVLRRWAKGFHGADGVIEFQDELADKKEELAE
FT                   MVGVQSARKERKDKSSKKEKKEKKDKSDKKKKSEREKLEKKDSAERIDVVPSTAFDGDS
FT                   FDGDPGQ"
FT   CDS_pept        join(complement(152891..153149),complement(145467..152749))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640284"
FT                   /orf_name="MICPUN_105913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69364.1"
FT                   /db_xref="UniParc:UPI000199C830"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG2"
FT                   /transl_table=1
FT                   /translation="MATFQALGDRLAHLVPHGCDPSAIDQAAVFDTLAEAQLCLRRTDP
FT                   EDVRARQRGFEDALLRITCGGWAGPAVRRSASDVLSVLFSVGNAVALYSCVNEIMTHVT
FT                   ALPERGSASKPNVGCGLTRQGAARIGALECVARLARGGHGPAMSGGAGSIVAAVAKLLK
FT                   STDGTSAKFPNAWALTPDGARALRRCAMRTLAAIVGGASRERPLRAEVRTAAARVVSDA
FT                   IAHGLAHGPRLSSSSSKGSSSNDLIARDLENAAEKSGHSCAREAFSLADLTGDRERLIP
FT                   GAGRTVQAAACAAAGALASTPGGSGLWGDEGGRSARGGSGKPGLRSAAEEMRDVLRGAL
FT                   EEGDEETRGCAASALGALAAARLYPSEHTHATRVAPDGSNGGGGGGGGGDGDDTAVYDA
FT                   AVGALDDTPTKISGSGGGGGNNKNNKKPTHHRRSSSSGGGLFGGLMRGKAGGGDTESSA
FT                   ALAAAKAAAATAAAAAPLDLDGAGVDRRWTETIETCFVRAFRDACRSPGADGRRARHGL
FT                   AAAMVRFTARVSAKSLESGKSVPARLLVGMTSQVYGAIADALEGPGGMAREDAPHAEAC
FT                   ALHVLRCGVIARLDEPGRGSLLRSLASIFFGHDGSKEDRTLNPKVNVTGDIAMRAIAHA
FT                   LAAAGRVDDDTADALCGCVFRAMDSGGCPDEVALAAARLASASPRRAAGLLRRSVEKVS
FT                   ANIAGTMDAAAVAAVCGGAAATAALVAAGDVLPLGLPGGLLRDAAAAAFALAGGVVDVD
FT                   DADAECELRARGFLAAAGVLRGPSGRYEAESRRDEILASLKKALDPQALRTLLESLEND
FT                   EGGSSAQSQSKSSGAFGFMSSSAAKKKRRPAPRWPPARELRWRAAAVDLLAAYASIANT
FT                   DELNDEKNDSPAPPSVVDALLDDAARCSLVNTVHFFEGDPRGEEGGAEAGQHTAGYVDV
FT                   GEWPADSLVATQLASFRLATLRAFNVIHGVENARKNARDPPLKPPLERFGRRGGHVGYS
FT                   NALVALCGTPVRPLPDSNLGSACVVALRLALGRRGDDADAGAWASGGGGGGDAALDELR
FT                   AFDGGWDAPRDEELFLGFGLGGYAKGSFRRGASRRFPRPAGLAATLQATRVHALAFLCT
FT                   VDPAALRFIEAEAGIVVKGDVKGDDSNPSGDDSNPAETVRKRFEFDGSGLLPASPASLV
FT                   NACVASLALADSDRFKSFADASLVASSLAKIAGAVDRSRWSGPAHWRVAAELSARAAEL
FT                   GGDADAASLLTSLAASLPSTPPRRRSDDRPGSQKNPNDNSNPSADDDGPSPRAVAACTA
FT                   AATFQRAGALAATSATKPLVRSLLETSAQVDVGSDATHLWPLRALGVVAQHVGPGFARH
FT                   ASTVRRLAFAMVNSPECAYAAGAAETRAACGRLVNAAVAAIGPDLDPGGETFKSFAALV
FT                   AAVRDGGENGPTGTEPTGNRTDGDDGTDAGDRRDAECQLEAALFLQQLAVFAPQTAPPD
FT                   VLVRRLRPYLEGSASASLRRVAAATLRHVCERDAYAVLRSVHARSMSDGRSTRRRSHHV
FT                   GGGIEADLLALLDGYGGGNEGGELEDDDGYAVRDATRALWLLTGANAHDDPAKAARRLA
FT                   AVALHAPGRDWGGDELDGGAELDGGAELDGDDEGGGAEGAEGEPSNAEGDDSDAEDERG
FT                   VRNGRRNGRRIAIEVAGRAAPKLSTRVIAAAMISAIPSFVSAHPAHLDLALARKSRGDR
FT                   WLCAQADALVDLGHRLATSSSEPLRPRGLALMTRLVETLGDARDPDVPGSALLEQFQAQ
FT                   VLSALRAAAAAVTAVTDGDGDSGESTAGKSTPRLRFNASSVADPASVLEALSLASASLV
FT                   DGRVTGGDPAATRRVVDFIVRSAVAALSLDQSEDDASDKNGEYFDGACEGITARLRVAT
FT                   SRALAVAATHAPDALATALAKANVDAPRNRCELWWRRVLTRSNALATDDLSSRPIIARD
FT                   LARAAGPALEALALASSSSSSSSSVFDACAAAFRAAAASGSFSSGERPREGPGGLNDSA
FT                   DCAGVLNDAAFFEELFEPLNPPPGRVARGDGADGVVGVDVLAATRALRLALDALVSSSS
FT                   SSSFSSSSSSSSSSFSSEAGSAAVAAVRACAATLVERRRAMGARVASDSTFVRECAATL
FT                   ASSARATALVAERGGTPPSEWTLATAALGAAIAGSVPASSPHFRASLVALDALLVSSDK
FT                   STRPEDGGAMSAPLLALAVDISREDDDKVDHGSSHHQNGDVLARLFARAARECPRDDVA
FT                   LLTATRALEAARDAIDAGGGVSPASASVAAVAAGVIASRDGGGGINRAVPNAVDVDAVV
FT                   GSIVGGAAEPRAASAALAAVRETLALERTSGQPSALGDGDDRFGGSDDDVSNVAFAFLR
FT                   AHGAAAAAGTRARCALAAAAAAAGDDRARGDHARAVAEGLKLCAAAVTKLASSREGAGG
FT                   GDSAVSAVSAAVSVFLPLAMDAGAGVGDDERRAAPHPPVPELRAAAAALVRMVAAAAPE
FT                   GFRHAVAALGSESRSRLQSALAGGGGIATTPGGAAAPGTPPAISLGSMG"
FT   CDS_pept        153330..155621
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640285"
FT                   /orf_name="MICPUN_60505"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69080.1"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniParc:UPI000199C831"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG3"
FT                   /transl_table=1
FT                   /translation="MAEFSVACSAPVAGAQTKGVATLAGDVLAWRPSDGNLTGERTAPL
FT                   HLITGHQRNKAGSKVPSLRLVVGEPMPGQKPNALVLSFPGAETDRDALSDAIKAALTEI
FT                   MRSRRMQADADGGGNPDGGAPDADRAHVTTAAERAAREALLAANRDLADMHGKLVMGSK
FT                   HRRDGAELSATITDDEFWASRRHLLAGAVAKVGANQRTGIDNSEIAGIQGQRAGDGDKV
FT                   TATLTHEKMHRIFAERPAVRQAFVDNVLAGKMTEREFWTRFLKSEYFKMVRAGAPPQGE
FT                   EEAADLQLFSRRPAPEVERRARVLALSRSVNLVADAGDYAGQVGTAVASQGAGRVMGME
FT                   DDVGGGPQGGHGIARDGAKEPPPPATRAAMVAAAGGSGHAKAAAAKFAAREVLQSLNHH
FT                   AEVVLRGRPSMAVTDARSAAMAAEEQERAAWAQTSNKNVSNAGGGGGDDDDALVQLEDL
FT                   VEREAPRRMRLTLEDRDAYFAAATGGTRDGAGDGDGEGDEAGHIRTISPETVRARARHL
FT                   VKGIRLVCEQLGIEPTVDGVPVAFPEGTEITDEDRARASAGRRELEGGKKGVKGVVKGE
FT                   PDEASARVVKGEEVDAKTGIGKRKRRRGMPRPVANEDALAVLKEMAVANRREIVNAGLG
FT                   GGGGGATGWGAAGDLESDACKLDDATEGALRDDAGMANELLRHFWSAQPLVTPARWDKA
FT                   DRVARTLEKVYERLEATKRSQTGARRSAAAIRLKPLVQAMDAAFQFFDDEKVKRASAYE
FT                   AFEKEKAARE"
FT   CDS_pept        join(complement(156615..156679),complement(155746..156580))
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640286"
FT                   /orf_name="MICPUN_60506"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69365.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C832"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG4"
FT                   /transl_table=1
FT                   /translation="MSERYARLERIARYTALWQCEQQKAGKSHYRTAELKVTLTKVVSN
FT                   GRRPAGHLDGARGWMPAIWRPNVRVTLDEDGEVEDTESGGEEVTKQGTKRKRAPPTKGP
FT                   CEHGVKYRSNCKVCSACPHGKWRSRCKECGGGSICEHGRQRSRCKECGGGGICEHGRQR
FT                   YSCKECGGGAVCEHGRRRSQCKECGGGSICEHGRVRSQCKECGGGSICEHGRQRSRCKE
FT                   CGGGGICEHGRQRSTCKECGGGAVCEHGRRRSQCKECGGASICEHGRQRPHCKECGGSQ
FT                   ICEHGRVRSKCKECRAAN"
FT   CDS_pept        join(<157161..157357,157451..>157776)
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640287"
FT                   /orf_name="MICPUN_71893"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69081.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="UniParc:UPI000199C833"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG5"
FT                   /transl_table=1
FT                   /translation="FYAQLLTQRRIFLNGRVDDKSAHTLVGKMLFLDAADPTKPIVMYI
FT                   NSGGGVVTSGLAIYDVMQHVRPPVYTVCLGHAESMAAVLLCAGEKGHRYALPNSRIMIH
FT                   QPHHVVSGQTTDIIIKAKKAEHTRETLSAIIQAHSGKGEGEVNAALERDTYMTASEAKK
FT                   FGIVDHTVTRI"
FT   CDS_pept        complement(157905..159125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640288"
FT                   /orf_name="MICPUN_60508"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="ACO69366.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI000199C834"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG6"
FT                   /transl_table=1
FT                   /translation="MTQLARDIDIFDQTTLPDEDEVPDRRATIRHIKSLVRRELHGDAK
FT                   VQVFGSSRVGTDLPTSDVDIAVNHDIIWKRWLDQGGDRNASQDVINEVIKPDMIHAARK
FT                   VAAAIRRDPKFGNTVAITRCRVPLVRTSCEINELRTGIDIVFGQKNGIAAAKWTDRMIE
FT                   SVHPELRPLTKSVKALLKQKGLGDVSRGGLGSHAVTCALVCYLNHVKRQMKDGQEGKRG
FT                   EKEEKRGEKEEKEDGELDAEVGTVDLGEAFVGFLREMGKIDVEKEVLTLERWRAPKPSA
FT                   WMTEDEFARSGRPRTSAPDGGFAAKDPPRLGIADPADGNRNLCAGSHDVQRVLKGFRDA
FT                   VYNNGPGSYLTRFFNVEDALTGTTLIDDEDDGLSSSKRERSRGGERADRPGKIAKMEGT
FT                   RLPPPDI"
FT   CDS_pept        complement(159254..161587)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640289"
FT                   /orf_name="MICPUN_60509"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69367.1"
FT                   /db_xref="UniParc:UPI000199C835"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG7"
FT                   /transl_table=1
FT                   /translation="MRDDRVGAARRVSVCGSGRVLRLEIVDFLQRSSRGLMISAWQPGL
FT                   AVDMSAWRGARELPRSPPREPPDPSPRVSDITSPRSWSALESSFESSDDDGSSDDDEPE
FT                   TLLYVAPRGRFATGGVGAVGRPAGVTRRAPPLHAYVSSLTGEPCAPLGQDDTTPRHRCA
FT                   TSGVTTAYAHEHHSPGWTGSRSDDDGSGASSMDDDRPLHRAERAERRRAAAESAARREA
FT                   RAMERERRRRHSRTVRRGPACHLPRNLNGCHDNNQNFWTHPWDDPSPRTLRALCVDACA
FT                   AVLRETTRLPPAMDPALVDETMDRCALDVRVLAMCLAAGATKLRLRDFAAVPNVPLTAA
FT                   WRCWQEDSPACVGVSRPPPTRSTPIPAAMVEVVDGILQTRVEGWTKLFGLADTLETVAL
FT                   ECGETGEDDESHGYLRETIAELCGTRSLRKMALGFFERVTDDTLRPLWGGGGEREREGG
FT                   GTSVEKAPLASSSMANRAFVPPPVAIPPPVTALTTPPALTRLDLSHLPLVTDLTVRSVL
FT                   CHCQMLRELRLEFLPVTDACIAHWRVALRNLTWLEVKSCPHMRFAYPDVDWSRPPDKLR
FT                   TLRIQPGGAPENWGYANSERDMRVSARHLHQLSFAKKSAIAHLCLGCEFAAPEGENKKL
FT                   GVGGNVGGYRSETVWDLREAPLRGVTHLELYRARQIIWPRRLARWTDCLESLVVETSED
FT                   GLIHRLLGVATLRRLVVCDCSEMDVDEFVALGKLTTLTELRCGGVGERLAPFAGDVKAA
FT                   IGERLVEAHFHSCVEYPVEESLFD"
FT   CDS_pept        join(165312..165443,165563..165658,165968..166747)
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640290"
FT                   /orf_name="MICPUN_96518"
FT                   /product="Nad-dependent malate dehydrogenase "
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69082.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000199C836"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG8"
FT                   /transl_table=1
FT                   /translation="MAALLRASSRTVSKALGDQTRGYKVAVLGAAGGIGQPCGLLMKMN
FT                   PLVTELSLYDIAGTPGVAADVSHVNTGAQVKGYAGDAELGAALKDADVVIIPAGVPRKP
FT                   GMTRDDLFKINAGIVAGLTEACAAHCPKAMINMISNPVNSTVPIAAEILKKKGVYDPKK
FT                   LFGVTTLDVVRAKTFYAEKNGLETAKVDVPVVGGHAGITILPLLSQATPAVAMTDDVID
FT                   ALTKRTQDGGTEVVAAKAGKGSATLSMAYAGALFADACLRAKNGEANVVECTYVESTVT
FT                   EAPFFATKVTLGKEGVEKIHGLGELSAYEQKGLDAMMPELKDSINKGVEFAKSM"
FT   CDS_pept        join(complement(167459..167695),complement(166948..167286))
FT                   /codon_start=1
FT                   /gene_family="HOG000222533" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640291"
FT                   /orf_name="MICPUN_60511"
FT                   /product="S-adenosylmethionine-dependent methyltransferase "
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO69368.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG353974"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="UniParc:UPI000199C837"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFG9"
FT                   /transl_table=1
FT                   /translation="MASAMASFKDDPDYLGPISATPQKMVEEMLAVAGVTAADVVFDLG
FT                   CNDGRVLVTAAANAGARGVGVEIDENAVKKARTKAAEAGVEHLVEIRHGNACAVDDLAV
FT                   ATVCFAYLLPKGNAKLSEKLMRSMAPGSRVVTYVFRLPKEHWDEHLETCKAVASTRDRG
FT                   GGGGVDTSGFNKIFVYRVPETRPEWCES"
FT   CDS_pept        168393..170399
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640292"
FT                   /orf_name="MICPUN_105915"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69083.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C8C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH0"
FT                   /transl_table=1
FT                   /translation="MSGSQPPWPGFGQVPGGVNPWLGFAPGLNPASAGDGASLAVGNNA
FT                   VPVPGAGGPLSGGAFDFALDRAAAQRALAASASAGGGAAPSSKVRKPYTITKQRERWTE
FT                   EEHEGFLEALKLHGRAWKKIEEHIGTKSAVQIRSHAQKFFSKLQREAQKSGTVDRAGNG
FT                   DGPSESESTVTVIPPARPKRKPAHPYPRKAPDPGVHPTHSGGIANGAGASMNALKGTFG
FT                   GVANGGDSNVAAAAAAAFMMAMGNGTAGFGAVDPAAAAAAWPTAASGFPSPLGAPGNLG
FT                   NAHGGAHGAHAGNPYANALHSQMLALAQVNPAALALLGARPQQTQQQQQQQQQQQAAAA
FT                   QANAARAQQQFMAALAMIGGGGGGGGAQQQPPRVPPAAAPAAPAARQTPGPAPNIFSAM
FT                   LNAVAAGNTAAGAPNAAAPSLSDTAAFANWAAAMGAATNGSAGGLAAANGAAEGEAGPN
FT                   TAVAGGNADQMAALANVMMFFPGIPGGAGAGAGAGAGAAVAPPAPAAANGSGGGQQTHS
FT                   GTGTGTNQTVSENTGRDDATTKENRAERKSALEKRKRGGSARDASDKGGDTAVGDGGRE
FT                   EPRGKRVNSVVAPAIASKGNTAVDEGPHKTSGSGGSGSGGGSGGGSGSSAQTGRRAAQQ
FT                   GFESSSQRENSPNSEKGPNSDKGSDKGDAGVEA"
FT   CDS_pept        complement(170838..173717)
FT                   /codon_start=1
FT                   /gene_family="HOG000237551" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640293"
FT                   /orf_name="MICPUN_60513"
FT                   /product="Glycoside hydrolase family 36 protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69369.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG611539"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C8C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH1"
FT                   /transl_table=1
FT                   /translation="MGPKRGTARAANGVHAATSSLSLALEGGCVTVGGHAFMEGCSQAV
FT                   SLRGTSAVVGDNGCDGATDPGPDTPKTTVDAAILGFRNTHPAWDDDPESDLRILRDRHV
FT                   IRLARRLRCDRFVAAARCKLWWMTPTWGAGGDALVNSSSSTEAGIPAETQFVLFELNGG
FT                   SAHVAAVPIISDGFRCTLSGHVNDCRNTDDDDDDETDGTPHGTPGDGTPGDGAKRCVLA
FT                   LVAESNCERETCDGVDAALVLACSDSPFRAVEAAMAVASEAMNGTFRLRTRKVAPPVVD
FT                   VFGWCTWDAFYHAVTPAGVEAGVNSLTDGGIPPRFVIIDDGWQSVAPDPQFKKRVDHIS
FT                   DHPRTKPDFIDKPHVTEVVEFGRGDAGGGALAWAGGALASGLEYAYWNALHSVAYNSLT
FT                   WNVAKFLVDWVFSPVIRGAFSTMSCFNHRVSAIHANVKFQDEAGRASDDSPSVKRVKGR
FT                   GTKRKSPTADGGMVVGGEDGFGRVISRIKALGVQSVYCWHALFGYWGGLHPFERGVSRF
FT                   RPKVVLPRHTPGLLSVEPSQAWDPISVGGVGTADPEKLAEFYEELHLYLADAGVDGVKV
FT                   DGQAMVGGLGRGLGGGPNLARHLHAALEKSVKRHFPTNGLINCMCHSTENIFNFGDSAL
FT                   ARVSDDFYPTNNASHTVHLANVAYISTFMGEVVVPDWDMFHSLGDAGPLHAAARAVGGC
FT                   PVYVSDAPGKHDFNLLRQLVFPSGKVLRAKLPGRPTRDCLYADTCRDGVSSLKVWNRNE
FT                   IGGVVGCFNIQGAAWSRRKGIFVFQHSDAGDVPSVVASVRPEDVEGMVTGTADGSNEEF
FT                   VIQAHRTRSLSLLKPGQRMPDLLLGPKEWEVYTVCKVLVAGGVKWAPVALDQMLNGGGA
FT                   LESCSLTLAHGVKEGAAKGKGGKGGGRAGVVGETTLYGCGALVCYSSVEPIEVEVDGAR
FT                   VRAKWRASDGNLIVPLGPREGTHAVVVRF"
FT   CDS_pept        174045..175151
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640294"
FT                   /orf_name="MICPUN_60514"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69084.1"
FT                   /db_xref="UniParc:UPI000199C8C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH2"
FT                   /transl_table=1
FT                   /translation="MEFGRRARAGRRGDPEPSGPARSSGDGQLDYLDPDLLGGDSPGTP
FT                   EDRSPRAKSRGGTPRKAQVGSIADDFDEDTDDEGAAPPSRGLDAAGGWGDEGGGGGGRG
FT                   GQTGRRPDPRGSTRGGFFDEDENDDAPPRLEGRRQATGAMSPPPRQRPGGIAADFDDES
FT                   PARPALSGVSRRKAREMEEDDSYMMVDQFADLAVRGGARGSPDPSTRSGRRIDPNGEPN
FT                   RGPHDWDGGVETAVDDIASIPDAEFEQNQNQPGPQSEVADVPRGYVNRRSRFVMPDDLA
FT                   KEAPERFEPAREEYRREGRDDLDDEIDLSPLLAQLLSREEAFAEDPDEVWTADSLWAEI
FT                   RGVLQAEADEKARAEEELEKLEREREKI"
FT   CDS_pept        complement(174134..174760)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640295"
FT                   /orf_name="MICPUN_101764"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69370.1"
FT                   /db_xref="UniParc:UPI000199C8C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH3"
FT                   /transl_table=1
FT                   /translation="MSSTAVSTPPSQSWGPRLGSPLGSIRLPDRVDGSGEPRAPPRTAR
FT                   SANWSTIMYESSSSISLALRRDTPLSAGRAGDSSSKSAAMPPGRCRGGGDIAPVACRRP
FT                   SSRGGASSFSSSSKNPPRVDPRGSGRRPVCPPRPPPPPPSSPHPPAASSPRLGGAAPSS
FT                   SVSSSKSSAMEPTWAFRGVPPLDFARGERSSGVPGESPPRRSGSR"
FT   CDS_pept        join(complement(177086..177409),complement(175674..176966))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640296"
FT                   /orf_name="MICPUN_60515"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69371.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG562538"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR013260"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199C8C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH4"
FT                   /transl_table=1
FT                   /translation="MSPLPRCFFDMSVGGTPVGRITFELRVDVAPRTCENFRALCTGEM
FT                   GKGRSGKPLHYKGSVFHRVIPNFMCQAGDFTRGDGTGGESIYGEKFADENFRLRHTGPG
FT                   VLSMANAGPNTNGSQFFICTAKTDWLDGKHVVFGQVVEGMDVVQRIESHGSKSGKTSKE
FT                   VRVMDCGEISAELIDGVSDTAKEVMRRQREEERAAALKSMLPGQEDPDAASARRLREMM
FT                   EENKARFGRGYGSSSSYDKKGDEPPVRGSGMAALASAHFEKPARGPDTGGDTAGGGGGG
FT                   VNDAPPTAVGAATTFDPTGGHASEDASDAAPAPDKPLNPAQRRLFELRLKLNEARKANQ
FT                   REAIEEKKRREAPEDFEREQKKKAYEGKKARREEIMEIRGMDPKKRELTQTIEQAQELY
FT                   KRWDKKKSNSAKGGEVFSKHNLYNAYEKRTAHVTVDMDEYERDKRAMGAAFYADADEYV
FT                   HGVTGADVPQDKIDRMAAELEAQKQKRANFSRRRTHRDDADVTHINERNEHFNRKIERA
FT                   FGEHTREIKANLERGTALPDH"
FT   CDS_pept        177587..178000
FT                   /codon_start=1
FT                   /gene_family="HOG000100774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640297"
FT                   /orf_name="MICPUN_60516"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69085.1"
FT                   /db_xref="UniParc:UPI000199C8C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH5"
FT                   /transl_table=1
FT                   /translation="MTVVRRARPTGVTARVSAGRRVATTALPVGKSLSARTRPRAATVA
FT                   RAQDDDKPQTRGGDDEPDRDEDGLYIGTYSNFFTDPDQLKGVVIFCAFLASFLSLGNIG
FT                   AAILLPILYDQPISTCIQGILFGYYCPGQDGPI"
FT   CDS_pept        complement(178101..182057)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640298"
FT                   /orf_name="MICPUN_60517"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69372.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="UniParc:UPI000199C8C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH6"
FT                   /transl_table=1
FT                   /translation="MPGASRSGAASGSGQSGGESTWARDQAVELLNGAKLSTDAAAKST
FT                   HLKQLAELVIRKDPSLLGEFLEPLLELQVDPAVAVRKTLVSLCEEIATGNPQHLARCIA
FT                   TLRALLKDAAPAVVKQAAKASGPVFREALIEAATKGEGPRVPKEVTDMWTAAKALKDDV
FT                   RRLVLADRVNDGVRMQAVKFLELAVVLFHGREWGAGIVRDGHATVSLDALATEADDLMG
FT                   VLLECLKPETCAAQAGTVTLVMIGAATSVMGKLPIYTDFALPALLELAAANVAGDAGDA
FT                   KSAATASMAKELRSTLLNALKSSGERNEIAEYKSELVTALQELGATEEVETWRRQEERA
FT                   AQKRKEREERAEQERVKRQRVGAGGTGRGFELAPDEIEIETATPPDLMRQVLSTIGTLA
FT                   ENDRAMLRAFVTQLAPDVLADVVLSQLANTDSVNRRTMIDVEAGAGRGVETFVLDAMAA
FT                   HERGDHGATRAPRALTDKERLMMGAGDSDGDLAHLVADDEGDAEMENAQLAAEEADRGR
FT                   SGSKKGSKGKKGSKAADLGETKCAALTAEQVRHHGKGALTRIVQAADPGGPVARMGGLR
FT                   LQNVLLTRLACAAVAAAASAEGPDAAGAVGGAALHHGGGGGALAETASSAALIAGAQTP
FT                   SAGILEYLVSALPDRGAAFAATRLLGAIFVNQTLGLMGTTSDGGEKEAESSSAKDKASK
FT                   TSIHRVGPYARTLMTLAVGLIDSQTPARREHFTRLLLDAPAIPPPAIALLRATCALPPQ
FT                   GPARKEIKREGDDAMDVDADVDTDVDAWGFGASADGETFSWAGTPLPKSPESLSVALET
FT                   VRCLIERRPVVRAQCLEIALECAVSPNEDVRTRAVRLVSQRLHGVKTLATGIEAFALHH
FT                   LDEASAEGKRALEEATRLAEKASESLARAKEKKVKAEKERAIKAAKLKAEAEGRAYKPG
FT                   DEDGPASSSVTEEDARKKEEAAAAEEAAARERMTSVAVGDAVRATARHVALFCALCNRN
FT                   NSLLPRLFDFYAKLPEILRPAVVEGVAFDSLVRHVGPACDALVAAIAQPPRGAETLVRR
FT                   AVEVLADTSEYSEAEAQALAAAALEAGEEAKPPPPKQAPAALIAAVEKLAAANGDDVTY
FT                   LVPLLGSFDAKRVKALMPRLVGSAPEIFSAALDRLTASIPPKPLTAPEIIVALHDVDPA
FT                   RDGVPLKRIIDACGACFERPDVFPAEALAAALQKMVEFTPLPLLFMRTVIQAETAAPTL
FT                   REFTLGLLRTLARRQVWRMDPKIWEGFARCAKRSAPRSFPLLCELPPSALGEMLGKFPA
FT                   MRQPLLAYASAPAVQSGISRAIMAVLQEDKQQQG"
FT   CDS_pept        182278..188229
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640299"
FT                   /orf_name="MICPUN_60518"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /function="helicase activity"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69086.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="HOGENOM:HBG609795"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199C8C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH7"
FT                   /transl_table=1
FT                   /translation="MGADSAAARPDEGGATAARIAADKKVASQLASAGAPKGPARSDVT
FT                   DPAEEIAGTRAPEADAVVSKPTADAPASPDDPMDVDGDAPSAKKAPKPGKLKGSKGRSK
FT                   MQAKRGGDSGDDEDADDSGADMDAEDNAPDPDDVEDAADPADGDQPKPKQTRKVIGDGF
FT                   VHYAADVYVQSSARPGTGHIDLTFQLYDAEGEYYPFKNCDATGHYHPVKDAPLLRSKIA
FT                   VQRYLERDGMTPEDAERFAAEFQAREFVESIPIEVVPREAPPRRKAAANAAKYKDVSSD
FT                   DDMSDLMEAGETAPLKPGDDGYESEEDEDKIEKILLALEPGDIDAAELEELGSDDAKAF
FT                   AKLVLEGKWAPPTPKKKKPVKPKPKKQKRGKKAEPEEEEEEAPLPPLLYCVKWEGCSHR
FT                   RRSWETEGGVVDAKGKYKLNNFQRQYRVDPDSCQEGFHPDYLLIDRIIDEREADDDDED
FT                   ADDSPHSKRSDESASAEKAEYLVKWRGLNYSDATWEAADWLKSDVDAKEISRFRLRNSV
FT                   KDKRKVHAAAAERAKSGGKPPAKPKPPAFKNGMTLRDYQVTSFEWMIGNYRRRTNVILG
FT                   DEMGLGKTAQCISVMEHVRTEQLRAPRPFLVIAPLTTLGHWKREIEKWTDMNVVLMDGN
FT                   AKDREIIESTEFWFPGKAPGKGPAKFDVLLVSFETARRLTELIASFEWAACVCDEAHKL
FT                   KDVNSLTTKAVMEIGYDWLLLLTGTPIQNNVKELFGIMHVLDPEKYPSWEHFQESMLDG
FT                   GGREVDAEQVMRLREVLKPRMLRRMKEDVEKIPAKEEIVVWVELTPEQRAYYRMIYEKQ
FT                   VHVLMDGNKSKNVPQLRNLCMELRKVCNHPFLCDGMEEDFANKKKRAVELAAEKAAKEA
FT                   VEKGLEPPAAPAPPQPLDMITQSSGKMMLLNKLLPKLKAEGHKVLIFSQFAIVLNILSD
FT                   YLDLMGYEHERLDGSTSQADRQAGIDRFNTPGKGFVYLLSTRAGGMGITLTAADTAIIY
FT                   DSDWNPQNDLQAMARCHRIGQTKEVKVYRLVTKATYEQSLFETSSKKYGLDEAVLGGGE
FT                   GGFGAGKAKEDAKKINELLKYGVHGALRDASGEEARAFAEEDIDSILHNRAEHRAIGSR
FT                   AGNTFSTATFNVGDAKNIDVESEKFWEEMLPEAVKRREEEAANDAAWGVDARFRVQGPR
FT                   KRAKIGMYKEGARGIGFGAFRRGEKSGDSENDYSSSESEDDRETRAAKRRTKRAKVESE
FT                   RRDGWVDREIKAIEEALFTFGPGRNNDCVRAVKEARQSGSLEDNRTFSECKSVALALLD
FT                   MVDGVGKICKESQEAKSEAEDGRKGGKVERCAVCASSKKGRCGTETAPKSCLNLSDELR
FT                   ARMNAADEDADTAVPVGMTRATWDAVIACCEGVLNSHEDSLPPAAFSSLGRPCVYKRMS
FT                   SGWARGTKAIKERNALAGTIEAPEYAPAPGSFDETDGPEPPPEKDEFEFSEMMKPTSGG
FT                   WSRWWGKECDAALLRGSLRYGFSPWSQADLEAQFECILKDKTLWFAMNDVVAPDEDEDK
FT                   KADAEHSKRVKAANAVHEEAKKALNDENDKETHEAKLKERREMLEEANKIADEGPKRMP
FT                   GRDTLKRRILGLLKNLIDPPAKKELKIKLVKEPKPKKPTKAELAEIRKAERLARDQENA
FT                   QKFKDSLTGGGNLKVAFKIPKKETAAADAVNDEAAAAAAAAVNDEATQSHPKPKQDQGN
FT                   GEAPAEISRHTSPAAGATTNDEGAAPAENVDEPKIVDAFGALMTSKKGKMPKKEREPKK
FT                   EREPKKEREPKKERERKKEKMPKEKRAVADGENGDDAVKPKKRRKKKDAVVVAAAGEVD
FT                   DAGAEKIPAAAAAAPDPDPKPEAEVELGIGVVAPPRDPSPAVERAAVPAPAVVKPLDFG
FT                   ISEDDDPLTSCVLTSLNANANGNVNGGVRTPAGAAKPQGSSFLTPGSSTGMVRFGKAGG
FT                   FKKSGVGGVKSGLGPGQTSLFGFFKTPAPAADQERPRAVNTPTTGDFIAM"
FT   CDS_pept        188370..188897
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640300"
FT                   /orf_name="MICPUN_60519"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO69087.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000199C8CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH8"
FT                   /transl_table=1
FT                   /translation="MAPQDEPLPFTRDACLRALGLDPSTRHDASSIDRAYRRKLFTNHP
FT                   DTSGVAGSPESLNRVIHARNMLSSGSFGSRGGGGRYAPSSDGYTPMSDAYSREEFYRWR
FT                   ERRWGGDKDPIGLWRFRTLGFRSFAGNVRLGLGAAFMATACTLAWARHTEKRRKKERSP
FT                   RLRAAMGLRAED"
FT   CDS_pept        complement(188964..190451)
FT                   /codon_start=1
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640301"
FT                   /orf_name="MICPUN_84056"
FT                   /product="tRNA synthetase"
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69373.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG435805"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C943"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFH9"
FT                   /transl_table=1
FT                   /translation="MSTRDDQPSESANAGGEQVVTPWDVAGGADGKIDYAKLVNEFGCS
FT                   TIDDALIARIEKVTGCRAHPFLRRGMFFAHRELDQIVTAYEKGEKFYLYTGRGPSSEAL
FT                   HLGHLIPFHFTRWLQEAFKVPLVIQLTDDEKFLWKSLKLEDARRLARENAKDIIACGFD
FT                   PRRTFIFSDVNYMCTPFYLNVLKIAKCVTFNQARGIFGFSGESNIGQVGFPPTQAAPAF
FT                   PDCFPHLFGTDKKSLRCLIPCAIDQDPYFRMTRDAAPRIGGYKPALIESRFFPALKGES
FT                   GKMSASDPTSAIYVTDTPKQIKDKVNKYAFSGGRLTVEEHREKGGDLEVDISWKWLNFF
FT                   MDDDDKLRTIGEAYGSGAMLSGEIKKELVECLTPMIVAHQEARAKVSDAVVDQFFSTAP
FT                   RDFDSMFGELVGDAPAPSEGPVSFQGGENLVASNAPVPAVAGGEGNEGDDAGAAAAGGD
FT                   QPLSKSELKRIAKEKQIAEKKAAKAAEKAAKAAAAAQ"
FT   CDS_pept        join(190736..191702,191787..>191866)
FT                   /codon_start=1
FT                   /gene_family="HOG000200871" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640302"
FT                   /orf_name="MICPUN_113904"
FT                   /product="Non-selective cation channel-2 family "
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69088.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609741"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="UniParc:UPI000199C944"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI0"
FT                   /transl_table=1
FT                   /translation="MKSTGGTPGKDKKAAGKDKKRGDKQDPLHDPVRAVAYHLRGSKGP
FT                   ESRNARLDDYQRIDYFRGKDLFRLLRKHPGLLDEYAPAITGKPTPANPGIKERDVQIAE
FT                   IGERLMRDGYFFRIDRVYEDPRPGRTRRVKFPKFMQTLPRQMQKFTDDGEGFYGWRYDR
FT                   PMSWTSILLSCLAAFAIVLMCLFPLAPIWMKKMVLYACLSILGLFFVVFVVRTVVFAVV
FT                   WLLTGRHFWILPNITSDEIPIDEVFSPMWEFDDLDASGNVVGRIGAVKRLGLAGALTAV
FT                   LVGLYKIAPENTKAINIHKAHDSILDLFDLNDVPKGIAGSVAAAGGESQVNAEGTANVT
FT                   ANATEPPIE"
FT   CDS_pept        join(complement(193574..193624),complement(192235..193353))
FT                   /codon_start=1
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640303"
FT                   /orf_name="MICPUN_108728"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69374.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C945"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI1"
FT                   /transl_table=1
FT                   /translation="MAPRGIHHAASPLVCAAAPATTAEAGTEATPKTERRKRVLSGVQP
FT                   TGSIHLGNYFGAIKNWVKMQEEFDAFYCVVDLHAITAGAHDPKELIKSTRSSAAIYLAA
FT                   GLDPERSNVFVQSHVSAHSELCWLLNCATPIGWLEKMIQFKEKARKAGEDVSVGLLDYP
FT                   VLMASDILLYNADIVPVGEDQRQHLELTRDIAGRVNNLYGGGKWKKMGPKGSRAPSGRF
FT                   RGGDILRVPDAYIPEAGARVMSLTDGSAKMSKSNPAEGSRINVLDTPDEIAKKIKRCKT
FT                   DAVEGLEFGDPTRPEATNLLTIYQLCTGMTKEEVLKECGSMRWGDFKPALTDAVVEHLS
FT                   PIQARYAEIMQEEGYLDGVLKRGADAANEVAEKTVADVRDAMGFMERIR"
FT   CDS_pept        join(194479..195249,195365..195385)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640304"
FT                   /orf_name="MICPUN_101770"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO69089.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG529058"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI000199C946"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI2"
FT                   /transl_table=1
FT                   /translation="MEDWDDDDEDPLHSVGGVHSDDEDDAAAFVDRDEDGRPLYNQLPG
FT                   GIGARALALGYNPRTAEDPVLEPGLYLVGTPIGNLEDITLRALRILRSADAVLCEDTRH
FT                   TKRLLARYSIEPLKLVSYHAHNERRRREPLLDKMRRGASLALVSDAGTPGVADPGADIA
FT                   AACAEEGIAVFPIPGPSAAAAAVAMAGIPVDEGFTFCGFLPPKSGARRKKLETLRPIKG
FT                   SLVAFVPPHKLVNTLKDCAEALGDRNCCVCREMTKHVSSHV"
FT   CDS_pept        join(complement(198607..198885),complement(195936..198461))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640305"
FT                   /orf_name="MICPUN_101771"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69375.1"
FT                   /db_xref="UniParc:UPI000199C947"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI3"
FT                   /transl_table=1
FT                   /translation="MLKGFFGGKRPPETPPSQGATRGADARARASSVSAEAAGGVVLGP
FT                   SEARSTSERNPERRDPDDIPDGDMPALFERCQDLLAKTAKRADIGAKTPEDESRQFLRL
FT                   NMIKRLVARLRAGLHEPDVLDAGERAAWAAQIEFLEEDVDRAVERVTGMAHERDPPTPK
FT                   RDAAADGRGHRHGSSERQLGGMFAGLHVGGTPAGSSQFSGGADSGDLFSGLDLTPPPPP
FT                   PAASSGLDLTPPPPPPPPPAAAVPPLTVGGVAGLGMLDEAMFGDGGAAAEPESAAPPAS
FT                   SPAPSSTTGGKNRRRGKVRVGYARDDDASGALDERRIGSPESAVISDGGGLGAVPILDP
FT                   SEPSPTEPVPAADPPSEPSPTEPVPAADPPSEPSPTEPVPAADPPSESSPGFEPETSHA
FT                   PTNSTAAAAAALLAAVRTAQTCELEAAACERRQMSLCEAEDYDGAEALNQVVDDLRARA
FT                   LQAEAEAFRAEALVAEALRDAVDAIEKRALKADAAADAADAEAKARRAKASGLEEEEEE
FT                   DGAAAAAARARSESAREVRDAAADDAARARTKAEAARDARDAEVRESEEFAALTRAKSS
FT                   AESAREEREALEREIESMRRALVEKESALERVVEREKVLREEEESAAAALTRTSESADE
FT                   KVAAAEADANASSAALVAAEAALAEAADAAKRADEDAVAAKNAAARLADEAEALLKTAQ
FT                   ASASAARADAGRTRDALNAVDAASRRLEAATAKERELETAETNASRRAVTAALERHVGK
FT                   DVVAGAMTRSTPGARGPESLRKTAAVRRAECDRLVTEAEGEEEAKRAAAAMRDFKEAAA
FT                   RSKAAKDLRESAEAAKREADELEADAARMEAEAEAEDDTEPRDGDGEAEESTPADPTEA
FT                   YKKLKASREEALVETWRARRRRVLAESAVEPEDSPASVALRAVAEVLEARIKRRERELE
FT                   EDAS"
FT   CDS_pept        199072..199770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640306"
FT                   /orf_name="MICPUN_60525"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69090.1"
FT                   /db_xref="UniParc:UPI000199C948"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI4"
FT                   /transl_table=1
FT                   /translation="MWNQGKSAFNMNVDTDDARRRAERVMETAARSGAALPLHSTWVRK
FT                   IDDSDPKSRWIVEGSKPDATANDPLAAHLDLEAAVGRPPSAMGLADGDSDSSSNYDDSS
FT                   DSESRGKKSSRKRKERDGSSDSDRKGSKKRKKEGKRKKRKKEKKSRRDGKRSKKSKKSR
FT                   RSSSSSSSDGEASGDSDGGDRKRISAVSGKKIKLKLEGTSARTDAEDKRRQAYLRSLNA
FT                   HVDMSHLTGR"
FT   CDS_pept        complement(199868..205255)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640307"
FT                   /orf_name="MICPUN_60526"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69376.1"
FT                   /db_xref="UniParc:UPI000199C949"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI5"
FT                   /transl_table=1
FT                   /translation="MSGVPRAEGGAELRGKRDAEGDGGETAPATARGESKGDSGGGGGS
FT                   LGERRGGKIAGGILLRDGGGSGSSDHGTRAAQALLEAHGGVWLGLLRLSDEPWRPITAR
FT                   GLREEDLRRVGSGEGNSSRETSLSDDVSGSGNDENPEVTMDSQGEPAGPATMSGDGGSV
FT                   VGEDEDEAATDDRPENRGEHTQIASKNRTRSTGGSGRGRSDSPHARTAGEGPIPREHGR
FT                   HTRKRRTSKSESRKGSFSGAGFLDARSGRAGAARGLGGVSGESVPLISCPMIARPPPGD
FT                   AGIPGTERGEGQARAAAAGSAMPDVMEACLVRPMSDGWPDAWNPVALLRLFPSSADPDA
FT                   GTAFDKLSEVLTPREDDEGGLPEEGDEAETGRQGGGGGGGGGGGFGGEKIGGFGPAGCG
FT                   DAAGGGDDSTRAQLARRSESKSPRLKSPEASADGGGVVGTDRSIGPTGMDVDDTGSVHS
FT                   GGSMAGNTGGPVSETGPAMRLAAARVELEGGYVAFVVSDELLPADVRRSVAAAGGGAPS
FT                   NTAGAAGDPSGTAGTAVAGGDASEGSDGGSGKSSGTAEALGAEKSGDVSESVGLERRQQ
FT                   HGGGVERAPTTAPARTLKDLLGDAAARSGAKRPRARPGIAAVRAAQSANLRKRPLWVIV
FT                   QSDEPHAPHEASQTPVPAPDVRPTRGILRHRHSKPPQYGLLSSRHMPGHQTPPPYGRSS
FT                   SDIIAGHVAGGALDQRVPPNWLAADGTVGLSSPGRKTGEEFDHEEFHFSDDPGSSPDIH
FT                   SGVSSGESSGDEGLSGDEGSDEGRDPLSTTAASERHLNAIESWGRSSADAPHVVGGLDA
FT                   AHGAHGQVVSGDGTSDGSDGLLVASPLPTIPVPPLPVVPDGHTVGSGVDGAGVDGIPIS
FT                   APISNPPPPDMMGDDDGSPATTGGLRDGAPDGGGGRDAVGVGAIERPAMNVPPVPIDGM
FT                   RFGLLGFDVAHSHIQRLLSTAESRGALFVAHPTPDSVDLIVMHPPFLPMLGSPALPFTV
FT                   GEFLRRRSVRFALGLRHLELCLEQNRRLDPRRETLEVFPAGVLLVVDESALLSSDGVIE
FT                   RLAKLLGQAAAAAAAAAAAAGEFHYGASGVREPPPWPWAIKVHQQIFNTLVLQKIKAQR
FT                   APALPTPEGNAAREQAVYRIESVLKALHNLRQQGDRSVRAARLLGITSEEACRNDIDDP
FT                   PQPVRDAVKIAAKHAALCRVVFLVSEDQKSLAAARQQRSILSGGVDAAAAFLEELIAEM
FT                   WSETVTASAKPWANGVGSSARGREGRGDGADSHNGGGRNSSFDGTAGDASDREGPDPYG
FT                   EVVGRKKGKTDGRGSFVDPAPPGSPDSRAARAEGDSDLRSGGTDSGGENDGSLASLGGG
FT                   SIADGACSGDEAGGPAIEPGGGQKEPRGGGDGGATNGSSGGGHGGHHHHHHHHHHHHSS
FT                   QHSGHHSGHHHRSPNHHHHHGHQHHARHEGHFTPGTDHAISPGRRSTARHSTQAVALGG
FT                   ENEKGTAAAVANARLFARRDHFYPDGGRGGSGRGTPRLSGDAGGSVGGGAPSGGSQGDG
FT                   GAGAGGGISSAPRRATPANSVDGGLSFSGVSGDASGDEGGGGSTAGELAAETSGPGVTS
FT                   SGEGEYPGGAGDEGTRARDADNRGRRSSFGGNLSGAERGGGSFSGIVSGVAGGGASSGG
FT                   YGGTVSSHRPGHREFRGGSGGVYRGGGHGSHSSSARRHKSVRFATTIDDGGQRTGSRGR
FT                   YSPPPSPPRSVGRGVGREAREDTPPGSAARGAREDTPPVPADPTDAVDVALEPPPTDPP
FT                   EEPPKPPDTDAMEVVATVLGKRNAPDADGDGDGDGDGDE"
FT   CDS_pept        join(205919..208982,209327..209445,209615..213418)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640308"
FT                   /orf_name="MICPUN_101773"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO69091.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199C9CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI6"
FT                   /transl_table=1
FT                   /translation="MSDDDRDETAIARLNAEVADRAGSLTLKNAVVAIGRVFDCEEDAR
FT                   RVVEACIDAPGDDKVVGGGDDDDAGRVSAAGGSDASTAGDDDDDDDHYAYSDEDDSDAD
FT                   GAKTGVDASVPGELNSDQLTRLYQNKRKCVEREERRVAQKTANEGANGGAGEETWDMKA
FT                   AARNQIFSSKGAFTRLSTELFALQERMDPELAVDAVDHDVYVWDVKFMGGFDPGSGLAE
FT                   DLETLEAVNGYGYVQLRLHFMADLYPFYPPRVELVRPKLAGIIPGAMTAHPRLHLRNWQ
FT                   PFRPIKSVVEHLRAFLQKFARVDLASELNEIERFPDGAYVDSVSRLELALARLAACGTS
FT                   CGGPLIPSRYNEMYEEEIRLETESGATRRGYEEEFGRDDADIVDFARVLQDGAGGAAGG
FT                   VGGKDGKGGKDGGGTPGSRDGKGAGPGPGSTGKIKLKSSSEAKADKRKEYWAKGTGYGH
FT                   DTPRRAGKDDGDAGSQTWDAAAARGAQAAEDQSVLTLLVEATRFIEALPLNPSGKPGKT
FT                   RKRVTNAGDDADAAPPTLTDAEASRADVLIRASSLPQFLARELKNCSFMNMTARSAYYS
FT                   SLMRTARALAESRCADCLLIDGAAGQGHASALVKTLEDAAVQAKIYLKSVDECEVAALA
FT                   TATASLPSPSKESLGTLGSNDESGPNTARHGLKSPVMAKPGGVRSPVASSLLNVAEKEE
FT                   RRRAKQREAIASEVALARLILDAGESVSAAAHALGFASGASGGGGGGEGGVSTRGKGKG
FT                   KGKGKKGGGGGGGEGDDDAAAEEEAYQSALRPFTYDSAELLAAGHAYAGEARVDLRSGP
FT                   HISRVAKEIAGLAGGALPLNRSSSAFVRVDDAKSVIWSIMITGPEDTPYDGGCFVFDAF
FT                   FPSGYPTHAPKIQFKTTGGGRWRANPNLYKDGKVCLSLLGTWQGGKGETWDPAVSTMLQ
FT                   VIVSIQSLILCPRPYFNEPGFERLIGTPEGRSKSDQYDAAVVENTLRWAMIESLKKPHP
FT                   AFKDVIMAHFRLRKGHLLGPVRARWTEGATGELARVAKQIREDAMADDDVRKFDPDRTV
FT                   LARGLPLATSTAKSVTSMFTTAGKVSRVAVGSEEQRDKGTFAVAAIEFATPPNKSLLDS
FT                   MEGMDVPGGHPAGLKFIDWDVKKHFKLFGKKQRGAVAEAGRAAAKVELAAGSSEPEDQQ
FT                   RGDATGWAAVDPEPEPDVPVSVRLAREEEERKKEEEERKKEEEERAAQLAAAQADAEDD
FT                   LISLGGDESDHFDEDGDKSRSDTPEPRDDDDDDDDVRHVEPEGHRRRDDDDDDDDDDKE
FT                   DRRPSNKRVASRSRSASRDRPPPQNARRFSNGGDWNNAPPSGPHGPHGRGMEPMRRGRS
FT                   PPPQREFRDRRDSRGAPPTHGGRHSGWDDRGGRGGPQPRGYPPRSPPRDFRDGRRGGPP
FT                   PGRGEWDRGMDRDRGMDRDRGMDRDRDRFELPDRARPLPRSPARAPPPLDLNATATLEE
FT                   ATTVFLSRSRIHQLCCVGVDGPGTGSGKDVDRALDALRAARGAIVRVGVGGGRYQVGEL
FT                   AGGALAPLADADAETGPTHPVLRLIDERDQVAERAHSLGVISNSAPTRVEWDAYVAACR
FT                   NGGMPPPRVGDVNAVRAALDRVFRVGEQVGFGAFANNPRGRSPPPRERGRSPPREPLDR
FT                   RNRHSPPREFGRAPAPRGRRDGGPRSRSPPPRDRGPGPGAIPEFNHRGAAARERDSGWD
FT                   RRGGGRGGDPTAMAPFDRPPRRDGSRDFDRPPRGDSRDRGPGPVEPAPFQPGGDRRRAR
FT                   SPSRDARGGSRDRSPSRSVRARLGGFADGPPATLDHDPAGAEWLVDTRGNNGLVVGPAG
FT                   SQVKKIEHATSAKVSAERDGTTVVIVGRVPDVERARDMIEDLLAKNGIDFRGKPGRGFP
FT                   LDRGGPRVVADRPRDGEPNNPGGDLRGLLKRKSLDADTPAPKAKKGPAAAQDPAWMAEE
FT                   LDKMRARAERFGLPAPTMDDVRAKHASDGDDKGDKGDKGDASADEDLVPVADKMMMSRV
FT                   IGKKRQTMAMLCKIADVKMFIAQKDMAVRVKCADSNRRAHAVALVRAVVSNEIGTKITF
FT                   QILSAAFDAIVAGEPIPPPDPANEIAAKSKDAAKGGVLARLQGGVDEDEDGNDDDDGND
FT                   DGDEGDAKDVAAGRFRRTVDTRGLVGVIIGKNGSTIKRLERVTRTKMEVDQDTKSVTVR
FT                   SKTEKAVERGCELVETVLASCEKSKSERTEGQRGPLLKDILAGAIARWNGEKGEAPPAE
FT                   VSPEGTEVKETVEAPPDAAAEDPAGASVESDEAEKPAEENAEENAEENAEENAEADAKQ
FT                   EDTQEAEDEEKKPATRGGRGRGRGAAKGGRGRGRGRGRGKK"
FT   CDS_pept        join(complement(214556..214594),complement(213506..214393))
FT                   /codon_start=1
FT                   /gene_family="HOG000234613" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640309"
FT                   /orf_name="MICPUN_60529"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69377.1"
FT                   /db_xref="HOGENOM:HBG602769"
FT                   /db_xref="InterPro:IPR007134"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="InterPro:IPR019461"
FT                   /db_xref="UniParc:UPI000199C9CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI7"
FT                   /transl_table=1
FT                   /translation="MDALKHKVHTAYKGVAESLMTTRTTSAFLEKGVVTPEEFVVAGDY
FT                   LVEQCPTWSWQGGDAKSAKSYLPEDKQFLVTRNVPCLKRARAMEEYAGKEEHLSGEDEG
FT                   WVAAGGDGNGGSKDDDAPDMDEIPDISALRVDSRAKEDQNDDDDDADIPDMDDFDMCGD
FT                   EEDDASALPSSRAVTTVTTADDAGHILKTRTYDLSITYDKYYQTPRVWLNGYDERRRAL
FT                   DPTKALEDISAEHAKKTVTIDPHPHTSVPSASIHPCKHAPVMKKLIESMGGDAAPSVEH
FT                   YLFVFLKFIASVVPTIEYDYTASASLR"
FT   CDS_pept        215471..219289
FT                   /codon_start=1
FT                   /gene_family="HOG000261358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640310"
FT                   /orf_name="MICPUN_97720"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosylformylglycinamidine synthase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="ACO69092.1"
FT                   /db_xref="GO:0004642"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG335309"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000199C9CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI8"
FT                   /transl_table=1
FT                   /translation="MATLQWLLRETFEPDLFTEATQLDGDVVEVGPRLAFQSAWSTNAV
FT                   SICQNTGLGKVTRLERSRRYSLVPAAGKSIDESAKLAFASLVHDRMTECVYDSPLATFT
FT                   TDAVPEEVYTVPVLAEGRAALEKVDKEMGLAFDEEDFDYYLTLFRDDIGRDPTNVELFD
FT                   MGQSNSEHSRHWFFGGNLIVDGVPQPKSLFKMVKETIEGERGHNSTIAFKDNSSAIRGF
FT                   VNTPLRPVNAGGPSPLAPRMVDLDLLLTAETHNFPSGVAPYPGAETGAGGRMRDTHATG
FT                   IGSLLTAGTAGYCVGNLQIPDNVQPHENTDFTYPTNLAPPLQILIDASNGASDYGNKFG
FT                   EPLIAGYCRSFGQRLPNGERREWIKPIMFSGGFGQIDHSNLEKQEGDVGMLVVKIGGPA
FT                   YRIGMGGGAASSKAGGEDEANADLDFNAVQRGDAEMSNKLNRVVKACVELDGGNPILSI
FT                   HDQGAGGNCNVCKELIYPKGGELNIRAVKLGDATLSVLEIWGAEYQENSAMLIAPESLP
FT                   VIEKICARERCPFSVLGSIDGSGRVKLVDPTAPEGSPIPEDLDLEKVLGDMPKKTYDLK
FT                   RMDLKPKALELPEGTAASDALDRVLRLPSVCSKRFLTTKVDRSVTGLVAQQQCVGPLQV
FT                   PVADVGVIAQTHYGITGGATCIGEQPIKGMVNPKAMARMGLGESLTNLVFANTTGLKDV
FT                   KYSGNWMYAAKLPGDGAHMFDACTALCEAMGELDVAIDGGKDSLSMAARAGGEVVKAPG
FT                   SVVMSGYVTVPDVTKTVTPDLKLLGTGELMLVEFGSKEGKRRLGGSALAQAYDQVGDDA
FT                   PDMDDRAYFKKAWEATQFCVYKRLISAGHDVSDGGVVTAILEMAFPHPDAGVDVTLPNG
FT                   ATNDPMAALFAEELSIVIEVAPENVDAVKKAYTDAGVTVVSIGKTTADGVASVKVDGSD
FT                   AKIEGSVADFRDAWEHTSFLLERMQSSEATVAAEQTGLRDRKAPTWKLTYVPEKTDKAI
FT                   MEKTDKVKVCILREEGTNGDREMGAAIHAAGMEPWDVTMSDLLTGKVQLKDFRGVVFCG
FT                   GFSYADVLDSAKGWAGSIRFNESLWTQFQEFYNRADTFSLGICNGCQLMALLGFVPAEG
FT                   GLGATVDVEQPRFIHNDSGRFESRWTTVGIEENTPAVMLQGMQGSRIGIWVAHGEGKVK
FT                   FPNESRVPDILKSGQACVRYVDHAGEPTTQYPLNPNGSPHGIAGLCDATGRHLAMMPHP
FT                   ERAYLGWQMPWAPAEAGIAPDGPGPWMRMFQNARIWAESCEGEQCAQ"
FT   CDS_pept        complement(219458..220522)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640311"
FT                   /orf_name="MICPUN_108731"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69378.1"
FT                   /db_xref="UniParc:UPI000199C9CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFI9"
FT                   /transl_table=1
FT                   /translation="MAAAAAAAAAGAVKDSGQTAGGHGGPSDADEISADALEDELRRNA
FT                   REDEEILRAFQASARADERRAAAEAATQLAGADRRRGRGGIRAEFLGGDEDDDDGHEIV
FT                   GEDVFERAAARAMANKDTGSPSRRAPASSESASHQSAFDGPGWIGAGAGVDSSSIGGFG
FT                   PMGPRSNSAHTSVLAVDGSSDEEQERERIAAGRPTRAPAFDDDDTTDPDSTDADSIYDV
FT                   FKTAPGPTPGQAGRREATLSRFASASNPGLDEEHAAAMERLMATGGGGIGGRDAARSLA
FT                   SAADDDDVDLPGGGTGGTGGTGGTGFTFSNALPGSGRVAGGENNTGTSVDRPATARGRS
FT                   RGGVSFSNALPQIR"
FT   CDS_pept        join(223575..223652,223808..225937)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640312"
FT                   /orf_name="MICPUN_60532"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69093.1"
FT                   /db_xref="UniParc:UPI000199C9D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ0"
FT                   /transl_table=1
FT                   /translation="MSSFRAKELEDLRMELRRELRMYGDDDEDDGVMDTPPRSRPGAAS
FT                   RFGTTDRPATSTGLLHRPTSSSFAVKTAGPGRSSLAHDAIEERPSRRPATSSNATAINR
FT                   GLGSRPMSASKERLMGQYSSLGKLAMATPGGKENRWDGVPGSARRRPTTPRDLYDYNGR
FT                   RIDPSARATTTTTTTREAFTPRSNLRELDESDSRGRAGGRAAERTRPSTASTARRRRPS
FT                   TARAASDKPEYDGDGRRITRDGRLRRDVEEPAASRGGGATTIRKTRWGGFEEVPLKRAV
FT                   DPRRPSSSADRGRGNMSARSSSSVLDRPAFDTGPGGLGIDHRDPARINKTEKAGGRVTA
FT                   SRRGGRYDDDDDREDKEDRMPSNTRGGGVDAAMDARARIPPTAGEDDDDGAPPFRSRLR
FT                   GPATARSRVRTPSSSRGLDASAAMDAPIAHPRPAPSAHNRYDNRYGGGGVRSSREFGGG
FT                   YRSAAPSAPTTPVGASTAHDRHVSAEDLVESVRRAIPTAVPTAAAAPPSVYFDRHQRPN
FT                   TSYGNPVHMETMRNFGPGGSRPSSAAPTPARPATSHGGYGSGTPGGGYGIGLDAAHTNY
FT                   LQQMHQYQQYQQYQQTQQTQPMQPMQQPMQQPMQPMQQHGYHQPQPAYPGFQYHQQARQ
FT                   QFHQPVTANDDFQATLARAQALAYAPSPSKLAASYGGQGFGFDAGSAQGGYQYHNPNYR
FT                   NLPHQAYQQASPGGFYLGGAYGVGGTATGAAAAFQRYGGAF"
FT   CDS_pept        complement(226029..227186)
FT                   /codon_start=1
FT                   /gene_family="HOG000201523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640313"
FT                   /orf_name="MICPUN_108732"
FT                   /product="Predicted protein"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="ACO69379.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG629833"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI000199C9D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ1"
FT                   /transl_table=1
FT                   /translation="MHASVACRLAPRVAVALFSAPRSSPTSPPPGFAPRATTTTTTTMS
FT                   ASSQHPSRPRRYIDVGANLTDGMFRGEYHGKTYHEPDLDVVLRRAWDVGVEKVMVTAGT
FT                   LPEAREAIDLADRFDRGDSPEGAHHGDGDPERRSSPRRLFTTVGVHPTRCGEFEASGDG
FT                   DAYLQSLVALAVEGAKAGRVVAVGECGLDYDRLQFCDADSQRRWFEAQFEITRATGLPM
FT                   FLHMRAAAEDFTAIVRRNLDGFKGGCVHSFTGTWEEADALLKMRDDVYIGLNGCSLRTE
FT                   ESLAVAKRLPNDRIVIETDAPWCGIKASHPGHGFVGTTWPAKDKKKRAAVDSGETVKDR
FT                   SEPCHVAQVLEVIAAVKGEDADELAEIYRRNALRLFFPEEYAALG"
FT   CDS_pept        227310..227888
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640314"
FT                   /orf_name="MICPUN_60534"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69094.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C9D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ2"
FT                   /transl_table=1
FT                   /translation="MPAVARWVAVPARPRRCVRAASGQGRGRGGGGYQQRAGGVLRDPY
FT                   DTLGVATDASQAEVKLAFRKLVRTYHPDVNPDENAAARFRRINAAYEIVGDVERRRRFD
FT                   LGQDWEVRPRTFVPREKKQITILVVYPSTPPNPTSPLTPSRRRRPWTRDGCPRRRQRRE
FT                   RGRRRTTRTRRDPQRRLRLGGRESEPTSR"
FT   CDS_pept        complement(228089..230746)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640315"
FT                   /orf_name="MICPUN_60535"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69380.1"
FT                   /db_xref="UniParc:UPI000199C9D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ3"
FT                   /transl_table=1
FT                   /translation="MDTPSRRGCRRARSLSLLAWPICPYTRVWAREDVTSFHEKLRLFD
FT                   AHGRGARGERPRGRHVGRPADAPIRAMMREPATVDERAPLLRGAGSGFNRRGASIRGCL
FT                   DDVSRVASNRWFRAAMVAKSAFFTLGTVILLHHGTSMSTGRTRREGNGYLEVPAEAHFA
FT                   PLWSGDHLRHHPAADDLNVAWFPVHRGRFVMDQAAERAKDAARGGNRAKDDRMPKWPKH
FT                   VIGGDDWADLGVVAMSGAFGGAREKQPEFWFHAVPGDVPVVSMDVRGHGESERGWNALS
FT                   VDDAFDAVRWNLMANDVLAVADDAKFRRVVLVGSSMTNAVALWAAVSPHVKDRVAGVLL
FT                   VRPATGWEIRGEGICKLRKIAWTHASFAMLLRRSRRFAEGVAADELDSDDLPPLPTPEL
FT                   TSSLVGKSERVREGDANAKGGSDSGGSKGGARSDSESGWVSRWVLKGSAWKRYRGNPGL
FT                   GKPSTKVEPRDEVYKSIKELDPGLDGYWSKMVEKYLGTSTDGANYLAAAKRYAESEPEE
FT                   WRRISPLVPLRYLGDKVSDYPSRRALQLWFASPAGNKTPVKVIAYNWSRTHRYVMAKAL
FT                   RFLTWGDWSRDYLADGHDGLARDIAEFVEKVRRREESIAGGDSPGGGDGGKESDEFWRE
FT                   DEEDEERIAGVTRDEDWVRSDYVDSLDYDDGNADDVREDDDDEASSALGRRRRRRTTRA
FT                   MHGLMKEIDALLGAEDAEDMEAEIDSVPGHVLEKEATRLVRADAERVTARGRSLDDWLV
FT                   ENFGPKKSLASLDLLDYCDGRCCRLKTQLPESGWVPEKARSGPGIQWVFHEELASEEAK
FT                   CYAREAEDAAREERRVRAGGRLTREERVDVEAEQFCVAVIKARAEETKSAAEESRATLA
FT                   ASVGDVEKSSAATS"
FT   CDS_pept        230855..231745
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640316"
FT                   /orf_name="MICPUN_60536"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69095.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199CA52"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ4"
FT                   /transl_table=1
FT                   /translation="MARGHAPADEASTNSPALSSETYRVRGWDERELGALRRHYAREGW
FT                   VVVRRLVTTDEVDALHAATDALQAEASAFTRSRRERGVYFEVQSASGRKGDPAVAPGVL
FT                   RKITSPSKRSKAFASLTTHANVRAVCAQLCGVSDGTAEEGSAAPSPGRRRSSSSSMRCV
FT                   VDQVNLKHPLGAGTGFPWHQDVSFLKPDARAACEAHGGCNAVVAMDPSHEENGGFVVLG
FT                   GTHRLGEKFTQTRDAYDGAADVSGDVFDLSRRFCPRLAPGDAIFFHPALAHGSGTNHSP
FT                   ERRRIATLWFVGAGD"
FT   CDS_pept        join(complement(233277..233406),complement(233068..233141),
FT                   complement(232037..232912))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640317"
FT                   /orf_name="MICPUN_105919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69381.1"
FT                   /db_xref="HOGENOM:HBG562222"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199CA53"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ5"
FT                   /transl_table=1
FT                   /translation="MASMTTVNLALGSRAAVRGAKVQQKRTVAAKKVAAAARAELSQVE
FT                   KAAAVAAVTVAAATPAQASELGEDLFAIFDSIDKAADKVEEAFGVVAQGVEKVGEVVEK
FT                   VTPVVKPLAERAVEAATPVVKAGADYAGRAAGPIVQDAASKVSAAGAGAVDAAGNAIKA
FT                   RGIDVEPVAGVVGKAASTVAGAASSVLPSVDDVTGFLSTASPTELAEVGAGAVALYLLS
FT                   PALLGAFGGVLRGYAGSVRPVEAYDAVTTGKCVIVDIRQDTGRGEIKVPRGKVLSIPRE
FT                   KLSGNFKNMGDVEANLTALKVASLKGVKRGTKVLILDNNGGSDATKVAKALAAQGFGKA
FT                   FVVQGGFNGWANAGLAIER"
FT   CDS_pept        233863..234702
FT                   /codon_start=1
FT                   /gene_family="HOG000262433" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640318"
FT                   /orf_name="MICPUN_84210"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69096.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CA54"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ6"
FT                   /transl_table=1
FT                   /translation="MKVAVTGAGGRTGSLCMKLLAQSPEFAPPRGLVRSEKSAAKVKKL
FT                   LGAESDAECVIGDVSDATSCRALCEGCDGLVILTSAVPKPKIASLVVAIVSKILPWMDA
FT                   KRPEFYFPDEGRPELVDWAYQKNQIDAAKAAGVKKVVLVSSMGGTQIDNFLNTMGDGNI
FT                   LLWKRKAEMYLKASGLDYAIVHPGGLLDKEGGKRELLAGLDDSLLSGDRRSVPRADVAR
FT                   VAVACLTLAEARNVSFDLASREEGEGSGATTDVGAMLANLPGEYDYSMPTGSPVPLP"
FT   CDS_pept        join(complement(240747..240845),complement(240308..240483),
FT                   complement(234807..240165))
FT                   /codon_start=1
FT                   /gene_family="HOG000100091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640319"
FT                   /gene_name="CAV2"
FT                   /orf_name="MICPUN_105920"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated calcium channel activity "
FT                   /cellular_component="voltage-gated calcium channel complex "
FT                   /protein_id="ACO69382.1"
FT                   /db_xref="GO:0005245"
FT                   /db_xref="GO:0005891"
FT                   /db_xref="HOGENOM:HBG557219"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005445"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199CA55"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ7"
FT                   /transl_table=1
FT                   /translation="MPAPKSRQGGPGSAGASLKHLNPTVADRKVKFEELPEKSLWVFRK
FT                   ENPVRRLCVSLMRNPWFDRVVMTLILLNCVFLAMDSREPGFEETTRGKAVDNSENIFLS
FT                   LFCGEMVIKIVAMGFFVHPNSYLRDSWNRLDFTVVILGIIAAMNLGNFSAIRTVRVLRP
FT                   LRTLQGFAGMRQLVVTLLNSLPLLGDVAVLMAFLFFLLGLMGVQLFSGALNRRCASLDN
FT                   PNAGCHLCGYDVGYAGYNASQIASGCASDCALPAAPRWTVHEETTCGGPRVAKYPSKGE
FT                   KPSGYSCPDGQWCIAYEAPNHDITSFDNILGAWLAIFQCISLEGWVDIMYWTQDAVSEW
FT                   SSWYFVVMIIMGSFFAINLALAVLYVSFTTERKTDKEQHSDAIAAEKEANSKLLKSMES
FT                   EGAYQAAQVADLQRRLSDASPGRKSAPPSPSVSPHESFVAATPPNGGGDKRLEDTIAEE
FT                   VEMGTFEDADGAETPATVTTVTTTTNDAHGGDVAVRRPSVFDSAFRPEKFGSAMVTPLP
FT                   MRTVDEDGDDDFADQPWLAEGFATPQEWVRHHGGEIEDVQIVDGVPVVVPPSLAQRFQR
FT                   TCRVLAMSATVGKVTMFLIILNTVLMASEFHGMSKGQIDAYEGINYFVTAYFALEMVMK
FT                   MIGLKWRAYIADRFNIFDGVVVIISIIELAVADGGGNLTVLRSFRLLRILKLARSWPQL
FT                   RKIIATILDTIPSMSSLAGMLFLFIFIFDLLGLQLFGYEFVFCDSYGVDGAAPTCPPGV
FT                   AETACPNRKDCYVACKASQVGTWIEYASGAAGYCAEYGGGETALARLGMSDQPRHHFDD
FT                   FFWAFITIFQVLTGENWNEVLYDGMRTKGDAACLYFILLVVIGNYIVLNLFLAILLDNF
FT                   ADMDSSGETAAETAAREERKAADLQRKKELALERRKTAREEWMKLQAQASLLSSGQSKS
FT                   LKAAATGGVVTLSVMDRARIQVKRLILHPKFDQFVILLILVSSVLLAVDSPNVDEDSKL
FT                   KKALNITDVVFVCLFGLEAAMKIFALGVKKYFANGWNLMDFVIVFIGAIGAILELSGSA
FT                   TMQAARSMRSFRALRPMRMAARAEGMRIVIEALFQAVPPIMNVALVCILFYLIFGILGL
FT                   NLFMGKMYRCVYDGTDDVINSPAMGIAARDVTKRWCASGTHLTGCVGGARVALYSSGAN
FT                   GWACTRVTSTVSELNVDLNRVETFSGSWTCAASADTLAVLTADPYDPTESFGTRATYVD
FT                   GTIGAVGYNATVVREAVTTAQATGAFSSTCEPRFEAHEWKKPENYNFDNIGASMLVLFE
FT                   TATLEMWLEVMYHSVDAVAEGLQPRLNYNEGAALFYVVFIIIGAFFVMNLFVGVTIDKF
FT                   NEMKETQEEEDEIEGRAKGASLFVTEEQRRWQLVERMMSKCKPTRVYEPPKHPARAKVF
FT                   GVVTNPLFDVFIMMCIVANVVVMCLTYAGEPEQWTMDLFVANSFFTFVFLCEVIAKITA
FT                   LGVVNYFEDPWNRFDFTVVGFSLVGFIITMATDASAGFIAMLRVFRVARVLRLVRRARG
FT                   LRTLLQTLLFSLPALLNVGSVLVLFFFIFAIMGMNLFGKVKKADHLTRHANFDYFPDSM
FT                   LVLFRSSTGEMWNGIMHDCMVYRKCYEIQVGPYAGTYVDKGDPLLDGLRLGEDGYEDRC
FT                   TPSYIGTIVYFVLFILICGFVMLNLVIAVILDNFQSYSGNVDLPVSEEDFTHFALEWGR
FT                   IDRTGSYYIAVDKLPKLLKRLSAPLGVKNLPKGMIKRSLILTLFTCNVSVEEGKVHFSS
FT                   VLKALAARLDGIEPPPEPPKRRRRRGSVGSTISEAEEEELFGPYGEDDKVKHIFAAIHV
FT                   QSAWRRKEAMRRVQLAKIRARKHKGTAQGAAAHKAAEDAERRLAKSTSMTSDRSSASHA
FT                   SSA"
FT   CDS_pept        complement(241272..242981)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640320"
FT                   /orf_name="MICPUN_101781"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO69383.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199CA56"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ8"
FT                   /transl_table=1
FT                   /translation="MAARSFLGIHPLHHSKLWYFLSFGAFACLSPFLPLFYRSWGIDER
FT                   QIGLINCLRPLVSFWVTPMWGALADWSGRHNAILFAKMLAQGYGYSGLLWLLPNHSFKI
FT                   LFAYVASLEALCCANNSLADSSTGQMCRRARRLGESPMGGIDYGSQRLWGAVSWGYIFA
FT                   PLSGAIQTFSPAGVKAAFPFVAFPALLTMSAFVSLGMDFTPEHGVPIEEDERDGGGEAE
FT                   EGTAVHTAVPVPGGADFRTPRKTTLEMARVYRSSPDERRPRADEEAANEPNGPRASPAR
FT                   IDPRTGYAGLGPGFNGARTPTREGSVKVLGVDLSVHEESDWEDGEFSDDSAAATGEVKT
FT                   ADAAVVGSIPRRGERAVASRVFAVVAQPEVALHFLLFLIMGASMAVTDTFLFLWLEELG
FT                   GSKFLMGLALMFTCLSEVVVFAKEAAIKRALSTEWCVALVLFCYGVRQVFYASLGRWPT
FT                   PWVVLPVQLLHGVTFGLYWSVGNAFVHDIAPRGLNAAVMTVFGGCVSGGGFLGAVLGGM
FT                   AYAKYGGAGLWFGVGCVNFALCGAVVGKIRRCGGGGDPTARGWRRLGTDEGA"
FT   CDS_pept        complement(243225..244580)
FT                   /codon_start=1
FT                   /gene_family="HOG000260888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640321"
FT                   /orf_name="MICPUN_108734"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69384.1"
FT                   /db_xref="HOGENOM:HBG525581"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniParc:UPI000199CA57"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFJ9"
FT                   /transl_table=1
FT                   /translation="MDERKLLRLLEAALHVSEYTDKVDVLTFRSKTQRITKQLKEICAI
FT                   MCGLVVATDYRAGQELIKDKDFEHNARFFQSIFEIGRRHKVMNPEKMRSEYGKMIYLLQ
FT                   DSQMSDVQELLNFKLVKPMRTAHALLAEKNGLAMLRDGLMHQATAEIMHEGKPRIQVQR
FT                   EIKAKEKAREHLSRRYSHADLSSEEILSVLYSISDNNAYLRFNRDPVDRMIDFLKRYFD
FT                   PKTPEPGFSLGITMGMGGARLSHNHERQYTYVMQSMMLWREVSNDMFKLWYLAEGDLLR
FT                   EGGYYQLTNTGQGLNRVQSAPQTNKAIHQVLARCQAKLGHWVGSAVVHLGDHNVPNALM
FT                   FIDKYTQVPRILNPVALVVQRVEELCEDDGLRQYVESTFGGVDECRKTILADFFRHAFD
FT                   GSGADNFFDAGSCIDGRLTSAWNWCSKIEKKSYYPVFSLAGFTGFDGGDFRS"
FT   CDS_pept        join(245371..245439,245642..245672,245881..246278)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640322"
FT                   /orf_name="MICPUN_107024"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69097.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199CA58"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK0"
FT                   /transl_table=1
FT                   /translation="MSNPVCFFDMSIGGQPAGRIEMTLRADVTPKTAENFRALCTGEKG
FT                   FGFKGSSFHRVIPNFMCQGGDFTNHNGTGGKSIYGAKFADENFQLKHTGPGILSMANAG
FT                   PNTNGSQFFLCTVQTAWLDGKHVVFGSVTKGMDVVQAIEAVGTSSGKTTKQVVIADCGQ
FT                   LS"
FT   CDS_pept        complement(246417..248939)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640323"
FT                   /orf_name="MICPUN_60543"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69385.1"
FT                   /db_xref="HOGENOM:HBG609708"
FT                   /db_xref="UniParc:UPI000199CA59"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK1"
FT                   /transl_table=1
FT                   /translation="MAIDSSRPKSVLADLHSVAQPRTDNRVAKTAAAVALGSASLLAAH
FT                   ATLPPAVPCVGVGVARAGTFSHQKDHTLGDVLYYRFQKIFALPLPGKILCLVAFTVPVV
FT                   FAGAVAYKVVDALNAKLEPAAGEDSSNEPESWTDALANSFYLLNNVPGADATTDEWDTP
FT                   GGARRGFVTQCIVFVGLFVFAIIIGIISDEITAQVEEVKTGNNKVVESDHTVIVNWNSQ
FT                   LVPLLKQMAVAKSERAGTFDRPVVLLADVDKETMDEAIGEALEESPPLQVVTRRGNPFD
FT                   AEDLARVNAFAAKRVIILHPHEDEVGLLGQGVHARDESDESAGRIKELQFQREQREEAL
FT                   KATVILNLLNDKAHANPDVVVQMPYRLPNEQDLVGHALKITKSQDARSMGQIPSSSSSS
FT                   SSSASSSSSAFETSAPKEGSPRTRYVQVHGTENTGKISAFAAFQPGIARVFEVLFEQDD
FT                   ATPEFYLSDAPQFVGVCFADAWRMLPRATLCGVSHADGSVTLAPDDAYVIRADDEVVLL
FT                   AESSSVDITPADDAVTPRKGSERYYMKALSEYTDADRGPKKILFAGYNDETLLAVKLAQ
FT                   DMAPNGSQITILAEQIPADEFEQLRSTPNCKLRVVKGVPSSHEHLKSVPVSTQDSVVIM
FT                   PARDLGSKAEEDATVLATILQTYANCELRRSSAPDPSAPQYRNPHIVATLNTDSARTIA
FT                   ELMGTVDTSHAGEIPDVIMSDDLIGGVLLQVSANPRLASLFDALLATEGHECYIRDADL
FT                   YGGADTRATSGTSGGQYEGSGKGLEGEGSYADAGPVRWGVVCERARERDELAMGVMRAD
FT                   GEMVISPAKDATFVFEEGDRIIVLADSL"
FT   CDS_pept        249458..250579
FT                   /codon_start=1
FT                   /gene_family="HOG000100775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640324"
FT                   /orf_name="MICPUN_53009"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69098.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199CA5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK2"
FT                   /transl_table=1
FT                   /translation="MGVEDGVKPPSDGAAAAKTSPVRTALIVALYLALNSSLNLLNRYT
FT                   LGHAGFRYPVSLTCAHLVFQICSLAPVVFSGKPAGETHAQTVGRLWKALAAIGAFMSLN
FT                   IALNNASLLHLSLSFNQVIRASIPVVCAACAVVVENKVPSPAEAAGLLLVAAGVMATIA
FT                   GSADKSKQRPDETIGVVFCVVATLSNALMMTFSGRIMGPERLNALYLTFYTSPVVLALL
FT                   APVSAGMEWERMVARLAMPAPNDVIVAGVEVDGTELLGSAGDASGGGGLIGDGGFVGGG
FT                   DLVKLVLLGCCNAVVYNWVHNKVIAVTSATTTTVLGNVKVAMLFLFSRVLFGETKDWSW
FT                   QMLGGAVVALVGFALYSGAKLRAMRKAKLAAVR"
FT   CDS_pept        join(complement(251485..252071),complement(251197..251339),
FT                   complement(250653..251137))
FT                   /codon_start=1
FT                   /gene_family="HOG000265038" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640325"
FT                   /orf_name="MICPUN_84170"
FT                   /product="DNA methyltransferase"
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="DNA methylation"
FT                   /protein_id="ACO69386.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006306"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG490141"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="UniParc:UPI000199CA5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK3"
FT                   /transl_table=1
FT                   /translation="MTGGGEGGASEPPPGPSKRARVDDDATPRHLRAVEFYCGVGGLHY
FT                   SLLRARPDAKVVAAFDINPNGNDVYEHNFGVRPSQKNIYGLPVASFDRLDAGLWLLSPP
FT                   CQPFTRQGHRKDKDDGRSQSFLRLLRDVVPQLRSPPTHVLVENVVGFETSDTRADAIAV
FT                   FRRLGYDTREFMLTPRMFGVPYSRPRYFLLAKNGYRAGRRASYQPSSRATPRRSLTRGT
FT                   GLGGEVGATVRRLNRTPPITPYGSRDVNEGSADVFREYAVAERDVKIGLGAVDVVCRTS
FT                   YKCNCFTKSYGKYVKGTGSMVTDKLVDKDSWDGTVASGGAHEGAEGGGVRLRYFTEGEI
FT                   ARMHSFPSDFSFPAGVTRQQRYALLGNSLSVACVAPLIDHLLNDPSVEGERPPPRREVV
FT                   GPEDA"
FT   CDS_pept        252488..253204
FT                   /codon_start=1
FT                   /gene_family="HOG000012648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640326"
FT                   /orf_name="MICPUN_60546"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO69099.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG745819"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="UniParc:UPI000199CA5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK4"
FT                   /transl_table=1
FT                   /translation="MAALANVATPLTAVRGSSFAGARVRSKAPAAAPTRRVVTTRAAAG
FT                   ETLISVDKPLGVNLKASNKGISGGVEIASARGNAAKAGLKAGDYVVYTSSFFGDELWPA
FT                   DQLGFVRSAIQACPNQVDFVVVRDAKQAATIDVKRLPKRPAPPRFGKKLSAAQKERATH
FT                   ICVDCGYVYTLPTPFKEQGKDYKCPQCNAPRSRFANYDPETGKASGGAASNAPLITTAA
FT                   TVLGLAGMGYYLAQLL"
FT   CDS_pept        complement(253345..254004)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640327"
FT                   /orf_name="MICPUN_84536"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69387.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI000199CA5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK5"
FT                   /transl_table=1
FT                   /translation="MMGAAKSAASPAKSVAKSSVAKPSVAPWARGLVDIAADPGGKEGV
FT                   KWFDSDLVVLTDKYPKARTHYLVLARDTSLAAGPSALRASHAELVERMATVGRAIAAEN
FT                   AAKVNGGEETIAPLLRAGFHAKPSMPTLHMHLVSSDLRGSGMKTRRHWNTFATDFFKEA
FT                   DDVVAALRARGRVDWDEEEEEAGVAMAKLRCHRCGDGPFAQMPKLFAHLDECERAL"
FT   CDS_pept        join(255395..255811,255883..256095)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640328"
FT                   /orf_name="MICPUN_60548"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69100.1"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199CAE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK6"
FT                   /transl_table=1
FT                   /translation="MGCGVSRLPDDRDDRATSQQRTPPRRSIAAGPVFEHYVATHHGGR
FT                   VHPVTYDYDSDDETQPWLPREERRVLRILAERRGEFASRAEVRAIQKAYLETLREYAAG
FT                   DYANATVGVSTRALARWHPGLRENPLARRVVATFDETTHGAMSLTRRTRMAEGLVRRFD
FT                   ANGDGGLEMNEFLNLLNAEDYLGRFTVEMYAFDGASPPRKPRKTYL"
FT   CDS_pept        complement(256164..257915)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640329"
FT                   /orf_name="MICPUN_60549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69388.1"
FT                   /db_xref="HOGENOM:HBG562227"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniParc:UPI000199CAEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK7"
FT                   /transl_table=1
FT                   /translation="MAMSTLTPPVVARCARSASRSRSDGPASSSRVSRVTAAAPARRWA
FT                   PSPGSPSRRFRTGPRAAPAPAPSASIAPADGFVPAIDIARDTAGATSSISPAATRLSDP
FT                   IADVAVDAWSVTGGTTLGAKFAGVETKLFQAGLLPYLAYLYFLGKDEARTPAASNFGAR
FT                   FLLLFVFATIPAGIVAKTRYGDILANVDVLHGSSESLLTVSNFLFAFGFASALADAAAN
FT                   GGDDSIGDESAGDDGDEESLLKRRMSAPAALALLVGAAGAGSFALSLGAQTVNLGPALH
FT                   EPSNALSVPTWAVHVSSVTEWALAMRLIYAFADVSGNKNWRNVSVAMTPFLASGFCACT
FT                   FHLFYNSPGVNALVPLQALLTLLGNCACGVAAWSVVKEGEAMKVDEAMKADETNRVMIP
FT                   PRVTSSFDWAPEPNAASVLKLAAWSAIGAAGVKYGELLCGTFFLEPTYGKALAIVAAPT
FT                   AIWCAVVFGGTDRSSPGSSFLSGLSMDKVKSFGKAGTIAYVIVELGFWAIAFPVAFGWY
FT                   RVAEGTWLDLADAGDKARLFGAGAVFVNGVRALVPLRLAAALALAPYVESAMGGGAVGA
FT                   GDEDGDE"
FT   CDS_pept        complement(258149..264343)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640330"
FT                   /orf_name="MICPUN_60550"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69389.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199CAEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK8"
FT                   /transl_table=1
FT                   /translation="MGRAGRAPKQAVAATDDVDQDDDNDTKCERCGLGDDEPNLVLCDD
FT                   CPRGWHVYCLRPKLPHVPRGSWSCPRCAPAKKGSGGGGGGDDARGSPAAPASGDRAKRR
FT                   RTGTRDETTRSTRRSGVAAAGSTKAPDDDEMSDREGAEDDEMRTMRCVTCDLGDDENKM
FT                   VLCDGCDAGHHLYCLRPKLSQVPRGRWFCPACEIREDARRRSAEATAATKALRVAVANE
FT                   YADGRVVRAILGSRLVPETRLATLRADATRGPAFEGRSAEVEFLALFEHSSKRAAEWIP
FT                   GCAIEVLTEGKLRYFWKRHDAGWDDPMVEPEYVPASVVPEKVIATDENTNRMLVKWAGE
FT                   GYDEATWEPLADASDEAVASAAAATRARLVTSPGGGKGKGKGKAARRVSSGGDKAECFE
FT                   RADEPPADAGDVGDVGRRLRGTPIEGGGNAGIATELREELDAFRARAARPRKPQRSASK
FT                   WSGEKGKEIHFDLDVVPALAAVAGAPVISANESSDGSTSAAADALVLHAYQRDGVRWLL
FT                   NKLRLGASAILGDEMGLGKTVQTAVFVAGARALGLLDDKPVLVVAPLSTVPNWMAELRK
FT                   WCPTLNRVGYVGNAAARETCRSFDFPNTTAGGLVDVVVTSYEVAIADSKELHRLRWGAV
FT                   VVDEGHRLKNFQSRLSRVLSTLDSPFRCLLTGTPLQNNLEELFALLHFLEPEKFKNPSS
FT                   LAESFTADAKALSTAGKGKGEGNNGRDSATGDGDDKSEAIDAQLKSLHGLLGKHMLRRL
FT                   KRDVLGGLPKMRKAEVACQLSPFQREVYADVLARNHKAFNQGAHARERTSLLNVLKELQ
FT                   KVCNHPFLFVSAEKDTFRAARKSGLAKKVAEEAEAERRRRGERLPGSPAAPDNPLEATL
FT                   LRSSSGKMQLLAKLLPKLRERGHRILLFCQMTRMLDLLEDWLRASGVGFVVADDASNGN
FT                   NSRNGSVRPVYGRIDGGTPLADRQRVIVDFNTPGSDTFLLLISTRAGGQGVNLATADTI
FT                   VLYDPDFNPFIDSQAQSRAHRMGQTREVAVYQLVTAKTVEEKIVSMAKSKLAIERLVVK
FT                   DVRAGEEGGGGKGEGGGGAESRKALEARRAAELAEVLMHGARGVMAGAETDEADNNRDD
FT                   TRRRVIAAAEPTDAEINRLLDRASLPEVDGGADGAAYLGEIGDATSTEPGAPLEGADEG
FT                   SLGSTEAAGGKGVALVDLLASRASRLAEGGEEELGRGKRQRHQVFSNLNQKNLEASGAN
FT                   ADGASGAHQDAPVRHCCNVCDGDDDEESMLRCGGCTARAHVLCLGMGEEHPGGAWWCGD
FT                   GECAEVGAPLDAKRPTPPLSTTPDRGDVELHPADIAGEDDDVKDEDYDHADEDADDDDD
FT                   DDDADFHIASLPVGSKRRKGGAVGKAADATADAFGSIARAAGEANAAAGVGVGVVRFVP
FT                   TETAIIGAAAKQMARVRSAAVQAQERLDRAKTLADPTKDDFNYLGLAEDTLTAILKEAA
FT                   RGDSHTEEELLPLDMFLPMRVFAWRHDEDVLARRRAVAGAEAFEKSLTAEHAEATRRAG
FT                   AGSLETNRLEGLYVANRARAKEAERSLAMMRILTPGQRAAKFSERVLSATGRKISTRTV
FT                   ENFMISTSTADATWVDAKGQPLLQRLCDAYSHSLGMDCSIECPTIPSSLPPSSPGSGHG
FT                   ASAEKQPVAGAGLTAAPNLAGLLGGGVGVGAGSGGLGGLDALGSLGGAGLGGLGGLGGL
FT                   GGLGGLGGLGGVDLSSLGGLGGLGGLGGLGGLGGLSALQQLQLQQIQQIQHIQQLQHIQ
FT                   QLQHRLAATHQGGVAAPPQQQQPEQLQQRQLLQSQHAHQQQLQQQQIQQLLLQRQKIAH
FT                   QSMGNASAQQTAPLPFGQQPPPPGIKVEGGRKVEGQKSDMHPDLEYDRAPSDVVAALVP
FT                   AADESDEKCSLLQPRRGRWVYAIRGPASELQRLCDTRPAAKPVGWLQSMRHACDRWGLV
FT                   TATRAGCVEVCVHNPVSPGKPLTFWLPREAVGLPPRFAELDADGNGGNGATHRARVLDD
FT                   RAMVETLCNTKPEESPVTYVKSIACVVGKEGDLLESRGDIVKLRFAPETSGRPNDIELW
FT                   LPKEAVVICTPWN"
FT   CDS_pept        join(complement(269296..269461),complement(264737..268983))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640331"
FT                   /orf_name="MICPUN_60551"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69390.1"
FT                   /db_xref="UniParc:UPI000199CAEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFK9"
FT                   /transl_table=1
FT                   /translation="MESLASRTNVASLRAGSATRPASHLNRGRAAPVAVRAQGANDDGN
FT                   GADKTSSAVAGAIASAMLLSAAAPSAEALASFQGNQVAQTAEYSELLGFDPASVMNAKT
FT                   GSKVAPPAYQAPASAPVARGVDPAVKNVIAQTAVNVVSVDAAKSSSGANTQTALANPTA
FT                   IASDDAGSKVAAIKAAKAAEAAEAAARKEEAARKAGLDKAEAAAKAKAEQAAKAAEKRA
FT                   AADAAKAEKAKADAAKAAEAAAKKAEADKAKAAADAEKAKAAEAAKAEKAKADAEKAKA
FT                   AEAAKAEKAKADAEKKAAAEAAKAEAAKAKAEANKDKAAADAAKAEAKAKADAEKAKAA
FT                   EEKAKAAEAAKAEKAKADAEKKAAAEAAKAEAAKAKAAADAAKAEAKAKADAEKAEAAA
FT                   KANAEKAAAAKAKEEAAAAAKAEKEAAAKAQAEAKAQAEAAKAEEKAAAEAAKAEAKAA
FT                   ADAEKAAAAKAKEEAAAAAKAEKEAAAQAQAEAKAQAEQAKKEAAAKAEAAKAEAKAAA
FT                   DAEKAAAAKAKEEAAAKAAAEKAEAQAKAAQEKAAAEAAKKEAAAKAEAEKAEAKAKAE
FT                   QEKAAAEAAKKEAAAKAAADKEAAAKAQAEAKAQAEQAKKEAAAKAEAEKAEAKAKAAQ
FT                   EKAAAEAAKKEAAAKAAADKEAAAKAQAEAKAQAEQAKKEAAAKAEAEKAEAKAKAEQE
FT                   KAAAAKAKAEAAAKADAEKAEAKAKAEQEKAAAEKAKAEAKAKADAEKEAAAKAKAEAK
FT                   AKADAEAAKAKAAKAEADAKAKAEAEKAKAEAKAAAEKAKADKVAAIKAAKEADAAAKA
FT                   DKTAKLAKQQAEREAANAEKMQRQAAKAKKEAGPKAGTSPYDVEYPSAVKNYTSPFDGA
FT                   SEESSAPALPSIPALPAAPKLEMPSMPAAPKLEMPSLPEITIPTPEPEKKEEPSKAPAA
FT                   AAGAAAAGAGAALSIPKFNMPKFDIPKIEVPKIEIPEVEIPKVEMPEMPAMTAPPVAIE
FT                   APKPQVDEAAEARAAAEKAAAERAAAAQAEREAAAKAREEAAAERAAAERKAAEERAAA
FT                   EKAAAERKAAEERAAAERAAAEKAAAEKAAAEKAAAEKAAAEKAAAEKAAAERAAAERA
FT                   AAEKAAAEKAAAEKAAAERAAAEKAAAEAAAAKAAAEKAAAERAAAAQKAAAEQSAAER
FT                   TAAERKAAAERAKQEMADKLQAQKQAESKPVKKKEASKRELSKAASSKAAKPAPKGTTL
FT                   VGAVVGDVTVAAIAAALATALLVPGVKDKALGGDVEGALEDAKTAVAGVDGLSGKAGYV
FT                   GGVIAADALAHLPVLGALIPGPAEFIGTAAAVLLASRYYVTKESTPADDLAAFGASLPG
FT                   EFPPATDSILSPVQGVGKRIAEIDLDILQDDIQQAPTRLQRWVGGLDDAAGTIAPPAAA
FT                   LGATVLAGQIANLPLLSLVLPRALELVGVAYLVAAVNKYGTDPDAEVKDDLAAAAKRGG
FT                   DAVKKLAGK"
FT   CDS_pept        join(269768..270400,270887..271697,271935..272281)
FT                   /codon_start=1
FT                   /gene_family="HOG000205412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640332"
FT                   /gene_name="PRP3"
FT                   /orf_name="MICPUN_60552"
FT                   /product="U4/U6 small nuclear ribonucleoprotein Prp3 "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO69101.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG562230"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="UniParc:UPI000199CAED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL0"
FT                   /transl_table=1
FT                   /translation="MAGGSAEKRKAEEADAAPEEGARRSKRRRWDSADDANADAGAAAE
FT                   ASKDAPATDEPAAEKPAPSVAEKLAKAKAAAAKAMELAEKLRAAKAPPGPAPAPGAKAP
FT                   SAAVQRALELAGKIKGATAAASTVAKGPGALRLNDKGQEVDEQGNLVTANVVAVSTFAV
FT                   NAKSAKLEAFANAEKAAADAIADDGAEAWQDPRMGKGGRRRDRRSTFQFVKEGKFQRQA
FT                   DMVRLQAKFGETEARKIAAREARERRAAAERERLEATADPNLIPLGARAGIKGGMAGAA
FT                   QSRAAAVLDEVPDVEWWDAHILANGSYDDVSDGRWDIKPEKITPYVEHPVPMQPPMEAP
FT                   PPPPQPLKLTKREQKKLRTQRRQQREQEKQEMIRQGLLEPPKPKVKISNLMRVLTDEAT
FT                   ADPTAIEKEVRKQMEERASAHEDRNLARQLTPAERREKKIRKLFDDPSGGVETQVHVYR
FT                   VESLSNPKNKFRVDINAQENRLSGVCLITESFCIVIVEGGIKSVRRYEKLMMRRIDWNA
FT                   HTDGAMEYDDDTPLGEEAVNKCTCVWKGTAPKPSFKKFRFETLRTEAAARKYLQEMNLA
FT                   HLFDAAAACVAVSADFDDDA"
FT   CDS_pept        join(complement(273735..274139),complement(273009..273677),
FT                   complement(272394..272897))
FT                   /codon_start=1
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640333"
FT                   /gene_name="NADP-ME_3"
FT                   /orf_name="MICPUN_97726"
FT                   /product="Malic oxidoreductase mitochondrial "
FT                   /function="NAD or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /protein_id="ACO69391.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CAEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL1"
FT                   /transl_table=1
FT                   /translation="MAFSEEERYKMHLLGLLPPGKFTQNTQVKRVMRVIRGLSDPTEQH
FT                   LHLLGLLERNERLFYRVLVEHQDELFPIIYTPTVGRVCKKFSEVFYGPRALYITSRDKG
FT                   RIYDILKNWPEKHLKLLVVTDGERVMGLGDLGVQGIGVAVAKSCLYTSMGGLDPADVLP
FT                   VCIDVGTNNESLLNDPLYIGQKTRRVEGEAYDELMDEFVDAVKLRFGDRVIVQFEDFSN
FT                   QNGKRLQERYATRAATFNDDISGVAATTLAGVIASLPKTGMKKVGDHTFLVAGAGETGT
FT                   GIGEMIAEYIAQDEKIPINEARKRVWMVDSKGLITRSRAEKEEDLALHKLPWAHGGKRE
FT                   CATVLEAVEAVRPTALIGAVLQKMGECAQAPLVFALSRPENIAECTAKEAYDATGGRCV
FT                   FAGGCQVEPFVHAGRGVEIRASTSAYVFPGFAYGLTLADAHRVRTPMWLEAAEAVASMV
FT                   TEEDLGKGAVYPRMAKIREVSAMVAARVAMKCHEMGVASIPGKPPSSAKMLADAKRLMY
FT                   NPAYRCYM"
FT   CDS_pept        join(275280..275354,275574..277106)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640334"
FT                   /gene_name="SNF1-like"
FT                   /orf_name="MICPUN_60554"
FT                   /product="Serine/threonine protein kinase "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69102.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001772"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199CAEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL2"
FT                   /transl_table=1
FT                   /translation="MAEAAPDPNAGGDGTVKGGSAAMAEIYLPNYRMGKTLGIGSFGKV
FT                   KVAEHILTGHKVAIKILNRKKIKAIDMEEKVRREIKILRLFMHPHIIRLYEVLETPHDI
FT                   YVVMEYVKSGELFDYIVEKGRLGENEARHFFQQIVSGVEYCHRNMVVHRDLKPENLLLD
FT                   SKSNVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYSGPEVDVWSCGVILYAL
FT                   LCGSLPFDDESIPNLFKKIKGGIYNLPSHLSPGARDLIARMLLVDPLKRITISEIRTHP
FT                   WYVVHLPRYLVVPPPDTLAQATNVDAETLEMVVNLGFEREHVVDALRHQLRNKATVAYF
FT                   LLLDNRRNLFGGYLGAEFEAGELQVGVDAALQGAGGKGAAVGPRRPSQVQAHLMQQRLV
FT                   AEQRWMLGSTTTMAPAEVMAEIFRVLRDMNVQWKKLGPYNLKCLCKIAAAAASSAGVDV
FT                   SIGGGDHEMDTGEGDGGGDGGGMTGVAPERKEMQVKFEIQVYKMKDDRYMIDFQRMDGG
FT                   VMSCMDMAAAVSRQLRLA"
FT   CDS_pept        complement(277207..279195)
FT                   /codon_start=1
FT                   /gene_family="HOG000200713" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640335"
FT                   /gene_name="TRME"
FT                   /orf_name="MICPUN_60555"
FT                   /product="Putative uncharacterized protein TRME "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69392.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI000199CB73"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL3"
FT                   /transl_table=1
FT                   /translation="MSTAARPVASAAAHRASPRGVALAAAARPRAARVFPACRETRRAS
FT                   GGVGSGVVAPTRAAAEPATLETADDDDDDDDEHDDEHDDEAFSSYGDGDTIVAIATPVV
FT                   PNAGGVAIIRLSGPRAVEAARAVFRPASRAARAAAREGAPPSSHTALYGVVVDPTSVPN
FT                   GSRRVNDEDVDADALDVVDEVLVLPMLRPRSYTAEDVVEIHCHGGSVCVQRVLSLLTRR
FT                   DLLDPSGDTAGGVRLARPGEFTLRAFLNGRLDLTQAEAVHSLVAARTERAADGALAALR
FT                   GGLASPVRDARARCVDLLAELEARLDFEDELTPLDSDAIAAEVAAVRADVAKVLATARR
FT                   GKLLDTGVTVAIVGKPNAGKSSLLNAWSRSERAIVTPIAGTTRDVVEARVECAGLPVTL
FT                   LDTAGIRRGAGVDEVEAIGVKRSVAAAAGADAVIVVVDATEGWTAADDDACAGILNRKR
FT                   GEGIVGEADEGESAVGVRAGGGDAAGGGGDEWANAKARLHKVRGTRGLDGSSNGADGDD
FT                   DATRRDGGATAILAVNKTDAIAADVALDAIVPVEVSGKFAAVVRVSAVTGAGLEELERE
FT                   LGRIVEGGSVDAEGGAWSANQRQAEALEQALGALERLEAIVVDGNLPVDFWTIDLREAA
FT                   MALGAVTGEDVSEDVLDVVFTKFCIGK"
FT   CDS_pept        <279529..280455
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640336"
FT                   /orf_name="MICPUN_60556"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69103.1"
FT                   /db_xref="UniParc:UPI000199CB74"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL4"
FT                   /transl_table=1
FT                   /translation="RTDARALLLLALLATSGFVGVARAAAADDDFEPPAARAKPAADPA
FT                   VAAKGTVATAKTDGGKRGAYEEVSFVLEHSLVVGPGDASAADFTPCGVFSARAHTAPDG
FT                   VSVRLSHLRLTRDPIDENFAEKFDALVAADLVYRVRVHSNVLHPVDGEYTMAYLPARCL
FT                   ADAGLAETFALHTDERGGVIGVDYSTAGGDCVIDPEQSAGLPPKLAGAASQGSIAFRST
FT                   AQVRFYKLAPALDPDAPTDLRGHGGPATKQRQEEHRRRKESGEPREKGKKPVKEKTFWE
FT                   KNWMYIVPISFLVSNALSAPPQKAKRG"
FT   CDS_pept        complement(280605..281153)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640337"
FT                   /orf_name="MICPUN_60557"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69393.1"
FT                   /db_xref="UniParc:UPI000199CB75"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL5"
FT                   /transl_table=1
FT                   /translation="MPTTTTTARVNLVSNARARGVRARLGIVTGARIPSARHPAGVPGR
FT                   RLGTLVVARSRDDGGSGGGSWGKFLTGFLVGGAVFGVAGVLFAPQISKTFLKGKGEVGK
FT                   FLYDDWTEDEEEDSLEKTRQNLNDKIAQLNAAIDNFSTEADRGLSDKITKLNSDMEVME
FT                   KDLSGKEERKEEPKPAESR"
FT   CDS_pept        281547..283592
FT                   /codon_start=1
FT                   /gene_family="HOG000020624" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640338"
FT                   /gene_name="LEPA"
FT                   /orf_name="MICPUN_60558"
FT                   /product="Protein-synthesizing GTPase "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /biological_process="positive regulation of translation "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO69104.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045727"
FT                   /db_xref="HOGENOM:HBG286375"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="UniParc:UPI000199CB76"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL6"
FT                   /transl_table=1
FT                   /translation="MSGIAPSAARGATLGAARARALARDGGGGDASARFFPTRRPRLSG
FT                   RRAVRVRAADTPVVPKRKGERVKIDPNAVLQVPAKNIRNFSIIAHIDHGKSTLADTLIS
FT                   RTGTVADRDMEAQLLDSMDIERERGITIKLNSARMNYTARNGETYVLNLIDTPGHVDFS
FT                   YEVSRSLAACEGALLVVDASQGVEAQTVANVYLALENDLEIIPVLNKIDLPGAEPERVC
FT                   REIEDVLGLDTSQAVQASAKANIGMEDILEQIVELVPPPPDTADQPLRALIFDSYFDSY
FT                   RGVVCVFRVVDGTISVGDQVKLMNTGAPATVDEVGIMRPNKVPVTTLSAGEVGYFIGNI
FT                   KSVADARVGDTITSAKKPAKEPLEGYAEATPMVYCGLFPTDSDRYDDLREALGKLQIND
FT                   AALCYEPEQSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYKVYMNDAE
FT                   QTCVDCANPASLPDAGKRDRIEEPYVNLELITPADYVGSLMELSTQRRGEFIDMTYLSE
FT                   GRTCLKYEIPLGEVVTDFFDELKSRSKGYASMEYSFLEYRKNDMVRLDVMINGEPAEPL
FT                   ACIVHKDKAYAMGRGLVDKLKELIPRQMFRIPIQAAIGAKIIASTSISAMRKDVLAKCY
FT                   GGDISRKKKLLKKQAAGKKRMKQFGKVEVPQEAFMAVLKVDQNAPN"
FT   CDS_pept        complement(283656..285362)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640339"
FT                   /orf_name="MICPUN_101796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69394.1"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI000199CB77"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL7"
FT                   /transl_table=1
FT                   /translation="MAAAAMPELGESLDPWTEDDPENFDLDGFAAEFYGDASERRMRHL
FT                   RDQLSSLRDLAESEQRQNVFAHYESFIRVSREISRLQGQVGKLREMVQVPSDVVETLVA
FT                   DARSHQDDAHEDEDEASATLRRAEERAVASARAVTDGGVDGTLGTLGGRRRADDLVGDD
FT                   GVATGDARRAAKLRDQLEESLSGREVFAALEAIEEGTRLLRSMRDDVAARGGGRRGKTS
FT                   RTFGGDEDAKRGAPEGRRPDRVASVSTVDRTPEEPRSGSPSLGETRANPLFAATRHRAA
FT                   TAPSAPSAPGDDSNDDSKGDTAGAEPAAIQNLARALAESRRTALDALMDTLVDPHETKA
FT                   RRDAAADSLRRAGASAAAARRVADAELATARSETKRLAETEKGAGFALEACEATFRALR
FT                   VAFVHVDDVEGAEGGAEGAEGGAEWGAEGGAEGAAFIAERVRDETSRLLHLVAERSLGR
FT                   WERAASLSEACAAVLACVRHVDAFVADASSSRRRGGTSIAEGLLDAVQAHPGINGAMKR
FT                   VLDAATEAFIADDGETDGVGSSGGWIDAGERWLETHAWEDLRTLCELGVAD"
FT   CDS_pept        join(complement(286825..287130),complement(286548..286595),
FT                   complement(285730..286320))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640340"
FT                   /orf_name="MICPUN_60560"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69395.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199CB78"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL8"
FT                   /transl_table=1
FT                   /translation="MSCQLPPRFCWSSVGILRSIEHNRSRQSPPAEHTRPVEDFTQFLR
FT                   TTALPLSRRTPPRTVAMAKEKKEKKEKKEKKEKKEKKEKRPAEDDAEDEPDAKKTKEEE
FT                   PEVEEANDDDEDDGFKVHKKSAADANPLSKTYEDITLNCRDCNAEFVFTAGEQEFYNSK
FT                   GWENQPTRCTECKNAKKARFGEGPSSGKPVCYAYQRGECTRGDACRFAHEEGGGGDSRP
FT                   PSRGAPICYAFQRGECDRGDSCRFSHDANASTPQKSSAPCYAFQKGECTRGDACRFSHD
FT                   PNAEAPQRSSAPCYAFQRGECDRGDACRFSHEQ"
FT   CDS_pept        287362..289932
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640341"
FT                   /orf_name="MICPUN_60561"
FT                   /product="Alkaline phosphatase"
FT                   /protein_id="ACO69105.1"
FT                   /db_xref="HOGENOM:HBG737815"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI000199CB79"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFL9"
FT                   /transl_table=1
FT                   /translation="MIAPLATIALLATAFASGARAEAVHGAFVHGVASGDPTHDSVVIW
FT                   TRVTPTGRDPGETDPDPNVSFDVRWRVATTPPTSAAVDPDARPVVEGSRVPMAPGSTVF
FT                   GWSDSSKVARAGIATARAERDWTVKVDVTGLSHGVRYWYAFDVVDTRGGSKTKPSDFPP
FT                   MTRERRSETGTFELPPPKGVAYPRDHGPVRAAVFSCANWGWGYFHAYDAAARGWGGVDE
FT                   LNSIAEDSRRLHVWFHLGDYYYEYGQTHYPNADESVPERWRSLDPSTETVTLDDYRRRH
FT                   RLYRSDPGLQRLHASAPVVAMWDDHEIANNPWMNGAEDHQAWEGDFKTRARAAIRAYHE
FT                   WLPTREPGGSNGEDDSSDSDSYYYNRTVHFGDVASFHVLETRLTARTDPNANPSGNVWA
FT                   NLTAEIAASDTKAPASWPGSALERRIRDVKTGLDAYRSEENEQMAGPAQLAWLVDEVTS
FT                   SAASGVAWQIVAQASPVMDMMSPDVEKAADALDGDGAPPPTGHESWRAALEAWTDWTGT
FT                   APPNAESFGDGGRAVPVSAARALLAAGRYRLNWNFDDWHGYVAERKRLLKALVPNANRA
FT                   VIIGGDSHDSWAGVIAADETHWGAEGSWAAGARDPSSLVNSVGAVEFDAPSVSPPGAFE
FT                   QSFAWCPSELIDRGHLEANPGTLRHAQTGRRGFVMITADADAFTADFVLTPTVRSRGYS
FT                   PTCGGSFVVTENSADGLNGGGLVLTERACPQFPSKLFTGPADPRFVDWSAGAAAGLGSA
FT                   AATDGRDDGRIKTMDETWIFGVFLGAFFVVGFAAGLTWRQGACGDVNARGGSGGGDRGT
FT                   AGRGRRGQRNYHSLDDSAARDAADGDDRQSEIEMGSVGGTRPSR"
FT   CDS_pept        join(complement(292434..>293152),
FT                   complement(291729..292379),complement(290953..291166),
FT                   complement(<290213..290941))
FT                   /codon_start=1
FT                   /gene_family="HOG000165474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640342"
FT                   /gene_name="Pms1"
FT                   /orf_name="MICPUN_65816"
FT                   /product="DNA mismatch repair protein-MLH2/PMS1/Pms2 family"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO69396.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR015434"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199CB7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM0"
FT                   /transl_table=1
FT                   /translation="GPDDPAPSTALQKEAPSIRPIGASSVHRICSGQVVLDLAGAVKEL
FT                   VENALDAGATNIEVRLRDHGQDSVEVVDNGCGVKSDDLAMMTKKYATSKIRRFEDLDAL
FT                   ASFGFRGEALSSLCALSDLSVTTRTADSDAGTRVEYDAEGNVRTRGVVARAVGTTVTVQ
FT                   NVFARLPVRRKELARNVKREYGKLLNILQAYALINPETRIVCSHQGKGKNAPRQTVLNT
FT                   QGGGSLRAAVATVFGHKTIDGMVSKAAPGCGRGAGDRQFFFVNGRPVDLPKAARVCNET
FT                   YRQYNQTTSGTPFPCVVLDFRLPTDAYDVNVTPDKRKVLLHGESKVLAGLRGALEKIWS
FT                   PTAYTYAVAAAGAADGSETTRVRVHDAIGAARDVIAGGPSAATPALPPASAVGVKRERE
FT                   EDDDATVVAPSVDVKREPAEDRVPRGTSAAASAWESFGMNAPRHNTANDATTTANDRVG
FT                   TGKVGRTRRTFPCTVRQSTRPRRSASSRGPRARLSRTRTTSHRAATHREARVKRRREGT
FT                   RGASVNDRATAEGGLGPALNEGGDEVATGELERVFRREDFRDMRVVGQFNLGFILCTLG
FT                   DDLFIVDQHASDEIYNFERLQRTTTLNRQPLLVPKKLELTAAETQTVHRNMPTFLANGF
FT                   GFCEVDQPPPTVRSLALNSVPFSKGITFGADDVHELIGMLDQGEYALPARSQLTVGLSR
FT                   QSTGTPGSGLSVSEIVRPSRVRAMLAMRACRSSIMIGKALDAKTMRRVLDNLSDLQAPW
FT                   NCPHGRPTMRHLADLRKL"
FT   CDS_pept        join(293543..293630,293801..293849,294201..294399)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640343"
FT                   /gene_name="PSBX"
FT                   /orf_name="MICPUN_108740"
FT                   /product="Photosystem II reaction center X "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem II"
FT                   /protein_id="ACO69106.1"
FT                   /db_xref="GO:0009523"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="UniParc:UPI000199CB7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM1"
FT                   /transl_table=1
FT                   /translation="MAAIAASNFAVAARPTVARKLSSKKAALSVKRVQAVKAVSVKAVA
FT                   SSKVEKLSAAVTVGTAAALANPLVAEAAVTPSLKNTLLSVVAGGLVLGAIAAAVIGVST
FT                   FDKVNRK"
FT   CDS_pept        294768..298364
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640344"
FT                   /orf_name="MICPUN_101799"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69107.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199CB7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM2"
FT                   /transl_table=1
FT                   /translation="MGADEVEGADRTSASAARAVRERVEAVRAGVDIAQALGSDDSVID
FT                   LKTFQKLKAAFDEADVDGGGDLCVDEFVRAFQMVIPEVDEAKLRHLFTRIDANADNTVD
FT                   WDEFSSFILLEGIAGEKAREAMDGTEYVLCEDGPKGVVGAPVDKHKDMCTAVMRFQKGD
FT                   SYATASRDGTIRVWAHDDSKGGIMTHRKTAKTGGAYIVDAAQLPASQRMLIACADRKVK
FT                   VYDPKGWVCVGTYGGLPDAPLCATAWEGGARIVNNQDCDYFAVGDDKGVVTVGRVIDMT
FT                   DGEAAAAGGGDRVRFETMWRMKVHDGWVNSVSHVGELNSVASGGGDGLACITDLERKGY
FT                   PLADPTRRYDGHNRKSVNAVSWTARYKKLVSCGEDKLINLWNPLSAKPQQIFVGHEEPI
FT                   LKCLVLDDVHQIVTLDVGKRMHVWDLRSARCVQVIHDKESYHPTNMLGALGYDSKRNRL
FT                   VTGAPAPKCYALVKRLAETHAGHKRRCVAALWNRRFHQVVSCDEAGGVRVWDVFTGKIS
FT                   FRFEGAEGTRRPDDDERLTDTYRPMVADRAVDEGDDEDMAPHRRNRLTCACFDHAQRRL
FT                   MTGSSDGNVRLWNFANGVMLKEMTTPTMDDVTGLVHAVNESGDGKRVVSSGWNGLVTVW
FT                   EDLGGISSKQEPRRQMRGHGADVLCVAEHHPGTIASGDFDGVVIVWNVDNGGKRHKLIP
FT                   PPPSEADANESSLPVSRAAECVHFIEGGGPPRTSMNALSEFKLTPVVLCVSHADGRVRM
FT                   WNAIPSSGALLCDFHAGHGDGESVLCVATDQRATRMVTADSTGRCRLWDIAGLVRGIHS
FT                   RAPGAGEDEPPFGRSDVELLGYWQAHSSGKCVNAARWLEVEGIGVFFTTAGDDCAVHLW
FT                   SKDGQHVGEFGPHRWTLEDTRTWASTELPPDGDFSRTTVTDEDGTPALNPNPNPTDDAD
FT                   DTGDADAPRDESKKEVDAEKEEAPAVVVEETSGAEEPRPAEDGEDGEDGEDGEDGEESP
FT                   APTAGGSRAAVFVMPTMPDPETFRALAVERAEAKYGRLEDLPEVVHPTPPKPRPPSPTP
FT                   SESALEVRYPKRPGYKAVQPNDDRPRWTADVPSSFESGATYRRIQSMDSAKANDLRGKS
FT                   KEELRAIEAKLSAPKGERHERVYIPAGDEHINNPEAKGRAFSSLYHLLKIRDVAETKPP
FT                   PETSKGLFKYGAPVDEVLARRTAKATRDETDE"
FT   CDS_pept        complement(298425..300032)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640345"
FT                   /orf_name="MICPUN_60565"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69397.1"
FT                   /db_xref="HOGENOM:HBG609809"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="UniParc:UPI000199CB7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM3"
FT                   /transl_table=1
FT                   /translation="MSGWLNAIKTDAPEAPVEPNAPSAPTASSSVTKVVVDTNAIVKGF
FT                   RLERFADEAVTIPEVLAEVRDRQARHTLTTLPFELKVQDPDADSIAAVRRFAKLTGDIG
FT                   ALSEPDVRCIALAYMLERDAHGTAHLRTSPTPVVLSKHKHNKASKMAGWDFVPNQDDWA
FT                   ELDEMNAEAEAAAEAVAKRMAAATVADDTSGTPSPKLPKSARIAAEVAAEVAAERGAGS
FT                   IRGESDAPAHAPGGDESPAGESPGAADDDGWERNVSRTTRVKHAKREQRRREAEEEARR
FT                   LAEEEARMEAENAERRRELDAAAEESAAFFKSAPGAVPEGAEEDDEEDDEGEGDGEGEE
FT                   GDGSDDDIVPFETTISSVTADYAMQNVILQMNMKLLTPDGMRITNLRRWVLRCHACQEV
FT                   TRNTERVFCPKCGNASLTKVEHTVTADGVEQFGVRRKHVLKGTRFTLPMPKGGRREKAP
FT                   ILREDQLIGMRARRNKDTDVDVFAAEYNEESFAGGRAVNAGAAHLYAQKELLENASGGN
FT                   LKKNPNERRFVRTNRRRK"
FT   CDS_pept        complement(300409..302064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640346"
FT                   /orf_name="MICPUN_101801"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69398.1"
FT                   /db_xref="UniParc:UPI000199CBE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM4"
FT                   /transl_table=1
FT                   /translation="MLVIPKQRRTSAASGARKESSPPEEGAPRTSSPDENADAGNAGTS
FT                   PAVKGPPPKRARSAAAPVKSFDGAKNFIAQLQASDADPKPKARANTSSRKAPGSGDASQ
FT                   NRGGPAGGSNRLDELEEDAMHALSDLLSQDPEDSFALGGSDAGTAPTALAARAPKRVRS
FT                   NVVAAKPGGAKARRTSAGGSARGKSKQQSGSDSGSQGTTTQAANAQQQLDGPSASRKAA
FT                   DHRRLLKSYMKALFRHLKLPVEYKSAASATYRDRINNALAYWFGDSFAPGKTTRECHAP
FT                   KVVCCLVRIATSGRVVIRPEDVSEILVKGLQAKNANYAVSAAALRKHKIADAELRTMFD
FT                   GETRTTDGWPRGLPLNLPDRDEALPDFDSKAAKVDAALSPVKEEPNPAEADEGGGEIDG
FT                   AIKPVAAVKGARSKRGGGAKRPDVTGTPAPPAAVKTHGATVVGDSPLFSPVGHVAAAFA
FT                   AAALMPEPSDRSEAAREFTTSMVDPLIASVRAQADPATRMEMINCAQGELARLATEMAR
FT                   EHHEASRAALAAAEADQPYSPPDAASPSRPSKRR"
FT   CDS_pept        join(complement(303943..304060),complement(302509..303782))
FT                   /codon_start=1
FT                   /gene_family="HOG000229292" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640347"
FT                   /orf_name="MICPUN_97729"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO69399.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="UniParc:UPI000199CBE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM5"
FT                   /transl_table=1
FT                   /translation="MGYVVGEDGLSIQDAASLDASTLTPLTPEVISRQATINIGTIGHV
FT                   AHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDACPRPDCYRAYGSTM
FT                   TDSPACTVPGFEDKKMQLVRHVSFVDCPGHDILMATMLNGAAVMDGALLLIAGNESCPQ
FT                   PQTSEHLAAVEIMRLQHIIILQNKIDLVQENAAANQYDTICKFIQGTIADGAPVIPISA
FT                   QLKYNIDVVCEYICKKIPVPVRDFTAPANMIVIRSFDVNKPGAEVDDIQGGVAGGSILQ
FT                   GVLKVGQEIEVRPGIVSKDAEGKIKCTPISSRIVSLFAEQNQLQYAVPGGLIGVGTTVD
FT                   PTLTRADRLVGQVLGEVGKLPRVFTELEVNFFLLRRLLGVRTQGSEKQGKVAKLSKAEV
FT                   LMLNIGSMCTGARVVAVKSDLAKLQLTSPVCTKEGEKVALSRRVEKHWRLIGWGQIQAG
FT                   VQLMD"
FT   CDS_pept        304845..306260
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640348"
FT                   /orf_name="MICPUN_60568"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69108.1"
FT                   /db_xref="UniParc:UPI000199CBE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM6"
FT                   /transl_table=1
FT                   /translation="MERPRPPAHPGARSHDHGLHARTTTTTTTTTTSSALDEWHTPAPA
FT                   QKTVAETTPGYVVYRAIPLHDGRAPKPKPAARRRQQLDEKRDGSAMARVASFTFDTAAA
FT                   DERASMIPSTSDGAGGGGTEASRACSSLEACALGRARKQLFEEHVRFRRSHEPDSDDED
FT                   EDYGEDGGGRGGVGTFRGFASAVAAVPGASPAKRKGSDRAMPSTACLELDSSFDTDDDD
FT                   DVNNRVSPDSVLELVATEAANARTKSPMKSPNKFARGAYDGPLNSPGKARRMRELARMH
FT                   RAQQRRSAKLASSPLKNESSTTATSNSGIDFRPIPSPGTEQIETGGRGALEARIDAALV
FT                   GDASPPRRPGVGGGVGGGRGESDDDARPPAAPRPGRLDGAANDACFGDVDAKPVRRTAS
FT                   RIAHLLGSASSGGGVDDLRLAMRRLEIPSARLEERFERSLDAEFGLGNFPESSFATPAP
FT                   ARKTAVAPMSVGT"
FT   CDS_pept        complement(306347..306871)
FT                   /codon_start=1
FT                   /gene_family="HOG000236377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640349"
FT                   /orf_name="MICPUN_60569"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69400.1"
FT                   /db_xref="HOGENOM:HBG619116"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000199CBE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM7"
FT                   /transl_table=1
FT                   /translation="MSRFVYGSLLAPEVLNALLGRVPDRTPATLPGFVRRRIKDAVYPA
FT                   IYPAEDPSNASVDGEVLTGMSRRELAVLDWFEDEAYVLTRVDVTFDETRVWSPPETVEG
FT                   VEPYLDPSIVMAYVFTSPRDLYGVWDYEEFRREHLGSYVAMCEAFAEDVKHNDLPGDDD
FT                   ELEDGIGDEVK"
FT   CDS_pept        307013..309085
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640350"
FT                   /orf_name="MICPUN_60570"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69109.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI000199CBE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM8"
FT                   /transl_table=1
FT                   /translation="MGGPGAEEDEETRLARAIAESKAQASKRTATIFAPSDLPDYQPRP
FT                   EVNWGERWELEEALATVPASQGGAAAAAAMGMAHPEIDGSSLAGTGIARRAIPEALPAA
FT                   ELDPAERGFHADDDAAGSPADDGDDRPVWVKTYDPNEDDFYFYNPETRETTWEEPDASA
FT                   AKIMLHHAIEGNARARRKLGLDPPGGPDDGGDVGDDGGADLGAEGADGYGRVTMSEMLD
FT                   DVKVYEYEDVRAVWNGMPTETEEERESREATEAASRAKDPFGTRGGGDAKQSKRAARKK
FT                   ADEMQERLWRLQDERQRREDAAAGVASGIVYEGTAGLWAAKAAEARAAAVAAAANDDDN
FT                   DNGAGAAAEVGAVSEWAVAAMEGLAAAEAGRAPGPPLAAPASSSRKEWYYCDDGGVWQG
FT                   PWSVDELRGWRSMLPMELAVRRAGADGGAPVDAGEDQNHNQNQNLASVLGDDELLARAA
FT                   AMDVHLPPRATATQAEIAIETVIAMRAGNAGRGDAAAAAAAGDGKPPRDLSAAAAAAAP
FT                   AGMSAPPPPRAAAGVASSMVDSVLAGLNPEQYRAVVSGGVDPADMARALVAKVERDRVA
FT                   AAEAAKAGVGDHWTSSGYATEARYNKMTGRVTAAPAGSFATGGGASIYSGGALDHHIDV
FT                   NKLEEGLWEMKRAKERRKERALSKQEIDRLKKRRAEIKKKHYVAPWDVGFENVQE"
FT   CDS_pept        complement(<309184..>309562)
FT                   /codon_start=1
FT                   /gene_family="HOG000128762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640351"
FT                   /orf_name="MICPUN_74198"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO69401.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG282327"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199CBE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFM9"
FT                   /transl_table=1
FT                   /translation="AGLVNYYRSGDQLAGHVDDAEVDMSKPIVSVSLGCPCVFLLGGRS
FT                   RDVAPTAVLMRSGDAIVLTGPSRRCYHGVPRIFVAGEGCVDGDGVRLGCPEWLGNPDAW
FT                   AEEPDVARYIAGGRVNVSVRVV"
FT   CDS_pept        join(310504..310941,311017..311535)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640352"
FT                   /orf_name="MICPUN_84021"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69110.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199CBE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN0"
FT                   /transl_table=1
FT                   /translation="MPALGLGTWKIAAGDTTAAVLSALRCGYRLLDCAPVYGNQPQVGA
FT                   AIQQALDEGTLRSRDELFVTSKLMTQTLEPTDFEAAVRTSLAELGVDYLDLALLQWPAP
FT                   QRAPIAEQWCAMEALVDAGLARHIGVSNFSAKKLGELMDGSDCRIPPAVNQVECGAHFR
FT                   QERLLRWCVTRGVVVQAYGPLGSGDQFSSDGMGRERSGAEPVDHPAVINAAKATGMTRH
FT                   QVLLRWNVGRGNVCVIPKSANPERQLENLRAVTGDTALPPEHADAIGSFEEQYRLQHGS
FT                   FHTGPGKPYRTLADLWDEDVGYMKGREFERPEGFALR"
FT   CDS_pept        311723..312937
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640353"
FT                   /orf_name="MICPUN_60573"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69111.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199CBEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN1"
FT                   /transl_table=1
FT                   /translation="MVTAGVVDIDPEIRAARAAQRARWRREQGLPPDDPEPTTVGDPAD
FT                   DLASEPTDWEDLGDAPETSGAADARDVAEAVERAIEERERRRRNGVLFHTALGAGILGH
FT                   TLVGATRSIGRALQRWGSGEHAGARERLIAGPPEERARRAQMRRDEALARRLQREERAA
FT                   AGMRPDHDPPEQGDGGEDRGALDDDEDEAAGFDWASGTVSDFLVHEWRTPFGNFRFAVN
FT                   RGGDGDGGAQPRLRTTQGDDAEALLRRMMTGGAWGGADSGHDVFAFHEWMRSRGGNGFV
FT                   TAGGENAMGGMTYEQMMALAERLGAVSAGVSADVIDAMPAWTYHSPTPGAMDPSGSPGG
FT                   GPEHECSQVPCCSVCLCDAEDGDAMRTLPCMHVYHADCIDKWLGEHSTCPICKHDVREG
FT                   SAVRT"
FT   CDS_pept        313214..314002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640354"
FT                   /orf_name="MICPUN_108742"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO69112.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000199CBEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN2"
FT                   /transl_table=1
FT                   /translation="MSAASASSLPAALGSAPRRASRAFASRSTPLRAAAEEGSRSFPST
FT                   TSGSPTRRVAVASSVALTLVLLGACAVSPVMASSDESEMLTDAIRAHRVVIVSKSYCPY
FT                   CRAVKKLMAEQYPEVHPHVIEIDLDTRVDMTKFQNAMAETYGQRTVPQVFIGAERVGGS
FT                   DDTFRAHVDGTLGRLLRDAGRFDDSPAARSADGGRSTPADDDDDDAPVERIQGETESEE
FT                   DELARIQAEIAAWEAEGASEGDEAATGAVATAPDADEEEE"
FT   CDS_pept        complement(314075..314569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640355"
FT                   /orf_name="MICPUN_108743"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69402.1"
FT                   /db_xref="UniParc:UPI000199CBEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN3"
FT                   /transl_table=1
FT                   /translation="MALARSAPGHAKTPPPVAPVPSRDDEDEEDASADAATSPAASASV
FT                   SIAPTASGDSSGGCSLDAPLDGTETARIRDDPGVDSRSSATTSAANDDRLRERRRAVAF
FT                   ARALIDGDGAAKGARRWAKAAARAAAKASDGAGGDGKKRRRLPAGWAVRAGTGARTRTR
FT                   C"
FT   CDS_pept        join(316368..316589,316718..316841,316965..317857)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640356"
FT                   /orf_name="MICPUN_107027"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69113.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000199CBED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN4"
FT                   /transl_table=1
FT                   /translation="MMRELENSSLEDVQMRQRLLENEIRVLRDESNRLALDLQGDKEKV
FT                   KENLEKIKMNKQLPYLVGNVVEILDLKPEDEEEDDGANVDLDSKRQGKAVVLKTTTRQT
FT                   IFLPVIGLVDGDKLKPADLVGVNKDSYLILDMLPAEYDSRVKAMEVDEKPTEDYTDIGG
FT                   LDKQIQELTEAVVLPMTHAEKFKTLGIRAPKGVLLYGPPGTGKTLIARACAAQTNAAYL
FT                   KLAGPLLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDEIDAIGTKRFDSDTNGDREVQR
FT                   TMLELLNQLDGFSSDDRVKIIAATNRADILDPALLRSGRLDRKIEFPHPNEDARAQIME
FT                   IHSRKMNLSGEVNFDELARSTDDFNAAQLKAVCVEAGMLALRRDGTEVTHEDFNEGIIA
FT                   VQAKKKSDLFYYA"
FT   CDS_pept        complement(317922..318479)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640357"
FT                   /orf_name="MICPUN_101807"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69403.1"
FT                   /db_xref="UniParc:UPI000199CBEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN5"
FT                   /transl_table=1
FT                   /translation="MACSTAAAVACGHSRVSPGPRGRPIDHGRRAARIVRAAGNEDMNA
FT                   PPFVVPQDCFQDKTYPPELKAAKQLKLLVTMVAVRVVLAQEEGFGNECHDDPSYTELHD
FT                   DLTTFLSQNPLGKLWDGEWLEKLIRHPKLNCRLAAVRIIEVRDVYLSKEFDWGLYKSEA
FT                   FDDMDECYKRLMSEHMERSMLG"
FT   CDS_pept        join(318710..318796,318905..318973,319124..319846)
FT                   /codon_start=1
FT                   /gene_family="HOG000239560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640358"
FT                   /orf_name="MICPUN_94842"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit G"
FT                   /function="nucleotide binding"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69114.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG381036"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017334"
FT                   /db_xref="UniParc:UPI000199CBEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN6"
FT                   /transl_table=1
FT                   /translation="MVGKMRWGDSAELDDDGDFDMSAALPASQVIGPDANGVKTYIDYK
FT                   VKDDGLKVRTVKKVRVHTETKKVTPAMAARKKWAKFGDAQRYKPGDESMTAVSIEEIFL
FT                   ERYRATPKSESEKQGDELAKMASSNTSLLVCRICGKKGDHWTTKCPYKDLASMNTLGLG
FT                   DSKPPGDDDGPGKGPGKGGYVPPSMRAGASSGASMGESMNRRREENSVRVSNLSEDTRE
FT                   QDLQELFRPFGPVTRIYVAFNRETGESRGFAFVNFVNKDDAQRAINKLDGYGYDNLILR
FT                   VEWAAPREERK"
FT   CDS_pept        complement(320032..320235)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640359"
FT                   /orf_name="MICPUN_108746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69404.1"
FT                   /db_xref="UniParc:UPI000199CBF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN7"
FT                   /transl_table=1
FT                   /translation="MHPTDARSTLAAIKRMGLGGAMDAKTRRALEAAAAATGEEANALR
FT                   RSPTAKERREARRGGGRPGEMR"
FT   CDS_pept        join(323726..323949,324102..325347)
FT                   /codon_start=1
FT                   /gene_family="HOG000009857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640360"
FT                   /orf_name="MICPUN_84113"
FT                   /product="Predicted protein"
FT                   /function="glutamate-cysteine ligase activity"
FT                   /biological_process="glutathione biosynthetic process "
FT                   /protein_id="ACO69115.1"
FT                   /db_xref="GO:0004357"
FT                   /db_xref="GO:0006750"
FT                   /db_xref="HOGENOM:HBG294235"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="UniParc:UPI000199CBF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN8"
FT                   /transl_table=1
FT                   /translation="MRSHATAPARLSARGALGSSGQLSKTRAATRNARRAVTRAAGAPA
FT                   ASAEKRTATNALTKKDLVAYLESGCKPKSQIGTEHEKFGYQLANLRPMEYDAHVAKLLH
FT                   ALVDRFDWEPITESGNIIGCKLNGQSVTLEPGGQFELSGAPLANLHQTCAEVHSHLYQV
FT                   KTVAKEIGVSFLGLGFQPKWSVADTPVMPKGRYKIMKEYMPKRGNKGLDMMFRTCTIQV
FT                   NLDFESEEDMVRKFRTSLALQPIATALFANSPFCDGKPSGQKSLRSDVWTDTDPDRTGS
FT                   LQWVFEDDFGFDRYAEYVLDVPMYFVYRDGVYHDVTGESFRAFMRGELPQFPGEYPTLD
FT                   DWEQHLTTCFPEVRLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALANAEALVADW
FT                   TPEEREYLRVAVTKDGLQTKFRDGTVQDIAVEMVRISKEGLTRRGCNEENFVDGLMEMA
FT                   TSGQTQADKLLDAYVNKWGMDIDRVYNELSY"
FT   CDS_pept        complement(325461..326075)
FT                   /codon_start=1
FT                   /gene_family="HOG000231573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640361"
FT                   /orf_name="MICPUN_83988"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69405.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG635218"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI000199CBF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFN9"
FT                   /transl_table=1
FT                   /translation="MSAPRGADAPPLPGRLDPARTAVFVCDVQERFRTVIHGFDHCVHV
FT                   SSMMLRAGKILGMPAVVTEQYPERLGATVDELAPNLDPRAPPVAKKLFSMITPEVDERL
FT                   GGMNRDQAVLMGLESHVCVFQTAMDLMARGWEVHVLVDGVSSQRPTDRAVALRRLEASG
FT                   AMLSTSEMALFDLLKTAEAENFKAVSAIVREKRPEPPLPSL"
FT   CDS_pept        326795..327598
FT                   /codon_start=1
FT                   /gene_family="HOG000236200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640362"
FT                   /orf_name="MICPUN_97735"
FT                   /product="Bile Acid:Na+ symporter family "
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69116.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG747007"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="UniParc:UPI000199CBF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP0"
FT                   /transl_table=1
FT                   /translation="MLGMGLTLELDDFLDAVKKPKQVALGVALQYTIMPTLGLVIGKLF
FT                   PVARPVAVGLILVGCCPGGTASNLVTYLGRANVALSVVLTTASTFLACALTPLMTKTLA
FT                   GTLVPVPASGLFASTLQVVLLPILGGLALKRWFPEAVKKVTPFCPPFAVATVALVCSSV
FT                   IGSSSVAIASAGGALIAAVATLHACGFALGYGVACAFGFPEPDRRTVSIEVGMQNSALG
FT                   VVLATAHFADPLVAVPCAISATVHSCLGSALAGTWRALDDGKNRA"
FT   CDS_pept        complement(327712..330780)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640363"
FT                   /orf_name="MICPUN_60583"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69406.1"
FT                   /db_xref="UniParc:UPI000199CC6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP1"
FT                   /transl_table=1
FT                   /translation="MSDESAPLLEPREGADARSRRGRIVRVAAAGLLAAGAVVAVAGGS
FT                   SRDAVALLRSPATKTTMPSVSHREARLGDGRWEEIEEANRLMMAQERLQMQADAQTAAV
FT                   EQSAFEDREASVARAGPGELASPDPTAPTEISQPTAAAVPSVVPSAAAAAAPPGPYPMA
FT                   DANEGGGPVFVHIPKNGGTSVELLGAYYGRRLGMCAAKDPDEWEGALGYETIPGFKCNV
FT                   WHRPPLPPATGDTAGDGDGDLFDSGSGVNLGKIANSFCMSRNPYDRLASIYRYKSGLYP
FT                   DKFAPTCESFSAFLDKHFEKLVTNQLLRCVHTGEFHPSECEYHVRADMAKAEADMDDIE
FT                   QHSSYSDEDCHFLPQSLYTRTCENVFKVEDYDAAVMPYLKEQFAKFGAAAAARSEGASS
FT                   SSAALGDGDQAVAAMGDYRTDWWWNHVGKYQQRKAGSSERRPEVDAETAAVGEAELAAN
FT                   DGTSSTADSTTADSSTSPLSSCTWSDVSAETIEHIKFAYQDDFDSLGYSPEPPPGPLDL
FT                   SGKDKTDSMASLGASELRVASSEPRENAPGRNFRSTTPRRARLGSVAADRQAMEAKLEA
FT                   RTTQQRDADEFFAAWLDEDADVRTAVRGGAKLGAAPETPTEPTRWGDAAGQPVVRELQP
FT                   RPAKAGQLQPDARGGGDDVSNPVRDALADPDSVGPGSGNGRGAWWQGIWHGGWKEEDEQ
FT                   RPENGLGDVEPKQQQQQQQQRRRRQGGDPAERDEDPAEKKEPTEAQKRWWMEHHGGVDT
FT                   RVAPEDTRVAPEDTRVAPEDTREPPSAAAPVPEEETPGDADAVDPVTMKRLEEAATACS
FT                   AAFPKKGKANFPAIIKSHLLEMHRELTAGAAGGAASSTMPSGDSASEASTIPSGAADSD
FT                   GGDGGASSGMSEEERAIAAEDAAVAKAMEEESAAYGVRPTTESGAGEPQPQDHSGSYPD
FT                   QQQRGAPGGTIVEAAPVKTEAAPVETEAAPTETEAAPGETEAAGSDDDMSSLREELKAE
FT                   LKAELKEQLKQELMQDMMKEGGGGGGGVVGAAR"
FT   CDS_pept        complement(331181..332119)
FT                   /codon_start=1
FT                   /gene_family="HOG000012770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640364"
FT                   /orf_name="MICPUN_60584"
FT                   /product="Rieske [2Fe-2S] domain protein protein "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69407.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG562245"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199CC6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP2"
FT                   /transl_table=1
FT                   /translation="MSAFIITSTPVVRASAASRASARAPVAAALRPPSARISTGVARSA
FT                   ALRIRRRRASSLTVRAEAEAETAAAPVESLPPVPGTFVKICDADELPRGTRKKVSALGK
FT                   SILMFWYKDSMVAIESRSPAEGAFSEGFENARLTQDGCIVCPSTRSTFDLKTGEIKDWY
FT                   PDNPVLRRLTPIETCRPMEVFPCLARPDGVYVDVKNGSLGPDFVAPATKGGSNTSLENN
FT                   NVYAVEPQMVVVGADGKEIAVDDDGESGMSKMDPGTLAISIAGVAALALGGSAVCVFYE
FT                   NYVGLGLFWLVGFGIAAKVGLDATGALDEDK"
FT   CDS_pept        332385..333245
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640365"
FT                   /gene_name="PSBS"
FT                   /orf_name="MICPUN_108747"
FT                   /product="Photosystem II 22 kDa protein, chloroplast "
FT                   /protein_id="ACO69117.1"
FT                   /db_xref="HOGENOM:HBG609835"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199CC6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP3"
FT                   /transl_table=1
FT                   /translation="MSAALVRIAPVARVRASALPEARAARIAARARATSRRFESASPLR
FT                   TSSGTARSRGDAARVRVAHPDEGFTDGNPLATAENMDLEMKLGRAAMVGFFFTTVGDVV
FT                   TRGAGPVEQLRDEQTFIMNHINPAMIAKDALEVAGIYVESVFIVWLCLAAAFILAVQQG
FT                   LASPVRTYSSKKSARRAELEASGERLGVMLASVKDALDVQVREQKPYELFNGRLAMLGF
FT                   AFALVGEAVTKRGPLEQFNLETGVPVIDEELFGAFFLLGVVFNVVATGANVWKTAWAKG
FT                   KSVNR"
FT   CDS_pept        333832..335196
FT                   /codon_start=1
FT                   /gene_family="HOG000264855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640366"
FT                   /orf_name="MICPUN_97738"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69118.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG562246"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199CC70"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP4"
FT                   /transl_table=1
FT                   /translation="MPANDALDKQILKLFVPAMLNFLIIPFVGAIDVFWVGRMGSAVAL
FT                   AAQGAANQVFQSAFWIISFVPSIIAPVVAKAAASGDTEEVQRATGEAIFVASLVGVFGM
FT                   VLLTVFQSASLKIVGVVPGSATAAAAAPYIGWRALTFVPAIVSTVGFAAFRGTLDVTTP
FT                   MKITLVSQMVNLLLDPILIFGAGFVKAMGVAGAAIATSASEITSFTLYMSAMLRRGIIT
FT                   LGSLIRVPSWGNIGKLMVGGAAVQMRSIAQNVTFLAVMRAILTMDATGTAAAAHTLSSQ
FT                   MFQLCLIAVLALSTLASILIPQKLNAAKGEGGVEQAKICADRLLVWGFLLGTFLACVQL
FT                   TALPALKFFTPLENVQAMARGPVLIGAMQMPLNGLVFVAEGLMQGHQAFARLAGGMCVS
FT                   TTLMLGALKVWGHTVEGVWGCFFVFNVSRLAFGLRHHFFDGPLAPARMRAEKSNP"
FT   CDS_pept        complement(335377..336276)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640367"
FT                   /orf_name="MICPUN_60587"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69408.1"
FT                   /db_xref="UniParc:UPI000199CC71"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP5"
FT                   /transl_table=1
FT                   /translation="MTKLVKTGRKPGASAPKGGVGKGRGGKENPKSSQPPRKNSGAWKD
FT                   EFREKFKFKSKRAGKAVKERTERRSIPDFLKPEDKGEKLTPKQVARVIGEVLQPVRAKY
FT                   GGQGFAKPSAFINGAAPDFKEQLGELFDEHVEGFSGKSFRKMGKKQEQMNMLWKQRLKA
FT                   KAEADGTIVAGKRLREKEPDVDDDDDDGGGKTLARGGVNWKRKERAIVPDATAAAEEEE
FT                   EEARDGGDAPRGAGGGLSRKQRTKAAQMGMTPEAYLEWMQRGKVKVAVDHDARNNAIEA
FT                   YRAMQKAKLQKANPRGRR"
FT   CDS_pept        <336808..>337578
FT                   /codon_start=1
FT                   /gene_family="HOG000044954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640368"
FT                   /orf_name="MICPUN_69191"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO69119.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG754478"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199CC72"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP6"
FT                   /transl_table=1
FT                   /translation="DEGQRLSKALAALGVASRRASEELIFAGRVQVNGVTVTMPQHAVS
FT                   TSRDVIAVDGKVVQGGLESLGDGGHLYFLLHKPKGYLCSSKPAGAGARASGQDRLVLDL
FT                   FEDWREGWRKRHPGQLAPRLFTVGRLDVNTTGMLLVTTDGQWCQRVAHPSSQIPKSYIV
FT                   TAATRPTKAQIKKMAEGCEVDGVHVTPLRVESMEGARDGGPAHRILVDVVDGRNREVRV
FT                   LSASAGVDVKKLKRVRVGGLRMPSELPIGKYMSLK"
FT   CDS_pept        complement(<337961..338607)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640369"
FT                   /orf_name="MICPUN_108748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69409.1"
FT                   /db_xref="UniParc:UPI000199CC73"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP7"
FT                   /transl_table=1
FT                   /translation="MGGAAARNAANTGANTRGARRLAKLTEEEDALAERLLEEFAREEG
FT                   GRSGVRGIDSSAAASLDADVDADVDADVGADVDADARSVAASTRSFASSVNTNPFAVTR
FT                   AIAGVVHPGAGTAFGSLDVDAHGPVDEDARRLAEIERALGEIASGRGTVAKTQPASSSS
FT                   PASAVSSSPAPSSASALARRLGASSVSGGGGWDDDGEKENDSVRTFRGEFDG"
FT   CDS_pept        complement(339792..341879)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640370"
FT                   /orf_name="MICPUN_53032"
FT                   /product="Amino Acid/Auxin permease family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69410.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199CC74"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP8"
FT                   /transl_table=1
FT                   /translation="MPSASIDEGVGVDANDDGRMEEGAVELGGPGDAPNGDEGASVPHP
FT                   HAGQKPGSAVFNLSSAIIGAGIMAIPNAFRVLGVLGGVLALVAMHVVTGTTVRFLVRAT
FT                   EASGAGTYAACAARFCGDAARTAVQLAIVLNNFGIMVVYQIIFGDVLAGTPADLRTLPD
FT                   VDPGPGSDAEDYADYDDGRDNATRVYPPPLPPAAPPSDEDDEDAAPAALLPWAFARAGG
FT                   SCRVPVAAVAPNGRLTLRSGPSSYHSFLASTGVPVAAYDARGERAYLRAALAVPDDGAI
FT                   GWGESSDTFIGRALDGWAAQKNGGNVEPNHHSQTQVAYETAWYCTRPASIAYVLVLVCA
FT                   PLCLMRSLKALAGASFVSVACAANFAAVLLFKFVMHVVEEFGNDTAGDTAGAGVFGKLA
FT                   ALTPRLLPDPTRTSVREAISVIAVMTTAYVCHFVVHPLYAEMDHPRSPERFEALVARRS
FT                   LRLCTSIYVGVGVVAFALFGDGTHADVLVDFRRNTALDQAVVKGGYVMSLALTYPVLFC
FT                   VMREVLVEIFMDRGDAAKRRSGATTDADDRYDDRYGDEATSDELREHLLTDAGEEERAD
FT                   PGDEVAHTLAMRDSRVSLRDPEECAWRLSRPAHVALTLSIIAAQFLLAIVIPNIEVALG
FT                   FMGSTLSVFVAFAAPAMIAIGVAKEAGADGSLAWAVLAFGVLVGASGLTVATWNVVSPP
FT                   E"
FT   CDS_pept        342175..345723
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640371"
FT                   /orf_name="MICPUN_60591"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69120.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniParc:UPI000199CC75"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFP9"
FT                   /transl_table=1
FT                   /translation="MRAARGSPRLAAGLTWLALWAAWTVASFPGPRTHPLGPVVGSSWW
FT                   NGPSSLLPVAAAADATPGDAGAGGLGTTIPSHPGAPGGAGVEDQTKAGSAAAPTSPSSA
FT                   PRSGAQTEDPVATPTAGEPTGAPPAASSDDHQATVTMVSTSDPAASKPVREADPIAELA
FT                   ASCAIENSFSHDVLRQSNVTLAALGGDAGAGGGRERMVCTTDAEKGSAAFAAAEDARLR
FT                   REKEARKAKEREAKEKAKIPSLKDFKSDIAAKVSAAKAAKEEPKEHKEPQKDKDKEHKE
FT                   GHATSIEPNVSDQNATGTDRADAAGEPPAPSPGTDADVNAEGNANRTGSDVAGSISGDA
FT                   NSTATTEEERERRAGAPGTGAPKGAGSAKGAASAAEENRGERRGGGDEKAGGEPASEPE
FT                   RDDAAPDADAVAGAAAGARSSAEPAHPGAAEEDEGGGGGGKIEARSEPPAAPATSATSA
FT                   PSAPSAPSATPEDQPAAAPAAAPAAGATDGDPAVASAPAAAPAAAAAEEEDPWIMPASA
FT                   AEGEAFIRQYNYASYANGARVVSSNPESKSAGAALKEDMDSYYLTPCAAKNGRWLTVEL
FT                   SEEAAVTAVTLANYEFHSSGVREFEVWASAAGAHDREEDWRRLGRCRARDGRDVQTFVL
FT                   PRGHWSKYVRVSMTSHYGRHHFCTLSLLRVHGKDAKQTLEEEMEAINREVAEVEEILNA
FT                   GDDYEPAGEAVQSGGGSGDDDKPAAEDEVQVADTDSPSEPGAAPEPPIEPSIGTPDGTP
FT                   TAPPTELPADAGPGATSEAKPPGESDSAGADASAAADDKKEGFFKSWFGKEKEAASKEE
FT                   AAKEAASKEEAAKEEAAKEARDSPPRPDHALTDPAKEAGSKSRSDEEKEDDGSGSGGED
FT                   TVGVEPPASAETAPGSSERSLSSEEAKTATADAREGAEPAAETPTTPPAAEAAAQPIQP
FT                   TAEEAAAAAAAAQQQQQQPPTVGKDDKPLPAVPKPAVSEQRPSSPENVFSLMAKKIKSL
FT                   ELNQSMFDRYIESLSASYGGRFEDIAQEVNDLEELVANQTSALVELDKALDKATRGAKS
FT                   DLSVAIERVGRDWAKNARETAADVRDKLASVERRWELYLGLTMFAVATVLGVAAFASGA
FT                   QAALVLWREGAEPSERARLAAKVTAVACVVAGALSLGCYFAAAWLVFGRMATSVWAAGV
FT                   QAAGAAFGYLRMNRRT"
FT   CDS_pept        346399..347490
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640372"
FT                   /orf_name="MICPUN_108749"
FT                   /product="Major facilitator superfamily "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69121.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199CC76"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ0"
FT                   /transl_table=1
FT                   /translation="MFTAVTPSQLTVGRLVAGLAVGFSTSLCTVYIGECAPAATRGALT
FT                   SYAPLGVTVGILTSYFVSLPLTNVVGGWRLTLAMCAVPATAQLCLRHWLVESPRWLAER
FT                   RGDIAGARRCLRFLGQPDADLSTLADDDESVGGSGRLNRQPRQSVTFKALVTERRYRKP
FT                   ALIACGLNALQQLCGINVVVYYAPRILNQLGFTPVAAIGFVCVIGVAQLVVGSRIGAII
FT                   DAVGRRPVALGGIAGLAVGLAMLAASSHLTPAGHAWAPWIAVLGILVFRLSFSASMAPI
FT                   PYVVSAEVFPSEARSVGAAAGAAAREVANVVVTGSFIPLVNALGATGTWVLYVAVVCVA
FT                   FFVVRATLPETRGRTLESMEDGV"
FT   CDS_pept        join(complement(348728..349354),complement(347759..348319))
FT                   /codon_start=1
FT                   /gene_family="HOG000280753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640373"
FT                   /orf_name="MICPUN_84293"
FT                   /product="Phosphate:Na+ symporter "
FT                   /function="sodium-dependent phosphate transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69411.1"
FT                   /db_xref="GO:0015321"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557226"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniParc:UPI000199CC77"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ1"
FT                   /transl_table=1
FT                   /translation="MTPEEARDAARQAKWLVPSNDDPKLKVALTLAVFFCIWVFLLTLS
FT                   IMGTGFKLLGGKDSAKMFDVADNPISALLIGVLATVLVQSSSTTTSIIVAMVGADELSV
FT                   NIAIFMVMGANIGTSVTNTIVAMGHFANQDDLRRGFAAATVHDIFNMLNVLIFLPLNWI
FT                   YPFLAKMTYEMAKDQKPCEGDKCKKTEFLGPYISPYSKGVANYDKKMTDNGAGTFLTIV
FT                   SLISLCSCLFCIVYMLQIIMKGAAARVLQKVVGFNGYLNIAIGCFITIMVQSSSITTST
FT                   LTPLAAVGIISLNDMFPLTLGANIGTTLTGIMSASVVTSNPVNGWQVALAHLFFNIFGT
FT                   LIWYPIPKVREIPLRAARFLGHCTAHPQYGSLFPFVYVSMAFFIIPGIAYGIASA"
FT   CDS_pept        join(350744..350891,351026..353616,353664..353723)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640374"
FT                   /orf_name="MICPUN_101817"
FT                   /product="Predicted protein"
FT                   /function="amino acid binding"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ACO69122.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199C43E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ2"
FT                   /transl_table=1
FT                   /translation="MAQLTRSDSSMSNLAEEFPTRIMECGLLPLTCAGVEVSNKLHVTC
FT                   TVVKVKTADRTALLLDISDFFQRNKYSIIEAEVSTTAHDNMASDIFLVQQADGRKIQKP
FT                   RQFAEEIRDVILKSNRIHRSNSTTPGTSMSSSRAGSREPSAHGGNHFFTSQTGESRMGV
FT                   VDALDVIKRADDLARERNGIGANGNGGANGVPPIELKSHVMNANGISEAEVTALDLRLA
FT                   EMELGPAPEVERVERHGTGDAYTAKLDDNDAGIEPGVGGAARSPPSRDVRESSGRGGMT
FT                   QIEEEKEAMVEWQLRTKVGGSTHSSAGFKLSQDKLANATEITMEVPDRVGLIADVLECL
FT                   NKNNVGVVHAHIYTTAEGLASNYLSVVDVATGEKITEEVLEEVHSALAARCFRDSKRVG
FT                   GTNKTRPYSSNSAKRGLALVGTPSPPGAATPTPSPPKHDKKVWGIDIETEVKKRMARLH
FT                   GGEVHGAEYMQMRSKAMESLTRQMNNVNLAAVEPAVLTPEDRSVVDGALAVLPAYASIM
FT                   FQSSKEEIISELREVRWAAGDIAFEPEDFIPNLYIIVEGSLFRDSWHNQAGNQVQALVL
FT                   SRGCLLGEVALQHAYQTAARITSQNGEMEPVATRGFAINVETFKRIVRSRIHRTRQLCT
FT                   NVLNIIETFRMVPANMKELLLNAMWTESKSYPPGSIISGGGKVPSFHIILEGEVRAGTD
FT                   WRQVHLMAADSFGEDALLSAEARKRAGLPPADEASTHSHVAVSHTVTLKVTRPLLERLW
FT                   GADFDKYIRSRHDVTTASAAGASKDLIGGHQLGAPSGSMKASDSGSSLDNWPASPSPTH
FT                   KTIADKAKKVDGVGGKAGDLSIRSGNIFSSVKSQGAVHKSLAKKALMGSISVHAGMSGL
FT                   GDSDAIARAAAEEESKKARGASSTSLMASFKSFSKQMKKMMGAVIAGGVPPGFAQAHNR
FT                   GG"
FT   CDS_pept        <354475..>355209
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640375"
FT                   /orf_name="MICPUN_70519"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69123.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C43F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ3"
FT                   /transl_table=1
FT                   /translation="AVKVMDKAKILEINETAHVVQESKIMKSVSKHPFIVSMLESFQTP
FT                   SAMFIVMEYASGRDMFFMIHERGTLSLFQTRAYITQVTLALDHVHSKGFIYRDLKPENL
FT                   LIREDGYLRLTDFGFAKALKPGERAYTVCGTPDYLAPETLRQQGCNRAADFWAIGVLLF
FT                   EMMTGYPPFHGQTHSDLYRRITAGRMRSFPRQFDEDAADLVKRLLKQSEGERIGVGAEG
FT                   IQKIRRHPFFKGFSWTSVLEQTL"
FT   CDS_pept        complement(355518..356312)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640376"
FT                   /orf_name="MICPUN_53034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69412.1"
FT                   /db_xref="UniParc:UPI000199C440"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ4"
FT                   /transl_table=1
FT                   /translation="MSKSRGAHGVLSQGFVEKEAAMDERRKREREELEALRAEADAKLR
FT                   LARETLESARKERESARKEWGGLGGGVPGASRDLMPPPPPRSAMPTPRQLRLDSEPSTP
FT                   RDFSDAPAGSAPKGDPNPNPNPNPDPNDPGPSGDAPGVTPGDAAIEALVDNLARRTAEA
FT                   EKKLTRAENLAAGSQIGGSKVNVASGIAALRSRLARIAVNSRRLTHAVEEGDGPSKKET
FT                   IAQLEQQERELASWFAELQSQLEALFARPKTARRSAVRSSWN"
FT   CDS_pept        complement(363228..>363806)
FT                   /codon_start=1
FT                   /gene_family="HOG000233767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640377"
FT                   /orf_name="MICPUN_84177"
FT                   /product="Predicted protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="ACO69413.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG715660"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI000199C441"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ5"
FT                   /transl_table=1
FT                   /translation="AKKVKSDSEPSEVVPDVFLGSIGAAHNREVLERLGITHILTVAGG
FT                   FEPKFPQSFIYECVDVKDVPEERLSVHFDRCLKFIAKCLLDGGRVLVHCFAGKSRSATV
FT                   CAAYVMATEGLSLEETLVTIGRKRPAASPNHGFMAQLASFERELNRARTEGRLLGRVQL
FT                   DARRAASCEELAVKSGEEGEEVVEGTRDE"
FT   CDS_pept        complement(365094..366107)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640378"
FT                   /orf_name="MICPUN_60596"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69414.1"
FT                   /db_xref="UniParc:UPI000199C442"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ6"
FT                   /transl_table=1
FT                   /translation="MGQCASQPRVDDGAVVDAPVDRKLTPSDSADSLARPNVRQTRGEA
FT                   FYHPTKTAKAAPFAKPSPLPSNEGVVDDYTLRRGVVPRHMYTSKDVNNPAIPPVHPDHR
FT                   LTKEEAEAHPLGRFLNASRLVKPPPNRWGPWEDNAMVKEVDKRIAELEAADPQRQLYEK
FT                   LMAERFEALKALPQRPIDPETGEINFDVDPTAEDPTFDEPVPTAPRALSSAMERALMEC
FT                   DDKWADKAEIAEMLHPDIVYRTMDGKTWNGRRAATDKMNHSIAQMTVRMKRSAKKSWDI
FT                   VKWRDTWVATEPERKAPGVWVMEFRIKLLLMSIKFREEYVVDDRGRILELTRVRLS"
FT   CDS_pept        complement(366395..367342)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640379"
FT                   /orf_name="MICPUN_60597"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO69415.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199C443"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ7"
FT                   /transl_table=1
FT                   /translation="MSLAAAGPIRAAPIASAQRTGMPGKPAPASSRADVAGIGRRDALA
FT                   RAATIAARKLLPSTTIVLPSTIAAPNARADPVDLAPFVGKAGFFIRYPAGWVRATDRPG
FT                   TDNGKSETLALVGNFKDIDTVSVRREPMALHRDFAEAAAAGGDDAPEGGDGGDDAPREG
FT                   GEDASSNARSNARRVALALTAAERDAVAANQNFGVVGGVENGRSGVMDFALGDASVADG
FT                   PGAAKGTTQPYFAYEYFTEVCRANIEEGAGGAKVCVGPRGDVLDTVRRVNYAVATESEG
FT                   YLYLVKASAVEGRWETVGPLLREVAQSFRVPQAY"
FT   CDS_pept        join(368248..368543,368673..370245)
FT                   /codon_start=1
FT                   /gene_family="HOG000030580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640380"
FT                   /orf_name="MICPUN_83947"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO69124.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG744005"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="UniParc:UPI000199C444"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ8"
FT                   /transl_table=1
FT                   /translation="MRSPPPPPPPSPPPPPPPPPPPQTRTPPTPDRSPIALRDVLLEKG
FT                   IVLTSYTPGQHRIVCPSCGGGSTAERSLAVHVDDDGASCQWMCHRATCEWTGGARRRGS
FT                   GAGGAPKLPAPESLERVGPGALTDNAKEWADWLVSRGISLEVAERNGVAAQRVFSPAAG
FT                   EHVNALVFPYMRDGELVNIKYRGSDKSFWQIKGAEKIMFGLDDIAGSSEIVIVEGEMDK
FT                   LALEQAGIKNVVSVPDGAPGKVRDGDLPAPEEDRKFEYLWNCRAALDPVSRIVIAVDSD
FT                   GPGLALAEELARRLGKERCYRVTWPEGCKDANDVLQKEGDAAVRGSIDNAEGFPLRGLF
FT                   RFSDFQDDISNYFGVSEASEMKGVSTGWRSIDGHYRPVPGELTVVTGVPNSGKSEWVDA
FT                   LMCNLAVQHGWTFALCSLENKVHEHARKLVEKYTGEPWFEGKYGGKKARMRPETMRAGL
FT                   HWLDNQFVLIRHEDDELPSVDWIIGLARAAVMRHGIRGLLIDPYNELDHKRPQGQTETE
FT                   YVSQMLTRIKRFAQHYDVHVWFVAHPRQLHNWRGEAPGLYDISGSAHFINKCDNGIVVH
FT                   RNRDEKLGSLREVTIHVAKVRNKVAGAIGDPKLEYNLTNGRYEDLK"
FT   CDS_pept        join(370672..370846,371127..371563,371663..372513,
FT                   372562..372703)
FT                   /codon_start=1
FT                   /gene_family="HOG000181157" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640382"
FT                   /orf_name="MICPUN_94846"
FT                   /product="Nucleobase:Cation symporter-2 family "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69125.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325349"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniParc:UPI000199C446"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR0"
FT                   /transl_table=1
FT                   /translation="MALTKEKLIGDYDWGALCLPTVPWAKSTRKMPFFARNDETPFLVA
FT                   AVMGLQHCFAMIGGLITPPFVVMRFSVAFTDVKLQQYAIAASLILSGIFSIVNCLQFKI
FT                   PGTPYVLGTGVLSVLGTSFTFLPVFENGISAMRADGTDAEDAYGKMLGTVMVCSFLEIF
FT                   LSFIPKDKLRRMFPPIVTGVAVMCIGIGLTGTGMKYWGGGTIPPIPAGTVCGGKTCCAA
FT                   GDVALPFGSPELVGLGFSVFVMLVLVELFGSPMMKNCNVIIALLFGYFVAGLSEKCVGS
FT                   TCRKFVVDTNIENAESITFLWVKSFKLGFYGPAVFPLLIAFLVTTLETIGDIGAVYDAS
FT                   EESVESEEFDKSIQGGLLSDGVCSFLAALGTGMPNTTFSQNNGVIALTKCASRRAGVAC
FT                   GCWLIFFGVLAKVSGIISSIPDCVIGGMTTFLFVNVFISGLKTVAQVDLTSRRNRMILA
FT                   ISLGVGIGVAIVPGIFADMRASYGTSPFFPGVRDGIVQFLSTPYCVGTVLALLMNAILP
FT                   PDMEILRKDAPISENKA"
FT   CDS_pept        join(370672..370846,371127..372703)
FT                   /codon_start=1
FT                   /gene_family="HOG000181157" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640381"
FT                   /orf_name="MICPUN_94846"
FT                   /product="Uric acid-xanthine permease "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69126.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325349"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniParc:UPI000199C445"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFQ9"
FT                   /transl_table=1
FT                   /translation="MALTKEKLIGDYDWGALCLPTVPWAKSTRKMPFFARNDETPFLVA
FT                   AVMGLQHCFAMIGGLITPPFVVMRFSVAFTDVKLQQYAIAASLILSGIFSIVNCLQFKI
FT                   PGTPYVLGTGVLSVLGTSFTFLPVFENGISAMRADGTDAEDAYGKMLGTVMVCSFLEIF
FT                   LSFIPKDKLRRMFPPIVTGVAVMCIGIGLTGTGMKYWGGGTVCAETSWKNHNEAYDLVG
FT                   FNSITENATGVEWNKIPPIPAGTVCGGKTCCAAGDVALPFGSPELVGLGFSVFVMLVLV
FT                   ELFGSPMMKNCNVIIALLFGYFVAGLSEKCVGSTCRKFVVDTNIENAESITFLWVKSFK
FT                   LGFYGPAVFPLLIAFLVTTLETIGDIGAVYDASEESVESEEFDKSIQGGLLSDGVCSFL
FT                   AALGTGMPNTTFSQNNGVIALTKCASRRAGVACGCWLIFFGVLAKVSGIISSIPDCVIG
FT                   GMTTFLFVNVFISGLKTVAQVDLTSRRNRMILAISLGVGIGVAIVPGIFADMRASYGTS
FT                   PFFPCRGPFRTEDDCTDAERGVRDGIVQFLSTPYCVGTVLALLMNAILPPDMEILRKDA
FT                   PISENKA"
FT   CDS_pept        join(complement(373309..373384),complement(373059..373219))
FT                   /codon_start=1
FT                   /gene_family="HOG000178587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640383"
FT                   /orf_name="MICPUN_53038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69416.1"
FT                   /db_xref="HOGENOM:HBG627799"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI000199C447"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR1"
FT                   /transl_table=1
FT                   /translation="MGGGNAQKSAMARKKAQEKAAKEGKGSQLKQNAAAQSIQCKVCMA
FT                   TFICTTAEVKLKEHADNKHPKNDFHQCFPHLKA"
FT   CDS_pept        complement(<373773..>374624)
FT                   /codon_start=1
FT                   /gene_family="HOG000200873" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640384"
FT                   /orf_name="MICPUN_76243"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69417.1"
FT                   /db_xref="HOGENOM:HBG609782"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI000199C448"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR2"
FT                   /transl_table=1
FT                   /translation="LSGELAEQLRLILEPTLASRLQGDFRTGKRLNMRKIIPYIASDFR
FT                   KDKIWLRRSRPSQRKYQVVLAIDDSKSMAENRCGHLALESMVLLARAMARLEVGEIGVV
FT                   GFGAAGGGGNGKDDPSPNANATDAVRTLHPLGAPFTDQGGPALVSQFTFAEDNTLADTP
FT                   MVNLLRYLDAQLGAARENIRGGSEQLQQLCLIIADGRFHEKEALRRQMREMGSRRGLLV
FT                   AFIVLDNPSSSVLDMQSVTFASGKPVFQKYLDTFPFPYYTLVQDINRLPSVISDLLRQW
FT                   FEI"
FT   CDS_pept        join(complement(392766..393253),complement(391655..392402),
FT                   complement(390710..391450),complement(390059..390389),
FT                   complement(389218..389720),complement(387997..389124),
FT                   complement(<386952..387680))
FT                   /codon_start=1
FT                   /gene_family="HOG000084869" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640385"
FT                   /orf_name="MICPUN_65101"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="transcription factor binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69418.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG435210"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="UniParc:UPI000199C449"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR3"
FT                   /transl_table=1
FT                   /translation="MIRTGSAARNLRAVALALCRNKPLLLEGPAGAGKSAVLEEVASLT
FT                   GNDDFVVLHLDAQTDSKSLLGSYVVGAAPGEFKWQPGALTQAVASGRWVVIEDVDLAPF
FT                   EVLAALVPLLEERRLYVPGRGESVPAAEGFQLFGTVTVGGGRSGGAAAAGARADPLAGL
FT                   VHAGRPFTLRDLLRWARRLERMRKTELSLIRPGKTRADSLPPKVRLAAYEEAADVLGGM
FT                   LPAGVGKRRVLEAMAGCWGLGADAAEHTDVLHKPAMQRGSGGVAVGRAVLPAGDGVSAA
FT                   DGSDGRWAKTGHAMRILERVAAAVQMTEPVLLVGETGTGKTALVQQLARVTGAPLTVVN
FT                   LSNQSESADFLGGFRPAGARHLCLPLLPRFRSVFERTFPSAANAEFMHRVTRYGEKKKW
FT                   THLLHAMRAGVERAKKKQKQKRALPDDLIAEWRQFERELSTAERACGQAGGGPVFAFVE
FT                   GALVTALKEGRWILLDEINLAPAETLERLGGVLESAHGSVVLSERGDGAAVPRHPRFRL
FT                   FGAMNPATDVGKRDLPAALKHRFTEIYAGECESREDLALLVKQGLRDTVPGSSIEAIVD
FT                   FYLAARRDAAATLLDSADQKPQYSLRTLSRAMEYVRAAAPVYGVQRALYDGFAMSFQTL
FT                   LQAPSAAALETLMVKHLLRGQPLKAIFKAPPAPPDGTHELIEQYWVEGGDLEREDPEAS
FT                   GRYVVTPGVKTHLSALARAALLRRHPILLQGPTSSGKTSLVEYLAQRTGHRFMRINNHE
FT                   HTDLQEYLGSYVTDANGNLSFQEGALVQAVRRGYWIVLDELNLAPSDVLEALNRLLDDN
FT                   RELFVPELQETITPHPHFMLFATQNPPGATYGGRKVLSKAFRNRFMEIHVGDIPDEELK
FT                   TILNKRCAVAPSYCAKLVEVMRELQRRRQASRAFAGKDGFITARDLFRWANRQSNGYEE
FT                   LAADGFRDMYVAAEEGALKLRLDEAAARAAKRAEEAEKMASSAVAAADARSAKQDASDA
FT                   AQLSEAMAWTPAMRRLFSLVEACMNHKEPALLVGETGCGKTSVCQLLALLRGQKLRILN
FT                   CHQHTETGDFLGGFRPTRPTGAEADDVDGEEGADGVVDKKGAAPFAWEDGPLIKAMRDG
FT                   DILLVDELSLAEDSVLERLNSVLEPGRTLTLPEKGGSEVEELVAHPNFLLLATMNPGGD
FT                   FGKKELSPALRNRFCEIWVGATGDASEMEQICVRRIPEPELKPYAGHLARFWEFYREIA
FT                   GRGAARAALLTRDLVAWAQFVRAAATGAGSAASGCNRRLAPAEAFAHGAYLTLLDGLGL
FT                   GLGLPEETARGLAEQCKKFLRDELPPEVSAAANPGGDHLAAATGDGAFIDRDGIFGIAP
FT                   FAIPRGSATTPKTMSFELSAPSTRRNAARLLRAMQLPKPILLEGSPGVGKTSLVSALAK
FT                   AAGHNLVRINLSEQTDMMDLLGADLPADGGAAGEFRWADGAFLAALKNGDWVLLDELNL
FT                   APQPVLEGLNAALDHRAEVFVPELGETFRCPPTFRVFAAQNPVQEGGGRKGLPKSFLNR
FT                   FTRVHVEPMERSDLVHITAALYPTVPRLVIERMVHF"
FT   CDS_pept        complement(394676..396997)
FT                   /codon_start=1
FT                   /gene_family="HOG000200841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640386"
FT                   /orf_name="MICPUN_60602"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69419.1"
FT                   /db_xref="HOGENOM:HBG562256"
FT                   /db_xref="UniParc:UPI000199C4CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR4"
FT                   /transl_table=1
FT                   /translation="MEDSNPNMTPRELWQRAVSKVAAQRIVDDGTQDGAAFARVVKQRT
FT                   FIRMVNSESAFKAAFGARSLRNSLSLSSKKLVAKEAGDDNFEGIGASSSSVVRPSAGAQ
FT                   FVPEAEDSRADSHAEGNLEKAERVARYVRVEASEEEGCLRVASAYSRRFYLSPNSKFNY
FT                   SQFFRSFLYEALSFPTLQWIAVLVVETLVFGHTVEEAMYCAGARFFAPIPIIGERMRKA
FT                   FRQIDKSANLMFVLGPVLFVIPPLAVFADLGETRKYIEPMELLPLLLMVLVQCGVISCK
FT                   YGILPASYTSDAFGKIYQPMTPEDLNRTLILGAWNDPKNEKHFDLLKMEMENACLEADV
FT                   DLNHTEINVGSAHAARAIRMRSRGIGERSEKRMNETPETVSGKELMAALVDVHIGRQLP
FT                   SELMPFIMLISILYGLTGPVMRAWCGVPMFGGTHMSKFAAAGLFIASVMMFMANFSFAA
FT                   TCAWHYRRQYDVMEALSQMVRFPGEPLINFLPPKPKPNSKKGKIAPVKAISGAIIALNS
FT                   PVPQQGGQPATKAKEDDDEEKESEELRELRRAAKTDEFDVVIDLKDPASCLCWSLVRRS
FT                   MRHMGSSWARRMNLYSVIFLLAAFFSAGMILGLYFGANRINHRLATAASCYFLAIMVSF
FT                   LVSLTVYEAAAINEMVPRVRSWLKRESVAIVAQMAYLGNGWGRSGTDDRDKQEAEELRG
FT                   AYRLIETVEQYIRLEEEESQPVEVFSKIKATPAAVTFVVSSLLSMLLIAMQRGFTMMES
FT                   EGWSYDGKNGEFAMDPSRQE"
FT   CDS_pept        complement(397097..399877)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640387"
FT                   /orf_name="MICPUN_60603"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69420.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG609783"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR011666"
FT                   /db_xref="UniParc:UPI000199C4CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR5"
FT                   /transl_table=1
FT                   /translation="MDSDSEDFIVVGTPLEQEEEARGYRKKVTDLAVTKALPVHKQEAT
FT                   DAEGRRRFHGAFTGGFSAGYFNTVGSKEGWTPQQFTSSRANRAKVTQTAEDFMDDDERE
FT                   EMRATALEARDDYDTFGTAAELRAQRAMAASEATGDGGRRKVYGPAIIPGPVPSDLVVP
FT                   TSDPVGARLLRLMGWRRGKGIGRGGARNGNGGDGQGDGDGDGQGDVNDENGGSRRSRWG
FT                   KSATALVDDTPRYVLHPKTNLHGVGYDPFEGAEEFRKVAEARAVRRNADPRGLGSVRPN
FT                   RGEAFGVGVFEGDDPDEDVYRTRTLGGDEIGHTYEIMSEEEDEEDEEEKKGEDARRRGG
FT                   GKDGRRSGEGGVGAVRGFSLSADTLAPATWYPPPVVPKSFRAFHVFPPGTEPPPFADAS
FT                   RALAKPPPRAPPPPPPVPPPSDAERAKFIDTTAMFVAKNGPAFEAMARERQRGDPKFSF
FT                   LFGGPDEGYYRYKLGECRRELGAGTGAVTQWASVALGEARPKPLDADDRARMLGETPLP
FT                   ATMKGGGLARPLSAAPPPGTKVPEKQPETINVKGIAAADRSRIQANLGSMFTSGSTLET
FT                   QDMGHGSRALKPGLTMASSFVSAGALEDPKEAREREERAKLAPIVNSRVSRDWAPESLL
FT                   CKRFDVRDPFEGRAKPGAVRSFKSDSIVLTETVAAATAAAPKFLPPTGGDDRVLEVPPP
FT                   PPPRRVPASVMPPPPPRSHPPAAPTASVQTLNPALQTPVVPGGDLRRYSTGAWGSRPVS
FT                   APPAGEPVPSAAGDGVGPGPVSAREPSVREEAESFLDSLGIVPERPMEFFKAIFDDSDE
FT                   ENDPPPPPRRRERSPDRRERAIGTMESASLEGRRPVEAPTDVVSGPAPPPGGVPEKRHR
FT                   ADDDDGRSSKKAKKDSKKKDSKKKDSKKKSKKEKKSKKSKRSRRDRSDSSSDSDS"
FT   CDS_pept        join(400123..400170,400313..401035)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640388"
FT                   /orf_name="MICPUN_60604"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69127.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="HOGENOM:HBG741588"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniParc:UPI000199C4CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR6"
FT                   /transl_table=1
FT                   /translation="MQQAALRRAARAALTQVGAATSRRAVPSMASSVYTAAAAPTARTA
FT                   VASVAKAASSLPANPGTSRGFAASAGTIAEAASALEQQYATPLQALHWLIAGGTVGTFA
FT                   FVQLAMNLPKDQAAEKGRFMMLHKSLGLCVLGLTIPRLALRLTTKIPAAVPGSKAEQIA
FT                   AQLGHLVMYGMMTAMPVSGFIMGYYGGRGLPFFGYTIPGASKRDGKLAGRAFKLHKQLG
FT                   WYYEMFVPLHVGAVGMHAIKGQNIMRRMGVTAFG"
FT   CDS_pept        complement(401064..404837)
FT                   /codon_start=1
FT                   /gene_family="HOG000218168" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640389"
FT                   /orf_name="MICPUN_101824"
FT                   /product="Type II secretory pathway family "
FT                   /function="ATP binding"
FT                   /biological_process="intracellular protein transmembrane
FT                   transport"
FT                   /biological_process="protein import"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69421.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017038"
FT                   /db_xref="GO:0065002"
FT                   /db_xref="HOGENOM:HBG284200"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="UniParc:UPI000199C4CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR7"
FT                   /transl_table=1
FT                   /translation="MASTAAVGVQATARSPWARGGGRGELGSRHRVGGSQRPGPPNRRI
FT                   SSRTSTTAAPRAAVDGSAPTQDELPDFAKARRPLPNVRDVVKNPIKFASDLTDAIPKGA
FT                   DRVIDQKVRQVVVPANRLEDAMRALSGPELAAKTDEFRDRLKKGETLDDLLVEAFAVVR
FT                   ECARRELNMRHFDVQLVGGALLHDGCICEMATGEGKTLTATLPAYLNALTGKGVHVVTV
FT                   NDYLARRDAEWMGRVHQSLGLTVGIIQTDMEAEERREAYEADITYVTNTEVGFDYLRDN
FT                   MANEAHELVMRRGFNFAIVDEVDSVLIDEGRNPLLITGPATEGDEEMNKYTVASQVAAQ
FT                   LKEGSDYVVDRKQKTADLTERGMMVAEQLLGVSDIWDTYDPWGRYLLLAVKAKSLYLRD
FT                   VHYIVREGQVMIVDEGTGRVQPNRRWNDNIHQAVEAKEGVEIKRENTTVASISYQCLFK
FT                   LYDKLSGMTGTASTEAEELYTTYKLSVVTVPTHRRNMRVDKPHAMFRTAAARWNAVADL
FT                   IVSCHWEGRPVLVGTTSVEHSEYLSRLLAEYRWQSQDGKLVNGVPHKLLNARPQLAAKE
FT                   AEIVAQAGRAHAVTIATNMAGRGTDIVLGGNPPGLARLFLERALFPKLSVGTPEADDAS
FT                   EPNPMATVGMSPKTEAAVQAAVGLAHVTAKADGAVPVSPDAVVALVTEAVEYAEQILRG
FT                   GAVREAAEAAAAEREKEIGGPNPVMNALRHAAVCLLEDCTAQCEREATLVRDLGGLQVI
FT                   GTALHDSRRVDNQLRGRAGRQGDPGSTIFCLSMEDELMAVYCPGWASSSVWDWSGMDDD
FT                   TPLFSDVVDKQLAGIQASIEDFHATHRTSTYETDRIIDGQRDAIYNVRRKVLEDGQQPL
FT                   RARLLRYIEWIVDDACDRAKVDGLRPIDDWDIEGLLDDLRTVFAGRRDQWLNESGQTMS
FT                   EFPHFLPGVDARGIRDALKSKGAMPLQTELPGLEAAPEVVAAALRGVDVVDMNPPAKPA
FT                   RVVDTEPEAAEECIAARVEKRMEITKGMKSLEDYGRRGMNAAEGRMLRTYLSESAIALY
FT                   LDRFARLNQRYDRTDLEAVERVWVLRAIDDRWQRHLVEMQVLRSSVNVRAFGQLDPMEE
FT                   YRIDGARAFVDMVRDMRRKTVANVFFFVGSAVEPTLDFEEVAAEEAAAVANPAAAEREA
FT                   EIAKVMQATGMTAMADFISKGDDAEAETVLVEAQRQAARAGKKLQAMDDGEQKKMMEEA
FT                   ERVLAKQRALIEEEEEEEDPDGDSDGSVTYKF"
FT   CDS_pept        405076..405843
FT                   /codon_start=1
FT                   /gene_family="HOG000024463" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640390"
FT                   /gene_name="YCF4"
FT                   /orf_name="MICPUN_104909"
FT                   /product="Photosystem I assembly protein ycf4 "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="thylakoid"
FT                   /protein_id="ACO69128.1"
FT                   /db_xref="GO:0009579"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG439339"
FT                   /db_xref="InterPro:IPR003359"
FT                   /db_xref="UniParc:UPI000199C4CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR8"
FT                   /transl_table=1
FT                   /translation="MSSALASAAFTVRAAPTRATARTTARASLVAKAPAGLRATLPARL
FT                   SKSAGVSVSRRGVVTRADGAATRDVSVKTNTDNLIIDPVVGAKRFSNYFWAGVVSIGAT
FT                   GFLITGASSYFEHNLLFFLDASEIKFFPQGLVMSFYGVAGSLLATYLWLTINWDVGAGY
FT                   NEFNKDEGIMRIFRYGFPGKNRRINLVTPLQDIQAVRVEIADGVNPRRVVYVRCKNKSD
FT                   IPLTRIGQPLTLAEVEKQAADLAKFLQVPIEGL"
FT   CDS_pept        406059..407630
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640391"
FT                   /orf_name="MICPUN_60607"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO69129.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG562258"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199C4D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFR9"
FT                   /transl_table=1
FT                   /translation="MAQAQALACARGLRHARSFTAARARRDAPVRPVPAAAGTARPYGA
FT                   HEGRARRMESERDATGAVAKNTLHGANHPSLSLRLVTPDGDRLDAGVDFNLHAWPPVPC
FT                   AKYFDDRAWRAVESFAARVVLGEACVSSLAPGEMEPAGVCPGRGVNQDGTRIETLPMRT
FT                   KGSRGRRTNVRVHLAYYGPAFTGWAWTPENDKDYTDCPRSADATSASASANAEDDAEDD
FT                   AVDAARGSSTEWRYGERSVSASIQRALRPLFSSDKERLIHSAGRTDKGVHAAAQCFSVW
FT                   SNAKDTFTPRNVRDALVAHPAHAAGAWRVVGDVEEVSDAFHATFCATWRRYVYILPMRS
FT                   LGDEEENGLSNVAVDPAATNAMLNALEGKSMDMSAFARATPPGKDSTCFVKVARAFEAT
FT                   VPASKGAERGVGRGARRRKSAGFSEDGGLGVGGGGGGDGGPPNSTMERVLVVELVADRF
FT                   LRKMVRTLVATAVREAATGARGDVLLRLARAGERAATAPPAPPEGLIFAGVGYGNHPVW
FT                   DVGGRD"
FT   CDS_pept        complement(407777..409615)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640392"
FT                   /orf_name="MICPUN_60608"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69422.1"
FT                   /db_xref="UniParc:UPI000199C4D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS0"
FT                   /transl_table=1
FT                   /translation="MATPRARRATTPFGQAVRGPNPSQIVESTILTANPENLTRRDPSP
FT                   SPAQRRTPAARPIYSDSESSEDDLWRAPASVLLVDGTPGRGAMRAARQAETMEELEIDP
FT                   PPARVSSSSGRAGPSPRSTPGYDPGSDDGMEYEDSDLEREADEYRAMLVGASGGGGRVF
FT                   RNIGAFTTPKPRGADGSSSRRGFRGLSPGASFGSAGPVRGSLHRPSPTSSGGGAPRAVD
FT                   FETTAAREGVGDGDGRDGGYVAAEEFSVKEEFEAIRRELAEIKSNMSSPATAAATPNDG
FT                   GGGGGVHLDGGTPGRGEYPHGPHRASVGSFGGSVARDVHSGGGVVRQQQQQQQQQQQQR
FT                   RDSNASTDGGGKRGGSGHVGSHRSAGSSKTSARHRSGRKVSSEATGTGRLLFGDDDGDR
FT                   SGGVGGEPASAAREPGVGADDSVRRRGRESGAVNRRHSTGEDEAPGSNDSSLNRHGGSG
FT                   PGSNESSFRHGASFDRTRSQSPRESTRVRATTRETAVNTDRSEAEEGGGVPGRSPFPAE
FT                   ESPSRKSAGREVSGGESVVVSALRLFALILLLVGTWYMVLVIVDVIEEDFLSGRLPRSN
FT                   LFLDSLTSLTRTPLEFLTGKRSWDGLDDDPPFAAPT"
FT   CDS_pept        complement(409783..410091)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640393"
FT                   /orf_name="MICPUN_60609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69423.1"
FT                   /db_xref="UniParc:UPI000199C4D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS1"
FT                   /transl_table=1
FT                   /translation="MDASLIAPQLFALVFILGAAAYLQVFVTGTARARFDKADPARRAF
FT                   VETDGGESSEPGWVERELARKGGTRPRGDRTKGGTVIPGVGDAPEWMRRGEDDELDS"
FT   CDS_pept        410324..411499
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640394"
FT                   /orf_name="MICPUN_60610"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69130.1"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniParc:UPI000199C4D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS2"
FT                   /transl_table=1
FT                   /translation="MEWSAARAPVWQLGQVTAHFGCDNVASPSVYMLAVGAPSRVLAPR
FT                   RAPRGAVRRAVPAKKPPLVIRAASHGDDAPADASARRPRLVDPSNESKKRVTTTGAKRA
FT                   VETCVACGGVGVVECRACGGKGTLAAGGFHAKNHVDMANVVGTNWTAHRRTKGWRHFEC
FT                   IGKSPADKANGKPRASVHLAATCDRDVTVWVDVKELKDRHLWSAGWKQREDLDWIGDPD
FT                   QPGGAVAVPKPGAPCVACDGEGRVPCQRRGCVNGAERVRKQREVIERTERTFKKVIKAT
FT                   RGEGTEGEAGEAAAELRRRMKRQLKDMAKAKPGGRAGRDRGDTVSRGNNGNGEEDWGAW
FT                   GRRRRDEKLDKWMRAGAVPDEDWPEDDEKKPRSRRRERRRRGRDAGWDDQQ"
FT   CDS_pept        416703..417404
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640395"
FT                   /orf_name="MICPUN_60612"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69131.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000199C4D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS3"
FT                   /transl_table=1
FT                   /translation="MTGSTIQAARSSSGGAFRRGGGFRGAPIAFAVLILASLVRSADAL
FT                   KVTIGGHDKECFNLHADRSGDTFVGSFNVVEDGTASDVFDMIVKDEDRSIVYSFKHSSE
FT                   HKFEFNTNRDGAHEFCFTNNKGHPHTLYWDVNVGHHWAHDAATDAHVDELQMSLDSMRE
FT                   MYYKLRSEVIYQKHREAAHRRTADTITGRVMGFSVLNTAVLIGVALFQAYYVKQLFESK
FT                   RRGSMSTMRSV"
FT   CDS_pept        complement(417568..419199)
FT                   /codon_start=1
FT                   /gene_family="HOG000269479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640396"
FT                   /gene_name="HEMG"
FT                   /orf_name="MICPUN_60613"
FT                   /product="Protoporphyrinogen IX oxidase chloroplast "
FT                   /function="binding"
FT                   /function="oxygen-dependent protoporphyrinogen oxidase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="ACO69424.1"
FT                   /db_xref="GO:0004729"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C4D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS4"
FT                   /transl_table=1
FT                   /translation="MALSVTLSASAVATTTGGRFNVKRTSPGRRAARPAARGLVVRVAA
FT                   DSDYDAVVIGAGVSGLSTAFTLGRSSPGVRMLVTEARDRVGGNITTKNENGYIWEEGPN
FT                   SYQPGDAILTVACDAGMRDDILLADPNSDRYVLWDKELRALPKDIPTAVLGTFLTWPGK
FT                   IRAGLGAIGIRPPPPGKEESVKEFVSRNLGTEAFERLIEPFCSGVYAGDPAALSSVAAT
FT                   GRVQRLEPLGGSLVFGALKAQKEAYDAKKARGPRDPRLPKVEGQTVGSFRGGLKTFPEG
FT                   LAKALGSEKVKLEWKVTKIAKRDDGSFAITYDTPDGEKQITTATVVMTAPAYVTADTVQ
FT                   DMAPDAAAALRKFYYPPVASVTVSYPEDSFRLDGTSALPGGGLTGFGQLHPRSQGIRTL
FT                   GTIYSSYLFKDDKRQPEGEFMILNYIGGARDTGITQLSDEELVKAVHEDALKTILKPGT
FT                   PLPKVVGVKVWEKAIPQFNLGHLDVLAEAKAGLAKAGCDGLFLGGNYTAGVALGRCVEF
FT                   GVEQAKDLETYLSKQSAKKGASVPAR"
FT   CDS_pept        complement(419479..420345)
FT                   /codon_start=1
FT                   /gene_family="HOG000264306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640397"
FT                   /orf_name="MICPUN_84437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69425.1"
FT                   /db_xref="HOGENOM:HBG600357"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniParc:UPI000199C4D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS5"
FT                   /transl_table=1
FT                   /translation="MWFGESCVGATFYVGRVVHTRSKPLKRVFAYPMRFAVIDLDSPPS
FT                   WFTRSGQAGDHLSADEVRERTGHDGPVRLFTLPWAYGYVQNPISVYYSYCLGTDAGEER
FT                   MHDAAGKSRKFELKTCVAEVTNTPWGERVRFNFLPGGTRAPKSLHVSPFMDMQGEWQLT
FT                   ATDPEEDFQLMVSVKGHPKFGDYFFAKLDARRDQSAPHARNERSGIWRLLQHACTPHRV
FT                   AFWIYAEAVCLLSKGVSMFPPPGLEFVAKAACRRGEVHEIGSGDFVGMNCPLRSTWHAA
FT                   RAWPWRT"
FT   CDS_pept        join(421056..422573,422640..>422912)
FT                   /codon_start=1
FT                   /gene_family="HOG000266721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640398"
FT                   /orf_name="MICPUN_84426"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69132.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199C549"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS6"
FT                   /transl_table=1
FT                   /translation="MAAKVVPVPAYPPDPSAPPSKFRAQVRALEEIAERAGATLALTTR
FT                   AYDAARRCAAARLGVRDLAEALRRGRLRAGNDAGGGPKSRTTLEWTSLSALATGSNRKC
FT                   RLSDDDEGGARCAERCSSKQLRVDGGAADDSGVAFVQFTSGSTSRPRGVAIGHRQLSHN
FT                   CALIRQQFGVKVDDANVSWLPQYHDMGLVGGYLVPLTIPPEPGAKPAEVTSAFLSPAAF
FT                   IKDPIVWALAMSKYGATMTQAPDFAYRLCAERFALERSASSSPRPGELNLSKLRRCLNA
FT                   SERIDADTAMIFSRAFEDFGFDVRAMSAGYGLAESVVYVCDGGCSHETVSARRLECDLI
FT                   AECVRFDSRGLKSFKSFDPDDARRVASCGAPRGDVKVLVVDPQTRLTLQDGRVGEVWIA
FT                   SPSVARGYWNETSPRDDDSPNGPPRAHYSSPFGATLAARSTLFRRGFAAEHEKERYLRT
FT                   GDLAYMRRGELYVVGRLKDLIVIGGRNIAPEDVERTVRETRWSHRGRGAGNGCNGCNGC
FT                   NGHVVRESLAVVAEVRDGVELAPADLGVIVDGIIRAVAKAHGVTMPRCHVALLRKNAAP
FT                   RTTSGKIRRGECARRFVAREL"
FT   CDS_pept        <425408..>425629
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640399"
FT                   /orf_name="MICPUN_73974"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69133.1"
FT                   /db_xref="InterPro:IPR019370"
FT                   /db_xref="UniParc:UPI000199C54A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS7"
FT                   /transl_table=1
FT                   /translation="DKEDEDMFYEEGLDDKDQAFVDKLRGGRQSDAVLSCPACFETVTL
FT                   DCQRHYKWEHQYRAMFVRNVRVDTKSHLK"
FT   CDS_pept        join(complement(428238..428363),complement(425838..428120))
FT                   /codon_start=1
FT                   /gene_family="HOG000272269" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640400"
FT                   /orf_name="MICPUN_60617"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO69426.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG361197"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C54B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS8"
FT                   /transl_table=1
FT                   /translation="MTIIQSFALLLVWAALLAYAAYRGYKIFITLLVRALRWVPHRATS
FT                   PTPFGARFASGILRSFSLDDDKFFCADGAPEEIAKKRRAGMDNLARSFDEQFAASQKAS
FT                   ETVLDGISDLRFTDTNRVPFPFQKLVRERLNVATLALSSEGPHIVDLDGNRSLDVSGSY
FT                   GVNVCGYDNYKRWMEAGWRRTKDLGPVLGPLHPIVGENLAMIKAVSKLDEVSFHMSGTE
FT                   AIMCAVRLAAFNTRRKLVVTFAGAYHGWWDGVQPGPGNERKITDVLPLKDMSPASLNAI
FT                   RARKDEIACVIVNPLQGFNPNSPPPNDLVLMTAAIRKAADSATLDHYAVWLKELRKVCT
FT                   ECEVPLMFDEVYTGFRMAPGGAQQYYGVHADMVVYGKTLGGGMPCGVVCGKRELMRRFD
FT                   PERPLRVSYVIGTFAAHPLTMGAMNEFLRWVTTPEAEQVYEKIGKQFEHWIKDVNDEMK
FT                   AENLPLSVHNLTTVWTVIFNQPGRYHWMFQYYLRDEGIALSWVGTGRLLVSLDFVENDF
FT                   ELLKKKLVNAAKRMRDDGWWYLGTPDKPITAQSISAAMGKEMAYNTVMKTVREGLLAEV
FT                   LCLPEQHGPRAPKAVPPETLQEFYEEVMRRKEDDHAASHSNTVNQFMHLISSTIFIINY
FT                   YTIWSNCTATMATGLFSLFLRQSGHAIFEPPCHDEEELLLGFNTRSKCFVVAGYTLAPL
FT                   ISLLRLSNDVGFFLALASIARSWLGVTLFFVLGHTGLLWMQYGFRISMVWLIKLVTDPF
FT                   TDVLVYYPSAVTVWTTKDWQTATWDNFLSHLRGEPKDDGAKSAEEKKTQ"
FT   CDS_pept        429507..430418
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640401"
FT                   /orf_name="MICPUN_108755"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO69134.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199C54C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFS9"
FT                   /transl_table=1
FT                   /translation="MDWHDPPRCVVLPGMRPRTELAGVYRATDWVCSASAFETFGNVPY
FT                   EAAHCGTPALLQDAQGFKDQIDANESRGALLEFDAEDGEQLCAAAMGRTSRLLNAPHVV
FT                   RSEARRMANRGTCIHAVVSEVVTKWSAGPVRKRRWIYLACAIWSSLVLASILQVMSFFM
FT                   RLGVAIGVDFTTGMKNQRMSKQRWALRKTPTSTVELARMRSLVHADALGTKQKGIPMGD
FT                   DEEESGRRSPDENVAPNGFVGGGEQRSRANRKFRRGSPPKVTFAPNTPEPTPMWRRSSL
FT                   DGPSHRASVRPVFPVRVFLAGF"
FT   CDS_pept        430602..432332
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640402"
FT                   /orf_name="MICPUN_60619"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69135.1"
FT                   /db_xref="UniParc:UPI000199C54D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT0"
FT                   /transl_table=1
FT                   /translation="MRSAVYAKDLVDDDYGDDSYGEMQRATPPELADAHRRVPEAAPPD
FT                   AMFHSKRTSTLRAVTNAWWSHMKYILPFSIGVIMVIYSLMYYAHAKCTASLTREAFELG
FT                   GQSEITRRWMRCFTPNFSDDEFRPLNSFGDFSVYVIRYTKMWSVFSADNNFFVHMFAWN
FT                   LLARNRTWKTRLYFVWFAIFYVTPLIDYQVTGYRHMTSWYVQIGCQVFGWITCLAAKET
FT                   RDMPTMSWWFVYHGMAGITYIFALRNLAIGDDDSYSLKLKLLVRFVFDPLMWEAMKTAQ
FT                   RHVAMMNPSPGPGLNTAGIMAPIVSQAVYSRLLLFLLTNDGKVSVITLQLIISLNELMM
FT                   KLTLKHRDGFFTRTVMGTMAGDALLSSSKMDELHAVSCLADVFCELGAIAFITPLMVVF
FT                   NLPSTGDLPDGKTRTSNYDDMAWICFQLAAMEIGMSFVNTFAQYRFHSIDIGRVFKKSE
FT                   AAYRREVKLSRPNGRGGRTYLSYKFLVYTVMAVFFATCALNTVMGTMWTLRMCPRVRKD
FT                   GHVYFRACLPTEEKHLPGGSSVKGPGILAYNFDWPPWKSPYAVDTSNQTYTYEQFRSEL
FT                   "
FT   CDS_pept        complement(432398..434170)
FT                   /codon_start=1
FT                   /gene_family="HOG000238311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640403"
FT                   /orf_name="MICPUN_101833"
FT                   /product="Predicted protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69427.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG406925"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="UniParc:UPI000199C54E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT1"
FT                   /transl_table=1
FT                   /translation="MRVRLLLAFALVLLAGPASAARAAKRPRHPARTYVPTSENLRKVG
FT                   GFSPGWTPLEACQERYRDAPLDHFSWAAPTQTYRQRYFFCPHFWEKKRDALAAAKRRHG
FT                   SAKAQPRLRGVASLGADGESSPLDDLDAGFTKSGPPIFFYTGNEANVELYLNATGLMWE
FT                   HAESFGAVLVFAEHRYYGESKPKPKEEDGNALDASNLGGIIPGHLKKKGQYPYLTSEQA
FT                   MADYATLIRELKAEIRAPDAPVFAFGGSYGGMLATWMRLKYANVVDGAVAGSAPVWSFV
FT                   GEDPPVDPGAFADGVTMDATAAGGSPPACAPNVRAAFAELLRRSETDPKSIKAPMRLCD
FT                   DTPLGSPTDVLDVALWAQGAFDYLAMGNFPYASSYILNGDGTLPPYPFRVACGGAMADP
FT                   KLLNKGGDALLSALADAVGVYYNYSKTQECFDTRHGSNDDSDEDGELWDYQYCTEMFMP
FT                   MSRDGVRDMFFPQPWNETDAVLECERRWGVRPKTLWATTVFGGRRLSWASNVVWTNGYL
FT                   DPWAGLGVQESLSPSLVAMMLPGGAHHLDFMWSNDLDPEPVVEARKTQMRLLRQWILNK
FT                   YQAVAARGETIAEL"
FT   CDS_pept        join(434333..434644,434805..435554)
FT                   /codon_start=1
FT                   /gene_family="HOG000028298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640404"
FT                   /orf_name="MICPUN_60621"
FT                   /product="Predicted protein"
FT                   /function="prenyltransferase activity"
FT                   /biological_process="menaquinone biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69136.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0009234"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG313998"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="UniParc:UPI000199C54F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT2"
FT                   /transl_table=1
FT                   /translation="MERRSARAAARAGNGDATHPRSKPKASRSSKVKGGVAGWVSAARP
FT                   KTLTAATVPFLVGSALATTGGGEARWMEATCALVGYFLIQIGTNLVNDACDFVRGADTE
FT                   DRAGPTRVTQSGVFSPRAVHIAGVTCFALAAFAMCPAVALRGAPMARLVVAACGAGYAY
FT                   TGGPLPLGYHGLGDVTVIAFFGFVATYGMARVHHDGTSADGSGGSSWERNWPLIVASAQ
FT                   VGSLAASLLAVNNLRDARTDARCGKNTLCVLLGEGFGRWEITFLVFAPFLLQPYWAWEG
FT                   ARRLGVTMFPSVASALPAATAPLAAWVARETWRLEVGDAGFNGTLSAAAALHLLFGSAL
FT                   ALGLALDGVAWRD"
FT   CDS_pept        join(complement(438756..439441),complement(438558..438680),
FT                   complement(435639..438477))
FT                   /codon_start=1
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640405"
FT                   /orf_name="MICPUN_84330"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69428.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C550"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT3"
FT                   /transl_table=1
FT                   /translation="MDSFRFGHAKHSESRVVYVTADASAHGPNAGFRFKGNAISTGKYS
FT                   PITFFPKGLYEQFRRIANLYFLSVAIISLFEAISPIKPYTIWSPLVLVVGLSMAKEAVE
FT                   DYARHKQDHEQNTSLTERFNGTSLVQCEWREVKTGDLVRVVRDQAFPCDLVLLASSLDD
FT                   SVCYVETKNLDGETNLKIKRGVEGMGGVGTGPTKMRELCGDGRDAYVECEHPNNSLYTF
FT                   TGNLDVPEKISLVPSNILLRGSSLRNTEWVIGLAIYTGHDTKIMASASSAAPSKRSTIE
FT                   KGMDKIVISMLGLLCLMGTITGIICGSWIKNVSPKHWYMDTSDTDMVFDPKNAPKVGVV
FT                   AFLTSYVLYGYLIPISLYVSLEFVKVCQAMVFLNSDRQMYHEETDTPMRARTSNLNEEL
FT                   GMVHTVLSDKTGTLTCNSMEFFKCSIAGVSYGEGVTEIERSIAKRQGRPILTKPTKPIE
FT                   PGFNFKDARLEGDKWRSLPDAEHIRDFFRILGVCHTVIPEGEATRETICYQAESPDESA
FT                   FVVAAKRFGFFFKSRTTSGMELEEPSFPSSGEMSTVHYELLNVLEFNSTRKRMSVIVRT
FT                   PEDKIMLYCKGADSVIYDRLSHGNQKYTDVTQQHMDEYAKCGLRTLCLSVREISQSEYD
FT                   AWNVTYTEAAQSLEKRDEKLQAAAEIIEKDLFLVGATAIEDKLQDGVPGTIEQMMRGGI
FT                   AVWVLTGDKQDTAINIAQACALIRDDMDVHIVNIEELVKQEHDREITRAQFNEQGKVQV
FT                   AALIEEGIEKEAATAKKGMETCLVIDGRSLSFALEQDLAPRFLQLGSGCTSVVCCRVSP
FT                   LQKALVTKLVKDSGKITLAIGDGANDVGMIQSAHIGVGISGQEGMQAVMASDFAFAQFR
FT                   FLERLLLVHGRYNYKRISKMVTYFFYKNLAFGLTLFMYNLHAAASGQVVYNDWLMSAFN
FT                   IFFVAFPVIALGILDQDVNQRSCLQFPQLYRQGQQNACFERRVQLGWALNGVYIGMVTF
FT                   FVVFYAVHGGEADHPKGHVFGLWEVGTSLYTGIVITINLQMAQMINFWTWIQHVCIWGS
FT                   IAFWYIANCILSNTDPYLSTYSYKIFIPTIAPTPKFWMATPLIVVIGLLPDLLYRTLRR
FT                   LFRPEPHQLVQEYERTVRGTTPRSSAANTPMDTPRHGSRYGSSAVLAEEGRIEVDEPEE
FT                   GEENIEPDEPAELDEPAEPEEPDPNEVERSDEEAPPREAEEEKKADESA"
FT   CDS_pept        439696..440526
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640406"
FT                   /orf_name="MICPUN_60623"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69137.1"
FT                   /db_xref="UniParc:UPI000199C551"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT4"
FT                   /transl_table=1
FT                   /translation="MSRRLRSAWSGSPQLDNQGPINRTHWLIQKTRDSPGDNHTSAIAM
FT                   FAGEEEALMADPNGLSDYELERIERIRRNREIMKRLGLGDHDIVSAARQRCGVEEGKEN
FT                   ASGPTENKKRKAPAAKKKHEIPAEERATRRSRRIATKDAEHAGLGDDHEETETYIVGRG
FT                   EYAVEVDGAHEAEAEAYRLRNAGIQERVSVVGTASYQHTLMRVRTMSEPALGNRVKAIE
FT                   RAKGKHAVVKMKLFARVLFLEGYEELSTLATESLERLVAELGDPDVDGEDGDAE"
FT   CDS_pept        complement(440632..443655)
FT                   /codon_start=1
FT                   /gene_family="HOG000008829" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640407"
FT                   /orf_name="MICPUN_84399"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69429.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG413876"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniParc:UPI000199C552"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT5"
FT                   /transl_table=1
FT                   /translation="MAPAVAAIAALKPGAKLADGAFEVLAVNEVPEYNVACVELVHLKT
FT                   GARWMHCGADDPNNVFNVAFRTTPTDDTGVAHILEHTALCGSDRYPIRDPFFNMLRRSL
FT                   STFMNAMTAADFTCYPFSTMNETDYYNLLGVYLDAAFFPKLSREDFLQEGHRLEFKDME
FT                   DKNSQLELKGVVFNEMKGAMGSQAARFNRALGATLFPTSTYHHNSGGDPVSIPTLTHED
FT                   LTRFHATHYHPSNARVFTYGDLPLERTLAKSQELALGKFDRIDVSALDVADERRLTAPV
FT                   KVEVPVPADPVVPDPNKQSVVSVAYLMVNQIKEKEAELENFALTVASDLLLNGPQAYFH
FT                   ETLLESGLGSGFAPGTGYSSSRRETSFAVGLKGVAEADVTEVEAKIQGTLERIAKEGFP
FT                   KERVDAVMHQVELGAAKVSTNFGLGVAFGAMGTWVHGGDGMKPLKIPVLAAKLQAAIDA
FT                   DSKYWQKLIQRRFLDNSHRVTVVGVADKDYDAKLEEAEKKKVAEIEKSLTEEQKDTIVK
FT                   EAVALRASQDGDQNADILPTLKVSEAVPREIKHWNSLITKTSGGFDLQIDAQPTNGITF
FT                   ANLLLDVSDLPDRLVPYLDLFADFITELGTKTMDYKALAQEEKLKTGGIGAGVNVQQSL
FT                   DASAPPRVYVSLSGSALDRNVPAMFQLMADVATGAKWAGEDARLGLLLSRRAASAGAGV
FT                   SQNGLSYAKGLANASIDPVAALDYRTAGLPHVALLQRLAREKEAGVEEVSAALAEIAAF
FT                   ALARNRVMRCRISAKPEACDPAVKQMEAFIDALPLRGADAVGDELTLAQSLASFAVAPS
FT                   KTFVATPTQTNYCAASYLTVPYSHPDSAPLFLLGQAMSTSFLHREIREKGGAYGGGASA
FT                   APVEGVFVLSSYRDPNTTATVETFEKAATWAAKEGNLTQEILEEAWLKAFKAIDAPLAP
FT                   QSRGASLFTNLMDDESRQLFRDRLLDCTPGRMRECAEKYLVGKTPALAIVGNPASVPDV
FT                   KKAGWTCVDAEGNPLKEE"
FT   CDS_pept        join(444126..444626,444747..446252)
FT                   /codon_start=1
FT                   /gene_family="HOG000241868" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640408"
FT                   /orf_name="MICPUN_84071"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69138.1"
FT                   /db_xref="HOGENOM:HBG749438"
FT                   /db_xref="UniParc:UPI000199C5E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT6"
FT                   /transl_table=1
FT                   /translation="MLRRLCSRANPSRARWYPTTVPSGWAPAIANALVNAGLGVNPRGG
FT                   ATRVAAATGRAPLVAACTSGRDPAFTPSAGPLAPAFARTLSGWTPASGGGRASPTAAAA
FT                   AKGQSKSHGAEIDVREVLKGLPSICPGCGVGLQCEDKNGPGYFVVPKRLLEPERDADDE
FT                   GGRFGLGDDDLDADEDDDDLPDFDGGDFDGDDQTETGDPTPSEADALAALDALFDGDDD
FT                   DGADVDGDDWESIAARKRAEREARRRESPETVVCARCYSLRNYGKVKNEAAEILMPSFD
FT                   FGRVVGDRLSRLGPGGAVVLCLVDLVDFDGSFPVDAVDILSPYVANESVDVLLVGTKVD
FT                   LLPTQCTRARVTSFVRRRAKDLGLRRASGVHLVSAHSGMGVNILSEQLETLLDEGREVW
FT                   VVGAQNAGKSSLINRLSKKYGGPGPEDGGPLASHLPGTTLGVVKLPGLLPNGSDVYDTP
FT                   GLLQPFQVSGRLTAEEARAVLPRKRLAPRTYRAEIGSSVHIGGLARIDVVDGPQRTLYL
FT                   TVWASHDVPTHYMVKGEGGKADAFYEKHAGGKLSPPVGENRVAQLGEWGCRTVTVYGES
FT                   WQRSDRDISIGGLGWVGVGVSGNASFRVWTHEGVQVETREALVPDMSRDLCRPGFSDEQ
FT                   QPGGGGDRARPSKRIMRKGGYRAPKKSERKFKL"
FT   CDS_pept        join(complement(446406..446863),complement(446344..446350))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640409"
FT                   /orf_name="MICPUN_60626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69430.1"
FT                   /db_xref="UniParc:UPI000199C5E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT7"
FT                   /transl_table=1
FT                   /translation="MSACSAACPRWAPAGPRRVRDASRIGSSGDGIEGVPQEDKAVVHF
FT                   WHLFGSTPHCRAALTSAGRDSPYRNAPLLESRVRALAKVFDTETSGLDVPRVLTKEPEL
FT                   LLWEANDVVRRVVELKRIAPELGGRALTQAPGLLLCDPEDVAAARQEMDS"
FT   CDS_pept        447046..448251
FT                   /codon_start=1
FT                   /gene_family="HOG000235998" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640410"
FT                   /orf_name="MICPUN_60627"
FT                   /product="Lipoic acid synthase"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="lipoate synthase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69139.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016992"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284542"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C5E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT8"
FT                   /transl_table=1
FT                   /translation="MSALIIAAARRSSGAFSRALAASPRAVTHGASATPREPAWTRRSS
FT                   SSATSSSAAQSEAMAAFRERLAEGPDFGDFVRGDELPGTAYSLAAPKNLRDKSVRKPPW
FT                   MKRTIPGGDRYTEIKAKLRELKLSTVCEEARCPNLGECWGGGDGHTATATIMIMGDTCT
FT                   RACRFCAVKTSKTPPPLDPEEPANVAKAIAAWGLDYVVLTSVDRDELPDQGAGHVAETI
FT                   RRLKSSAPNLLVEALTPDFRGEAELVREVAASGLDVFAHNVETVPELQAEVRDRRANWD
FT                   QSVGVLRDAKRFVPSLITKTSLMLGLGETRPQVVNALKLLREAGVDVVTFGQYMRPTKR
FT                   HLAVKEYLTPEAFEAYKKIAEDMGFLYVASGPMVRSSYRAGEYFLENVLKQRKAEAAKA
FT                   TA"
FT   CDS_pept        complement(448331..449782)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640411"
FT                   /orf_name="MICPUN_60628"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69431.1"
FT                   /db_xref="UniParc:UPI000199C5E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFT9"
FT                   /transl_table=1
FT                   /translation="MTSWFAGSSAGKFFGLGAGGVLSSYVAYTRSETHRERPPESRAAR
FT                   KARGREAAQRTPAMFGRAVAVSPASAVMEGVTNSTALPLPADGAATETEEMTVTRRSVQ
FT                   VLASEDETPTSSSTSEPPRSAIRRKHEGRYSHRGGDDRARGGKFASFGHTAASIAAPFI
FT                   LSALKDLLSRRWRRLRRKDADVRRMERLRELLLALENSGHALAVPIAEELERLVTERDD
FT                   ALKELEERKRRRRRSPFGGDAREAADQPAQKSSPIDLAVDVSLRTRAAVARVRDLLTPQ
FT                   GKGKKKRPSLFSPGATPAKGAANLDSANASPENDQALLTTMGGSSDAKAVADLDRTVGF
FT                   QARELRYLRMTLKEKERKIGNLTKRLKAAVDESGSLEADSAGSSPASDDAPNLDGLDWN
FT                   VVAPRIVGFPRTGIPPETPGADSDDELSRQMRRMRRRPNFALVTPAPNMAGKNSDEARL
FT                   RRAKSRVGRISPTGKRVAWVAVDSP"
FT   CDS_pept        complement(<450154..>450495)
FT                   /codon_start=1
FT                   /gene_family="HOG000116372" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640412"
FT                   /orf_name="MICPUN_73823"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69432.1"
FT                   /db_xref="HOGENOM:HBG594959"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="UniParc:UPI000199C5EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU0"
FT                   /transl_table=1
FT                   /translation="SAIPKGYGAVILVNVIGASLALVTLSFKVSAARKEYKVDLPAMYA
FT                   TGKDKKSVTFNCIQRGHQQALETFPTILASSLIGGIRYPLSVWLFGCGYIKARQEWAKG
FT                   YASGDPQNRY"
FT   CDS_pept        join(<451887..452200,452414..>453569)
FT                   /codon_start=1
FT                   /gene_family="HOG000200874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640413"
FT                   /orf_name="MICPUN_75538"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO69140.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG609774"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000199C5EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU1"
FT                   /transl_table=1
FT                   /translation="SYREWLGVASQLDKLPANLGEGGDEWRRDESRSSDAYDAALCKIY
FT                   LTVMRQARAGGDAAALGLALRTVLHRNFGGMNRLLRLRHARTGTKLVAEEFTQELCRSV
FT                   SGDRIDSPRGGGGGGFDTRVPETLRLISEAHRSLGRTALCLSGGGALAMYHFGVIKVLL
FT                   EEGLLPQVVSGTSGGSIVAAFISMFPEEELLKTIKPDLSNRHDVRWFPPVWKMILHFVQ
FT                   HSVLMSGDEFARTTEAYFGDVTFAEAFAISKRAVSIQISVGSGHGFVLNHFTSPQVVIR
FT                   TAVNASCALPGLMPPSELLAKDEATGELIPFHPAGVTSFDGTITADIPAARLTELFNCN
FT                   NFIVSQVNPHINFVLHLADDGGGGRRFRHMGRSGERRAAVIKLLRVANFLLLNIKYGMQ
FT                   KLLEVDLLNLRMVRTLQGILVQDFRGHVTILPELKFSDYLRILHQPSEADMAHFISNGE
FT                   RATWPHVEAIRLKVAGEIALQEAAAALRARLA"
FT   CDS_pept        454397..455212
FT                   /codon_start=1
FT                   /gene_family="HOG000198202" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640414"
FT                   /orf_name="MICPUN_101841"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69141.1"
FT                   /db_xref="HOGENOM:HBG562270"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199C5EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU2"
FT                   /transl_table=1
FT                   /translation="MGAEMKRVPGDRTLFQLEIPGLKFLSLEVKPVVRVRVRLIGDGEE
FT                   VATWTGQSGHPGGKTPEWRADESARLAELAIKAECVDDDDEPEECPAPPPAPTPMGRPE
FT                   REDVVLHGPCVLIEAISCRVEGKTVEELGVNDLFVFRGTTCFRWRSRGDGTDAGPVPSR
FT                   TGPGGEDEAGTGWASAPVVGAKKLKDGQSCIVGWADIGVGVDPPGPFALLPQSFAEKVG
FT                   DAVMRTTLKALQSVFLNGLAKDYSKWATDEKYRAAREVAAAAAAEEAGL"
FT   CDS_pept        join(complement(457045..457066),complement(456748..456828),
FT                   complement(455408..456450))
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640415"
FT                   /orf_name="MICPUN_60632"
FT                   /product="Ubiquitin"
FT                   /protein_id="ACO69433.1"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI000199C5ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU3"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGN"
FT   CDS_pept        join(457395..457478,457693..458619)
FT                   /codon_start=1
FT                   /gene_family="HOG000260968" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640416"
FT                   /orf_name="MICPUN_60633"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69142.1"
FT                   /db_xref="HOGENOM:HBG395799"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C5EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU4"
FT                   /transl_table=1
FT                   /translation="MAAMGSGQSGAEIYTYEAPWLVYAMNWSVRQDKRFRLALGSFVEE
FT                   YSNKVEIITLDEQRREFPAEPTHRFDHPYPCTKIMFVPDAEGTSEDLLATSGDYLRVWR
FT                   IGDDGVHLRSLLNNNKNSDFCAPLTSFDWSTTNLARVGTSSLDTTCTIWDLEKETVDSQ
FT                   LIAHDKEVYDIAWGGPEVFASVSADGSVRVFDLRDKDHSTIVYESPTPDTPLLRLGWNK
FT                   QNPRYMATMEMDSAKVVVLDIRVPALPVAELKKHRAAVNTLAWAPHSSRNICTAGDDAQ
FT                   ALIWDLSSVAQPGEDGMDPMLAYNAGAEISQLQWSATQTDWIAIAFGKNLQVLHV"
FT   CDS_pept        458824..459960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640417"
FT                   /orf_name="MICPUN_60634"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69143.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013323"
FT                   /db_xref="UniParc:UPI000199C5EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU5"
FT                   /transl_table=1
FT                   /translation="MMTEIELNSPGVRGEPGTDEEKVQIVDRGACRCSNMCWSTRDGIG
FT                   KALVDAACKAAVYQTGMKPFANPKAQVGPLSAELVEKLEQGVKPDTILSNLSANINEWT
FT                   AGKRGMFTLNFWQEDSIASLQADVARGDGWAAADVSRAARTLLLAYDKRGLAHCEEAFA
FT                   SPEELLAHKEGCAFRPVECQNHGCVQVVGANSAGAHDASCPHKLLVCPQGCGADVKRAA
FT                   LRDHMATECDMKPAVCPYKELGCDGSVTAGSVDAHCRECAGTHLKLVVDWVGRLSTEAV
FT                   ATEARVRDIKLLLQGVVPKVEETAAEVVAGGEARGKLAGEVRELRASLNGMAKAVTALE
FT                   GEMKTQKSDMKLAIKTMDRLARAQEDMVKRVPMLSGKS"
FT   CDS_pept        460017..461159
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640418"
FT                   /orf_name="MICPUN_60635"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69144.1"
FT                   /db_xref="UniParc:UPI000199C5F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU6"
FT                   /transl_table=1
FT                   /translation="MEALGVGLGLRVQTRARPRPRRVVVRVTASGNAGGGSKRKGKKQG
FT                   GAFSTVEAAVSFLAQLLSAGDMFGTTGSSFKDDARFDRTDDGADKKVELRGWKWIKISG
FT                   KARTSTRVATVGEAPLDVYLQLPPEEYSLLDPQFVKRESPSTFRFTVPMREVIKKDKSY
FT                   GGPGEILKELTPTILFTTEVDTARQRVQLKGDGAALGQADLDTRFDLELKNVLTWEAMY
FT                   ESAPEADDDAGRIGVVVMDDDEDEDEDEDESRRSSSGLKGKEIIVAEYTDLDAKDRGAA
FT                   DMRRRAPCPPGWELRCDTRLSMRVQVPRPLSVAPSFLLGGAFSIIASAVMAAILPKFAE
FT                   FVAADYARWARGEDRSAPVGSFGEEKKGEEDDAGDGVVQF"
FT   CDS_pept        461360..462010
FT                   /codon_start=1
FT                   /gene_family="HOG000240201" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640419"
FT                   /orf_name="MICPUN_60636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69145.1"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI000199C5F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU7"
FT                   /transl_table=1
FT                   /translation="MRACYEVVERMGRGAVYLGSARVPEDHPHFQHAKELARDVALAHD
FT                   CTTWSGLGAGMMEAVTQGGMAAGKPVAGFMILLEAGGQRQASRKHPYLPDENYLTTSFF
FT                   SARKHGLVDAGVRNTPDDRTAFFALPGGVGTLDEIFEVLALLQLRRIGSAHPVPFVVMN
FT                   YDGCYDGLLQFLERDMVRYGSLREHELEPHWRACRTNEEALAYLHEFYSAQRT"
FT   CDS_pept        complement(462143..463456)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640420"
FT                   /orf_name="MICPUN_60637"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69434.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C5F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU8"
FT                   /transl_table=1
FT                   /translation="MLSVASKGEACRYCFDEGDEPLVKPCECRGSSAFVHRSCLLRWQS
FT                   QQMLSVASKGESPAVALSCLVCRSRYTTEPPTPGSLLELVRGTGGAALAALLHPGTFLV
FT                   SRERALPDAATLASAPNWLRWIIEHKHRHWVKSVYLLTRVEARPDSENGDVLIGVNVTR
FT                   AKRSGAGSDDEDAPPDDDDDDDDDDDESSDDDEGDDEGDDAGDSRPRMRRRLVAGSSSS
FT                   SSSAPTAENAALVIQRTWRRCRERHDERAASAASDDDSDDDSDFLESLNHDSDFLESLT
FT                   RTYVGGPVHPRRRIILFVSPTGANALSPTGDALCEVPLDRTCHPGSRARAFAYHPTATD
FT                   SDEYVDEIAGEAAAAALAESEEEDAAFNADGFFVPRVHVFEGHAKWSRTQLMNEIARGD
FT                   WGLCPATPEDLTSRWAETGSAYWDGLRASGRPVFASPT"
FT   CDS_pept        join(463893..464129,464300..465349)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640421"
FT                   /orf_name="MICPUN_60638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69146.1"
FT                   /db_xref="UniParc:UPI000199C5F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFU9"
FT                   /transl_table=1
FT                   /translation="MEVDSTLPGGAIKVEWPRSGEGNVLRLEEAYQGRAMFVKVKCLVG
FT                   DAPSELSHHPELRLRFPPRPGNGAPLIANGVSIQARDDVEVLLKRDRAGCYVSMDELVL
FT                   FESIRFEISCEKERWATGRVVRNDAEGDFVADDGAWSLELNPSGSALGSTAAQWGRACV
FT                   DLDASPGAAEDAFAMRSQTIHSGLSSALGAGAHDGGCALGLELCLVGTCDGRHTCMTRE
FT                   SALQWWKVTSPRSFVQRPSLDAIVELHDWPETGSDDEDGSGESAPSDVDDIDIHATSDI
FT                   DPNRASTQTCSPSNGNGVGVLDANGEPTDAFDGARAPLRTAPWSLVPWKGEMSLFDRAE
FT                   LLRNVRKKYEDLMHEYHSTNTEDKTGASNDLFTGELTWFSAGIRIGVGLGLGVCLGLGL
FT                   GLGVLVNGYKVSRDRLSNMKQALRLGYRR"
FT   CDS_pept        complement(465595..466398)
FT                   /codon_start=1
FT                   /gene_family="HOG000192069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640422"
FT                   /orf_name="MICPUN_60639"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69435.1"
FT                   /db_xref="HOGENOM:HBG316388"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="UniParc:UPI000199C5F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV0"
FT                   /transl_table=1
FT                   /translation="MSMEALVAALQDPETRENALLDLSKKRDMFTDLAPILWHSFGVIP
FT                   ALVQEIVSIYPLLSPPSLTNHASNRVCNALALLQCVASHPDTRAFFLNAHIPLFLYPFL
FT                   NTVSKTRPFEYLRLTSLGVIGALVKVDDTDVINFLLSTEIIPLCLRTMELGSELSKTVA
FT                   TFIVQKILSDEVGLNYICATAERCYAVGTVLGGMVTMLAEQPSVRLLKHIIRCYLRLSD
FT                   NPRARECLRQCFPDQLRDPNFTACLKDDVATQKWLMQLLMQLGSN"
FT   CDS_pept        join(467482..467691,467801..468868)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640423"
FT                   /orf_name="MICPUN_101847"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69147.1"
FT                   /db_xref="UniParc:UPI000199C5F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV1"
FT                   /transl_table=1
FT                   /translation="MDPPSSGAAVGLTSNPTQGTCHKCAAPLGRGNRATARCPRCGLTY
FT                   HTTDCGQRYANTGLDKKVSLEDCPKCTKLCLCANGPVLCHAGRLKFRRKAGNVDVGRGV
FT                   GTAAGTAAAAAKGPSGSGLGSPVLGTGDAGMNTAGLRALGGIGGLGVLANLGGNGGMNT
FT                   AGLGLNPSMYRLGQQQQQQQQQQQQQQQQQQLDNSVMTILLSLNAQLQAENASLRQTLE
FT                   ELTLKVGTQIVVCKQCHTPARLADLLSATMGGGQQTAQMDALRRASLQQAQLAAAMSGG
FT                   SFAGVGGSSGAGLSAQSWLGAGLLGAGNGLPGVAGLAGGVRAGDGGVMGGRFGAGHAIN
FT                   DPKASLGGLSRLEALSKIQAQANSAQNRARPGDVNGLKRPAEGEAGPAGEETVGTQELP
FT                   EMKKLRESGPDEQPAEDSILPLGRDV"
FT   CDS_pept        join(complement(469331..469964),complement(468906..469228))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640424"
FT                   /orf_name="MICPUN_84577"
FT                   /product="Predicted protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69436.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG744218"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C67E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV2"
FT                   /transl_table=1
FT                   /translation="MDEEPERSLLKFRLDHEKGLGPEGRTLHFVERLQIWTKLRPGVKK
FT                   FLRQVASMFEVHVITMGTQSYADEMRQLIDPGRQHIKGSVIGLGQMDEFGELQPADKKR
FT                   LDGELSGLDSIAVVLDDHVGVWPDHEENLIEIDRYLYFPSALKQFGVWRNGASLLEKKV
FT                   DEIADRSTLAAAFEVLRRVHQDFFAERAGHLALANKKAKDAAMAELARVTVPEILALEK
FT                   KKVLAGTGLVFSGVFPLDAPPHEQKMWRLAEQFGARCETQPGPNTSHVVAKTWGTGKCQ
FT                   WAKENGRHVVSPDWLFCSAFLWSKADERAFNPPDHRK"
FT   CDS_pept        join(complement(473296..473391),complement(471138..473198))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640425"
FT                   /orf_name="MICPUN_101849"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69437.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR008669"
FT                   /db_xref="InterPro:IPR012916"
FT                   /db_xref="UniParc:UPI000199C67F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV3"
FT                   /transl_table=1
FT                   /translation="MGADDVSNPLAPDYANPVPEKPKPKSNADFRKLLMTPRAVGGGGR
FT                   GGNRGEFQRPKPKFKPKPRPKPVEDEPEGPTYRDRAKERREEANPDYVGDQALFPGAVP
FT                   GKVPGYAPPGAQDELRQLSIEESKYLGGDMEHTHLVKGLDFALLRKVRAEMKEKEKDDA
FT                   HAEREKPEDKVSGEEKIPGEKKSEPPKPEDDGRRFDEDGRELVFHSDMARNLYDWVIES
FT                   SKVPDPKDVHPDFASGRLAYRFNLDDPDKPPEAFLKPESEAVRPPYVPPPKDLGPIVPN
FT                   EKFASGRLAFRFDLDDPTDTVTTVMRPMSEPPSHRMFGPDYQFVSEKDKELLLDVAKIF
FT                   KKHVDAGTWPIPDENSKGKDKKSKKKAAREAEAAAAAARARELAEEEERARKLATEPDS
FT                   DEDIFGDAGKDYEPTVTSLAQEGDKNKASIFGEDEPTHDGFSGRKTYKKEEAKKADGPV
FT                   IEDVYGLAGPLPAPPAPDFRSIDPWKEYYARYVAAGTVTREGAERWDPNAASEYLQTIP
FT                   DFALAISAHSVKLQEREEAAEAAREKERGILTKEKVKLRPSGDKPMDAAAAKAELERRA
FT                   EMSLAADDGYGECYAGGFGDYGANAYESDDEADGRKKKEAEDAADGGADTKGPKPGGKA
FT                   GRAGPGAKGGKPDLKALERERDQKINSELGSLHKMMKEKYGDKVDVAFGEGKGGGEGGG
FT                   GGKRAGEEEDGEGGGGGRKKRMKL"
FT   CDS_pept        474114..476009
FT                   /codon_start=1
FT                   /gene_family="HOG000268805" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640426"
FT                   /orf_name="MICPUN_97749"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69148.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C680"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV4"
FT                   /transl_table=1
FT                   /translation="MAPETPKVSNDDAKEASDGDASVDENHVSNFNLSKEVCARLETKG
FT                   ITSLYSIQAQCFQPILDGKDLVGRARTGCGKTLAFVLPIVEVINRENPMPASGRRVQGR
FT                   RPVVALLAPTRELAKQVHSDFQHIGQAFGLTSICVYGGAPYGEQERALRQGCDIVIGTP
FT                   GRVKDHLDRKTLSFEKLRFRVLDEADEMLNMGFVEDIETILNHAKDNANLQTVLFSATL
FT                   PKWVADISKRFLVPGYTTIDLVGDEKQKASGSVQHMLINCQWSERTDLVCDLIRAKVPG
FT                   DGRVIVFCDTKRDCGELQEALQKELEKGAKALHGDVNQSQREVVLDGFRKNKFQTLVAT
FT                   DVAARGLDISGVELVVQCEPPKEAETYIHRSGRTGRGGATGICVTLCTPRNEWAIPNIE
FT                   RKGGFKFVRIGPPQPAEMVAAAAKIVIQQVRAVHKGAAKMFMDAARELLAEGAGEHDEG
FT                   ADPTEMLAAALAKLAGHGELRQRSLLTSHTGQTTLLFTAGNNTEIRTPTYVWNFLKQRM
FT                   DEKDIQLRRLTLQADSKGAVFDVPSELQEKFLALSDTKGPTPITISVCEELPELVMKPQ
FT                   QSGGYGGGRGGGGRGGFQGRGGGRGGFSPGGRGGRGGGGRFGGGGRGGGRGRGRF"
FT   CDS_pept        join(complement(477373..477618),complement(476103..477128))
FT                   /codon_start=1
FT                   /gene_family="HOG000080585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640427"
FT                   /orf_name="MICPUN_91438"
FT                   /product="Type II secretory pathway family "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69439.1"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG565931"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI000199C682"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV6"
FT                   /transl_table=1
FT                   /translation="MNDFMNSKLPGKIGTVLLLLILSRVGTYIPISGVDRDAFAESLQG
FT                   GGNVLGYVDTLTGGSISKLGIFSLGIVPYINSSIIFQLLTSVFPSLKKLQKEEGEAGRR
FT                   KFQQYQRYGALGFAVVQAVGQCLYVRPFVEDFNLGWLVESSAVLTAGAMILLYIGEVLT
FT                   ELKLGNGTSLLIFTNIISSLPSSFGQTLSQASEKGDAATVLPVFFGAFFLTTLGIVYVQ
FT                   EAERKIPMNYSTRFQAGGLAKSSYLPFKVNSAGVMPIIFASSLLALPATLARFAPNPVI
FT                   IGAAKAVYPGGVAYVPVNIALICFFNYFYTFLQLEPKDVADQLKRQGASIPGVRPGAAT
FT                   SGYITRVLERLSILGSVFLGFLALAPTAVEGITGLTTFRGFAGTSLLILVGVATDTTRK
FT                   VRSEIVMSRYDTSLDDFYKDMPKK"
FT   CDS_pept        join(complement(477373..477810),complement(476103..477128))
FT                   /codon_start=1
FT                   /gene_family="HOG000080585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640428"
FT                   /orf_name="MICPUN_91438"
FT                   /product="SecY protein"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69438.1"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG565931"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI000199C681"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV5"
FT                   /transl_table=1
FT                   /translation="MPGLGADGVWDPLGLGRAKGWEVGDNDWNESERRLEGSGSVMALA
FT                   RGGRSVKAMNTGAGGGGDFMNDFMNSKLPGKIGTVLLLLILSRVGTYIPISGVDRDAFA
FT                   ESLQGGGNVLGYVDTLTGGSISKLGIFSLGIVPYINSSIIFQLLTSVFPSLKKLQKEEG
FT                   EAGRRKFQQYQRYGALGFAVVQAVGQCLYVRPFVEDFNLGWLVESSAVLTAGAMILLYI
FT                   GEVLTELKLGNGTSLLIFTNIISSLPSSFGQTLSQASEKGDAATVLPVFFGAFFLTTLG
FT                   IVYVQEAERKIPMNYSTRFQAGGLAKSSYLPFKVNSAGVMPIIFASSLLALPATLARFA
FT                   PNPVIIGAAKAVYPGGVAYVPVNIALICFFNYFYTFLQLEPKDVADQLKRQGASIPGVR
FT                   PGAATSGYITRVLERLSILGSVFLGFLALAPTAVEGITGLTTFRGFAGTSLLILVGVAT
FT                   DTTRKVRSEIVMSRYDTSLDDFYKDMPKK"
FT   CDS_pept        478379..484894
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640429"
FT                   /orf_name="MICPUN_60644"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69149.1"
FT                   /db_xref="UniParc:UPI000199C683"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV7"
FT                   /transl_table=1
FT                   /translation="MTSGSKVLPSYREVFSVLEGLGSLATSPEEVEKLLGDCSDFLKGC
FT                   LDSFKPPSSASKAAVESGTVSGYGDQPLNLNESIRKVTVEASTRLALDEVQTYALLRRC
FT                   LDEDKSPLPTACDDDLVVRLTRYYFAERLQLMKCIQALLERGTDAEHDDDDDEVTPALA
FT                   HARACLRDLLAGGLEEKLTGALCSHMRGSTPTRPAEYSKDRRRNAQLAKMWATQALEET
FT                   QVMLDCAFYMYYSPGVRCSASGFTRLAVAFEEGAMGRAPASAAELVNNAWVDGERGEEY
FT                   ARETVNRFSDSFRAMCSVILIETMDLEDVVQSLNAADGGDTHAMLNVDAMKDVAKALGK
FT                   WPSDATHGPVLLAWATLLSLAPSAASGLTPPPEADPAKMSARAAGGDAGFDSLLSLLRT
FT                   DYIKGIGHACKSVLKNLFTASLAAFDVLPVQRLKPGELDTLLDILVELVEGQPILCEQF
FT                   WGGSHGDGQEAPLMNLLVGCRERHPADGVPLLRALSALASGSDAAACALAFLSRSPTVA
FT                   LPTSGPGADMAGSIVPVGRDGKPTRKWKLAMERWEGEYADYEQRRDMGWGGDAPPAPPL
FT                   PAGPVRSTVALASAYLPGAAIPAGARGVAIDRMGSARDAADEEEGDGAGEDDEEEDDEN
FT                   AVMATAGPATSGPGADIVTWDAPADGFAITIARLCVLSTAGAAKEADARELDAILSFIA
FT                   KVLKSAPSFAAKFAAVDVSDGVPRGTPTTILAALTAVIAAAVTPGRAWSTLPCTPGGNN
FT                   HPGLERTALALDAAAPLASAAPGAALAQLTATPLLHADTGAPRGPLASMRAPGPAVGLA
FT                   MFERSVLPAECTTGEYPVTLALLGLTAKLLWAGAGAAPAMTPILQHVFQEVLVQHGTWR
FT                   YRRRSDRWAIHAALVRVIAAALAPRPGPANASRRAAVAGFVSSDAAAAEATLAPLTMDA
FT                   EALRRMHDVRAAEVAAAEDAVAATLGMLPALMSAFAEVAKEKNSPSPLESGPLAHALLV
FT                   EGPGGGSPLAAAVASYAAYPFDAVFRPLALPALAALCAAAPADPPLACALPSLTAASDV
FT                   PSAFDSPYKHKGDADVAAAAKLDVRAAIVNALKPAAARGDPKGFRAAAALVTAAAARQP
FT                   MLAESMLIPAKLGAVKPDEEDASTLDSLYECLGEAKTMRANDPRSLASALKSLFSVWNG
FT                   NRLLGGAVAALRSDSSFVSRLEDCLPVSAEVDGDDGCDDETEAYRFSVEAYAMSMIASE
FT                   LAASERDSDTARSVRAWCDASGGESTLLRWLRRWMTIRHDPGTFSRARSHAQAVVLLAA
FT                   AETEREGAADLPDASLRDGAAEAARALLSHAAAQHLLIGGQATRAAVLDAVAAGAVASA
FT                   AGREGIRAPGDPVGRLLDAARSLRLERAVLAPPTPNCFDPEMGGDFLYDTSWIEVATGH
FT                   ARVADDDGAGHEVAFGSGGGGAEGNPSSLARAGGAAAEALRAAGRAAARGSSQLSALDA
FT                   CLEFFNAAAGVLPPVTHPEDDGFGSIPDAGLSDEGALSSWPAKERRVAVRLALEALEAA
FT                   MVAANEEGADHAKALAVELAEMLAVLVRLWGRAIESPAAVSPSKAVGFGSQLNLPAGST
FT                   GSDDGELNAFTVASDVARVTVEVLSRRGDVVDGDTVEITRALLTAVLASIRAWRDGASE
FT                   GNLRVSGSLPGSSPLREGNRLGQILWPLVPMLCGAASAPNGGTDSVLALSVLRELTDGL
FT                   MSTPALVAAMQSRAPLPPLEPPRPPVSPSPLARSNGMDSSGQASIIAVPFKYLGDAPTM
FT                   ALRPFLELNATIDGADGKENLQRANVGPKIGAEGSVDEGVFGGVEVPAALRLCLVLGRS
FT                   AEGAESLHRLGLIGQLTKLCKSLSGSTYHPAPAHQPSPRRVRGRAGFAPDEADELAEEH
FT                   PRVDPAALYCLALRVAATHADAVGSKPEVHEGLVAMAVELADRFAAALAPAELTVAALA
FT                   EAEATATLLHSLAAAANGPWQLKTPSHQVRMRASAVDFLRWIASPPPPRRGVACAPRGS
FT                   AQASAARRPPLVGASTGWFHSCALGSVPPVAATPAAAIAAAVAANDRSTPAGNAHSENV
FT                   AGRLYATAARCAAFLASFPRANPAAALGSETLDSLSGQAVALGEEMASRREASATSSAG
FT                   VALCDALTMTAKSLLEFASALERLEAGEPNLPDPPALRLHSSYSLVSQMSWRESTILGD
FT                   PK"
FT   CDS_pept        485019..485636
FT                   /codon_start=1
FT                   /gene_family="HOG000012583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640430"
FT                   /orf_name="MICPUN_108760"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69150.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG562279"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="UniParc:UPI000199C684"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV8"
FT                   /transl_table=1
FT                   /translation="MVFADKGAFGADGDGDKLKKNRFLSTTKEVEDLNQYWYSNRTISA
FT                   MARDVEDVCAAPETRAAFLSTPSVYFSLSKEVRARSWCFDLDTQWQKEPGYVCYDFNKP
FT                   IDFEGAEELKGTFDMVIIDPPFITREVWEKYTETARWLLKPGGHVMASTIQENAPFMKE
FT                   LLGVDPQVFMPSIPTLVYQYYLYASYESKHLKDKNPEIPDYD"
FT   CDS_pept        complement(485743..486501)
FT                   /codon_start=1
FT                   /gene_family="HOG000277503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640431"
FT                   /orf_name="MICPUN_84451"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosyl-AMP cyclohydrolase activity "
FT                   /function="phosphoribosyl-ATP diphosphatase activity "
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="ACO69440.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004635"
FT                   /db_xref="GO:0004636"
FT                   /db_xref="HOGENOM:HBG294308"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniParc:UPI000199C685"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFV9"
FT                   /transl_table=1
FT                   /translation="MAAAAEPEQIEKFLDGLKYDDKGLVVAIAQDVDTGAILMQGFADR
FT                   TAVRSTITKRQATFFSRSRQAQWTKGETSGNFISVKSIHLDCDKDSLIYLGVPDGPTCH
FT                   TGAHTCYYSQVDGDDGAAAVEGGGKHGQEEALTTLYELEETIQKRRTEAVKEGDKPSWT
FT                   RKLLDNPELLCKKIREEAGELCETLENDEGKERAASEMADVLYHSMVLLNLQGVGMEDV
FT                   LAKLRGRFGTSGVEEKANRPPKSKQAHRTG"
FT   CDS_pept        486989..488653
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640432"
FT                   /orf_name="MICPUN_101854"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69151.1"
FT                   /db_xref="UniParc:UPI000199C686"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW0"
FT                   /transl_table=1
FT                   /translation="MSLSGAVCSVMLYSNLAWSVDNQVTLEFSTPHGVAPNGVLLCATA
FT                   TGHRFDRSSFTVNALEEGGSQFVSGNAQTVTSSAATDLRAFGGATSWNHRAVETGVAAD
FT                   VLGTDAYYASTYMRRRYDTLAVDSTGASLAGVFQDPVWSTTDATRKNDTDFYIAKLSDA
FT                   TLTDTERQTHAATLAELNRPTGNCALLSGSWAKDTRYELKFTAPNPAQSTGATELGWWM
FT                   APVTYAKTSSTAPAGAGGMEPSNRVLYTVRGDKNGVVCGARATVKNVLHDACAALALSG
FT                   ANASVAAASVPAACADSLRWTSRAEATNGLGCGASAQAACGACAANAVASYRYSGHCVS
FT                   CENGAAATVSDGGVNRNSCACAAGRTTLKAGGSACGPKMGPAGTSTSAAALAAELCASF
FT                   TGVKTGLSGGPSAGKTTGVGGGVAAGAHAIATAHVDAFLAAAGSLVDAADVAAANVTYR
FT                   STLMFDERAPDDPTRRRGLAGRCAECGADGTFVDNYGRVGSVKDVQFDAVHALRLIGYV
FT                   LHLKGYDCDALYNPDDKFVGIYGAYEAAPVCGVATPA"
FT   CDS_pept        complement(488713..489858)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640433"
FT                   /orf_name="MICPUN_60648"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69441.1"
FT                   /db_xref="HOGENOM:HBG607200"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C687"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW1"
FT                   /transl_table=1
FT                   /translation="MSVALFDCTSAYDTTTAEYSAVVREEAARATRTVYASVFFGENYL
FT                   ACGSSSGSLSVFNLDDVLREQRGSGGGTSSPDPSPRPSLVVPDAHRGAVYSVIAFTLQG
FT                   SEMLCSAGEDGRSVLWRASDLIAAANAKATRSERTVAVTPAGEFKNPQESKARGALGPV
FT                   PETTALAVDPTRGTLLSAAGDGVCYGWDLGEGRDAPAMRLRGHNDLLHCVAARVGANQA
FT                   VTGSEDGTARIHDLRSETCSHVIDVWRAKEGKSGGHGSGAWVGCVALDKAENWAAMGCG
FT                   GGCITMWSFAAGACASRVPTAAPPQALRLTGQHVMAAGAEPAVYRWNLAGEQISRQPCT
FT                   PKSVFTLDLQPQRSLTAVGGTGGSVDIFSELGTRVTTLRCL"
FT   CDS_pept        join(490091..490135,490299..493166)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640434"
FT                   /orf_name="MICPUN_60649"
FT                   /product="Predicted protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69152.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI000199C70C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW2"
FT                   /transl_table=1
FT                   /translation="MSAIIITTGFDANDKREIKALIDKLGATFGDPDFTATSPFDYCVT
FT                   KTTNSPKYDLAVKLFKPVVTFAWLRDSAEAGELLPVEEVGHIPKAFLGLCVCVTGYTQD
FT                   ERTELEALVTKNGGLYMSDLVKGKCTHLVASGTTSGKYTHAKKWDGIKIVSREWVTESA
FT                   TGGVKANEARFPVEGTPEAAAAASRANIDADEAADAAVAWDSCYLMGCTVYLHELGNPK
FT                   ESAEWARAMQAVRHGSAFTTSNASKATHVVVSVSAAAGSLRDIRDQRDKTVLSTWLDAS
FT                   KALGAPAPVEEHAAPSALFATRREPPAKKGGGINRVDSMILSQEAASTHDKGKTSKATA
FT                   SKATEAADRRRRRRSGPASPNPLTRQALAAEAAKAAAAEEDAAANRVDLADQNMPPRYH
FT                   QPLSPAAARVTAATTDPGCSFDPGTATDLPATAVAIQETNGLGVDGDDYSTVFKGMRIT
FT                   LSPLLSREEEEAASEIVTRGSGIVTKKKAASSAYIVCPAAPTREERAILNSAPESERRR
FT                   HVTCHWLEISCELGYVVPLDSNRGGNPACRPLPCDAPFDSMHGLRISTSLYDEDVKSSV
FT                   NMLCHLLGAKYTERLGRNKNTHLVVPYAEGKKYEAAVGWGLHAVTVEWLHACIEAGRKV
FT                   EERDFKPPPPPSDDDRNGDDGRAGAFTTDGGDTQEAPPPPVATNAKGSDRRRSAGIDIG
FT                   GGNVCGGSQRGALNLVGSAVQRDTSRAAQTSQRAPPSTRRSTRPVSKTPAQPKPKAGAR
FT                   STPRRGESIAAPTTAAPAPATGVKRHLGSDRSPVSVGVDLEPEPPAPPPPRVTTGGRAA
FT                   HPADGSQMVANLIDDVAAGMFDGGESQLDDGFDGFRVPDPVQTEAAVAAVRDGMTSPGG
FT                   AGRGKRRRGPGDTTPSGMVGGIGGGVGESQMMESQQMMESQQMVGYADDGPPRGRSHTF
FT                   GGGRGGASGLVNSLLGAAGRGAGSATPSATASGLQAEDWV"
FT   CDS_pept        join(complement(494685..495054),complement(493459..494252))
FT                   /codon_start=1
FT                   /gene_family="HOG000230117" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640435"
FT                   /gene_name="PRK"
FT                   /orf_name="MICPUN_104911"
FT                   /product="Phosphoribulokinase chloroplast "
FT                   /function="ATP binding"
FT                   /function="phosphoribulokinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO69442.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008974"
FT                   /db_xref="HOGENOM:HBG541912"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI000199C70D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW3"
FT                   /transl_table=1
FT                   /translation="MASMTMSAACAQPLAARKFQGSRVSGKSVVRAAKRNVTVKAERDG
FT                   PVLIGLAADSGCGKSTFMRRMTSLFGGKATPPEGGNPDSNTLISDSTTVLCLDDYHLND
FT                   RNGRKESGLTALNLKEQNFDLMYEQTKALMEGKAVDKPIYNHVTGVFDPAEKIESPSIL
FT                   ILEGLHPFADERVRDMFDFKIYLDISDDVKFAWKIQRDMAERGHSLESIKASIEARKPD
FT                   FDEFVDPQKQYADIVIQVLPTQLIPDDNEGKILRVRMIMKEGVENFDAPYLFDEGSTIS
FT                   WIPCGRKLTCSYPGIKFFYGPDTFFGEEVSVLEMDGQFDKLEELIYVESHLSNTSTKFY
FT                   GEITQQMLKYQNGPGSNNGTGLFQTLCGLKVRELYERISEKEVVTAA"
FT   CDS_pept        join(complement(502284..509226),complement(495572..501933))
FT                   /codon_start=1
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640436"
FT                   /gene_name="ODA-DHCA"
FT                   /orf_name="MICPUN_104912"
FT                   /product="Dynein alpha chain, flagellar outer arm "
FT                   /function="microtubule motor activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO69443.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR001298"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniParc:UPI000199D592"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW4"
FT                   /transl_table=1
FT                   /translation="MHTLDLTNSELLVWSEVEGESLPPRSRHSCVVVKHFLVVFGGLNH
FT                   RARYDDVWIYDTKKNVWHELKCGGGAEDRPSPRAHHTATIVGNQMFVFGGYSGHGKSSN
FT                   ELFVLDFGTFFEEMETPDDVDTPKPATWSKPVLNGNGPSPRFDHGASWFPNKFVVLGGR
FT                   DNMAMFNDTHFLDLDTMTWVEEGTSAPSPYTMEISNHQLSAIESVPKYKMFCLTGKKGQ
FT                   NEYMNHVDVMDCGTLVWNTPKAIGSPPVVREDTAMAYDPKTCKVILFGGWSNRWLGDTW
FT                   TLNVSPIIGPPYACSKVVPDIGPVFGESEIVIHGLQFKESDKIEVSFSSGKNEKIAQGK
FT                   FVDEHTLTCQTPNFEDFGALEVNLRVNINDEGWTVNKLKFRYFANTSAANCIAYGPGVN
FT                   SDVTGVYGVEIPFFICAKDTCNSKRTSGDDEFIVEVTNADDPKAPQGSVRLVDYDNGTH
FT                   EVFYTVPTPGRYRIDVGYDDLGEPQEIIPIRGSPFYMNFGDPWTYQRTSGPAPLKRKHG
FT                   ALTSVGPQQVCLYGGDENGVSVLRTKQDGWTWGTAPVNGQPEPRKVQGQDSAGGGKMVV
FT                   FGGTTLGAKGEELGDLATFTADPDGVSGSWKIIDGIKGYVPLRPRHAKDSGSSAEGSPQ
FT                   QGEIRESEASAKSEVFLPMESPAPAEEPELADVVEESEPPAPADGEPPAPADGEEPPAP
FT                   VASGEPAADGEAEPPAEEATPADGDAEPAADGDEAKSADGDGAASSKGEGAGDEGAGSV
FT                   STPAPSTPVRPLSPEAAGATQPVVRSAPAVAMMGQSKVVIFGGETEGEDGKVSLEDFLT
FT                   VDLNAGRLRWNEVPIEGDMFLPRKGAAICTVGDVVYIFGGIYKDEEEDKEVVLDDFVML
FT                   KPEGDVMVAELIPLQGSGIPDARAFAMMESVSDSSLMLYGGVNENPINDAFIFDCNKRV
FT                   WKLMYRADPSVCEPTGALATVHAGKLLTVSSTGGNRFDVVATLDPDLSDNFSFTSCMKN
FT                   GVSKQLDKLEKFFNMTEGAFGMADDSEKLKESFDVLMKVMGALFDARTRKEAIDLELDC
FT                   IHETLFMLNKAKIPTTANDKRLEEARLQWEAIANLTPEVREAVNPVQEARSEGIRKKIK
FT                   DGTDNAAAYRKEFLESPIFKYETGFKGAYPLLDAARTKLVGLDESVKELTHLANMFEFP
FT                   EAVEELTACVAECHEDLRNAKDVWDFSSLVEVQFTKWRANLWDDINTEEMEDQTKAFQK
FT                   DSKTLPKKIRDADCYKGLDESVKNFLTSVPLVADLRSPDMRDRHWSSLMKVTGTEFTID
FT                   ENFSLDNLLALELHKFADEVGEIVDCANKEAKMEVSLKKLDQVWAKVEWVQIKHKDTDI
FT                   NTIKLGEEDFEGLEDNQVMVQGMMANKYMKTFEEPITGWNKKLMMVADVNNIMSEIQRT
FT                   WAYLESLFIYSDEVKKELPEAAARFKKIDSVIKSILKEACATKNVVNSACKDGLYKELE
FT                   NQQGELEKCEKALADYMESKRRAFPRFYFVSTADLLDILSNGNNPVKVMVHMNKCFQAI
FT                   EKLTLDTENPGAGRRPKAKAIISCVGKETIPFKSEMGLDGKVEEYMNLIIDKMRSELKL
FT                   HCFDAMQAYNNPKPRHEWCFDWSSQLGLVVNQIYWCSEVEEAFDKIAAGDAGAMKKYNE
FT                   QQVQQITDLIATTRRDLDKPSRQKIMNMITIDAHSRDMVIGIIENGETSKKCFKWMSQL
FT                   RTYWDADIDDSVIKICDASFPYGYEYLGNGGRLVITPLTDRIYITATQACWLSMGTAPA
FT                   GPAGTGKTETSKDLSAQLGKSMYVFNCSPEMDYRTMGDIFKGLAASGSWGCFDEFNRLV
FT                   PEVLSVCSVQYKCVTDAQKRKANMPGRGLEFVDKEGVKHDAIQNYKFIAADGVEMPLEE
FT                   GCSGFITMNPGYIGRAELPESLKALFRPITVMVPDRQLIMENMLMAEGFVEAKMLAKKF
FT                   ASLYYLLEDMLSPQTHYDWGLRAIKSVLVVAGSLLRAEEGQDESDVLFRALRDFNIPKI
FT                   LAADMVIFMGLLNDLFLGVDPPRKRDMKFEKVIEETTAEMGLTVEDDFILRVVQLSELM
FT                   AIRHCIFLMGVTGGGRTEAYRVLAKAMQKGVNVPEKEIVNDYLRPNNKKKVVIRDINPK
FT                   SISTQEFYGYVNLSTREWKDGMMSYYMRELATIPDEDPKWIILDGDLDANWIESMNSVM
FT                   DDNRLLTLPSNERIRLLPHMKLIFEIRNLKFATPATATRAGILYISEKVQWKNMITSWM
FT                   KRVVPDYAVKAKFKDPNQPAQWLTELVDKYLPDTIFEMKKSFQHITPLETMNFCTTLVN
FT                   ILEGMLKPENLNSKATQEAFETYFVLASETSSFTYFLDMMLELRAPIMFVGPAGTGKTQ
FT                   LVKGKLASLPEGNMSLNINFNYFTDVISFQKILESQLEKKAGVNYGPPGNNKLIYFVDD
FT                   LNMPKLDPYDTAMPISHIRQHLGWGHWFDRAKLSPKVIHNTQYVACMNPTAGAFVINPR
FT                   LQRLFMTLAVDFPGQDSLMKIYGTFLNGHLKHFNADCQELGMKLIQASLANHEKVVQSF
FT                   RKTAINFHYEFTVRHLTNVFQGLLFSTPDNFNNVAKLSKLWLHESERVYADRLVSAKDL
FT                   ETYNRNVVQIANKFFKIPGIDDFYAREKAKPLIFCHFAGGVEEKIYNDIAEYSKLQKIL
FT                   EDTLAEYNETNAVMDLVLFEDAMKHICRISRIISNPGGHALLVGVGGSGKQSLSKLAAH
FT                   LCGMTTYMIVISGSYNVNSLKEDLQKMYKRAGLKGEGILFLFTDSQITDEKFLVLINDL
FT                   LSSGEIPDLFPLEDKDEIINSMRGEVKAAGLNADNRDTCWDFFIQKTRENLHMVFTCSP
FT                   VGEQFRIRAQRFLAMINSTVIDWFQPWPEQALLGVSKRFLGELDLGTDEIAMAVMEFMP
FT                   FSFNLVGKMSEKFKESERRYNYTTPKTFLELIKLYKNLLASKREVTEGQIDRLENGLEK
FT                   LMKTQKDVDILVEQAKIKAVEVADKVASSETFAAQVQVEKDKANVENEAAQVEAEKCSV
FT                   IQEQVLAKQVSVQADLDAAEPLVDAALAALDTLNKKDLGEAKSLKKPPAGVDDITAVVV
FT                   ILLQNNPRDKSWNAATKMMNNVERFMETLKGFKDQIDAGKVPKKNVDACRPYLELPHFN
FT                   RDTIYNKSRAAAGLCEFAINIIKYYDVITMIEPKRKELADANAQLDEANATLQAVQDKV
FT                   AGLNALVADLERQFNEAEADKNAAINEKERLEIKLGLATRLVNALAASGEQWKNDVAQL
FT                   KIDNGLLVGDCLYAASFVTYNGPFTAKFRTELNTAFEKRLMENNIPMTEGIDVLKVLVD
FT                   PATIAGWVSEGLPSDRTSVENGTITCNSERWPLMCDPQLQGIAWIKERESKNNLQVVRM
FT                   GAAKTVDIMEKAIEAGHSVLIENMGESIDAVLMPTVTRSTYKKGRALFVKMGDKDVEYN
FT                   PNFKLFLHTKMSNPHYPPEIQAETTLINFTVTQDGLEDQLLALVVNKERPDLEETKTAL
FT                   IIQNNEFTIKLKELEDTLLFKLANAEGDLTEDVELIESLEEAKRVADEIVLKVEESKET
FT                   EEKINTSRERYRVAAARGALLFFMLNSLNKVHAFYAFSLNAFVTVFSRGIDLAPGGKKR
FT                   AVKLSFRTVAKRVMGKFDWNMDLLKSLIPSVKGGDPRKSETSEEPTEEAMAKRLNALLE
FT                   TTTYTVYNYTRRGLFDKDKLIVSTLLTFSIMVKDGLLESDEYNALLKGLKSMRGTPCPD
FT                   DLAVWMTDAQWAGLCGVEEKLAAFKGIARDMEKRNEEWAEWGMHELAETEPLPGEWNKK
FT                   LTEFQKLLLIRAVRPDRITSALSLFVEKTMGSEYVNQEAFDARKMFEESGPSTPIFFVL
FT                   FPGYSPSKDIEKLANEMGKSSENGKLTIISMGQGQEPVAEAVLDKYTQEGGWVFLDNVH
FT                   LMQGWIPSLERKLEIAAESAHRDFRCFFSAEPINGAPFAKIVPESILQTCIKISNEPPS
FT                   DLKSNMRRALAPFSQDVLDRSTTDEKKTVHTAVLFALCFYHSLLLGRKKFGVGIGIGLG
FT                   SGLGYCRGYSFNMGDLVNCTEVLFNYLEGNDNVPWEDLRYMFGEVFYGGHITDAMDRRL
FT                   CISYLDVLVTPDLLPSADGEAPTKQLAPGLIAPNPISYEELQNVVETKLPQETPSIYGL
FT                   HFNAQLSLLTSEGEILFKTIDDVQGGGGGGGGGAVDMDSIVRSGVNNMYDFCPEPFNLI
FT                   DIESRIVDKNPYVVCALQEATRMTDLLNFIKRSLEELTLGLDGALNMSPAMEEVQNGIF
FT                   RNSVPPSWMKQMSSRIQEVYSLSRWFKDVQERHAQLDKWTARSVEHPKTVWLPGLFNAK
FT                   AFITAVQQVYARANQLPLDVMKFRTEVTRMQPGDIEEYSDEGTYIHGLTMEGARWDQDL
FT                   GMVMDSKPKELRCLLPVIKVIPVTADKYDTNGYYMCPVYMNMQRANVYSAQVSTFTLKH
FT                   PEDQPPVKWTLASVALLMQDELA"
FT   CDS_pept        510102..510662
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640437"
FT                   /orf_name="MICPUN_60652"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69153.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199C70E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW5"
FT                   /transl_table=1
FT                   /translation="MTSTTAPEESLEFADRYPASETLLGFHDYEAFSKLRMPDSWVPGE
FT                   QAGPSESKDSIHMCGWLDKYYADDRGTKTWRPRWVYLLEDRLCYGSATSTDNVPPQVKY
FT                   IMLDRLPARPGGKLAISRLKVSPQGLNGQPGVDCAFHLVCDNRTHTFAGKTPEVALRWT
FT                   EKLEELAMKRFSATNTSMPFEST"
FT   CDS_pept        complement(510731..513562)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640438"
FT                   /orf_name="MICPUN_60653"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO69444.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG562284"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199C70F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW6"
FT                   /transl_table=1
FT                   /translation="MQRQRGRSRLRALVRFLLILGFVVWIVHSLLVQHYKKQRALVDRL
FT                   VDRVDNRDAGLRGAAPRRSALPDDEGGFEVDFSDNTHDDDNYGNEEELNSTLRSLKPPE
FT                   PSSVELRDVTVREELPRVSRRNEASRGGVWIPRDWGTRERGKNAEKNGEADAECFPADR
FT                   DADSGDRVVNPIEPLYRKAGSGCNKRETIPGLCDVLNVLLPSDGIERAVMLVFGGEKHQ
FT                   DTIALALAAADKTGARAVLFVASDDDAAATAAKENVPYIQPDCDGPCGRPEYVAAAAIL
FT                   SIGSDVLLVGRGVELRGPNPLINIPGLRGADVEGVTYREGMFGDVVGMSDPAMGWSAYS
FT                   QSMAVPNILSSLVLLRATGESIRLAVWLGEHRDDVDADVALTDELLMPAHDARQRSGAT
FT                   FRLLPPKCFRHHKSGAAVVEAAEGFPVKSWHGDEKSMFSFGTRAEDPNKILSSETFDAA
FT                   RSVVLRDGPIGAEDDDGNCAAVDMHDRVGPDPRALRYIAAPDGDFPVNCDGDLSQLCKI
FT                   VGRVAVKRQVLAAVSNSNILYMLGLFLDGVAAANITNTIVVALDQKTADWCKERGAPYY
FT                   HRELKSLTGATDNHATSGLKFRVLHEFLSVGVSVLLSDVDVVWMRNPFGGSRLVVPTIE
FT                   SDPDRVHVDAPAIYGDSDVEGMTDGWDDVSAYGFAYAGAGGTPMRRLAARNSGLFYLAA
FT                   TKESLRMVSRLAERMATERNTWDQTAYNEEQVWMWTSEAPNAGNRRSVPAGVSQRVMNY
FT                   ACFQNTKYLFRYMRYDPELYDGASGRSLRPISVHVNYHPEKPQRMVTLIEQYLKGERDA
FT                   ISKWNWGEGMAFAKPCLARPKNSKEGDALMEESELARQILERMSVSGEPGTWAGIKGFA
FT                   PGEKGALVTPWGDGKWGVIPPKEVDGDDRIFVDFSGAKHMVHSDQDRNGRSNGELHLIS
FT                   TRCTDGEKVDIVL"
FT   CDS_pept        513670..514467
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640439"
FT                   /orf_name="MICPUN_60654"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69154.1"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199C710"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW7"
FT                   /transl_table=1
FT                   /translation="MAGPRRNRSADVQVDDVPKNHRKVSDDDAADDAEDPAEEAEVAEE
FT                   EEEEEEEDEDPIELLKAQGVSEDVAKRMLEKADGDLDAAVMLIVEHQELEKEEKDLAKV
FT                   MEESLQEAEAESQKRRDLDEERKRSAPAEFFQGCSFLEHLGEDVAAALFSSDAKEDVIA
FT                   ILDLERKCRQWYRARGGDVAEYFSRIAVKAVANVEYEGKGGDESGEQDNIKASSMETVH
FT                   SLLVAHLSDLQDAVLSLPTIPGTIPAIFAPIDVESKIETVDLT"
FT   CDS_pept        join(complement(515504..>517553),c
FT                   omplement(514545..515188))
FT                   /codon_start=1
FT                   /gene_family="HOG000170818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640440"
FT                   /orf_name="MICPUN_84585"
FT                   /product="ATP exporter family"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="ACO69445.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG609268"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniParc:UPI000199C711"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW8"
FT                   /transl_table=1
FT                   /translation="SDTRMISSGQNRLVAFGIVLHALLVYALFDVHFTSPLVHGIEPVT
FT                   AAFAGPASRLVVIVADGLRADRLFELEGRDGRETGAPRGEKVPRAPFLHAIARESGRWG
FT                   VSHARPPTESRPGHVALLAGFWEDPSAITKGWQANAVEFDHLLNQSLAAWAIGAPSVVP
FT                   LFSKGIPHVRSRMYAEELEDFAASSNHAALDEWVFDRAIEVLVGNITEDEQRAGATLET
FT                   ERSALEGDKVVFLLHLLGLDSAGHAHKPSGEGYAENIRVVDAGVRRLAAAFEERFGPED
FT                   GGTAFLFTADHGMSNRGAHGDGDPGCTETPFVAWGAGIASTASRTPVDIACVPRGKDAP
FT                   TPEAEWGLKDEERCDIEQADVASLGASLLGIPPPIHNSGVLPVSYLSPRRSDLRSGAAV
FT                   SNAAQLLSVYRRKSAITAESSLTAYLSPSGLQAYKPLALAKDRLSDAVSARQSGHHNDA
FT                   IDMAQRLARECLDGITYLHLYDRWLLMGTITACFLAWIVFLGSKLVLEQLDTTARDQGN
FT                   GIDADKVHSMVAFAAAGVVCVVLALRRSPVTYYAYFNLPLYFVWYSSAVFSKISLKTSA
FT                   HTRMGLYQASRAFATIAVAVAATQLLCRGFHERIVFSWMFVAASGVLLLLSGWVGARSW
FT                   MPEISRDQRHVVMSASAASAIAALAFAALAPFTTFPIELNADSNLVIAAAVYALFSISY
FT                   ESLFYAVLGVATLAWLCLERCMQKLYAMNQIDYRGKKGELTFMSVSHLRKLEPGDIRHA
FT                   AIFLVLINAAFFGTGNIASVASFEISSVYRFTTRFNPFLMGGLLMLKVLIPMITVAVAF
FT                   LALLKLQRVPAFPVYLVFVVLSDLMAARFFYQVTTEGSWQDIGMSISRYALMGTQIVLI
FT                   QVFLGLADLYTHCLSINGVAAKAKMQ"
FT   CDS_pept        complement(517685..519943)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640441"
FT                   /orf_name="MICPUN_60656"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO69446.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199C712"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFW9"
FT                   /transl_table=1
FT                   /translation="MDVLACAGRAASAPAAVQSTYRPSALATRRISRNRVRVCLVGVGG
FT                   GAPIGTERPARPGASTRGFVRFPRTYRGISMVRALGGEDDDDDAGFDANFGDIDRLAAE
FT                   AEAAAEGDDVDVGDDDPDARLMSYGNQKVVEFGLSGRPLYVCQSIWWLRLSQLKTYPPD
FT                   AEDVRDIARRSGLTTKAVQKWFADALDHYHNLSLADKAKYDIECQAKLDRMEALIVRLG
FT                   TEKPGLFDGRDDEPVNVAAPWKEDGKLSSDEQKKLTLKDPLYIAMDALPDVMAKEAAEA
FT                   KLEKDTEEGLDDEAIARIPQDGSPEQPFLINPYAHSKAGSWSIVKKVGPPTAFEESIEW
FT                   LETGGWEALPDHEIASAVDGGALKFVGVSDETILGSRDRLDIAMPSNADSLAVAEEIDS
FT                   DGILRDAVRHTGDLSRKQLHDLTIGEELEGKIVSLELYHGALVDCGCETDGLIPISEDD
FT                   WPDLVDTLTMGTKVKVKVKAVHERWWRFRFPIELDILSPNVGHLIKTHPHEDGPPINIY
FT                   SGETVPYANMDAGRPLDKFFEVSDVDEEEEERLRVQAISDWVDEKMAETEQKTTKKGNR
FT                   MQRVLAAAKAAAAAAADEKNAANQIPVEDDEEDIRGMSDGGAAQALDTGSGLRGLGERT
FT                   EDMIAAEEEEEEAALFGGDKTVPGIAGPQEDPDAVEEGDEEDEEEDTADENFDGNVNPE
FT                   AEDTRGGVVVTADDLTASSIDYEDDEDEDDDDDEEEAGSKRKKGSVDDDDEDDDDEDL"
FT   CDS_pept        520225..521103
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640442"
FT                   /orf_name="MICPUN_108762"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69155.1"
FT                   /db_xref="UniParc:UPI000199C713"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX0"
FT                   /transl_table=1
FT                   /translation="MALAVANISAFCQLRPLTRGIVPRRAGASHSRGAPVRFAKKGPLF
FT                   GKETSPPLPPSFDEDEADEDDSYSCAIAYAEVDNDAHPTSTLLKVDVSAVPGVMRILSW
FT                   LLNGLDLELNDAEWVIDEDVDDDGSNNDIVHIKMFVTEGIGKGRSKVKDPKAVEERVTE
FT                   YLRFCTQAESKKVGVVEHSGIRIDNATDPERTLLTVRVNETGAKSLLSVASTITGLGLR
FT                   MNRAKLGVSKPSGASTWEMKLTDFESRNKLTSAQVQGLLYTLALVFNTQGFSGADYLVE
FT                   KMTADEGEFAA"
FT   CDS_pept        521414..521863
FT                   /codon_start=1
FT                   /gene_family="HOG000003673" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640443"
FT                   /orf_name="MICPUN_84251"
FT                   /product="Predicted protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69156.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG596607"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI000199C714"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX1"
FT                   /transl_table=1
FT                   /translation="MGCLVNVIHNYGVHVTMCLGPSMLPTFNRSGDFVLVEQLSVMTDN
FT                   IRRGDIVIAKSPTNPRHTVCKRVLGRGGDVIAVPKAGSFGGTQRVEVPPGHIWLQGDNK
FT                   DNSTDSRDYGPVPFGMLRGKVFLKVWPLSELGYVAREEWRSVLTE"
FT   CDS_pept        join(complement(522215..523055),complement(522070..522170))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640444"
FT                   /orf_name="MICPUN_101862"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69447.1"
FT                   /db_xref="UniParc:UPI000199C715"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX2"
FT                   /transl_table=1
FT                   /translation="MGMDESMNSQYTDVCATINASLEAVKALHLNFSQKVDSLDDENQQ
FT                   LRSSLKAANSEVCDLRKRIESAEATAAAAKNEHAAYKVEMLAAEKESAALVSSLRQELA
FT                   VSHATHEETRAALVEERKKAKEAAKTSSATVKELNGKLDTVRDALEKQKETCANLQMDL
FT                   SSTKSKLVQTTREVSVARAELSAVNAQCVDLQREISVAKMEVSAAEKDGKAKMEALLVS
FT                   KEEAAELKALLNDKVAEEAAAHEVTRTQLERLKQESFNLYTAYTNSMQQLQEFREALER
FT                   KARSCARRDAFEVVEHDAPAIQYCNDGKYGVI"
FT   CDS_pept        join(528328..528526,528608..529803)
FT                   /codon_start=1
FT                   /gene_family="HOG000220904" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640445"
FT                   /orf_name="MICPUN_84198"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69157.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG444677"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniParc:UPI000199C716"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX3"
FT                   /transl_table=1
FT                   /translation="MRSARRALGRDSLASRVWRFRGIIAVISPVFLLVLAIVLLMPSTP
FT                   SEHLPFSHDHLSASSSGIPERRYRFAVVIDAGSTGSRVHVFRFEVGARGELVLIDDTFE
FT                   QLKPGLSSFAKEPEKGAASLKPLLATALETVPAAQRASTSVEVRATAGLRMLPGSEADN
FT                   LLEAVLISLDEYPFAFDKDSVSILDGAEEGAFQWLTMNYLLGNLRGGIENTVATVDLGG
FT                   GSVQLAYAAEPVHAQNAPPGYFKEMKSGSNTYSVYVYSHLGYGLMAARAAVLGKAEGKA
FT                   SPCVPAGHDGEYIYGGKTHRVKGGKAADALACKSVVDEVLAPEKDCGAHAQKDCSFNGV
FT                   WDGSRGAGASTFYLSSYLFDRVSQAGLVDPGKPSGDTTPKKILAAAKKACSLSPEQVLQ
FT                   EFKGVEEKDAPYYCHDLSYAHSLLTVGYKLAESGQVTLVKQVTYKDQRVEAAWPLGAAL
FT                   NSLSSA"
FT   CDS_pept        complement(<530464..>530670)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640446"
FT                   /orf_name="MICPUN_74761"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO69448.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000199C717"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX4"
FT                   /transl_table=1
FT                   /translation="QRRKEANRESARRSKQRKKEESELLSSKAQELVRESATLRAELEK
FT                   VQKHVDNLYEENTALRKQISKAGG"
FT   CDS_pept        532191..533795
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640447"
FT                   /orf_name="MICPUN_108763"
FT                   /product="Predicted protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69158.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG713902"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniParc:UPI000199C79E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX5"
FT                   /transl_table=1
FT                   /translation="MVRRTAICAIAAIVVLATVTTVSGQTVDACQTRSTPIGVSITETT
FT                   ADGESNTFLGLLAFFGGAVGESETAPMHLAVASDKYGCKPIAQTTDKAVLVWRGGCTFG
FT                   EKAAAVEAAGGAAMIVVTDEAELTPMSCVGNSTVSIPVMQVLAQDGDQLKSGAAKGASV
FT                   TFKELKLKGSVDLVASFALLAMASLTIVFGAIWSLSDQGFLFKPKSDDDASQGSGGGRE
FT                   GSGGGIEGLEITEMSAAYFVVFASIVLLVIFFTMQHWVFLIIKGVFCFAAVQGLQALFF
FT                   AVFESGFKALSKDIDIPVFGTVNQLSVPSVACAVVVVLVWLLNQDATWAWMLQDIMGMS
FT                   FLVNVLRLVHLPNLKVGALLLVGAMCYDIFWVYIQPHLFGRESVMVKVAKGGEQHESLP
FT                   MLFLFPRLGGNVGDFSMLGYGDVILPGLLIVHNHLFDNRYNESSKPRLAYLVPSIVAYV
FT                   AGLLLTFLALHLQVGGQGGQPALCYLVPTVLGGTVAYAHFRGDLKEMWVGSQDDGNDPD
FT                   GEGERLIGTGSTNSSAV"
FT   CDS_pept        complement(534068..534241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640448"
FT                   /orf_name="MICPUN_60664"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69449.1"
FT                   /db_xref="UniParc:UPI000199C79F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX6"
FT                   /transl_table=1
FT                   /translation="MADELPRLAAELMNTAHVVAKKHNLPRGIFKVGLHLISSSHYIPL
FT                   LPRLLRGVLNTS"
FT   CDS_pept        join(534860..534886,535174..535254,535376..535420,
FT                   535493..535565,535642..535763,535816..535866,
FT                   535947..536604,536728..537134)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640449"
FT                   /orf_name="MICPUN_60665"
FT                   /product="Predicted protein"
FT                   /function="lipid transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69159.1"
FT                   /db_xref="GO:0005319"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609284"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniParc:UPI000199C7A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX7"
FT                   /transl_table=1
FT                   /translation="MKKKCVEFKVMSRLLPFVVNIMVARRLTPEEYGVPTVHFQLISTI
FT                   ILTCREGFRRALMRDAGSGTADGDVTDASQEAAGWLVIPIGAALSAGVPCAVLRLGGLD
FT                   MVRIVEKMHMCIDNPYAQAVASYGFSAFLELLAEPFYIRAQRRSRFRLRFVTETVATIL
FT                   RSLVTFYFVNFTEHHVSLGFAYGQLAYGVTILICYAIAQLDFAYFGCALFLGKTSVKWG
FT                   GTLRLVQTFSTQALLKLFLAEGEKGVLLLVGNADSQGVYGLVSSLGSLFVRIVLQPFEE
FT                   IAFVAFSKKLDSQTTKRKKIENEAKVFATLMRVSGMLGLLVAVHGPLYSEPAIRLLYGK
FT                   RWADTKDVSKSLVMKPNELNGANVALLSSSLLNIMMSIYLQPRVGPTGLIISNSISMCL
FT                   RFAYTMRFVVNERFRGCKLTIASFLPHHVVCLAFIVSLVTTTVTSKLDMGTHILAGFVS
FT                   VSGILMSILFYERNTLTNMVELKTRSKMD"
FT   CDS_pept        join(complement(538137..538568),complement(537996..538060),
FT                   complement(537681..537921),complement(537212..537595))
FT                   /codon_start=1
FT                   /gene_family="HOG000204877" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640450"
FT                   /orf_name="MICPUN_91450"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69450.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG562290"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199C7A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX8"
FT                   /transl_table=1
FT                   /translation="MYTSLAIAATGAAASAASLGYWQYLIFKLPIGFGCGGIGVSSFVL
FT                   STEPLGAKWRAFLGIATQYWWASGICFMSGVAAIMTEWRTLTFFFVFLTGMYAIFSSPL
FT                   VKESPRWLLISGEVEKAHAILTTYAKVNDKAIPPEGLPPLKLPNENSKTASIGDLLPFP
FT                   SLRRRLVAMAFIFFVNSMVYYGLSLNVGSLGGSIYLNNFLSGLVEMPSYAFAQFAVEAM
FT                   GRQRTLVLLLAIAGIGCLISGFAQGTAKTVVALAGRFGIAASFNMIFLYTTELFPTVVR
FT                   SAALGFCSLVARVSGIAAPQIIALQMFEPALPFLIFGGFAVAACLMATALPETKGVNVE
FT                   DTLEGAAAQSASLNGATNFTRLEESEEEEMLRV"
FT   CDS_pept        539275..540717
FT                   /codon_start=1
FT                   /gene_family="HOG000241099" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640451"
FT                   /orf_name="MICPUN_60667"
FT                   /product="Galactokinase"
FT                   /function="ATP binding"
FT                   /function="galactokinase activity"
FT                   /biological_process="galactose metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69160.1"
FT                   /db_xref="GO:0004335"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006012"
FT                   /db_xref="HOGENOM:HBG725121"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199C7A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFX9"
FT                   /transl_table=1
FT                   /translation="MSEIPVVNDIKVVYGEQLGDAEERYARLIATFEEQYGGKPDLLAR
FT                   SPGRVNLIGEHIDYEGYSVLPMALALDTIVAVKVDAGSDKLVVSNTNPEYTTKEFSTDP
FT                   SQQVDTASLHWTNYCMCGYKGVFDFLGEAGKALPEAIGLKIMVDGRVPTGSGLSSSSAL
FT                   TCATAVAVMAAHNLAFTKAEVADFTCKCERHSGTQSGGMDQAISIMGQVGVAKLVDFNP
FT                   VRASDVKLPKGSAFLIGNCLAVSNKAETAHERYNLRVMECRLASIVLAMELGVAQAEAL
FT                   EFSTLLQVQKLTGNLEESEKAADKLLHDGAYTKVELEEKLGKSLDDLFKDSPASLLVLQ
FT                   HNTKGFKLHDRAVHVYSEAARVHKFSDECAANPSLQRLGELMNASHESCRKFYECSCQE
FT                   LDELVEAFRSCGAIGARLTGAGWGGCAVALVELDMVDSVLSRVKDMFFKARIDSGRLLE
FT                   GGISEVLFASLPSSGAAILKGI"
FT   CDS_pept        complement(540845..541213)
FT                   /codon_start=1
FT                   /gene_family="HOG000082940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640452"
FT                   /orf_name="MICPUN_60668"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69451.1"
FT                   /db_xref="HOGENOM:HBG609283"
FT                   /db_xref="UniParc:UPI000199C7A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY0"
FT                   /transl_table=1
FT                   /translation="MSASFVASTGALPLTATLLHSKYRRPTYTASKGSSRGNLLTVRAE
FT                   SKDQAGCTGSCDSCGLAKEKMQCDGSGRIIGGMGAIPLFSWWPIKAYRPCPGLIESGGV
FT                   YVRKGQDVDGILFGEKGK"
FT   CDS_pept        complement(541450..542157)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640453"
FT                   /orf_name="MICPUN_84449"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69452.1"
FT                   /db_xref="HOGENOM:HBG562292"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199C7A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY1"
FT                   /transl_table=1
FT                   /translation="MPSDDSSSTQPSRRQIFGTGLAAAIVVSLPSGARAEVETFKNPSD
FT                   LGDGYLRFYGEATTSSSYGGYGGNENNFDKFKYYYDIPQGWTVDTVNKVEKSTNGTDSR
FT                   WSNPKSSGEKVYCVTLTGYNRLKEDRQGILSDLALSDYNLQDAIVAADSVEVVDRDVNG
FT                   QTYVDFDLYGFFGAIFASVTVYGGRLYAVFSVVPDALVEKDKEQGKRLRNSFGTISKDD
FT                   EQTQYDLEFYKRS"
FT   CDS_pept        join(542706..543128,543262..544530)
FT                   /codon_start=1
FT                   /gene_family="HOG000117912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640454"
FT                   /gene_name="CITT_1"
FT                   /orf_name="MICPUN_104913"
FT                   /product="Divalent Anion:Na+ symporter family "
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69161.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG321139"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniParc:UPI000199C7A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY2"
FT                   /transl_table=1
FT                   /translation="MLTHAASAPVATAARAINPKSTVRGSVSTASLSTNAAASRSAQFV
FT                   QGERAAAFSLRQHRQSSAVSKRSLVKRVVSASASSGVPAVQAAAASEWKGAKLKPLGYS
FT                   VLAGLLIWLIPAPAGVSAQAWHLLAVFVGTIVGIITNPLPLGATAMIGLGVSMVTGLLP
FT                   FAAAFSAFSSEIPWLIALAFFLARGFIKTGLGNRIAYYIVSLFGKSTLGLTYSLVFSEA
FT                   LLAPAIPSLAARAGGIFLPLTKALCVACGSEPEKGTEKKMGAYVMTTVFQTSTVTSGMF
FT                   ITAMAANPLSVNLAAATIGQTITWGQWALAASVPGLICLVAVPLILYVLYPPEVKDSPE
FT                   APVKAKEELEKLGPMTSDEKIMAAALSVTVALWIFGSKFGIGAVAAALVGLSTLLITGV
FT                   ITWKECLAEGPAWDTLTWFAALIAMAAYLNKYGLIPWFSSTVVKVVSAAGLAWQPAFLV
FT                   VVLLYFYSHYMFASGAAHIGAMYTAFLSVLVACGAPPLASALVLGIFSNIMGCTTHYGI
FT                   GSAPPFFGAGYVPLATWWKIGFGLSVFYIATFLGIGSVWWKLIGIY"
FT   CDS_pept        complement(544757..545488)
FT                   /codon_start=1
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640455"
FT                   /orf_name="MICPUN_84618"
FT                   /product="Predicted protein"
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="ACO69453.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI000199C7A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY3"
FT                   /transl_table=1
FT                   /translation="MHIFQDQAEVADALASLTMKAAEQAIEERGSFTVALAGGSLIKLL
FT                   GGLKGKNGIDWDNWHVFWVDERCVPHDDPESNYGGALQALLSDVPIPASQLYAIKESLC
FT                   QKNEGAAQPCAAEYDARLKGLSRSILPTKDGLPIFDLLLLGFGPDGHICSLFPEHPLLK
FT                   VTQPWILPISDSPKPPPERITFSMPVVNAAKKKCFTAIGEGKAEMAATIIKSAGDDPKI
FT                   PASYVKGDVAWLMDAAGASLL"
FT   CDS_pept        join(545952..546122,546275..553222)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640456"
FT                   /orf_name="MICPUN_60672"
FT                   /product="Predicted protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69162.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="UniParc:UPI000199C7A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY4"
FT                   /transl_table=1
FT                   /translation="MLPLPEVIRLSLLETARLSDEKLLKRTHGDILASLEGPSDARVGR
FT                   DTLVLCAEVALKVGATTIATQMLDIYFLESSKFWSDDSDIGQVELKDQYVCRAWFAKAL
FT                   VCSEDAKGLTGQDLVTGVERALNCLLEGLKVALQDSRYVFLLYDASVHYWNISRPLQKS
FT                   GTRRHLVDASTSVNDALQKVSGHEEWKAHHLRIHALCLSDAGKNADALKVASDAVDLCK
FT                   ANVPELSVLAIKVKSHVSSLEGLKEGGDGVDGAIALMQHVRSGACADIEDIKNTLIEAW
FT                   KLVDPAAEKLEAAKDESAEDAQLDIVAEIGWVAAQNQVLDIAAWCLERAADDSRLISRV
FT                   RDEMTRGMIALHNLGEKRGTLDSEAVRVHKDVILQAEKSLSTFSRLQDFDGIHDACQMI
FT                   WIASLPLQQSKFRHHLTRVLGAAALALETVGSSANRLRTALHLELAYCYISEDMVGQAK
FT                   AQVSKGLAIDYVAPAEEIESTGYERPLDRFLDPLHRMLSLKSKIHDDPDDIEDQALLLA
FT                   EQARDAKSVESKTDILQRAVDALMSLQPATLPSESDEMSTEEREMCRRSARARINIWGS
FT                   VIKVAMDAKQISMVHRLAKNVVDTAGWDLIKDKDIILLQADVNLLDGLASFDILRSRGE
FT                   PVIPPNEINTQVTISAGSTEELQNNTIAAFVRAMHLGASVGEDWVVMNAAANVWNNYLD
FT                   AFTAHRYAEMLPATAPVFAELCKIESCDKVLLGNFADALSCGYEHAAFLSVTDADDTKE
FT                   DGVFGYNSLRLTLRDHKFEDSQDVQRGIETCESVLNRVDERNARKLSATLARLHASMGT
FT                   SSEAKVEEDPVAQVSAIIQRLTLPGSDDASSDMLNEAMTLLRPTEGEILGDLETWARLG
FT                   ETALKAKVYGAAIECGKQAEIFLNKLTQSAPSISWYWGGVAESTFGCGILALIRPEHQD
FT                   QSTQDTLRETAFQHLVQAAKCGRRANRSDIVSYAAKHFWNSATSYMSSATTRRNIFGHL
FT                   QVIIDACRATKVRDDGLMKLMWVLYFDCLVDKKAWTDGIKHIDEAFKMLPTSDHQRLWE
FT                   YKVLFLSATGRKAEDELDILSSYDEETQAKVWAGVAVQATSKLEGMKAYRKAIDVLVNN
FT                   TAMRVDLMIDFADWMYANGQPVSDAEDLLVSTLDILLETDAESSGDNMDCESLATPQQL
FT                   GVTEFCFIVRVCVMLSRMSGSNVERTDYLLTAQHYALRMLIDPLAEAMRTMPASSVEGC
FT                   AAIPESLEEWANFKFTDKLVARMRERKGTFEISLESVGRPERILHYIDYLCSGLESASM
FT                   HLQCLPVCQLGVLIAKIVDKDDSLASVYHLRLASLADALFLKSAAIMHEELAGSLELSV
FT                   EEIRRGREEVKRQESLKELLSDDEPSSGVIDVSKPLRPYALRDYWIARGAYLEKRGALV
FT                   AANLLLQETIRHARAHDDVAVEARAYLHLAKCAARGNMPIDAVKLQHRGQNLGGDVSFW
FT                   GESMCDYTMYKLTTRDGKLSAKDSLVTALNLLQSRSSSSRCGDTLDTKMVMASLLTELS
FT                   RILELEIKNAIEVGENPHPQYTDAVNAISEAVAILQDCGGGIDYVNVLMAKAMLMYKDP
FT                   SATGDPRPGLRVIKEIIFEAETEAERIYTAACVSSINPLTISLPAARLLAAVKNARAGC
FT                   LLEIAHAEKVLEHVDRENNRPDFPSIQGVDATAILAFLDDNAPESFKDTLNDAEEAIVV
FT                   ASEATNLHKRDDGRIDSLCLLGEALLAVHNAQTRTKIWRKPPPVPPPTPPPPPAPPTPD
FT                   EKEEEAAAEAGDSKEDSEGAETEDVKPEQVADDAPEGDRQSVASDAETDIPSVGEEDEE
FT                   DEESHLPHSTFRGELVKPRAIRSLEQAIQFGIEACKYDIVSKAAVHLAHAHGSADTGKA
FT                   AAALALVQSCQAVETHLSIFISAADEKDIESLIIRNDRIIQGALNDMTSSKYSASLFER
FT                   LKTSCTAWGKLQIDAKQALSASSTLPDDLYVFSLQWLVGRGGDTSLAIAIHGKDDERTG
FT                   AYVVSANQEQLEAAVQLTATYRSNVEKAVIAASSSEDPDALQSVFESVDIVAGWDEVRK
FT                   ATEWVLEPIISAWRSFLGKGGSKEKKIVLLVDEALASLPIEALEFLNDAESISRDFSLH
FT                   MLSNRLARGSDITAAHMTALIDLRKEDLPQSDADKIRIPGEFALLQQKFGSGWNVLMGT
FT                   PESIPGEAECQRAMAAAKALLYYGHGRFLSYVSPSAVASVDLSSCRLAVLACNTNNEES
FT                   QRMQAMLDGRKTAEKKALEEPYRTAALLSMRGVESIVLPSFTVGNARANSEFLTSVLGG
FT                   GPVASSVWRADTPKPPRKEDEIEENEPEEKEVEEPEEGAKAEGEDEAGDDEAEAVEPPP
FT                   PPPPPPPPSGPYRTYVVYGHPLVKIS"
FT   CDS_pept        join(complement(554817..555000),complement(553360..554708))
FT                   /codon_start=1
FT                   /gene_family="HOG000076502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640457"
FT                   /orf_name="MICPUN_60673"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="ACO69454.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG694883"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI000199C7A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY5"
FT                   /transl_table=1
FT                   /translation="MAAFAPNSALVFSGRGATGARSLSSRSIAKPVAINDQSRARKVNV
FT                   GVRAATGSIREQAGRRAPLEKSTLFNCKYVPFSGDQNEEYSIDDVIYRSKNGGLLDVQH
FT                   DMEALAIYPPEYWKALFDERVGKTVWPYGSGVWSKKEWVLPGISDDDIVSMFEGNSNLF
FT                   WADRYGREVLGMNDLWVKQCGNSHTGSFKDLGMTALVSQVNRMRKQGKPLAAVGCASTG
FT                   DTSAALSAYAAAAGIPSIVFLPADKISLAQLVQPIANGSLVLSIDTDFDGCMRLIREVT
FT                   AELPIYLANSLNSLRLEGQKTAAIEILQQFDWQVPDYVIIPGGNLGNVYAFFKGFKMCK
FT                   DLGLVDKLPRMVVAQAHNANPLYRAYKTGFEKFEAIKAEPTFASAIQIGDPVSIDRAVY
FT                   ALKETNGIVEEATEEELMDAAAEADLTGMFNCPHTGVALAALKKLREAQTIGPSDKVVV
FT                   VSTAHGLKFAQSKVAYHAGEIEGIVGKFANPPVEVKEDFGLVMDVLKERLVQ"
FT   CDS_pept        join(555053..555104,555621..556219)
FT                   /codon_start=1
FT                   /gene_family="HOG000252083" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640458"
FT                   /orf_name="MICPUN_97757"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="adenyl-nucleotide exchange factor activity "
FT                   /function="chaperone binding"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein import into mitochondrial
FT                   matrix"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO69163.1"
FT                   /db_xref="GO:0000774"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0030150"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG732630"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniParc:UPI000199C7A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY6"
FT                   /transl_table=1
FT                   /translation="MIAATGPTSRQHDVPRVEKKEDDKAGEDDETEGAEDGEDVNEDEV
FT                   ADEEVQKLTAELSEKTAQVKDLNDKLLRTLADMENLRERTRRQAETAEKFAIQGFCKDL
FT                   LDVADNLARASATVDPEALETETDAANIKNVLASLHEGVLMVEKQLMSTFGKHGVVKFD
FT                   PAEGDPFNPNDHMALFNVPKGEKEAGTVAAVTKVGYKLHDRVIRPAEVGVFQS"
FT   CDS_pept        555212..556219
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640459"
FT                   /orf_name="MICPUN_97757"
FT                   /product="Predicted protein"
FT                   /function="adenyl-nucleotide exchange factor activity "
FT                   /function="chaperone binding"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein import into mitochondrial
FT                   matrix"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO69164.1"
FT                   /db_xref="GO:0000774"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0030150"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniParc:UPI000199C838"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY7"
FT                   /transl_table=1
FT                   /translation="MTDYRVKRGERLKKYGLDASFSLLSIWLPHRFERRFPRARRGARR
FT                   ISGRTISSGMIRSIFRACRSAANRMPPPEHIMPVAARATARSARQSFHHVPTVTRPSSS
FT                   FAARSGVNQQRPSFACSEIAGRAHSFSTESSEEKKEDDKAGEDDETEGAEDGEDVNEDE
FT                   VADEEVQKLTAELSEKTAQVKDLNDKLLRTLADMENLRERTRRQAETAEKFAIQGFCKD
FT                   LLDVADNLARASATVDPEALETETDAANIKNVLASLHEGVLMVEKQLMSTFGKHGVVKF
FT                   DPAEGDPFNPNDHMALFNVPKGEKEAGTVAAVTKVGYKLHDRVIRPAEVGVFQS"
FT   CDS_pept        complement(556274..558214)
FT                   /codon_start=1
FT                   /gene_family="HOG000201168" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640460"
FT                   /orf_name="MICPUN_60675"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69455.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG562295"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000199C839"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY8"
FT                   /transl_table=1
FT                   /translation="MSYEGVGGGCMDEPELLQFATERYVEAEASAVDLETDGLTDLQLC
FT                   AQYCRECTVSVQRMFHVRSLGRVCADALRVGAEPFPLDLLEDLAQDDDSEVRQSVAEQL
FT                   GVLTNAIKISRRKQEDDLALGLLNVAFLLVEDDSDGVVAAAEDATATVATLCTTGEERA
FT                   FLISRVEELCRCEEEEIRISGSKIAGELAEVLGAETTASTLAPLLTELSKDGALQVREA
FT                   TVRATVRAGETLRGTDAVIQLFDIFSSLANDPVWSVRKACADSLVGLSKSVGQDAFAAF
FT                   AQELFETLANDVSLQVRTGMLENLGPLIAELGRERTSESLVDHFVSMAESTGGSASGLQ
FT                   LSCAFAMPGVALTLGRERWAEIRGAYDMLAHSVHWKVRRSLACSLHEMARILGSELADA
FT                   DLVPVFQEMLGDTDEVSIGVVNNLAAFMREIPPTVRLDHLHVLARIATPKSDVTIGNWR
FT                   LRAAMTEQLGDLSKILPASANEEMTIPLALRLLKDPASAVREACIAVIGSVLQNSSDGS
FT                   SSAWRSGQIGRAMSAIKLMATNQHWADRQAYVRICGAFAGSINDNVLIEELLPLMLMTV
FT                   DDNVPNVRSELAKSLANLRTKDIFAELPDVSAAAEALRNDPDPDVSRHCVITDRSKHLE
FT                   FSTGLRATPVK"
FT   CDS_pept        561213..562961
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640461"
FT                   /orf_name="MICPUN_104914"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69165.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008907"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C83A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFY9"
FT                   /transl_table=1
FT                   /translation="MKAAQGGKSKSQAEDQPEDEEEEEEEAGFGIRGDVEDIEPPAAFA
FT                   AFANEEAADPVDPDEAADPLEPTEPADAAEQAGPGIEMSKKAANLAKLMKKRAKKGHDM
FT                   KSWDTKDAIDKIGQSAVPKSMVQESGKGMTIKELFKRYDVDNSGGLDQEELKQVMKDLE
FT                   VMPSGITEEEAAYTLGEYFKLADENSDGIISWEEFALFYRDLQEVKKSDLDHVPVTVPK
FT                   KYRNSKEFLEIFVKHCSFGAGQKRVEEMASKSFLKCLNEVDVIDNKQLTEAMVDQVFTK
FT                   FVKDHPRKRLTYNKFLDALAQICSYKDLDFDDIAGYIHDEGGPKVTGSQGPATMRKTGL
FT                   PDRSGGSGDDRPKAGTQKLPKKAAPAKEKSRINVLKSGSGKAELTARNVFDKFDDDGQG
FT                   QIDRVEFKQVCIFLGLDKEEGFDFEEEFDTANKSDTGMISWNEFNVWFNGLKGKAVTKV
FT                   EKVSSELVNDKEFKTLFEEWANFGIPTKKQKKVAEMQSAGLNKMLMKTGLKKPGIEHAW
FT                   MDNVFKKHAEKPNAKVMKYRPFLDCLAEIAATDKKKLDDFVKAIKEHGSPKAKATEVDH
FT                   LGRPIR"
FT   CDS_pept        join(complement(563528..564088),complement(563009..563437))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640462"
FT                   /orf_name="MICPUN_53075"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69456.1"
FT                   /db_xref="UniParc:UPI000199C83B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ0"
FT                   /transl_table=1
FT                   /translation="MLYRQWRDSCDGVRQGDSNAQLRAALEGRSSQLEEKAAARETAAR
FT                   EHAAFEVMYEAERLKKEERHAREMADIKKKADEAVRVLDQQVAENRKLRAEKAEAAKRE
FT                   VEEMKSRWAAEEARHDADIAAKLAKNMRIGEELKAFKAARQAELAAIKEREEAINRELL
FT                   EEAMRQKAEEEAREAELKERKKEQALYEAKRQAEKDRAEAARAKLMAEVHADRERQLAQ
FT                   HAIAREMAAEAKITDKLRMRKELAEMDAVEEEHKARVHAQRMKNRLDIEAQIQYKDSLA
FT                   RKQKEDARQAWEGALQAEKDYQSMIDFDAAQARPAVPNYGRKSTAWYH"
FT   CDS_pept        565107..566636
FT                   /codon_start=1
FT                   /gene_family="HOG000207983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640463"
FT                   /orf_name="MICPUN_84401"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69166.1"
FT                   /db_xref="HOGENOM:HBG627639"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR019175"
FT                   /db_xref="UniParc:UPI000199C83C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ1"
FT                   /transl_table=1
FT                   /translation="MATLADSFLADLDDLSDEDDVADEPVKDEPAEDGVKAEAAEGPVS
FT                   GVDFRSLDAVAKLVGSERYRRVISQVDDALAADAKKMEEEGDASAGPGSTLGVVDEGAY
FT                   QLIVDCNALSVEIENEIQVVHNFIRDRYRSKFPELESLVMHPIDYARVVKAIGNEMDMT
FT                   KVELESVLPSATIMVVSVTGSTTNGQPLSADDLDTTVRACDVQLQLDADKRKLVALVEA
FT                   RMDRTAPNLSAVLGPEVASKLMSVAGGLVALSKMPANNVQVLGQKRKSAAGMSSATAVR
FT                   AGDLHVGFINQCDIIQRKTPPPLRMRAARLVAGKCTLMARVDAFGEDPSGSTGRNMHEE
FT                   MVKKIEKWQEPPPARTAKPLAIPGGEVKKRRGGKRARAWKERFGASDMRKAANRVNFNV
FT                   AEEEIGYEGEGLGTLGTSAGMAAASGKLKLTAKPAKMKVPKNLQKKMMNYGSGGATSGL
FT                   SSSLAFTPIQGIELVNPNVNKDATSGTDSVFSEMRGFRKVSAGTLQRELKD"
FT   CDS_pept        join(complement(567089..567178),complement(566819..567025))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640464"
FT                   /orf_name="MICPUN_60679"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69457.1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014912"
FT                   /db_xref="UniParc:UPI000199C83D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ2"
FT                   /transl_table=1
FT                   /translation="MTRVGVLVSAFLLFAVTLVAAEEQHTATSDEFFKETVDKGLIDGV
FT                   RVRYIPGNAPELVMFDMTGKEKERINLEKMSVTEIKMLLASHGFAERARKVEL"
FT   CDS_pept        567286..567954
FT                   /codon_start=1
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640465"
FT                   /gene_name="MSD"
FT                   /orf_name="MICPUN_60680"
FT                   /product="Manganese superoxide dismutase "
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ACO69167.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG507761"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniParc:UPI000199C83E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ3"
FT                   /transl_table=1
FT                   /translation="MLRTARRLAGAVRPLGNAPQVRTFVAAKLPDLDYDYGALEPVVSG
FT                   EIMQLHHSKHHNTYVTNFNVAMEKYSEAEIKGDYATMISLQGAIKFNGGGHVNHSIFWK
FT                   NLAPAKDCAPPDGELLKLIERDFGSLAKLQEKFSAQTVAVQGSGWGWLGYDKASGSLKI
FT                   ATTANQDPCATVGLTPLLGVDVWEHAYYLQYKNLRPDYVKAVWEIVNWKNVAENLAAAK
FT                   "
FT   CDS_pept        join(complement(568548..568592),complement(567991..568431))
FT                   /codon_start=1
FT                   /gene_family="HOG000242493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640466"
FT                   /orf_name="MICPUN_53076"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69458.1"
FT                   /db_xref="HOGENOM:HBG595165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C83F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ4"
FT                   /transl_table=1
FT                   /translation="MSAEAAQETVDDFVVAARYGDMEDVQQYLSQGVSVDAVDVEGRTA
FT                   LFFAAANGHLEIVELLLEKEADPNIANAQGNTALHWACVNGHTAVVEKLLSVGAKTAVC
FT                   NAGGRTALDEAMHNDRQECIDAILKASGVEDEEHEDDIEVEGEEAEEIIVGPDDIAE"
FT   CDS_pept        join(complement(569889..569891),complement(569590..569676),
FT                   complement(568956..569267))
FT                   /codon_start=1
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640467"
FT                   /orf_name="MICPUN_91456"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69459.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG497568"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniParc:UPI000199C840"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ5"
FT                   /transl_table=1
FT                   /translation="MVTPLVKHKIVKKRTAKFKRFQSDRKVTVKESWRKPRGIDGRFRR
FT                   KFKGLPPHPNVGYGSNKKTKHLLPNGFYKFVVHNVADLDLLMMHNRKYCAEVAHNVSTL
FT                   NRKAIVERAQQLNVNVINKSAKLRSEEDE"
FT   CDS_pept        613583..615313
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640468"
FT                   /orf_name="MICPUN_108771"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69168.1"
FT                   /db_xref="UniParc:UPI000199C841"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ6"
FT                   /transl_table=1
FT                   /translation="MTPVFIYFYWDFNDYLQLSFLFGFRKNDLIIYLLFGLVIIPFQII
FT                   MDIFIFNIQELFHGWKVYEYMKYARYRFRHRTARWKGLEKTYDESIDYSLRTVDQLCFS
FT                   SQFYFVLGIGGSGSFLFVLSLSMMLRVNYNMFEDILFGLVVSLMLGLCMITRRVALFLA
FT                   DLVGLWKIDSRLDDDMINEDDLPTDFQLFGDKADTERDTEASERGEFTLADLTTDSFRR
FT                   KFLEHNRMWLLDQFAELLTPRTAKKFRKMGGKIRGTGGLSDSDSDEGERDRFEGDVILA
FT                   DTSAHVMRMWLHEASKRTGGGRMARRLGLSETSDSDMDKGPKWPPAKLSPEAQALAKGW
FT                   LAAVKAVRAARGDRPAGELSSSDTDTDGGGLRSQWGTPVVSPASAALVRDWLQRARKKV
FT                   GETPKGGGLTSSSDSGSSDGDLDRLVSLKPASAVVMRQWIAAVRARSRGISNDQLVSRM
FT                   RSELSSSSGESEGETGFDGPASVSATGQSLIRWWLVNLRRRMAEEGERMIAESIEQARS
FT                   QLPQAPTGDDGFPDDDEFTDSSDDNFPVAQMSTDPTYTTSDPNAGRRGSSDESNLDSSD
FT                   "
FT   CDS_pept        join(complement(616830..617120),complement(615515..616744))
FT                   /codon_start=1
FT                   /gene_family="HOG000006748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640469"
FT                   /orf_name="MICPUN_60684"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69460.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG562300"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C842"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ7"
FT                   /transl_table=1
FT                   /translation="MASLSVLVCGGGNAAHVFGGQLAARHVNTCLLTTFPGEAERLSAG
FT                   GLSDDHHDRSHLGSQRALRAPHITVKNWPLDDSGTKFGILRGSPTVCASFEEAFRNTTR
FT                   YDAIILALPAFAHDTYLAGIAPYLKLEDTRHNPTVICAAVAQGGFDLAARAALNEAEVT
FT                   APVVIAGFETLPWACRILRPGREVEVLGAKETVDVAISFYPNQTKASVQITMETLQTVV
FT                   GRCPTVKLASGFLGVTLMDINCLWHPTLMYHRWRDWDGHDTFTEAPLLYEECSDEVGES
FT                   LMAISDEVAAVCKKIRNTFPGVLLDDLSSARSCVEWFLRSYGDEPGLDKSSVATMMRTN
FT                   RAYHGLRHPMKHRVKYDEHGSAIPEANAPLVPDFSHRYLTEDVPFGLVVLRGIAELAGV
FT                   PTPTIDKILLWAQNASGVRYLVRRTINLEDAEADFDQSEANTSNFTLRGEHVFRTRCPQ
FT                   RFGWFELNHFMVDNGYVTSASTSNTEGTLFGSTRKTSATDITKSAGAA"
FT   CDS_pept        617457..620111
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640470"
FT                   /orf_name="MICPUN_60685"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69169.1"
FT                   /db_xref="UniParc:UPI000199C843"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ8"
FT                   /transl_table=1
FT                   /translation="MEEPAVTPAAMHDDEDDEDILVVRRHKRSRPVAKDGAVDGNSDDT
FT                   SPRGPIDASQADSPVKSSDDEQADEQDGLPGNRKFKLRRKGAIEEEEKEKAANVPGEMP
FT                   DDSDLELDLSNGGVDEEEYEEEDVVYGSDDEEGQMEVMLKQKGTLDGFGLDDDAADGSG
FT                   EDDESDESDLEDSEDERELQDEVERLKAEAAKRTAEAAKAAKPPPENETEEERIEREKA
FT                   ETAEAQREIMREAGKRAHFAGYHQVPDRDPFAYRKIFAAIKQMKDSLNLPPPPPSPEVS
FT                   DDEDAGEFAGEVEDEDGDLPDDEEEAELDSQAGDDEDEPANKKMPEEEEKEEEMVVLDV
FT                   DDEEDDLGYDQDALSKMLAEVQARAAETKAKAVAEAQAAAAKAQEEPDAEPPVVDFDDE
FT                   EAILREKAAQNLREKREAAKETLNPEEEEEDEGEEAESEDDLSEEEAVEMTRKERLRQL
FT                   KAAKAFFKADAKAAERTARGEVLEDEAELSEDGGHTDDEEEVEVEVGDGEERVIRRIRA
FT                   KRGDGLLDREELEEMVDYIDFNESKDDDERRAAKRAAAHARFEEERDEEELKKMQEALK
FT                   NGFRRPNKNGGYDDGPDYWQRRMRQREEGDSEGEEFDIDIPDRAWEHVELSDDDDGEWA
FT                   ERAERRKKVAAAQEAAKKERESQRESQGLDSQDVDEDSQLPSAKDFGFLGSQDFKSMMA
FT                   AGKSRRRRVGVGLAAAAMETQASAGSLPSHPSASMPAPAPRQVKAPCLDRTSSSMSFLG
FT                   KSGGGSRSNHGSNGLSRSFSLGDRGTSRSFVFGGGGDSLSMWEKDAEENGTAPAPTVLA
FT                   ELGGSDNANFGWAPREANTKPATKSKLSGSQSLFGMLQASQDWDEQVLTRSDSLTEAVK
FT                   AAKDIKLRPAMPR"
FT   CDS_pept        complement(620224..620613)
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640471"
FT                   /orf_name="MICPUN_84078"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69461.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199C844"
FT                   /db_xref="UniProtKB/TrEMBL:C1FFZ9"
FT                   /transl_table=1
FT                   /translation="MPPTLELQIERAGDGKNYPKKGDNVSVHYTMRLSSGREVDNSYKR
FT                   KTPFRFRVASGQVVKGWDQAVTQLSVGEKATTTFPANLAFGRTGLPGLIPPNQDLNVTL
FT                   ELVSIETDADVEAMLTGDDSFAVAE"
FT   CDS_pept        join(complement(622071..622103),complement(621013..621681))
FT                   /codon_start=1
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640472"
FT                   /orf_name="MICPUN_91459"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ACO69462.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG748975"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniParc:UPI000199C845"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG00"
FT                   /transl_table=1
FT                   /translation="MSSGNISKKRKFVADGVFFAELNELLIRELAEDGYSGVEVRVTPM
FT                   RTEIIIRATRTQNVLGEKGRRIRELTSLVQKRFGFAEGSVELYAEKVANRGLCAIAQAE
FT                   SLRYKLLGGLAVRRACYGVLRFIMENGAKGAEVVVSGKLRGQRGKAMKFKDGYMISSGN
FT                   PVREYIESACLHVLLRQGCVGVKVKIMLDWDPKGRTGPKTPIPDTVTIHNPKDEDESGL
FT                   AKPFVGKELEM"
FT   CDS_pept        622288..622635
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640473"
FT                   /orf_name="MICPUN_60688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69170.1"
FT                   /db_xref="UniParc:UPI000199C846"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG01"
FT                   /transl_table=1
FT                   /translation="MRQSQKKARLLLSSKITSQAWPAALWRELDSESMESFQQDALRFG
FT                   CLRGFKHMSLRPRGKEELLVTVHHRDDALGLSPGPWMTAPRPRQRDFSVDDDEPESPRA
FT                   KSKRRVDSTAP"
FT   CDS_pept        join(622907..623149,623185..623487)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640474"
FT                   /orf_name="MICPUN_60689"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69171.1"
FT                   /db_xref="UniParc:UPI000199C847"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG02"
FT                   /transl_table=1
FT                   /translation="MADDENEPGSPRARPRRTEVQAEDLTTSPSRPKSATADASTFLIG
FT                   AYAKYDRPYVWLREGGRIRSDGTGADDLPLDLNTLRRKSVGRGRGTGGDERFSNSTQRV
FT                   RGGSWRDQTDGGGGEVSRRGRHGWIFARHPRGRGAAGGFGAGREGTRGGFRGPGGRRYR
FT                   QTGGGAPRRGAPSTFGSQ"
FT   CDS_pept        complement(623543..626026)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640475"
FT                   /orf_name="MICPUN_60690"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69463.1"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="UniParc:UPI000199C8CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG03"
FT                   /transl_table=1
FT                   /translation="MSKEGDQSSSGWGWGSDWGVGNLDITSTLNSIDVTSQLNAVMESA
FT                   QSIDISSTVNSLSEQASTMVREMEETVEREYKAMEANEVAMAAAGAATVGATVAAAASP
FT                   KSSEDVGLGWKTGDAADEPKDEAETVAPGSPTFPAAPVDVPEKGGKRDGDKIATPPAPT
FT                   PAPGFPKDDAKGRDDADAAGAQVAKEEIVPKEARMDEASSDEPAPAEDADGPAPAEDAD
FT                   EPAPAEDVAPPRSHPIPPEPKPSAAPPTESDSLAARIEALEAELAVTRETLNAREAQLL
FT                   KSASKATAAAELELALNELRDKLAAAEHATGQAIKERDQWKRQYEKSGDNAMLLKEKDA
FT                   IIQEVMEEGENLSKKQMEMEMRLRERAKEIKDLKEKQADLVEQAVAAKRTEFQADLKSA
FT                   MARAAKELDEQKSYYIQQLTSAKTAAAAAEAATDSAARQTLGKQLKEAEESIESLKEQV
FT                   EGLQQALTRASEKAAAREERLAEDLRDAEQRLQESDARHEELAQRLPESTRPLLRQIET
FT                   MRAQESERAEAWSGAERAMLARVAAAEEATEVATAAQLAAAEDAADAKSRVHDAEAAAN
FT                   RARAEADAARKRLQEREEQLSEERTRVEAATEAAAAQEGKLRALEDQAREREGRLKQQL
FT                   AEERGRLEAAKAAWERERLELESSLAEVKDKLTDATKKLEEREEEVRAANRAKTSGDGV
FT                   RDTVQAALDRAARSVNTAGSGGAELAVMRATEELQRQIRSKEVEITIVQDRVKQLEASE
FT                   RALSDELVRQTQLMDEAGDPRQLRAELQELEGRHIDALELMGETSEENEELKDRVQGLR
FT                   MEVDRLTEQLAAAMA"
FT   CDS_pept        626129..626680
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640476"
FT                   /orf_name="MICPUN_84039"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69172.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199C8CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG04"
FT                   /transl_table=1
FT                   /translation="MAGAPQVSQWGLDPLFFSHPKLAIRELVGGEDVWVPAPEGNGAVH
FT                   LYRGRPVRRCEMMGCVVSLNPKPGKTVFTLDDGTGCVECVVWMGMDETGTAGGGGTDGT
FT                   VGADAFGVDPDGLRVGALVRIQGRMTMYRAKWQLAVNALQCCKDPNEEILFWVDWVRAG
FT                   EDIEAGRVAPRTDPGKNEQQ"
FT   CDS_pept        join(complement(630452..630689),complement(626734..630284))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640477"
FT                   /orf_name="MICPUN_60692"
FT                   /product="PAF1 complex protein"
FT                   /function="binding"
FT                   /protein_id="ACO69464.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG562307"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C8CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG05"
FT                   /transl_table=1
FT                   /translation="MAMMDTENGVRDIIYVPIGQTEEAVALPVDDLPDDPSEVLVLLQQ
FT                   EFAPLDIWLDIAKAYLQQGKEENFHAILSNATEDEIEEYYPDSQYERSCILCTLASYYV
FT                   NIAKGESDQINRVELLTKAEKLIDKADLLWQHKRREDREQMPCVSRAHLEFAKGNAIDA
FT                   EKLLDEARGLKDGGKDNIGPMLWKALLLFKRDQVADALQWYKRALRMHPGADAGVRLGI
FT                   GACNLRLGNFEHARLAFQRALDLEPENPDALLGLAQCELNEFTPVPESLLHGGDEDTDP
FT                   ASVEEKMEAAAETYTAAVQRGLELLRRAFNADPHHPAVNVALAQHFLIKKDGASVDHLT
FT                   DKLVRGTSTNELATPRLRAEAAYVRARLHHQDGKLDRAEAMYTAAVQMDESFAAAAFGL
FT                   AQVYLAKGDHKSSMLYAERAYAAYPDSVPVLKLYGHLRRKQDAAAAAAGGAGLVSVGTF
FT                   GAGAGRDKETARILKKVVEADPADLEARLELGDALLASGDYIGALGAYEMAVKIFGDRA
FT                   RNGKGPDAPAALLNNCAVLCAMTGKNYDKAKSLFLRALEASAAEEGGKKTGEQLDAQNE
FT                   RKKAAKSAQPIAFNLAHLDEDFGYVKEANDRYGDLLDANEGMTECLLRRAAMAARQEDF
FT                   DKAMELAKEATERRPDDVDAAAYVGHLLMKQEKYKEAQEQFKRLREMPKKLSAEDAARR
FT                   AAAGKTDPVTHTSDEYALISSANAAYYQAVKAQAGAKLVKSGPEREKWRNLEKEHLKQA
FT                   ELYYTKALQKSGSNLYAANGLGILLAEKGKIDEAKRTFQMVAEGLMSLGGGDHSKDDGT
FT                   EDSDANANKDMLTSPDIWINQGHIQMAKGNYVAAARNYEQAQQRFFFGMDPRVALYQAR
FT                   NHYEANNMEEAKVTLKRALHVAPWDHRLRFNLAYVYQEHAHRTLNRTLKGAEKGKQQGE
FT                   GEGRLAQVLNAIEDFKLALQLFQQIQAVLQADKQKEGKKSLAQEIGIDKKRLGMHIQFC
FT                   NKALTDSQPHLEAAKAEEDALKARRDAQAAARKKAEEARAVALAQAAAAKELERKAAEA
FT                   AAAAAQERFKQNQEKWLKSQAEEKAILAGMEEGEPKRGKKGKKGTGKATKNETVYNEDD
FT                   DDILVPDAKPMTKEEKARLKATGLFSDSEDEEEADDKETDEDEPNEDAKARLKAAGLAD
FT                   TDDDDDDDANVNVDAKKEASPEKEAEEEEEEEEEDEKARAQKAMEAIKRKRAQAKKDDE
FT                   EEDEAPPEEDEPDEEEEGRKSAKKRRRAVIDDDSDED"
FT   CDS_pept        join(complement(632859..632995),complement(632617..632671),
FT                   complement(631908..632497),complement(631442..631490),
FT                   complement(630977..631225))
FT                   /codon_start=1
FT                   /gene_family="HOG000220790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640478"
FT                   /orf_name="MICPUN_84098"
FT                   /product="Inositol 1,3,4-trisphosphate 5/6-kinase "
FT                   /function="ATP binding"
FT                   /function="inositol tetrakisphosphate 1-kinase activity "
FT                   /function="inositol-1,3,4-trisphosphate 5/6-kinase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="inositol trisphosphate metabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69465.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032957"
FT                   /db_xref="GO:0035300"
FT                   /db_xref="GO:0047325"
FT                   /db_xref="HOGENOM:HBG713117"
FT                   /db_xref="InterPro:IPR008656"
FT                   /db_xref="UniParc:UPI000199C8CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG06"
FT                   /transl_table=1
FT                   /translation="MGERVGTTVDAAAAPSRGGEEVLVGYALTEKKRRSLFSPELLAHA
FT                   RSQGVYFVPIDPRLPIESQTGHPYDVILQKVPASSPHKRQWDERVEKYAREFTSCRVVD
FT                   LPSAVQKITQRDTMLDAVDQVKHAFDRGGAVNDEGEPSGPSVRAPRQIVCAPGTAEEVR
FT                   RQVDAAGLQLPLLAKSIRADGSSDSHRVAIIHDQDGLVTVASGGVPGLAPPCVMQEYVN
FT                   HGGCLFKVYVVGDVVTSTIRRSLPDLRGAKKSSRRRAKAFDGGEDGSSESNRAIRENGS
FT                   RDNGALIQPPDEGFIKTLALGLRDNLKLQMFNFDMIRAGGDSDEYLVVDINYFPGIAKM
FT                   PGYSDTFCDFLRRGKVTNQ"
FT   CDS_pept        join(633445..635436,635533..636090)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640479"
FT                   /orf_name="MICPUN_60694"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69173.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C8CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG07"
FT                   /transl_table=1
FT                   /translation="MSDGGGGTGHTAGYEPVRGAEDTGSFGLGSLTSFLSSQAGAVESR
FT                   AKAVASAVRSATSADARTAASYSLRDRAKEIDAMFRIDPEEARARGGIAGLVHSCEVAL
FT                   DRYDATHAHHLSRMEAANALAEDVRTRLERSRASWTELERETSTLSDVTDSVWKLGADV
FT                   DRVCALLKETEDMLLEAEVAIGLDEVYARDAETRLSKRAAEIARREEVERMERFREEMA
FT                   AQAQTNQVAQRSRQEIALEEELKRDLDVIRKSARKQAKREGKSGFTPERPAPEDHFGLL
FT                   AKDGRKTNDDVDDTPIGPKRGSLAAAAAELDVAGSMRGSINRDLDDFLEDNEEEEEDGG
FT                   GDIVGEKSERLYTVYGLRRQADATQAATSDAKESGASSWLASTAEAVGLARKKEKDDGS
FT                   VVVNLRAPLTTMGAGDDVFVDEMPGIKPKPKTESEDAATTEKPEAPHEPGVGEQMSEQV
FT                   SAAAAAAAARAEAAAAAARAQAEAAAHAAGEAAAAAKAQAEAAAAAARKNAEAAAAAVS
FT                   SSVSSGWSSLLSFGQAATNHANKLAADVSNTVNNTVHSTHERWQQHLQGSGTSVADPAE
FT                   GGDGVGAPAPEIPRETPAAEKEAKKEEAESPAPAAYKVSPTSDRVDRDEGFDEVVSKEG
FT                   SRRFWEEKDAAASPRATDSPPQVKDSEAKPKATIAPAGMTNARVTSISDMVRMPFDAFR
FT                   ETVAPPVTPLRSSLSLDTLRQRLGRISRDHAALDPSEERRRTFWQSGGLFAPGIPYVMG
FT                   LEDGDEEEDPSLSYEALSELDNVPRRGFTRAELQQRLRRSRRLPVGAECPISREGFKEG
FT                   EKGVRLPCDCVDVWFKEAPLERWLATSRSCPVCRKEL"
FT   CDS_pept        636347..637564
FT                   /codon_start=1
FT                   /gene_family="HOG000100110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640480"
FT                   /orf_name="MICPUN_101884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69174.1"
FT                   /db_xref="HOGENOM:HBG562087"
FT                   /db_xref="UniParc:UPI000199C8D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG08"
FT                   /transl_table=1
FT                   /translation="MTSKDLERGSGGDRSPGIAAAERARVVANGVTTFEARARTGRTTP
FT                   TEREALLGSPEHRSRSQGYDLARKIVGTVVLGTCVGVAALSSQTRGYFMRSMGSTDPRP
FT                   YIVDFGDSVSPSFKHQAFVYRCDGESDLLTKLAERNHHGMYDYYAVTQVTVGEPSFEKC
FT                   YTKHFSSNPLDAVPKPVYFTEMAAHKGKMIGMFRLPENKISAGFVNAFESCPTMQHEHG
FT                   PSCNPAHESYAIGSCDAAMNPTPQTVEKYFNCVKGCQVSMLNGKFCGGADPKCLAVVLA
FT                   DVPDISSECEANHVPNEAEIQNAISKVNDGHFAVVGLAERYADSVRKLRAYLTGQGATA
FT                   MMGKNRKVARMGELEDLKPLVPFGDGPDVVKNAEARVAEIMKQKGLRDLADERLHAAAY
FT                   EWFQSH"
FT   CDS_pept        join(637717..637959,638093..638752)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640481"
FT                   /orf_name="MICPUN_105942"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69175.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="HOGENOM:HBG609160"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199C8D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG09"
FT                   /transl_table=1
FT                   /translation="MASSRMMSARASPSLGRLRGAKPALVSRPGRVAPPVRASAAQRGR
FT                   GSTDDYVVTLVNISVTPGNEEGFVAHSVDNATNSVEEPDNRRFDVLQDLDDPSKFALLE
FT                   VYSTSEGNDAHRDLPHSKAWREGVKDWMAEKRTWSVYKPVYPWAGLWGTAAASRRAKDG
FT                   VQQPVQAAFLTLDKDGDTAGAKAAAEDTKQITHVHVTCKPGTEDEFIEACLANAASSVL
FT                   EPDNLRFDVLRHRDEPNKFMLVEVYATSEGPVAHKATPHYNEWRTTVEPFMQEPRRARK
FT                   FRAVFPTDPAAWKMTLNDN"
FT   CDS_pept        638905..639420
FT                   /codon_start=1
FT                   /gene_family="HOG000264646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640482"
FT                   /orf_name="MICPUN_60697"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69176.1"
FT                   /db_xref="HOGENOM:HBG562310"
FT                   /db_xref="InterPro:IPR007702"
FT                   /db_xref="UniParc:UPI000199C8D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG10"
FT                   /transl_table=1
FT                   /translation="MDAYDSDQPLFCDDTGEALNEAARKLVLSALAEDKRAEVEGDGKT
FT                   LGAVLSSIPVVDCAIGTWKYVQVQLTHPDEPDTFVLVVRSYNHCSYHAENYQELMRRLR
FT                   RDAKTKGCVGRVIGGGRIRFDKGAGVCEVYGYSKTFGRTPGCNEKTADIIRKACPEFKK
FT                   VSWSDSGY"
FT   CDS_pept        complement(<639522..641285)
FT                   /codon_start=1
FT                   /gene_family="HOG000177172" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640483"
FT                   /orf_name="MICPUN_66893"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69466.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG324997"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199C8D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG11"
FT                   /transl_table=1
FT                   /translation="MGKKSMSKDRGYITATEWKTEGGGYKDKMQGVPFRRLPFNCCAVS
FT                   FLPFEDPVCTADGTVMDIMHAVPYVQTHGKHPVTGEPLQLRDLTKLNFHKNSEGEYECP
FT                   VLNKVFTDSTHIVAVKTSGNVYCYQAIDELCIKPKNWKDLITDEKFTRKDLITIQDPLN
FT                   LEGRMLDKFEHVKKGHEIDTRGGGVGGPDDSLNSRAMSADIKRVLEKLGTEDAAAALKS
FT                   GGGGRRAEAERILAEAKHKSDADAKGDSQATVDKSHLLKAPTNHPLDNVTFKPGSHTWN
FT                   TDGPEDWRVTHAKAADGEQMKKREAEMRERFKAVGSHISYRTNSMRTTGAGSTSFTSTV
FT                   MGSATVNERVEEVVKRNPPKGKKGYVQLRTNLGDINIELHCDVAPRTCENFIVLCKAGY
FT                   YDGVEFHRSIKNFMIQGGDPTGTGSGGQCIWGDKFKDEITHLVHDGRGVLSMANSGPHT
FT                   NGSQFFITYKSARHLDGKHTVFGRLVGGVDVLAEMERVPTADDDRPKEPIVINSTKVFT
FT                   DPYKDMAEAEERLAAEKKAKEEKEARERTEALNPGKWWSDPAGQMAKEAGDDGTMRKST
FT                   GVGKYVNRATAG"
FT   CDS_pept        join(641659..641733,641938..642234)
FT                   /codon_start=1
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640484"
FT                   /orf_name="MICPUN_84175"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69177.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199C8D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG12"
FT                   /transl_table=1
FT                   /translation="MSTGLGKGIGIPVKLLHEAEGHTVTIELKTGDTYRGTLLEAEDNW
FT                   NCQLEGITHTGRDGRVNQLENVYVRGSKIRFLIIPDMLKNAPMFKRIDPRAGGRGAGRG
FT                   GAGGRGGRGGRGGRGGRGQ"
FT   CDS_pept        complement(642315..643214)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640485"
FT                   /orf_name="MICPUN_101887"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="ACO69467.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="HOGENOM:HBG562311"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI000199C8D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG13"
FT                   /transl_table=1
FT                   /translation="MGLAFLEPRRGLMFAARKSQASVARLIGIQDPGWRWDWIAGERPP
FT                   PPRCIAAVVNDQDDAMHPRCLTQLANLAVWCTEEGIGHVSMYDQDGSVRAGKERLVEAV
FT                   VRATVEGHRRNRFHRMRACTYEVRTVDDDGTVRVAARFTCGGAATNKWAELFGMGKPSE
FT                   KHSPGDSPRSAPMTTTVDLLRGGDGRAALLEAARRWRDEKQDRDGKQDRDGVAPSGSDD
FT                   SITPRELEAWMERTGRLLPAVDLAIVFGKHFHASAYPPWQLHRAEIYHVDRGLWGFTRK
FT                   GLRRVLRRYSKTAQRFGK"
FT   CDS_pept        complement(643616..645427)
FT                   /codon_start=1
FT                   /gene_family="HOG000264647" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640486"
FT                   /orf_name="MICPUN_53083"
FT                   /product="Predicted protein"
FT                   /function="N-methyltransferase activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="ACO69468.1"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="GO:0008170"
FT                   /db_xref="HOGENOM:HBG562312"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniParc:UPI000199C8D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG14"
FT                   /transl_table=1
FT                   /translation="MGANSSFQDLAVRFRAYHTNSLNVALHMVTTPVGIIAALVLMVNH
FT                   PAVTPQHFQIAVGAYVASLLVTLGDIKLWVATSAMMAGLAALAVHIAPALATYDALKLM
FT                   GFAYIGQELAHIVTGEKTFQSTYQAASPTFLALLLEHTYFLLPLCIDALVNMKASFAEW
FT                   IVAHNYVVRCKLENSADKAARKTIYDFVTAEDPDRTCTAHWWYQKLEGKVKDAFSHCMS
FT                   CDAMMGMFYDRFRPDLYNVDPIPSMNEIYVASSHHNNNSDTVFYTQHCDGPWSVWPWCH
FT                   VYRVMLAVNENVQVETLFTMERGGGCLSDGDAVGFDYNREIHVIADLPTKNKDRRITCK
FT                   LHYVVYPKCFGPFGRLVGTLATWYNTTARNLFLATIRPRGLFWRFMAFHVIFWTKRVRE
FT                   LEMYAGLNNVAVAAALFAVGQKIHPYFFMVATSFTHYCMYIATYHYRYKINFGVFKRNV
FT                   VFFKTIALTHLCWNYLTNFTYDPVSIAMLVVGYGLSTAATVALGIDQTYFGVELGVMKP
FT                   NFVSQFPYGYVPHPMIIGSIVGLLGFHKMATFRAALPYLVPVHICMYMIHMIQEQVFDI
FT                   YKKDWHAGAKKAGVAPVKGRGKRVKAH"
FT   CDS_pept        646008..646874
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640487"
FT                   /orf_name="MICPUN_108775"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69178.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000199C94A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG15"
FT                   /transl_table=1
FT                   /translation="MHDTTFTAFVPPHKVDSPVPVVLFQSGHGSNSACHAPLMNALASE
FT                   GFVCVLPDRDTDTLNTPEGDAVEHIFTEGKLTAALSTDGTHLAAAYEWLLAQGGVVSGQ
FT                   KVDTTKVAVGGFSMGAIEAINFASQKQGAGGISAVFLISSSTSENAEPLYQFKETDLVD
FT                   KVSKFTIPSLYITSDKDCMHDATKKLAVAAAKPSALVVFKDEVLDNSMTLTQELSIWHT
FT                   RHIEMIPGLAQHFALAAEAKVVAKEPVVGFLRRTLLHAGGIWSDELVKASDCVAVVDQM
FT                   LVHNSVA"
FT   CDS_pept        complement(646967..649234)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640488"
FT                   /orf_name="MICPUN_101889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69469.1"
FT                   /db_xref="UniParc:UPI000199C94B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG16"
FT                   /transl_table=1
FT                   /translation="MAEFAASTSAIGASEGDRVTGSEAGAVNGTERELSYNGASSSAAS
FT                   TDEWIYPDDEDEEEEWDEEPDPHPWAFPVTSAAALAAWSVYVRKKKFADEAKLSKRERA
FT                   KLQKEREAKAKEAEARKGPVDDRPLKVRYREMRAAQIAAEEAKEQTAAAARAAEVEELR
FT                   KVAEWQRRVDAEQRSERMQEALKREANRRAWIEASRMEELALERQREQRLAEAKRLKDA
FT                   ENSSPKSEKQLRKERAAEEKRVAAEEKKLAEEAAKAKAAATKAADLAKEKKAADRARAA
FT                   ELKAAAKEKLKQVADAKRRAEEEAKPTAEKLAADARARLEAQRVRDAEIKAAKAEEAAA
FT                   KQAEAAAARDRLVAEQRARTADDKAANDAKAKAAREVNMVRAKEKAAEVKEQTKTKAAE
FT                   VKERVQREAAETAARAKAAMDKAGAEAAKAKAQAMERAKAAAAKARTKAIEVKQAKPAA
FT                   EKPKSDPKAEAAKKAEAEKKAKAEAAKKAEAAKKAKAEAAKKAEAAKKAEAAKKAEAAK
FT                   KAEAAKKADAAKKVKEKKPKAEPKSTDSKTPGTGQFVDAMNRVASRTRTAAADSVAAVK
FT                   STTAKTLDPIRREISEYAIAIDAKPPAPVAKLSTVSGLAPSTLVGTGIAMISGLALAVL
FT                   LPGGGSDTDVPTDVSPPARDDDARSKQREALQRQLAEDRREQRSRVESALGGGAAPSRD
FT                   EIREKNRVADANDSDDSEYGEAPEWDEKEVKAMQKEYQKFLKGSKATEKPWWSLGNRRT
FT                   EK"
FT   CDS_pept        649715..650692
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640489"
FT                   /orf_name="MICPUN_108776"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO69179.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI000199C94C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG17"
FT                   /transl_table=1
FT                   /translation="MNAAAARSTPASCSSRPLGSDRIDRRGRPCAATMFGGRSSSSFTR
FT                   DVISRAFEERPGRRGSRALRFAVAAEVPRFAREVSRGGLVVDRLAFTPVGSGTEVLREV
FT                   NLRIPPTGLNLIVGRSGFGKSTLLHLITGLSEPTGGCITFTDQPDFGHMSSAERLARVG
FT                   LVFQFPERHFLGRDMLSELTFGWPQKPEAFPKRRALALKLQDALQAVGMSNFPLDTPVA
FT                   SLSGGYKRRLALAIQLVRDPYVLCLDEPLAGLDWRARSEVVTLLADLRKERAIVVVSHD
FT                   VEEISPVTDRAFRMGKGGVLTPAPELALAGGNPFGSAASEFSSF"
FT   CDS_pept        complement(650874..651680)
FT                   /codon_start=1
FT                   /gene_family="HOG000264648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640490"
FT                   /orf_name="MICPUN_60704"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69470.1"
FT                   /db_xref="HOGENOM:HBG689426"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199C94D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG18"
FT                   /transl_table=1
FT                   /translation="MAQASTIGFRFERSLSRAPARVGSRDTSSARLRAPARRPVPRSLG
FT                   GEKRGNAVRISASSGASESSPFRMIVLRHSDSCTQDADLRDHDRPLTSWGRTAAAKLCS
FT                   ELVAKGWAEPDLVLCSASTRSRETLGEMVRTHAPLGKAETHFMGSLYAFAAMDGLTADH
FT                   LRETVAGLVEREGGRDNRVRTVMVIGHNKGWEEAATDFAGQTVKLRVANAALLEFAGEG
FT                   AGTWAEAFNQNAWRLTGVAKHGLREPEKECETEFGGDGDGPMPMPA"
FT   CDS_pept        join(652228..652734,652855..653277)
FT                   /codon_start=1
FT                   /gene_family="HOG000264649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640491"
FT                   /orf_name="MICPUN_84626"
FT                   /product="Predicted protein"
FT                   /function="NAD+ kinase activity"
FT                   /protein_id="ACO69180.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="HOGENOM:HBG562316"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI000199C94E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG19"
FT                   /transl_table=1
FT                   /translation="MNRLRERHDTHMTQVDRITEWLTARGVDMTSVMRDDATQDHVREA
FT                   DLVLALGGDGTTLIASHLIRDRAGPPLLGVNTDRASINDLATLYRSSEPVDMRRSTGHL
FT                   CATTASGDMTKVLTEVLNGDVAPTELARIRCVVAGEELAPALNDVLIAHPSPGAVSRYS
FT                   VHVGGALGPPLWFHVRSSGLRACTASGSTAAMRSAGGEPMHYLSRRMQFMDREPIYHDH
FT                   APPPSDGHGFYEEGKEMCLRWNSRVGTVYLDGAHVTHAVKMGDRVTLSTNAPPLRLFTS
FT                   AWFRRNHADRWPTLRKPDSAGEEDWIIE"
FT   CDS_pept        complement(653288..654349)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640492"
FT                   /orf_name="MICPUN_60706"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69471.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG562317"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI000199C94F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG20"
FT                   /transl_table=1
FT                   /translation="MGCFVSKEDKGSRYAVGGETEDGGDAAPARSQSSSKSEAKTEPLV
FT                   AKPKLDPKDFIYMKRTGEKLVKAPGTINGQQFVIDRCEDCEIYILDECDSLMIDDCVRC
FT                   KIVVGPTTGSIFMRDCSDCTCVFMCRQYRCRDCKDIDTHLHVTTRPIIETSTNMRFGCW
FT                   DFHYEGLEAQMRSAGISEWQNFWSHIYNFNPDDATWSLMPPERTALAALEPLPDFSELE
FT                   GVAEALADGARPPLCVRTLGERDSAPKEGCLILVPACDAHMAREICDMAHAAKVSLVRT
FT                   NRCQLTEAWAVSFLEAGGAAFHAELCKGKAVGLEFGGEGCADAMRGVASSGGFPMLENP
FT                   DQYAEWRYMGVEG"
FT   CDS_pept        complement(654537..657545)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640493"
FT                   /orf_name="MICPUN_60707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69472.1"
FT                   /db_xref="UniParc:UPI000199C950"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG21"
FT                   /transl_table=1
FT                   /translation="MWHATATGAMIAPVRWLSRGRRPRARASASLPVARAVPSVPTSRL
FT                   PGMSRRRPRDDSRPLRLRAAAQRYSPWVDPDDGPVAEDAPVRIDRPVGYSWGDELDNLR
FT                   IDEDERARAARKWQEGAYVPDDDDDDEMYEPSPDGDTLYGKGPSSKRLRWPPSLGHGTV
FT                   PRIARSLWALVAVVGVVWAVWSSVKHVMFLDFSTLDFGNLGAAIDAAALEALAGLAEGA
FT                   LVSTVVAPVVAALTAGFFELNLRFLTIMTAANLPRTLAPATAKTVADRERRLKAMKESR
FT                   PQHLAYAKLKKATFSACEARHAAAAHACAAWSRPVVAVILGLAVWLTAVAAAGGFGAFV
FT                   GLERSIVGGPGVGRGPLTTAGVAVWYVVGAALASLTSCLRRRPGAYAADARKEMERRER
FT                   EYLDGLHKGTFLCQWRSDDYVAPGERNKVNPDKQLTNRVVAAAAVGAAAHRRLPPSDAA
FT                   ALVLDASDAKTSEKLSMAFSYFGVGGSDQANGSKGPAGRFMSWLTSPMAPVDEPVEGEY
FT                   SYGVVYDSMSDSFDSLDEDEEDDSLSFDSEGTEDFEEFEGKVVQAAPYLRGSVELGRRG
FT                   KGANNWRYWWDNVKMKASKRVAAARGAYRAGATKADLEREALELNEGLGFPATSVLVPN
FT                   QHTHVVHSLREPGSPCTPYAADVAEVLRKRDPKAPPLNLVYLDHCGAVKQREQQLWDVF
FT                   SRHSVADGGVLAVTFSTRGKRLGWSKAAAVAACARALVEAADAHGYELEGGAADGALEP
FT                   NYLERLMDYTVHFGDSVAPSSSSEEDEDPNESPEYRQTTTTVAESDGVAAAAAALRAHR
FT                   SAVDAALREYTRQCELLGGVEAAFSEVVRGNPVETEANRAAALAARALANALVVWADDV
FT                   PASNDGRMVSFDTWASRRRRRLCRYLHSRVSGEEWDRVSPPTREDARLLQSLGREVVKS
FT                   AGKAADLAKPAIAKGVEWRKLEGDIKGELTYPRCFFLYNSLMFFIFRVRVKRRVRKGKE
FT                   ERTFEDRLKLAPR"
FT   CDS_pept        <658160..>658414
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640494"
FT                   /orf_name="MICPUN_74710"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69181.1"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniParc:UPI000199C951"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG22"
FT                   /transl_table=1
FT                   /translation="LASPLFALSVAPYLLFLKNIWEVPSATDEMRASFATLLLFVVVSI
FT                   PAEAYTQEQYGTVLSNIDALHFLIQAAISLTNLRIMLAFR"
FT   CDS_pept        <658949..>659233
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640495"
FT                   /orf_name="MICPUN_74616"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69182.1"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="UniParc:UPI000199C952"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG23"
FT                   /transl_table=1
FT                   /translation="NALSVPTWGVHVFSLVEWLVAMGLVWEYAAASGVKEWRWLTWGML
FT                   PLHASGVCACVQHFFFNAADLEWLVTAQGALTMAGNAGMCAAAGKLARRS"
FT   CDS_pept        complement(660005..661414)
FT                   /codon_start=1
FT                   /gene_family="HOG000280753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640496"
FT                   /orf_name="MICPUN_108777"
FT                   /product="Phosphate:Na+ symporter "
FT                   /function="sodium-dependent phosphate transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69473.1"
FT                   /db_xref="GO:0015321"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557226"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniParc:UPI000199C953"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG24"
FT                   /transl_table=1
FT                   /translation="MFDVADNPISALLIGVLATVLVQSSSTTTSIIVSMVGADELSVNI
FT                   AIFMIMGANIGTSVTNTIVAMGHFANQDDLRRGFAAATVHDIFNMLNVLIFLPLNWIYP
FT                   FLEKMTYEMAKDQKPCEGDKCKKTEFLKPYISPYSKGVANYDKKVAGYISENWCAGQCG
FT                   KSYSTDAMKLISAEVCTSTTDCSNVHKNYESNWMSKGYLAKKRAPAYIVGTASGPAEFH
FT                   YSKPASCSTSTKFFNDEDAWTSTVAGSLAAGSCYEVCGSKVKTGLCEKRLLKGGLLLDE
FT                   WEMTDNGAGTFLTIVSLIALCSCLFCIVYMLQIIMKGAAARVLQKVVGFNGYLNIAIGC
FT                   FITIMVQSSSITTSTLTPLAAVGIISLNDMFPLTLGANIGTTLTGIMSASVVTSNPVNG
FT                   WQVALAHLFFNIFGTLIWYPIPKVREIPLKAARFLGHCTAHPQYGTLFPFAYICMCFFI
FT                   IPGIAYGIASA"
FT   CDS_pept        662640..664322
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640497"
FT                   /orf_name="MICPUN_60710"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69183.1"
FT                   /db_xref="UniParc:UPI000199C954"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG25"
FT                   /transl_table=1
FT                   /translation="MTVLLPAVEVGEDGRGETKRKFFEDTRTAGLGDRSLARRALGVVL
FT                   AHARADVAARLASVNRALRADARRAPQLAFGPESALWRRSGDDADGTLTEILTRHRPGR
FT                   LQRLVLCPPARRIDDAGAGFVACSLSPATVQFAARAQLRLRCLWTEPGSMRPDPSGRLP
FT                   ANRGVVSVTLDREDCAAIVTRGQCTGIPRAVQNTGIHAPALTRLSVGAAAEMTDAGIRT
FT                   VLRSCRKLRSLEVTDGGGELMGLDWGGVGRDADVPTLQHLRLARCGHLRALRLTAPMLR
FT                   SMAATDCDALRDLALAPSTVVGDEASIDGASIDGASIDGAMTELRELTLGGFGGYRAGG
FT                   GCNVPGNALADIVARCANLSFLSVPASCGAGLSDEEIAEIWSAALAGCASSLETLCFQV
FT                   PVTTTALLLIVSGRAGEFPGLETLSVAMRVAAGGDGEPPIDAGNVADDLVAAVSPCPAI
FT                   RTLTLVDPPPELPTSVEEAAVTHAKMLASVELARGALAARCRLAEEESDSALGRELVVT
FT                   VADDFRGVAGRARTADAPTPGGMEAVLRECDECAPLEWSLDDA"
FT   CDS_pept        join(complement(665201..665362),complement(664376..665059))
FT                   /codon_start=1
FT                   /gene_family="HOG000209180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640498"
FT                   /orf_name="MICPUN_84366"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69474.1"
FT                   /db_xref="HOGENOM:HBG385175"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI000199C955"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG26"
FT                   /transl_table=1
FT                   /translation="MTYDGNIKNKDLLALREYVTHDSGSLNKADSTVQLMVTHSNLKAR
FT                   FMEIRFDRYMSILRVKEKLMTHVGSNVSTMRLVLKDWDGATVSELGDDSKMLGYYSPED
FT                   GWTIHIIDVDTNSMSANGWLEDVSKVKKYMMSDEDYEAREGTYRQWKKEQLAKDPTWCL
FT                   EKAMAEKRGEVWVPPAAPIEDDEHQAEEASAITVGMRAEINPGGKRGEVKFVGKCETLP
FT                   KGWWIGIQFDEPVGKNDGSAKGKRYFECPDGYGSFQRPVNVQVGDFPPVDDFDFSDDEI
FT                   "
FT   CDS_pept        complement(666578..667261)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640499"
FT                   /orf_name="MICPUN_108778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69475.1"
FT                   /db_xref="UniParc:UPI000199C956"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG27"
FT                   /transl_table=1
FT                   /translation="MATITVSPEQYIASLPSIVDRTSKQEGATKLANPNFIAIKYNAEI
FT                   EDPSCCFKTAACCGCLPLCFICAPPCSYFDKERSYLYLREGSLEANTSMDNYCAPICCC
FT                   CTFDDNVYVNYFDRAPYAIKGCLCPAVPKLEVYDPACMCCCIKLDCECCFGPKQVVIMP
FT                   YETCCLCCPNRSCWCHNCFGCCGQPDGNPLYFNQFYPQPKNAEAFVAQAKQIIPVSQRM
FT                   EGKSS"
FT   CDS_pept        join(668196..668449,668510..670034)
FT                   /codon_start=1
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640500"
FT                   /orf_name="MICPUN_97762"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO69184.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="HOGENOM:HBG726909"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI000199C957"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG28"
FT                   /transl_table=1
FT                   /translation="MEGDDSEEDSDEDEDDDDEDDDDDDDDDEDDDESLEGIENKSPKD
FT                   AKDLFSDEDEEDEEDEFAELGDDSDEDDDGPLEQDFSGDEKEDARRKREAEDAAAEQVL
FT                   NIEDEDVYELSGDEDDPDAPPDLQHVQARIQEVVRVLQDFKSRREPGRSRGEYVERLVA
FT                   DLATYYGYNTFLIQYFLDTFSVAETMELLEANETQRPVTLRTNTLKCRRRELAASLINR
FT                   GVNLDPIGKWSKVGLLVYDSRVPIGATPEYMAGHYMLQSASSFLPCMALAPQDGERVLD
FT                   VAAAPGGKTTYLAALMRNTGMIFANEFQKKRLSSLVANLQRMGCTNATVCNYDGRQLPK
FT                   VLGHVDRVLLDAPCSGTGVIAKDSSVKVSKSEADINKCAHLQKELLVAAIDCCDANSKT
FT                   GGYVVYSTCSITVEENEAVLDYILKKRDVKLVPTGLEFGRPGFTSYRGKNFHPSVEKSR
FT                   RFYPHVHNMDGFFVAKIKKLSNKLGPAGAEDGAAANGFGKATGDRSDSEEGYEQVSGSD
FT                   DEGGEGGYGYGVGVGVDDEVPEKKPAGKKKNARARMLEELKAELEAEKKAKEEKRGKEK
FT                   EKKEKPAKEKKAKAKK"
FT   CDS_pept        complement(670384..670881)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640501"
FT                   /orf_name="MICPUN_108779"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69476.1"
FT                   /db_xref="UniParc:UPI000199C958"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG29"
FT                   /transl_table=1
FT                   /translation="MYTQSRTKTVPYGFICGFPVQGVSSELYGYYEGQGGKSGRQGEAV
FT                   VAAMKQWGEGEAGTAGGTELGFAVCKRGYRPFGEDGSRRYGCLKHHEMRLENMRKPPPR
FT                   GAKRSEDGLYHRPGWERFDQWTFGEKNVVSESSSFLSIDSAEEGDLGRVAVDSPAKAKV
FT                   AN"
FT   CDS_pept        672187..672708
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640502"
FT                   /orf_name="MICPUN_60717"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69185.1"
FT                   /db_xref="UniParc:UPI000199C959"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG30"
FT                   /transl_table=1
FT                   /translation="MTDVVMNYLVKAQDLVPAEYGYYALVTAITGVGLAKAAGTMAHPG
FT                   SKMVGKLELVGAILLLMGPASLGGFGHIFAIWSILVAMGMMLAIKPRAILTEAMLITLS
FT                   SKILRSEWGNVTHDGMTQGMSWETAMGASIMTGYVIGTLTMLSDRFAPNKAGAKATPNK
FT                   AGNVKRTKRA"
FT   CDS_pept        join(complement(675609..676907),complement(672777..675464))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640503"
FT                   /orf_name="MICPUN_94915"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69477.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199C9D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG31"
FT                   /transl_table=1
FT                   /translation="MKAAAGIVSGTSDPAPIVAANRFADPVRWRVPPSPLQQVFFTQVT
FT                   PLISTGHIRRLEPEDLCHLPELDSEDLAAKFDRDWAEERRRRPDKPSLVRACLVGSGPT
FT                   LIYTGILYVIAQATLFSGPVLLRLIVEALECRAAGGASCPSNQDLYYYAMFLTLAGVVQ
FT                   NLCQAQQDYTMQRLGVRVRNRLMCALYRKVLRLSPLGLQEETTGKIVTLMSNDVNKLQD
FT                   VFQLLHNIWGAPIFIIAAFAMLYDVIQWSTFIGFLCIIVAAPFTFMVAKTLFSIRLKLL
FT                   KTAEGRINILSEVINGMRVIKYYAWEKSFKERAQEIRNKEVKLIWASQKVGALFGVALF
FT                   STPVFIAVCSLGSYSLAGNTLTASTAYTALALFNMLRFPLILVPFLLTNLLNALSAVQR
FT                   LGAFLLQDENEKVEPDMSEPGRVRVAAGDFKWPAEPEQPPFELTGVDLDLAPGSLTMVI
FT                   GRVGCGKSTLLSALNKFVPQTTGDMKVSGRVAYVAQQAWILNSTVKDNILFGQPYDEEK
FT                   YRKCLCVSQLEADLEILPARDMTMIGERGVTLSGGQKQRVSIARAVYAAADVYLLDDPL
FT                   SAVDNHVGAALFEQVLGASGVLRKSTRLLVTNALQYLPKADKIVVLEEGKVAEIGTYDE
FT                   LMRKGLDFANLMAAHGIEDEGEDADGKRASTDGRKSMDAGRKSVDGRKSVDGRKPMAEE
FT                   KPKGPPGAKKDDMSAEEERSVGNVGSRVYLALFNATGTKMSIPLVAFLFTMEYGSKAFL
FT                   DYWLSWWAADHWGWESNQYLGVYFAIFLFNGIAIFFRSIVLYFFLVRAAKNMHDQLLNR
FT                   VIKFPMSFFDTTPSGRVINRFSRDTETIDTILPGIIIQFLGCITSIVTTLAIVSVATGW
FT                   FTLALPFIMFVYIALQRFYIPACRELQRIESISRSPIYSGLGEAVNGVETIRAFRQEAH
FT                   FITLADGLIQHNADAFVTQKLAAAWLTTRLRFLGTVIVACTAFLVIQGKVGPGVAGLCL
FT                   VYALDVTKYLEHGTNMASELETKMNAVERVVEYLDKPLESDHETAPKVIQALPTAWPRK
FT                   GKLVVTGLNMRYRPGLPLVLKDLTFTALAGEKLGVCGRTGSGKSSLFVALFRIVEPASG
FT                   TVSIDGVDVSTLGLHLLRSKMAMIPQDPFMFAGTIRTNLDPFDEHPEVALWEVLGKVGL
FT                   RGMVEDAAKKLDYEVVDNGANFSLGQRQLLCMGRALLRNSKVLMMDEATASVDMDSDAL
FT                   IQRTVRDAFADCTVLTIAHRLNTIMDSDKVAFLEAGALAEFGEPADLLKDKTGLFTKLV
FT                   EQSGKKNSEHLIGLSNAAKERRQSAQNLREVQEAAEEAHHEGSP"
FT   CDS_pept        join(677091..677157,677432..677946)
FT                   /codon_start=1
FT                   /gene_family="HOG000240386" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640504"
FT                   /orf_name="MICPUN_60719"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69186.1"
FT                   /db_xref="UniParc:UPI000199C9D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG32"
FT                   /transl_table=1
FT                   /translation="MTWRGLRDLQKTLGRKSRGYVFVFCWEHASELAKLKPQFDEAGVL
FT                   LAVVAVGTPEGAQAFSKALPFPKECLFVDPDRKAYSALNFHGDLDGSEGLFFDPKVMEG
FT                   VKRLFFTKVTGERIKERGLMEPEGRAKMKEVMKNFVMIAPPQPRDAVQQGGTAVFKGNS
FT                   LVYLRADEATADHAPVSEVMAAAECPECTI"
FT   CDS_pept        complement(678159..679862)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640505"
FT                   /orf_name="MICPUN_60720"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69478.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199C9D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG33"
FT                   /transl_table=1
FT                   /translation="MSALVANAVGPVAVARRPPRRMRHAPRERVSAPRASRADDLPGIL
FT                   LGAAAKKLEEDVNSFIGLFDEDAPTHERPPTLPVAGNTLDIAQGGHRQLLEWAETYGVA
FT                   DGVHEVKMLSQTILHLTDPKLARELMFERSDSFPDRGVSAMAKFFREDQAAFVNTSGEQ
FT                   WMAYRKMGTATVNGGALDRLAGKVAERSEALVTRWVRDASASGDGRNATEVDISDASQA
FT                   VTLEVIHEALFSEQLDVIDGERNAVALARSFREFNVANQDLLNDFLTLYQRFETPERAR
FT                   RDTHRRRLRAHFDERADARRAAIARDGAAAAPRDLLTALLTARDPATGAALTRDDVNLT
FT                   LTEMMVAGHDTTAATVACMMCLLASHPEVRASVTGEVDEFRRNNGGRLPSSVADANALV
FT                   KLDDAMKETMRLYPAVLIVVRKAEEGTGGVFTKGPGREVRIPEGSGMWVSPYVLGRLAR
FT                   HWGGDEEDVKRFRPSRFEEARERGDSLDAYMPFGGGPRVCLGSRFAMLEGKVLAAHILA
FT                   DWDVELAAETRDAIARNDGELPIAYAAGLMSFPEPLRLRVRRRGAASGPR"
FT   CDS_pept        join(679988..681367,681390..681392)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640506"
FT                   /orf_name="MICPUN_60721"
FT                   /product="Monovalent Cation:Proton antiporter-1 family "
FT                   /protein_id="ACO69187.1"
FT                   /db_xref="HOGENOM:HBG609258"
FT                   /db_xref="UniParc:UPI000199C9D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG34"
FT                   /transl_table=1
FT                   /translation="MTDERKIPVLRVTPAEAKRALLVLAGVVAWWCASWLAIGPSMEPR
FT                   GPVFAVYVLLFVATFAGHYVARFPPLPPLLGQLVAGFVMRNVPGLSEAVGEAVDARCSS
FT                   AMRTAALGVILVRAGLSLDVAAVYRLRWPAARLAFGPSTAEALTVALLAKPALNLPWTY
FT                   CAVLGYLFAAISPAVVIPSLLRLQDKGYGVKAGVPALVTTAASVDVVYAIAGFGVCAGF
FT                   LVTAAGGGASSAAWRAPTQIVGGALLGYLAGRALGSITPPDRAVASPGGGSPDAFRVWE
FT                   VPGETPARRAAWLLGMSLLILFAGAEAEMTGGAALGVIVASAAAAREWGAVDAKACGGV
FT                   LNVLWNDLAQPLLFALIGAAVDVSRLSGGEVGAGVGLLAAGLCVRGLVAFLAAGGGQLA
FT                   FTERIFVAIAWMPKATVQAALAGLPLDAAIAFEGGDRNGPETKRAEVILALGVLAILIT
FT                   AP"
FT   CDS_pept        complement(681482..683368)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640507"
FT                   /orf_name="MICPUN_60722"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69479.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000199C9D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG35"
FT                   /transl_table=1
FT                   /translation="MEGGEGDAMSWRARIEAFAAKEGGDGGDDAKLTLTQSLSSAERAA
FT                   VHELARRLGLGSKSEGSDDDGTRVVTVFRRAPGSTGAAKRGGRAGGRGARRANGSSPSS
FT                   TAAVDPSADEDYGDDEDDGVSAFDDSLADLRDAPFDLYRALKIPRAENGRGYSGGTARA
FT                   RASYHREAVRCHPDTVPKGCGACHGCGGVLKPGRWWHRPQAIPANAPKGDGEFGLLDEG
FT                   EDDDFAIASVPTAREKDAGDSPPRSPASTLGPASTLGPASQHRLDMCPPCYASHRASHV
FT                   SRKVTFGDDGDAARVENRGDCFVKIETLGDLGAERARYDAAAYGALRRRRRTLAARAAA
FT                   DNARALAAVSGRAVDGNGRGDKDGDKDGNDPDDDPDDDPDAPPDEAGVHDPADAAAHAD
FT                   YRYRGDEDCLDDDPDDDVDDPRNLSGVTRFAAACAKFQRVTVAYLALRDPARCRVYDEH
FT                   GYGALVKAEAYAEDDVFDADPWDVYDRFFAGVDEEDRQYLLLHGGGGDDDSDGASSDSD
FT                   NGSGESDDDDDDAMMEEALVQARHERFETFDEGGGRLANVADAPPPRPPVSVLMAMGDK
FT                   AAGARSSAGDDDALPGLEGGDIWAALAKRYEADPVGEKRKRDNEEEEQGDAE"
FT   CDS_pept        complement(683594..685165)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640508"
FT                   /orf_name="MICPUN_60723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69480.1"
FT                   /db_xref="UniParc:UPI000199C9D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG36"
FT                   /transl_table=1
FT                   /translation="MPPKKKVDKKDDGKEAESGPDPAREQEKEIVTSELEIQGLTAKLA
FT                   RWQSRGKVLAEENLALVAQLEEARRVMDETNNPLSRQLRSTHAGTLAKESELLRAGEEL
FT                   ERILSEGAELERREADDARTRRAALEDELTAREATVREVDEFASTRDKLDLELREKKLL
FT                   LKASREDHRRRVDDVNTEFKIETAEMKREHTRKIKEAKAHMRALIDEQLAGTTKQTAAE
FT                   NERMEGEIAYQVRTTLDVIDRNETIIAEHAEMAAEMDELRLRERELAESNAVHSRVIRT
FT                   FVKALMERGEVDRIDKVAKHLGDAVATDTLPQYCLERTHTGALVERTRRKPRRRAGKGE
FT                   AEVAIARRVAEARFERERVGAALIAAAAAEKELETVVEEAARHARKECERFLAACVEDA
FT                   AGSGGEEAEAKDVLIEDEDEDDGDAEGRRRRRATARRVLAAALEKPEAPLADATRGMFE
FT                   QAKPPPVVPPTDLGSTRGFGSRGPEAVSHRSGSLASERRVARSNADLFERSGFRQRYTF
FT                   TTTRRR"
FT   CDS_pept        685457..686908
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640509"
FT                   /orf_name="MICPUN_60724"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69188.1"
FT                   /db_xref="HOGENOM:HBG611468"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniParc:UPI000199C9DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG37"
FT                   /transl_table=1
FT                   /translation="MRAMRSPMGAPTRATPRPRAHVRRVAPAGADGGESAPAVRSHKVR
FT                   WEEKYAELAAFVREHGHASVPPRDRWIDLNKWVVYQRKRRRQGIMSSEQETALDELGVC
FT                   WEPRTPRPDRRGMEDRWREKFEELSSFVETNGHTRVPSGYTKLHRWLHEQRRSFAKGKL
FT                   REPRRRRLEGLGVDLKSESRMSWEERVEELKEFRSEHGHCNVPATWRHNPSLGGWVKHQ
FT                   RMQFRADKLNAERKRTLDALGFNWDPKKKDSRATGSRSFHVRENVSPWALVNAARSRGV
FT                   GGDLAQEMDTVGKGARVSVMWMGEPDEADEEEMEKEDGKVPVVGGWGRSSATYEEKQHF
FT                   VFRHIEDWWKGDDECGEGWAEARGLVRDMRYNYAVQAKKRRIKPDIVIEMEQDGGTIWG
FT                   LVIEVDEFAHRRGKHYSWRAEEKRMQELQTTLGVKLKIVRFNPDPTGSFPIGLEERTCM
FT                   LLEHVVQSMQSAPVRDLEVEYFLYD"
FT   CDS_pept        join(complement(687120..689314),complement(686991..687000))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640510"
FT                   /orf_name="MICPUN_60725"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69481.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR012890"
FT                   /db_xref="InterPro:IPR022783"
FT                   /db_xref="UniParc:UPI000199C9DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG38"
FT                   /transl_table=1
FT                   /translation="MPKRGNLRKKTDEDEGEDAGAGAEEAPTIVIPTEKTKSKKKGKGK
FT                   ADGGMAASLLSFDDEEAGADTFQVTKKPPAGDGAHRVKKKSMRAPDALKPDAEEKKGGG
FT                   EYSIERLRELASAQKTLTARPAEHMDHNAPANGRSGAGTREPIAFMPPPPRPGRDDDFG
FT                   IPDAAAIKAAKAKREAARAALTSAADYIPVPGAEVDVDMDAGEDTAWEDEQLRKAMSAG
FT                   AGAGAPRAVVKKQPSVDVLAGGRAALESLRNGVARLEVSRQNAKNEVTRADAALASSEA
FT                   TLKNHEERLTAAGERYKYMQEMRDYFRDLCECLREKGPIIDELEEHAQRLHEHRGLASK
FT                   RESEGNLRDEATEAEAGMEAAQAALMRGASQAEAIAAATAAAEGAIAARFDSLRPNLDE
FT                   FGRDLNLAERQAAEKRAAVRRSRREEELRMKNLGEEDDAEDAVEVELFYKGLEDATEAA
FT                   SQVMRDAGADFSSIPPIKARSEEWKRRFPRAYKDAYMPESVPQLFAPFARLELLSWSPL
FT                   YAETRTSPGSAAAPAIDTMRWYSDLFDYGMVEGDDAAADDSDGNLVPTLIEKLVAPVVE
FT                   HAVNECWNPLSLAQSTRLAGVVKEMTVYLEPTECEAMRRILSSVRARLSEMVDRGCDIP
FT                   AWAPVITAAAPMAESYARRRFGVAVRCLRVIMAWDGVLPQSELRTLACDRVVAGCAAPR
FT                   LRLLLARPGECLAAIERLVAVLPPDWLTGSARVVRDVASR"
FT   CDS_pept        complement(689465..702250)
FT                   /codon_start=1
FT                   /gene_family="HOG000258250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640511"
FT                   /gene_name="CDHC1B"
FT                   /orf_name="MICPUN_96530"
FT                   /product="Cytoplasmic dynein heavy chain 1b "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /protein_id="ACO69482.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG523191"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniParc:UPI000199D593"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG39"
FT                   /transl_table=1
FT                   /translation="MGAFLDDQTTTVLQATLAGDVVTCANSVSFDTSSTAQVVLTKLRP
FT                   GPLRPSDIPHAVSVSSMAHSPVSALYHQLRQVYGPLLGNDARGDGAAPVDAKLRGLVAE
FT                   LEAGLGNVLRLTGGVGDLTRVDPADSPLVGIASPLDEFTLWSEVAYAKDVSEPTRRAAN
FT                   EVYRAFEPVKERFERLNHLADEDVLELVDEVGDALDAAWRIPRGDGTAGGQFPRRRAEH
FT                   FMRMVGAALVGHVQARAKGVSIWSDGFKSVESLLRFGHRCLAKWERTAADLTELNWREG
FT                   TGGCQHWQGQAFRDQELSKARERLDEVFRMREAQAELAELLSPEEGRSLALSDVFGPFA
FT                   RLDPLQVSEYTAPLWEAARGDYDRRMSPIEDKMSEKLREHFGARLIPSLQASMRSRGDD
FT                   SAVAMAQPHQVLREVGRYAELLRRPAVAQSLTSERNLLADSLERFLEDIKAECDRRARV
FT                   SGGGGGGGGSGGAGRNTTEKVEAVVWATQAQERVAIARETCAALVITTRDKGGNRVQGT
FT                   EQDAAGRRGSDLDREAKHLLREIDDLRKRLFKGWQEGIVDRLGEFKLDLGSKLMDLDSS
FT                   STGQVKLHYNSELVSLLREVRQLSALGFTIRRDIAAEAETARKFYRHGMVLRQVANFYN
FT                   NIASEMIPCQKPMMLDDAVKFEEVLTNPRDGLGKVITWNNPTALEKYIGKLQAVAGVLT
FT                   DKNRRLRKWHGSLAEKVCALFAMDLVRQKEAWKRAVKELRSIFANLEGEFRKDLQSAWR
FT                   VHWDHQLYKALEYQYHRGLETLNEMLPQVNVSLVFKQRRLQFEPPLEEIRTAHYKQVKD
FT                   FLNLPLVFKGVSDVSEKAGFFRGMMDSAVGAAGCAKVYDKTEALFVKLADEQKKYEHWV
FT                   ALGTVDLDTFVDERFSESKEFEEGFKLVKLASKQADRIPLEIKVDCYTVSCLPLKSAVE
FT                   KQIKELQDTLSNCLQRKVVRSKETIEQFIRSGKELLDTKAQTIEEIGNMRNDAKNLSAE
FT                   FQGKITQLRWQVADLSKLLKQSGGSGAQAAAQIDFSSLDSDWENLSTKLEQLEAHLEIQ
FT                   KDNLKVQIVHRISDFGSKAEAFRERWFEFKPRGIPQGESTLIMNKLEDDYRSLEELKEE
FT                   GEQLRMDCEHFSMERPEFPVLDEVAADIEVTREAWSRIGDFNKERNELAGRDWILIRGK
FT                   LYEFDDFLAKWDQKVRSSENKDAVAVMLLEQIEEYKKALPALKFCRGEGWEGSHWAQLF
FT                   SMLRFPTKGPEAVTRENLTLQHFLDRAELLIEKLDDLKKLHSQAQGEVTLREALHQLKV
FT                   WGLDRRFSTIKHNIAGPRGGSVSLIKDWKDLFTEVADNQNLVSSLSSSPFFAPFKEETS
FT                   IWETLMSNLADRLNHMNAIQRKWLYLQPIFARGALPQEQPRFRRVDEDFQGIMASIDAD
FT                   SLVKSFAEMRMRDDHMHEMSTQLDVCQKALADYLEEKRSMLPRFYFIGDDDLLEILGQA
FT                   KNPEVIQAHLKKLFAGIHSVVFTEGAGSITAMKSIAGEVVPLRKPVVVNEAVEVWLADL
FT                   AANMVQSLSGMLVRCLAEKDYEAFPSQILSLADQVHFSQKAEAAISRGTLPDLLDELQG
FT                   QLQEYTSFDVEGMRVMQLKVQSLVMDLIHSIDVVEQLQKEYCSNVGEWVWQRQLRYYGE
FT                   GRGGGVQVRMDNGAFAYSFEYQGNAPRLVYTPLTDKCYLTLTQGMHLGYGGNPYGPAGT
FT                   GKTESVKALGQAMGRQVLVFNCDEEFDFKSMGRIFTGLLKCGAWGCFDEFNRLEEEVLS
FT                   AVSSQIQTIQAALKSRQDSMTFLGKDIEVNQNAGIFVTLNPAGKGYGGRSKLPDNLKQL
FT                   FRSVAMTVPNFELIAEVILLSEGFRDARILGGKLVSLFSLSKQLLSPQQHYDWGLRALK
FT                   TVLGIAGKLLRDARTAAAAGAGPRVDKTMEAQIVIRATRVTTLPKLTFADGRRFADLLN
FT                   DVYPGVEVSDVSDAELEAAIQEILEEKHYENVPSQIEKVLQLHIACSQRIGIIIVGPSG
FT                   SGKSSLWHILEGAYKKLGRPVKRYVMNPKAIHRQQLLGHMDMDTREWFDGVLTDSARQV
FT                   VKESLDQHSWIICDGDVDPEWIESLNSVLDDNRLLTLPSGERIQFGSNVNFIFECDDLK
FT                   FASPATVSRTAMLFLSEEAVEPSLIVKGWLSKQPEELRGQLGGWCDEYFFQALDRALGL
FT                   GTVTQTTKVGTIKNALSHIAGADSKQRFARGLARGFASNMEPAARDRLLKDLERLTGER
FT                   DLLYVSAASIDRYDAPPSGIIKGKWSGVVMVAAVAQVQSLVAPWLESGQPFVLVGPEGC
FT                   GKAIILEDCFARLRGSSVATLACSAQTTAANVIQKLAQCCGQPVATSGVTHRVLRPRDS
FT                   ERLVLYLKDINLPKPDKYDTIQLIAFLQQLLTYQGFYDESQEFIGLLNIQIVCSMNPAT
FT                   TVGRHAITTRFTAIAGIAYMPYMSRDEMTEVYSTMFAEFTQGTNYESQSQRRLLADTVL
FT                   DIYTDVTRSFSADDHRHYKFTPRTVTEWIQALNRYDVGAVDLLEALHYEAGRTFRDRLV
FT                   GADAVNKFDSLVANVFRKHWRKDGLGSARHVYTTWAIPLDERDNKMGVAAPMASMPADS
FT                   FAEHARAGLLSYEREIKDLNIILFPEVLDRVARFNRVLSQPGGHLLLAGRSGAGRRSSA
FT                   SLVAHMQHMEFFSPKMTLSYDERAFKVDLKRILTEVAVENKETLLFIEDHQLVTPAILE
FT                   TVNSLLSSGEVPGLFSQLELDQIFGPLKDHMLAEGTMMSPFDFFTARVKAGLHIALSMD
FT                   PSDPEWASRTESNPALFTRCSMHWMDSWNEEGMRAVPEMMLREVFEAAEEFDGAAVVEQ
FT                   MSAIQRAVGGTPRQFVTFVDQYRRIFMQKREEHMEQRDHLVAGLQKLEEAADQVSDLST
FT                   QASEQQRLLAEKQIEADDALQRITVAMSAASERKKEVEELQVKLGKEEADLSARRGPIE
FT                   KQLAEIQPMIDSARAAVGSIKSENISEVKSMRQPPESVNDVLFAVLTLMGNTDTSWTAM
FT                   KRFLGSRGVKDEIINFDARNVTSRSRAAVQKLMEDKAASFEHKNILRASVAAAPLAAWA
FT                   KANLKYSSVLEKIAPLEEDLRELSESLDTSRTRMAQCKQDLVDLDKQVVDLKNEFSRRT
FT                   GEAEALKLSLKKAEDQLNAAERLLGKLGGEKSRWEEQVTTLETELTSLTRDSLLAAGFI
FT                   AHLPSLPEDQRQGALAQWTSFLGVERFDLRRFMSTESEMLTWKSEGLPGDELSMENAIV
FT                   ILNSAQAPLIIDPSTQASQWLKAHVAKDEKSALEVVTMHDKRFANKLELAVRFGKTLII
FT                   EEVDKIEPILYNVVRKDFERQGLRLMVQVGDKTVDYNESFRMYLVTRNPYPVIPPSAAS
FT                   IISEVNFTVTRSGLEGQLLGLVIQHEQPELEKQKSHLLQVEEDLKVQLAGLEKTLLETL
FT                   ATSTGNILENEQLITSLDETKAKGTTVKESLEESTTLQLSLDEQRNAYRPIAAQGSKLY
FT                   FLMRDLRALNHMYQFSLNSFILLFKKALNESTPSSALERRIEMLSAALLRLVFGQVSRS
FT                   IFNSDRLTFGMHFTRHLAAEDADESHWNYYFGLEAADGSGGRGSVPSWVPENAAQAFIN
FT                   LTATFPSATSELRLSEGTTWGGWIDSPVAETCVPAPSAGAFMQLLLVQALRPDRLQSAM
FT                   DSFVRTQLGVDSIAPPALSLPRVCDEADAATPVLFIVTPGSDPSQELEEHAEKAMGRGR
FT                   YHQLAMGQGQADEAMRLLTECARTGDWLCLKNLHLVVAWLPTLEKEIYVLKAHEDFRLF
FT                   LTSEPHAKFPSTLLEGSLKITYEAPPGLKRNVSRTYEAWSPQYISEGSPLRAKLLFLLA
FT                   WFHAVVQERRAYVPQGWSKFYEFSFADLRSGADIINQACDGSADPQWSQLHGLLERAIY
FT                   GGRVDSGYDIIVLRTYLQQFFSNEMTGGGGIRVKSLPGTDITLPNTTDHREFTALLRRL
FT                   DEANSPSLFSLPVNVQRTVQVTNSKHVINSLRTMAAAGGTSKGFDRAVWSAALSPLLRS
FT                   WERLTASNPALRSAPPPPSSGTLPPVDAFVELEQIRGHRAVAEIDGTLSALARVLDGAE
FT                   LLTPAIFAAGRCLMEDTVPPEWEKHWEGPDVPVSYCKGVVHRMAAVNDMVERTRRGSLL
FT                   SGTVRLEDFFHPETFLNALRQQMARDAGVAIDNLTLVTSWDGTGGGVAVEGMRVQGAVF
FT                   DGRKLRDTASDAPPFATLPTCGLTWVAPGSPGSGGPKGGAAPLSVPLYLTEGRERAIAE
FT                   VQFPVFDAEEASKWILAGTACFLGPVE"
FT   CDS_pept        709214..709774
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640512"
FT                   /orf_name="MICPUN_108782"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69189.1"
FT                   /db_xref="UniParc:UPI000199C9DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG40"
FT                   /transl_table=1
FT                   /translation="MTTIMDEDTCQKAGAVIDNQPGKIIKVEEPSIDRPKGCILHPFAE
FT                   GSAQKPTRLFRNGRLDGCGTVEQCLCISNPKAEAAAKAKAAAKAEAAAKFEYAAVREGS
FT                   CEDYGMTTIMDEITCKKAGAVIDNQPDKILKSVYTPIARPKGCTLHPFQRGSAQKPTEF
FT                   FRNGRVDGCDAGCDCLCIKNPKV"
FT   CDS_pept        709942..713160
FT                   /codon_start=1
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640513"
FT                   /orf_name="MICPUN_104915"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69190.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C9DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG41"
FT                   /transl_table=1
FT                   /translation="MAFELTAAELEEAVTERDKDAINKAGGHLGIAEKLKTDPKVGLCG
FT                   TELSEESLARRKEAFGVNEFEYPPPKSFLQLCRDALDDLTVQILCVAAIISLGIGAGLP
FT                   KHREEYGYLEGIAIVIVVFVVVFLQAYIDYVKEQKFRQLNSIKDNYAVKVVRNGEVHAV
FT                   TAGEVLVGDVVELSAGDKVPADGVFLEGSKLRADESAMTGEPIGIAKSHDKDPFLLSGT
FT                   TISEGSGRMVVIAVGSSSQWGVILKTLIVEPSSTPLQDRLDVLVVTVGNFGIGAAIATF
FT                   IASMIRWIIDGSEGKGWDGVLILDYLINSVTIVVVAIPEGLPLAITLGLAFAMRKMMAD
FT                   QNLVRRLEACETMGSATQLNADKTGTLTQNRMTVTDAYLGGTQYDSVPPDDISDEFAAL
FT                   LAESICVNSDANLAHNENGTVDHIGSKTECALLQLVEDLRSAGKGNLPESSNFAYVAGR
FT                   EKHDVAQRYHFTSARKRMSTAVPMNGGVRLHVKGASEIVVKLCTKMMKTDGSVEDFSPE
FT                   DLAAAEKAITAMASTGLRTLCIAYVDLDTAPSGLSDEPPEANLTLLGITGIKDPIRPET
FT                   AEAVRLLRQAGVIVRMVTGDNKLTAEAIAREAGILEDGDDGLILEGPVFRKMSQSEKEA
FT                   VAVKIRVLARSSPADKLMLCNLQKSLGEVVSVTGDGTNDAPALKDADVGFALGIAGTEI
FT                   AKEACDIVILDDNIQSMAKAVLWGRNVFQSIRKFLQFQLVVNVVAVSLNFISAAAGITE
FT                   LPLAAVPLLWVNMIMDSMGALALATEPPSPHLMERKPFGRSAPLVNKEMWRNIVVMSLY
FT                   QLIVCLVLLFAGQDLLGIDESDGDGHYRTLRVNSVIFNAFVFMQIFSEINSRKISEWNV
FT                   FEGIQNSPIFCFIIFLTIGTQAAFIEGVGRTVVGPAIGFMNLTGGEWAVCIVIGFCALP
FT                   VGFLARQLPLDIFPGRTDDEAAAESMEQKKQAVAAANAAVARDAALGAGDVNISLGDNA
FT                   AAKRRWSKVRNVMHAYSAFMSPLTVPVAESRERARGRSLSLTVGDEEEFLAAGLPSPTT
FT                   SAARTKSTEFRTVSPGSETSINMK"
FT   CDS_pept        713307..714017
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640514"
FT                   /orf_name="MICPUN_60729"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69191.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199CA5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG42"
FT                   /transl_table=1
FT                   /translation="MAALTATASQVKLRHRARVKTLPSRRVWGRSNQAGGVIRCSAGFI
FT                   ESYELALEASPLLVKSTTSLVGFLVADLVAQGLSSSRREDGDGRGIDLTRSGRNALFGF
FT                   ALYGPCSSWWYGLLDQYVLPEDPTSALAVAAKVAADQVAWAPVLVTTLFAWDLAWNGDN
FT                   VVGGGLQKKLGADLLDTLKVNWSFWPVFHVLNFRFVPPGDRILYINAVQVLYNVFLCYK
FT                   ASERSDEDEKAASG"
FT   CDS_pept        complement(714053..715726)
FT                   /codon_start=1
FT                   /gene_family="HOG000264824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640515"
FT                   /orf_name="MICPUN_53096"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69483.1"
FT                   /db_xref="HOGENOM:HBG562332"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199CA5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG43"
FT                   /transl_table=1
FT                   /translation="MSTTVAAAVVPISYRRPIFRRRVGPGRSARGRDGASRLAAAADTE
FT                   QAGLDDAVAKLLSWAESDSLRLSDKVTVGAAYPGGPRGLLATRDIEPGEEVISLPTSCT
FT                   AFDADYASADEIFGLRDAIAAYESSPSRGGDVTPEVSLALLIALARRHPERTPFGPYAA
FT                   ALPADPPPSPIFFPDEKLEALLPYLPLSLVDDIDAARQEMYTLWDVATAVMERVKVDGE
FT                   PAAALGLDEFAWAWMMIRSRAVTFRVRRAESGGDGVDARRCMVPVVDIMNHECSPVKDR
FT                   WRNAPFHRGPAVELEAGDGAVAWRATREIYAGEEVSWTYGNLSNEALWLWYGFVPEPPS
FT                   HGGCVVSFQLPESSLRGGLASVAKGDSAESAVAREDLLVRSGAFDARNGAGTERGTERE
FT                   LHFEVKVGERPKVLAGIAGLMCCSEEEVLAIKRALMSFGGCVMDEEEEEDEGAVAFVDM
FT                   SGRLKVRLCQESRRRAGRYVAFILDQVEPMACGPSGDDLLSLDTVKPDAVDADAWWATV
FT                   RLRTAAKEVFAITNVTLEEEAIKRDGGWIDEAVASILNIY"
FT   CDS_pept        715846..716949
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640516"
FT                   /orf_name="MICPUN_108783"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69192.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI000199CA60"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG44"
FT                   /transl_table=1
FT                   /translation="MIEGEVQRFLVGCALAALNLLYAREVVIRAKVPPGWVRLMLFLPC
FT                   LASHVYYPANNFDPLKETMASAVSFTNFGWWTNFKLMGLAFGRGQLVGKVGSPLMFLAA
FT                   GALPIKEEGRGPKHGSGRRTRSASAAEAKVARDLSPSATLARACCRIPVLCTVIYAAPR
FT                   LQVGSFALNLCYSFGLYAVLGFIFDIAGLVSSTVFSITLSPHFDKPFLSTSATNFWAKR
FT                   WNLVAGTLLREVIYEPIIEGSMTALPSKGSKSRNPPKPSTARRLAATTACFLASGLAHE
FT                   IIMWYMCGAREFGWEWTAFFTAQAPLCALEWFIKRQTRLRFPTPLAIVVFLTVQLTIAK
FT                   FLFFPPVVRQGLDQRVINDVKRILGLP"
FT   CDS_pept        join(complement(717918..717957),complement(717008..717873))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640517"
FT                   /orf_name="MICPUN_60732"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69484.1"
FT                   /db_xref="HOGENOM:HBG562334"
FT                   /db_xref="UniParc:UPI000199CA61"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG45"
FT                   /transl_table=1
FT                   /translation="MDARTLRIINLIDCSTRSEITHLFTQDVDPPEDEAVTWTEEQLRD
FT                   YFSSGGEIRPERRDTSVAGGFRDLPPPPPTCFPENMPKIGEELTEQLLTVEAYREAAFA
FT                   NGIPFRPNGLFTMGDSLLAELSKDPGLRAFQKNVVGFDEDGEPKYVPADSFAHGDGGAA
FT                   NGVDLRCFYRPDARTVVAAFRLGHRAAIAHHMYTTAHGGSIETVLDETTAEVVKCASTP
FT                   AVATTEMKVYLKRPLELFKTYRVDVEITDATEFKTFTKATIRDPSNPNIPLAIGEAVLA
FT                   HSAVLAKLMGKKRTSFNTAV"
FT   CDS_pept        complement(718109..719191)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640518"
FT                   /orf_name="MICPUN_101908"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69485.1"
FT                   /db_xref="InterPro:IPR021261"
FT                   /db_xref="UniParc:UPI000199CA62"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG46"
FT                   /transl_table=1
FT                   /translation="MNLEPPTLRSSEEENGLRRALEIVKKQGDFYKRQQGLSPLSFALG
FT                   LFNVGWSAFCLGRFVQYYWVWQVVKSVMLNYLSYSIKLKNHQRLYLMDLCHWLSFAYSI
FT                   VGSISLAAWAIPGLKEGLAPVTSSPYVFRACFCLANGPLGWAVPALANALILHSVEHTA
FT                   ALFIHISPPMVMWAMRWHAAEHEAAFPGILPMPLDAANGSGLGYVELITPAMTVYAVWW
FT                   IVHVAWLVSHGRYHGHSNTSGSSHDTVFHMTLRGNKVLSRWVGYDNDRPADIGPCVRYM
FT                   VLHAAACLLVTLVAPVFWYNFWAHTCFVLMLLASSIWNGSRRYYGMMTSSYERRLKALL
FT                   PEHARDNAPSEAPKKHEHVE"
FT   CDS_pept        join(719396..723037,723078..723224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640519"
FT                   /orf_name="MICPUN_101909"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69193.1"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199CA63"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG47"
FT                   /transl_table=1
FT                   /translation="MQQRGDEPVVALELDAGLGCLAVVMASSIEIWSTGQHRRLIGRHT
FT                   RDPEAVAEDGAYLAARWRGDGFARLAVVAAGGRARLFDVVWPNASTPRDADADPAALPD
FT                   RCELILRATLTVGPGSIVGMIPTAADDLLDGGHRRMGSLPPMLSPVNEESAAPLNDGVC
FT                   LSVAGDGDVLLLGTSTGHIVQCSWDARSSAAAGGGGSSHDVVSRGDPCADGGDHRHGAV
FT                   IRLDYSTEMRVAAAVMSSGACALLRIDDAGIPPGTGTDDDDDDDDGFGFTAVVAERLRL
FT                   ERWLGEGDATCASFSPPSQRTVAVGASIGTVRLYRVDAEADYDVHVATPWRVLSPADWG
FT                   YAPGDTGGCADVRWTTDGGGVAAGWWRRGVAVWSANGCRLMCTLPQGGGTAGSHADTAT
FT                   RDPWDGVDDAAGGRDGASTASVAGAGLSPRHFAGGRPTNARDREGGDGGTARLAWSGDG
FT                   YRLFAASASGGGGVGGGGVGGGDGEARRAKKGRLREFLFAAACPGHHLDASTRRGARAH
FT                   LLRAADRVIVVTGGDEDERAARHVMLPDAYAAPNWPLRLVAESADGRDLAAAGSRGLVL
FT                   HDFKTGKWRFFGDVSHEREFVATALAWLEGGVIAVCARLRGTGGGGGGSWFDWGGSSKD
FT                   TEAERHVLRMYPRNHLSVTSVLLEHELATEPVAMSALGRFLLVATPTDSGNLDVVVFEV
FT                   ALIGNMTGPRGGDMARVRPVRRVTLRDANVTGRVKELALLPAMPPRPDSTSPAAMRAQA
FT                   SALANRGSPRSGALGLGLPPTPSPPPVPAHFMMLRVGGTLSLIDLGSDESEGCTSERVL
FT                   ADGVERFWIASGGALAPNCDADVRWSWWTYGREGTRVWYVPVTGVPTFPAPSHGGGGDS
FT                   VAFADPELEFDKEAYPLGISLGDGAPLIVGATQRLAFASCSDQPCFEPTPKVQPILPCI
FT                   LRHLLRLGEMGAAIGAARAAAGKPRFTHSLEWLLFSSLDRHAGPNSVANKKDPDAAKEA
FT                   ERALADAVRLCREFPEYPDVVVSVARKTDSREWPALFKHAGDPALLQANALAAGQLRTA
FT                   ACYLLVVDKLVSADVGAKAAGEVLRAALERRRYGLVGELVRFLARPAVEAAAARAARRS
FT                   AEKKKRRGDDADEDVGIVSGLFRWLGAAPEPAKSEPADSAGLSPRRSLDEEFVQTPKGV
FT                   EHVSGARGGVIAVLQPDLRRALRDHAAALAAAVDLGALAAFARETDFDGAARLGWATSP
FT                   GLSPRPRIPCDDTSSVRGVGRRLRRCGRVWTRCWRRW"
FT   CDS_pept        join(complement(724710..724839),complement(724262..724582),
FT                   complement(723570..724153))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640520"
FT                   /orf_name="MICPUN_108784"
FT                   /product="DEK_C domain protein"
FT                   /protein_id="ACO69486.1"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniParc:UPI000199CA64"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG48"
FT                   /transl_table=1
FT                   /translation="MAEEPREKRERKATVEVYSVASPTKKEFVIPEGAGTKVGDIPNVE
FT                   FALGKFRSDDEFLKTVHRLMFGTPGKATIIKKNIRAFSGLPQDDEKATTRAEDMLKRAF
FT                   NATLNQLLDLFDLPRGSGEEGKKEAKEKRIFAWLMKPTQSGNKNLKEAAEAKREKAAKK
FT                   RDRVAAKKEKAASKRAKVSTGKLPDDVKAIKAELNALAARQAALLKKLEKAIEGGAKKK
FT                   AAPKKKAAAEDSEDEDSEDEEASDEEASDEEEEEVAEEEDAKDEAAPSQKEEPPPPSPA
FT                   VATSAPTAPTDEELEYAVKEMLAGVNLESVSMKKIRVDLEEKFGVPLNDKKSIIKEFAE
FT                   KYIS"
FT   CDS_pept        complement(724990..725700)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640521"
FT                   /orf_name="MICPUN_108785"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69487.1"
FT                   /db_xref="UniParc:UPI000199CA65"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG49"
FT                   /transl_table=1
FT                   /translation="MRGESGNAEDGGARREVFEVMCEACCHEGLVDVALEVFDDVKAYD
FT                   VRVSKVTLAFLEACCRRSKVPEWRVFDVCAQLRHQVTAKKQARLAAQMPAKSRSHHVYG
FT                   VVDSADSSDEDDVDESIPPATITTSSSSSSATAAFVQDDVGGERRRRKDVEDKWERARR
FT                   ERSRDRARGASADSGGGENLDLAWLKFDDPYGDDPYGDYDSRDRRAGGEEEMDPLQAEL
FT                   RTEGLGRGNRQDPS"
FT   CDS_pept        join(complement(726856..727026),c
FT                   omplement(<726130..726741))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640522"
FT                   /orf_name="MICPUN_84235"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69488.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199CA66"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG50"
FT                   /transl_table=1
FT                   /translation="MRAEGANAESFLESNAPDTITYNTLIAACVASNKSARASALLKDM
FT                   IAAGVPRSKRTYFIYTALIDAQSKGGDPNAAFETYGKMKAAGVSPTVVTFGCLLNACRH
FT                   FASSGAGESDVDPAELAYALLSEMSERGVVPNDRCQNALVRVVSEAGRIDDMLDEVKAI
FT                   ARRRGKFERTTLEGVVRALCRASYAERALRILSWMDVRGYSPSAPTYRALVQVCATEGQ
FT                   VQWAWTLHQRMRRLGYRPDRPTCSALTQALCRAAVATDS"
FT   CDS_pept        join(729096..729554,729691..730146)
FT                   /codon_start=1
FT                   /gene_family="HOG000265208" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640523"
FT                   /orf_name="MICPUN_108786"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69194.1"
FT                   /db_xref="HOGENOM:HBG562339"
FT                   /db_xref="UniParc:UPI000199CA67"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG51"
FT                   /transl_table=1
FT                   /translation="MDDLKEHYRSDWHRYNLKRKVAGLPVVGKELFERVMQQAAAGKNG
FT                   AQKVTGTSHLKRPDELPRSAQRAQRFVQWAENHKEEIQEAEEYARRLAAGEISDGEDHE
FT                   DGTGEDGAEHDEEGESDDDGDWESMASDEAEEVLARMEKMAMEDQDDEEDYGSESDDDD
FT                   EEMQLDLSNAPVRLADNGYELIITRDDGTKKRIGPRELRRYYRQRHRPEDNRQSVLAIK
FT                   AENAERGLVAARVGTGGDKLAKYDQNGRFYGVPPHIAALVKRAQKAARRYEGSRMIMGG
FT                   SGNKKFDLNGQNVKTKLPKACPY"
FT   CDS_pept        complement(730219..730947)
FT                   /codon_start=1
FT                   /gene_family="HOG000215319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640524"
FT                   /orf_name="MICPUN_84407"
FT                   /product="Predicted protein"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69489.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG597907"
FT                   /db_xref="InterPro:IPR008591"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI000199CA68"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG52"
FT                   /transl_table=1
FT                   /translation="MAEASQQDDLAEILAEASQQQQQDPTNIVARLKRAYVNEKNAPEL
FT                   LPFEHDLLEQVMAKVEDQELVVQQSREAAAAAGGGGGGGGGGGMDDLMAHIYQAELNRV
FT                   RFLIRAYYRTRLFKIEKYAVHVVKPETNEFAKLSPQEQKYATDYVNMLEEHFGSVLGQM
FT                   PEKYSSMLQQIEEDDAEMDMVPEPNLDKHVFCRVREDRRDVMFDPNDPDNTMDLDQGDI
FT                   IMVRYRFIKGLLEDGALDLI"
FT   CDS_pept        731606..732805
FT                   /codon_start=1
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640525"
FT                   /orf_name="MICPUN_84125"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69195.1"
FT                   /db_xref="HOGENOM:HBG630928"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199CA69"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG53"
FT                   /transl_table=1
FT                   /translation="MDAAKAAKKGKETDISKLIDSIDDDEKEKARAGADAIVEFKGEAG
FT                   TIVPETKKRYNYSAQIIPRLASKWPKPPWHAPWKLYRVISGHLGWVRSVTVDPSNEWFA
FT                   TGSADRTIKIWDLASGQLKLTLTGHIEQVMGLAVSDRHPYMFSCGLDKMVKCWDLEYNK
FT                   VIRHYHGHLSGVYSLALHPALDVLMTGGRDSACRVWDMRTKTQVFCLSGHDNTVGSIVS
FT                   QENNPQVITGSYDSTVKFWDLAAGKCQHTLTYHKKGVRALALHPREFTLLSASADNIKK
FT                   FALPNGRFMHNMLSQQKSIVNSLSVNEDDVVVSGGDNGSLYFWDYKSGHNFQQAAPKVQ
FT                   PGSMESEAGIFASAFDRTGTRLITVEADKTIKMWKEDEDATPETHPNLEFHPPRDLRRF
FT                   "
FT   CDS_pept        732973..735027
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640526"
FT                   /orf_name="MICPUN_60739"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO69196.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG610604"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199CA6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG54"
FT                   /transl_table=1
FT                   /translation="MGNSVGKEATVQESVAGDTGRPPRKEHEATRGSAAADERRTTEDS
FT                   PTLVSGLRLVEGIVDTSGSPSEHDILVAWIRGTLERGRAGELPGNTYAPIPEKWRKRNQ
FT                   SREMLQFGTYTHSNRVETHVPVAPLPPELDAVVDALIARGALTELQRPDSCTINLYGPG
FT                   QWIPPHIDNPAFDRPFVTVSLCSEQPMVLGRGMVWPEGGRGPCGDDERLNEEHALSLPV
FT                   GSAVVVEGEAADEYEHAVPPVTAERISLTFRRRGRPGREMDERTERAERCRRRCRDVRG
FT                   AIVAAAEARAGGVRRGFGPVGPIGAIGRVGPPPAKPAGRREGSVIKKPMDDDAEDVVGG
FT                   GVLSKNAAKKEARKAAKAAAKERARKAKPTTTAVDGTVFERKEKVRSCPACPPDLLPPT
FT                   TSDANESQCADASCVAPPMYGEDAGVPVAEALPSVERVHVQRVYDAVATQWHGTRYRAW
FT                   SGVEDFVRRVVQPGSLVADVGCGNGKNLPEVESLGGFGVGCDFSVGLLEICAVERGLEV
FT                   FAGDATCLPLRSRSFDVALNIAVLHHVSSEPRRRKLVTETMRLLTVGGTALFYAWALEQ
FT                   ADGGVSGHHFESQDVLVPFHKKAGVQGKVVVTGGSGSGEKEGEETRAGGAAGEDDDGDP
FT                   TAPRVYQRYCHVYKEGELETLFEHIKSWVKVNRVYFDCGNWCVEAERIA"
FT   CDS_pept        735545..737737
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640527"
FT                   /orf_name="MICPUN_60740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69197.1"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniParc:UPI000199CAF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG55"
FT                   /transl_table=1
FT                   /translation="MASHALVASHATAAALLGCNRHRRRVSVARWHRCVVVASSSGGDP
FT                   AGRRRGDGSFEASTSSASTPSPSRARKNRAAASKPRNAIATGSGEWDSDDDASVPSAGP
FT                   QPPARAPADRAATTRPPKAKPRAKARDSPSEDTELVMVLERRGEGWSEEVFPHVVMKRR
FT                   PVERKARPAAKAAKADTAELYLEERLGFSRDDAVATISAAAAWRVTPRGRALVDKKMMR
FT                   AVQSNTRDAIECMRQVGASEEDIPKLIRDTPQILAIVPINEWNRRLLEYVVRTKVPGGG
FT                   RLGPLKLSNRGRLPKEENRKGEAMKPWVNEVRELRRFGRLTQEQMYMLDVAGFDANVKE
FT                   TKRIGESRRTWEMWFDELVEYQCKQGTVNIPEERADAGLGLWLKRQKEKHREGKLGTKA
FT                   LKRLVAIGVNFEGYYPQSPIKPKRGRPPKNASKTDAAEAGVSRDERGEGLVSNGGSDCT
FT                   VEGLAGASEGTKDWRRVLGPDGVEYVYELKRWQSVEGEFIEPPLGSPLAVWLARVRARA
FT                   ADDAEDPLPDAEREALVDAGIELENFSPVWLGELEKFYGLRQHRVTLHDPVAQRAFVEE
FT                   QRQLAAEGKLSTAKLRRLKAAGVSGISGALQLDFLTLDSIDELDDEEFAPWPTAAPRSE
FT                   DPEDLVQSLMRENVVAAAAAAAARAEAERTRETPRTRRAPAARARRRPMAPIAPGPSGV
FT                   KKEEGLGSMDDDDEEEVVEEEEVVAADPPEFERART"
FT   CDS_pept        complement(737811..738704)
FT                   /codon_start=1
FT                   /gene_family="HOG000012499" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640528"
FT                   /orf_name="MICPUN_108787"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69490.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG610097"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniParc:UPI000199CAF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG56"
FT                   /transl_table=1
FT                   /translation="MSGNYATPPPQSATQETTLGQSNGFVDGSYPCGSLFGIPLRVHKL
FT                   FVAYIVIVSVLGFIQGGLEGDSEYGFMLFLVNGPILFGTVLIHELGHCWATYRVGGTVE
FT                   GILLWPLGGLAFIGHSGEAKEDLFVSVAGPLTHIPQMIVWVILLAASADGDATLTFSGA
FT                   FFADLCRHAIVINLSLFLFNLFCPAYPLDGGRILVSCMLLCGVPVGTTANITVAVSAVF
FT                   GLLIVCLGAVYLNFLTIFVGGWVCNQAWELYQIVRQGRLDLHPIFHKYANDARYSGSAG
FT                   SAGNNGSISSALGGRV"
FT   CDS_pept        741147..741728
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640529"
FT                   /orf_name="MICPUN_108788"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69198.1"
FT                   /db_xref="HOGENOM:HBG562341"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="UniParc:UPI000199CAF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG57"
FT                   /transl_table=1
FT                   /translation="MATAARPTTMTTLRAVGTGLEARSGRRVVTRALAVAHSPWSFAAR
FT                   GISDSIPTRGDDDKNAADVPSTSAGDAKDVQGTAEERANKRKDLYMMFTCGKCETRAAK
FT                   GFSRQAYENGVVIVRCPGCQVQHLVADRYGWFGEPGSVEDFLKGRGETVVTGKAGTEDD
FT                   DGTLEIDRAQLEAWMAKQGVGATTNEEGES"
FT   CDS_pept        complement(741790..743844)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640530"
FT                   /orf_name="MICPUN_101914"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69491.1"
FT                   /db_xref="InterPro:IPR019358"
FT                   /db_xref="UniParc:UPI000199CAF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG58"
FT                   /transl_table=1
FT                   /translation="MTARAGRRVRAFATLLLVAALATLAASEATASEDPNAASHAPSSS
FT                   HPASTTGGAEKPHELRVGDAAPRRIAANTRRPGILKLHGYPRMLQHKMFHHLTLEIYDD
FT                   GGFVANSCVLHRVVMDKESDGEVRRTKVRQRKGPGHPGLAALAGGSLNTAASNASGGPT
FT                   FVATFGPFDQGVTLTPRCERWRGGAAEPLSYRVRLVASDGPDTGKIAKLVVGAALVTLA
FT                   PAVSEMTLAYYGVGMALSVLAVAILIIYRVARSLPGGRAMKAGAGASAALAALVVPSEH
FT                   LSAVVEGYVHLCLKPVSLVARAVYEQNPDEAGLPYALAATIVMLAGAGIGLWVVRRWMI
FT                   DEVTGGVAPSVAGFACVAMRVVGVVLLQFCTLDLLSGFALVGASLAVTAADVARSWPGS
FT                   TRRSSSSSSGQTRGAWSHGSGSVASRHRGGAARRILRRAGRYFSDEEDEEDEEEVDAYE
FT                   ETDDDLTPGMGHERGSPGLGVRRRAGSGRKTPGNRTLSVDNRDERMGDRAGRIVFGTDG
FT                   PGSSRGGSFLGGVFGGGSGGHSGSARKRRSLPESMDPEPRTPPATIVGAGGAIGGGGRG
FT                   ASAVGGLMGLFGGGTRAEKRGTAPRRSKLGGRSVSSTVAAASNSPLPPVGMAAASRGRF
FT                   LTASEFNAQSARATDAGLDELCDTPEFKRWMRDNAGRIRVTSSDSDDDA"
FT   CDS_pept        744453..746399
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640531"
FT                   /orf_name="MICPUN_60746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69199.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199CAF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG59"
FT                   /transl_table=1
FT                   /translation="MSVMATPSAASVRGVPAPATRRVGARRPAPVVCRAAAPRDAAKLS
FT                   AGILAVAAANAARAEDVEAPADAVVDAPADAAAQAAAQAADAAADAAAQAADAAAKAAA
FT                   QASDALNGALGGLSGGLDGLTSQAGGALEGLKGGLGGLTSQAGGALEGLKGGLDGLTSQ
FT                   AGGAIGGLGSQAGGAIGSAAKGVGSVAGPALSGAAKVAGEGAGVVGQGLGQATKAVGGA
FT                   TSAVSGAVGGATSAVSGAVGGATSAVNSTLTSTVQSLESALPPEFQDVVARAQTDSDTA
FT                   VALIGLTAAVPIGLVVLGAATRGYAGDKNPFVVEEQLKKDRRAFLIDTRSEDARRNDGV
FT                   PDLRGKARGKGAAVEVATLPADERRVLSNPRLVELELAATKVKALTKGGARVYVLGPDA
FT                   KDLAKAITRLGGRRAFVVSGGFDAWRSSGLKVGVKYAKSALEGLGEDTSEAASSFTQKV
FT                   AGSVKTSITTKKPTDAIVPLLGLVAAAAAAYNYKTALEYAGVIGIELTILAKLLSYESP
FT                   WAFFEDVKETAAGVVGAVGSFEPPSVPEVSVPKVKVPSVAEMAPPPRPAPAPAKEEAKV
FT                   EEVVEEEEVAEPEPEAAAPAPVEEEAAAPAPAAEKKAGRVYDETYAESKSEMAKAAEEA
FT                   ARRADKKPEQRDM"
FT   CDS_pept        complement(746500..747522)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640532"
FT                   /orf_name="MICPUN_60747"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69492.1"
FT                   /db_xref="UniParc:UPI000199CAF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG60"
FT                   /transl_table=1
FT                   /translation="MGTRFRARFAFLAVALVVLVAEAQAQAGDVDPDDIFTPPPSPPPP
FT                   PPSPPPPSPPPPSPPPPSPPPAIGANRVPSADLAESNIFGGTEADGADSGSTCCMWYKW
FT                   CDNTAVTHQCNATTLENCYRAAGGRDALDGTATEHCRACALCDDADGAAVDSYNKNLIA
FT                   PTDPFTASNNYHACFDTRRTVKTQYYNVDPGNMNMSAVNTQYARRYLNLNETEFIYCSK
FT                   VNFKCMKQKASGSSECKVRKGVRVPNQHHALFGRLYDSSLKDPRRGPAAGRLMPGHGNY
FT                   VFSAERDYDKVAEMHDRDRAQDHSGYRYPYNVTKFDGDGIPPNMTVPAQYSPTSDPIGK
FT                   "
FT   CDS_pept        join(748130..748242,748382..748573,748643..749867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640533"
FT                   /orf_name="MICPUN_60748"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69200.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199CAF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG61"
FT                   /transl_table=1
FT                   /translation="MEMQNIFNAQNPALTLSGLNEQTRQLQSMQGFAAGNQGMAHPSVL
FT                   IPGFAPHGVPLPQPISNSLFNEAQTRAAQQMQVQANAATPTGADGVGSDNMMTYISGHE
FT                   SGRRVKAEMRRPTTDHPARSPLGKNRRKIVNNVVTKISTPYSTGHIPCPYGCGRSFKHA
FT                   TQKAIHIRKVHTGERPFVCKVEGCGKAFYSSGDLKSHEKTHSGLKPFECPTCGKALSSR
FT                   NALKVHIKALHTLERPFKCEVPNCGMTYMTRLDLDRHMKKHVKWEQKEEKAKMANLEKR
FT                   TEKAERKLRQVLEKQVKNQSGEARGSVNLSAGRLVALAPGEPPPEGAVAYFVPNANGAG
FT                   MPLDKLDVTYARGKYRRGSSKSTGGDGTSGMEPSSSLLSREGEEGDGDDPTVQGATDAQ
FT                   NALRAAANGTTADGGNGVVTPVAARKTYKRKASALAPADNAGDPEAMLRATKKKLLETR
FT                   LRREYDQGGFKGAIPFQSWRRGLSTEVCQKFQDEVDKLVHSGIDGVITEAA"
FT   CDS_pept        750264..753221
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640534"
FT                   /orf_name="MICPUN_101917"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69201.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199CAF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG62"
FT                   /transl_table=1
FT                   /translation="MVSRPRPRGGRPRALPRLVAVLAALAAISIVGSVRAEDPPVAAAL
FT                   GFGGDGGAVDASPVREEYPIATDQTDDAADDDGEEADDGEELRRRLDELERLLYLGGVE
FT                   HRDAEGALVGMFELASEAPSMEEVIEVTGRGVGGAERLAADARRDLDAARDAIRSAVRL
FT                   AYDDFNGRAAADELETHTYLTLDRIPGDTSRVNIAFDFERAEHAGVGYVGRAIARAIGL
FT                   PGSDRKPSDPVDVPADVARVIADAKRLITDAVRSEMNAHKAAVEAAGGDASPSVATPAR
FT                   WAPIADALFILAALAEAGVVPPDAWPLDALADTSPSQWSRDALALAAEMGSREASIAIA
FT                   DRVLFGRGAHPETEKGADCDGAAARLAKIADDVAGDAESAGDFALPREPGRLRDRERDA
FT                   GWVSAQELEDGDDQILMEEDMAARGVPEAQRHVGYRRLLGRGMERDEAAALREFEAAAN
FT                   QGDELAHFNLGYMHMRGMSVPRNFTEAKRRFEAAAAKDLPAAHNGLGVLAFNGHGGEKN
FT                   LTAARQHFERGAARGDPDSQFNLASMHAQGLDVPKNETRALELYAGANEAGHWRAPLAI
FT                   AVAHRAGAGTEPHCAVAAHYFRVFIDERSGWTSEQEDAMRVLDGGPPMDADEADAEEST
FT                   NAAPDPWGALVRYALLAEQGCESAAANAGWLLAKRAGYDRDDHVARAIAMLERSVRMGN
FT                   HESHVDLGNARWDRLRAEGGFTGKSGVHPSGFECERCGEFGDAGWLASRGWLDAEDAQD
FT                   KEGLGLRRVRLDRVVVPPAGLSPEEEVAFHYAEASAAGFAEGTVALAWAHAHGVGVPRN
FT                   LSMASHMLSHAMHNAVDDEEAVPAFFAWVGVGALRVVDRFVPGVGSRWYAATGSTPGDA
FT                   RGERGRDSGRSRGGGGGGGGDDAPGIGAGAGEKPVPPRVARRDDPWHPLSRRVVENCVL
FT                   LALAASWGIVAYARRALNDPGFDQNIVEQMPVGALAGVGAAIAVAAGVSVAVFGG"
FT   CDS_pept        753751..754068
FT                   /codon_start=1
FT                   /gene_family="HOG000232621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640535"
FT                   /orf_name="MICPUN_84551"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69202.1"
FT                   /db_xref="HOGENOM:HBG635181"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniParc:UPI000199CAF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG63"
FT                   /transl_table=1
FT                   /translation="MDGEELRLLVLNKWGKMYDTRIHQRRDQFNKLQLYLQIMWKHVGQ
FT                   KSFPLTEAAYMEQLDAVAELLTEWGAQDVVRRKIPESTKFPKLDTTGANAVMIPLDIEV
FT                   E"
FT   CDS_pept        join(complement(755534..755630),complement(754192..755402))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640536"
FT                   /orf_name="MICPUN_60751"
FT                   /product="Predicted protein"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69493.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI000199CAF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG64"
FT                   /transl_table=1
FT                   /translation="MPVFGVSVQDACRESGGLPRVVAETIAWLDAHVGVKPAENMFKVR
FT                   GDHNKIQECRIRYDRGEVMPLKGCADAHTVAGVLKLYLASLPEPLLTFRLYDSLLAVAA
FT                   MPSRSRRVLALGSLLDSLDVSAKRTLSAVSAFLRRCAQANAAARMAASKSDADETATLA
FT                   RCVRDISTAFSPLLLRLRGAQRDAAALAEDTARADHVVELLVEYHAEIIGLNRHKHRQQ
FT                   GAGTDQGNGCEVMSRKGGGLGASDNGRNAHRDERARVAAATLGKENASDGGAKTFQTRT
FT                   AKEKESSNAHVHAQQARRPVATLDVHLANDFADVAMDGLIDEFVGWSVGGLMGGDDLFT
FT                   AEIDRAAGSALEVLYKGGIHRMPPDELAAEKQHIKRRLRSFDNHVAACSGRKATKEDKR
FT                   HLRPLYLRLAHVKRQIGVLEQSGAGQHGAQRGTART"
FT   CDS_pept        complement(755969..756511)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640537"
FT                   /orf_name="MICPUN_53105"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69494.1"
FT                   /db_xref="UniParc:UPI000199CAFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG65"
FT                   /transl_table=1
FT                   /translation="MAGQDRWERAVLSGQSAIATALICIVVLVTLPLLKMLVRLGALVG
FT                   LASLYINNPCREPSTHHKAWEMLLAERRRRIGERNAKDVSNLNVISLIKNAVNDTTGLI
FT                   SGQRVMCDFVFFSFAYIDSESGVDAEYFALGAMGSWRIVEMAVLRRLASSFAMGLDGMA
FT                   SGIGGDGGTGSRAEPQG"
FT   CDS_pept        756652..757122
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640538"
FT                   /orf_name="MICPUN_60753"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69203.1"
FT                   /db_xref="UniParc:UPI000199CAFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG66"
FT                   /transl_table=1
FT                   /translation="MSAVFTGARTAARPGTSGRGLASPARPARFSRTARPAPSPTHASP
FT                   GEEANDVIVEWDVVVFRDGDGLSVGKVESVRASDGTCVCQPLFQEEETGVWLEATYTRG
FT                   PETVPLGDVTAILDADFAQRMAPDRVSNPHGEHAEDFWEILAELPDGVRRGE"
FT   CDS_pept        join(complement(761552..762003),complement(761055..761388),
FT                   complement(757305..760850))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640539"
FT                   /orf_name="MICPUN_105952"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69495.1"
FT                   /db_xref="UniParc:UPI000199CB7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG67"
FT                   /transl_table=1
FT                   /translation="MGRSCPPSATGLPRVSEEGELTDEADCLTCDEASLCEPACSRGSE
FT                   GSGALGGRSASAARSSESLHIVEKAKPVDLVPPAPGFRAPAGGSGLHQPTLPRNKPESL
FT                   GFRSKTFKFRSSSVDSGLYMLENRATTAASGYAMLMPLTLRVMEKIRLDGWRCMPKVES
FT                   DLWWRAHSHPMSTSGPPPPVTTELMRVGQRLLIGIKSPAKRPTAPDASPTSSRQGTVHD
FT                   VINAAVESAQSFAPARVEALGRILAPANWVTIDRLSESSEGKMVVWSPDDDDVPGAGFV
FT                   VTPAEAAAKMLFGADEAPRMVSALTAGLAATEQKHAHASTPNAGQRRKSLDGDDRPRPP
FT                   RLARHASFTSWDWNGSGQSSGEGCCVESNALAVGAEAEVSMAAGALGLPRRGRRANATP
FT                   PLPTIRSPVAVAKRRRVSEGEMAENDHGHPTSSLPIVHPSSPIVISAKKKSPPRQCMDT
FT                   ASVDDDGPSHVELARERDAEEERRRQREARREGESETIKALRQQWETMKGRTMRAGTPA
FT                   PAGGTRPERARDDGDGDTPPPKMVRRRAPNLKQRLSEVLIPVLNPMRNWNFNTRVTGLN
FT                   LSNASIGPEGAKFLASALHGRRNADGTWVFNSVLRSLNLEFNSIGDEGAVALFEALAPR
FT                   WVTDGADDASDVSGHSGFDQDEWMRSTAPASTPTRSDGAWVCNTAMQELNLNFCDIGPL
FT                   GAAALARVLAPRVGPEGGWVFCSGVTSVSMFHNHIGPEGARLLGDALAPRRQPQTGEHV
FT                   FNPVFRALNVGRNQLGDQGLSHIARAFAPKRSPSSGHWDFNPTFTHLHANQNSCMHQEG
FT                   PLAVGAALSPRPNPDGGWAFAHSLSTLHLANVHLDEEGGRAIAGIIAPRQNASTGVWVF
FT                   PSNLKVLNLSRTGLGDTGACHIAEALLPRWSPLAQLGGGGACGRWLFNSKLRELHLGGA
FT                   TIGPGGAKALARALTPQRNNDFLADVKVESQWAFNTALRILDLRDNQIGSEGMEAIAAM
FT                   LEPVQVETDFGAQSPNSGSSTPGAFNPNVFFPVAPADPATHASSATRTAGTAPPGPRTR
FT                   WIPGGGGLTVLNLEFNDAGPEGICHIARALTPRWCAGLPPPGRVGPDSGRSSPAFPEYP
FT                   SGLGTRGSGSPDSSNASSPGATPYGSRPSSARGGRGGFINPRSRPSSAGGSGPASRRSS
FT                   FGVAIANGLAVHKDVDALACTGVGGDDCACGTCRGVWTNGGGWTNGGGWTNGGGWTNGG
FT                   AQLGDGYWVANRALRGLAVGGNRMGDEGAAALATAIEPRMNSDGSWTTPALHALDAKEN
FT                   GIGTEGLLALARAVEPKCGRCLRGRTSRLNSTDSLASMDECRSVASRPGSTHGGSLLSS
FT                   VLLNNAANAAGDVAGLMNQWGLGGNSPADSPRSFSPTSDTERGSPFPGGSPRVGSPTGE
FT                   CAFEIHSAVRRLDLLHNDTNANLKAVFQHLKSTGSQCDVTI"
FT   CDS_pept        762924..764504
FT                   /codon_start=1
FT                   /gene_family="HOG000100776" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640540"
FT                   /orf_name="MICPUN_101921"
FT                   /product="Heat shock protein"
FT                   /function="heat shock protein binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO69204.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG562352"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199CB7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG68"
FT                   /transl_table=1
FT                   /translation="MTFAKVQLAFETLSDPQRRATYDLLAREFEFTYIPGVTPRARGGE
FT                   DLILDDLERLGLDLDPGRQLVVLCEVCGRPSNKTCYVCDCRFCDFCTRKMHWKGQFGLH
FT                   YPVQNAPGSMARRIAEKELETKTLEDGRERQLEDPNYRNDIELSEARAFKEAAAEIYGL
FT                   GAKPCDFNGTLPHHVRRYDHRLSRYYAWAQTERKVYIAVHVPTGFEDKRVHMEIGGGHY
FT                   AVLRVQAEDSAPVLERRFAFPIDEKCPVDTLQTQMRTKMLISVTKAEPGQTWTRLFDGD
FT                   PFYARCLQQPYKMEESSTEAVLEIELPFWIEGSDCDVKVDEYKLTVNVLNEIDGLTRTF
FT                   WRPGVDPNEKQKHPGTPHYLLPEETAWSLDREIHPVTNEPYNVLMICLVKRQPTTNEQQ
FT                   YKKGQVQDNRFAEIPMTNPPYCKGVRMFVEDMDRFSLEDDLQAMCFMETGSTWRPAKPW
FT                   AKYWGSASSGDPEQDIVATEVDMLPQGAKLTLEAFLKAEEKRQEEELNVECGGLVTACE
FT                   EMIHGGPRY"
FT   CDS_pept        complement(764538..770243)
FT                   /codon_start=1
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640541"
FT                   /orf_name="MICPUN_84094"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69496.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199CB80"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG69"
FT                   /transl_table=1
FT                   /translation="MEKLRRKEERKVGRRIAQGQGEPLLEWLANSGVGFAALCEGDWEA
FT                   AANQPSTEDDIWAGLYGLGGGGGGGKKALPAGTTRKVHKGYEEVHVPAGERAPVGEHER
FT                   FVPIEELDDWAQPAFAGMKSLNRIQSRIYEAAYHSNENLLVCAPTGAGKTNIAMMTVLH
FT                   EIGQHIEYGELAYGADFKIVYVAPMKALAAEVTGAFSRRLEPLGIQVRELTGDTQLTKK
FT                   EMEETHMIVTTPEKWDVITRKGGEVSVASSLRLLIIDEVHLLNDERGPVIETLVARTHR
FT                   QVETTQSMIRIVGLSATLPNPADVAKFLGVSDAGLFVFDQSFRPIPLTQMFVGVTEGNA
FT                   MKRQMLMAQIAYDKCTAALRSGKQAMVFVHSRKDTVKTAKQLGEIAANDQTQGGLELFA
FT                   PENHPDFTTWKKEVERSRNNELKELFHRGFGCHNAGMLRSDRTLVERLFSAGVVKVLCC
FT                   TATLAWGVNLPAHTVVIKGTTLYDPSKGGFRDLGVLDVQQIFGRAGRPGFDTSGEGVII
FT                   TEHKKLAHYLALLTHSTPIESQFISCLADNLNAELVLGTVCSVKEGAQWLGYSYLHTRM
FT                   EKNPLAYGLTWDDVNLDPGLVRHRRKLVTEAARTLHRAKMVRFDEKSGFIYQTEAGRIA
FT                   SHFYIKQASMELFDEHLQRHMSMPEVFHMVAQATEFENIAPREDEMPELEALRRNRKGA
FT                   CPLEIKATLADRAGKVNLLMQVYISRARMEAFSLVADSSYISQNASRICRALFELCLRR
FT                   GWPSLAEELLTLSKAVDLRIWPHQHALRQFEQTLSPETLYKLEERQATVERLFDMSAQE
FT                   IGSMLRLNTAVGQKVRGCLESLPHLTMEATVQPITRSVLRVTVALTPEFKWRDAVHGGL
FT                   QRWLVWVEDPVNEHIYHNETFMLSKKLHGEGKQHLAFTIPIFEPVPPQYFLRATSESWL
FT                   GCETFLELNFNELVLPDRGPAHTELLDLPPVPRQALYPPENPELGRKEFFDLYEGKFEF
FT                   FNKVQTQAFNTLFHSESNVLLGAPTGSGKTISAELAMMAAFRDHPGGKIIYIAPLKALV
FT                   RERIEDWKGKLCKVLNKKLVELTGDYTPDIRALQGADIIVCTPEKWDGISRQWQARSYV
FT                   TKVSLVVIDEIHLLGADRGPILEVIVSRMRFISTRTERPVRIVGLSTALANANDLADWL
FT                   GIEKQEGPKSGLFNFKPSVRPVPLECHIQGYPGKFYCPRMMTMNKPTYAAIRTHSPEKP
FT                   ALVFVSSRRQTRLTAIDLIAYAAADERPDTFVHMDPYEMEMHLAKVKSPELRHTLQFGV
FT                   GLHHAGLAPEDRALCEELFLKCKIQVLVCTSTLAWGVNLPAHLVVIKGTEFYDGKTRRY
FT                   VDFPITDVLQMMGRAGRPQFDTSAVAVIMVHEPKKAFYKKFLYEPFPVESSLADQLPDH
FT                   FNAEVVAGTIRSKQDAVDYLTWTYFFRRLVKNPSYYDLESVEHDALNAFLSRLVENALA
FT                   QLEDAQCLTIGEDDSLEPATMGRIASFYYLQHPSVALFASSLGPDTSLEQLLGILCGVA
FT                   EYDELPVRHNEDKVNAELARQVEDAGGFKVDARLADDPHTKANLLFQAHFLRLQLPMSD
FT                   YVTDAKGVLDQAVRILQAIIDVCAESGWLATCLHAMNLMQMVMQGRFITDPSCMSVPGV
FT                   DEQKAASLSGSGYEALPQLVDACVNKEAAARKALTNAGLKQRQVDEAVNHCQRMPLIDI
FT                   DVKLSKDGTEVEVNLRRTSKSAGGGGKGGGRGSAPRAILPRYPKVKEEGWWLILGDRNN
FT                   RELLSLKRVGFGQSARAKLAVDRSANAVFEPDLHVYLISDCYVGLDQEVEVARGAGAVG
FT                   AEDAGDTGDTDDEQGFWLSPEQVAARLAARATERATEDTDSDEDFWEMPAAAAPAGERY
FT                   SAVMAAKMPVEEDPFFWENEREYLDAK"
FT   CDS_pept        773403..775121
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640542"
FT                   /orf_name="MICPUN_108790"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69205.1"
FT                   /db_xref="UniParc:UPI000199CB81"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG70"
FT                   /transl_table=1
FT                   /translation="MRKATSMLMIFILLIAAIGVIVYAKDTLSKSPPAVACPNTVYDAT
FT                   TNPAPMLNCKAIWDLASEDAINNATSETRRSVDMFISNIKNYEKCGDFIVKADWARPMD
FT                   SSAYGAYTAPATGSAWDGGFLPNSQADECAALTCKQCYCTTVVSLANLGDLMNAYFDSG
FT                   AADKAFCKPIFDQIFQEASVMVGTIAMTTITNMVLMNSAAFFSEFERHKTLSATEAMAA
FT                   TYTFGALIVNQMIVPIIIYSFIEFLEGFPVLFQGTFGDFEAEWYNKVMVMIMGTAVTNI
FT                   IAFPLGAAAPNIVAWVKRKLTGCMAHSQKVLNEMYQPADFSLAKRYGQALCALYYTIVL
FT                   SACAPPLLVAAFFLFIIIFYVDKMILLKFSKRPPMYDHKLNEMFLNMAPFAAWFHLAIA
FT                   TWAFGYYEIPSYTIGLPSIAGTGIDANAVSSQSANADDSNVDYTGAPAQFDFMARLKRL
FT                   NALVPFLFFVVLTVSLFLAKLVDKLLKPICGAIFGNKGPEKIDEVPPFDQLIMPGQVGY
FT                   EDPVPEGELNNKLSGLRSYRIEDNPKYAKLFPEVIGGESGRRETPAKAPKTQNMA"
FT   CDS_pept        join(complement(777371..777799),complement(775268..777232))
FT                   /codon_start=1
FT                   /gene_family="HOG000037059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640543"
FT                   /orf_name="MICPUN_97767"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, proton-transporting domain"
FT                   /protein_id="ACO69497.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033177"
FT                   /db_xref="HOGENOM:HBG629705"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniParc:UPI000199CB82"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG71"
FT                   /transl_table=1
FT                   /translation="MELFRSESMQLVQFIVPAEAAHDTVLALGEIGLVQFKDMNPSKSG
FT                   FQRTYYKQVKRCEEMLRKLRYFGEQMVKAGLIPMAQPAPDQAYTLDELEAKLDDLESEL
FT                   RQITNNTEKLRRGHSELVELQIVLEKAGGFFEPGAGSGSMQQDPESVRLGFICGVLPTQ
FT                   KTPSFERILFRATRGNMYLKHSAIEGKIQDPATGEMVEKTVYVVFFAGERARAKILKIC
FT                   EGFGANRYPFPEDFSRQRQMNAEVTARLGELQETLDASIRHRNAALSSIGHHHELWTTL
FT                   VRREKAIYHTLNMFSIDVTRKCLVAEGWIPVAAKPRIQDALFRANRASSAQMGTVFQPI
FT                   NTDQAPPTYFPTNKVTAVFQGIVEAYGVGRYREVNPTVFTIVTFPFLFAVMFGDFGHGV
FT                   LMLLAALYLVYNEKKLGKIRQQEIMQMMFDGRYCILLMAIFSIYTGLLYNECFSVPMNW
FT                   FGTTKWTGCDPKNTSAGDQECTYGGVYAFGVDPIWHGTKTELPFLNSLKMKMSIIMGVT
FT                   QMMLGIFMSLLNFLYTRDFLSIVCEFIPQVIFLGSLFGYLVILMIMKWTTPGATADLYH
FT                   VMIYMFLAPGNADCAGEGANGEPGCPENVMFWGQGGFQVFLVLIALASVPVMLFPKPLI
FT                   LKRRWEARQRGEFYTALDDHLNVDGSLDDHVHGDHGFDFSETLVHQMIHTIEFVLGAVS
FT                   NTASYLRLWALSLAHAQLSAVFWDRVFMAAVATQNPVAMVVGFAVWASATIGVLMLMES
FT                   LSAFLHALRLHWVEYQNKFYRGDGYKFAPFSLAEILKPEASEYE"
FT   CDS_pept        complement(778118..779377)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640544"
FT                   /orf_name="MICPUN_101925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69498.1"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniParc:UPI000199CB83"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG72"
FT                   /transl_table=1
FT                   /translation="MATERDVQNVRMERRNCEPMLRNHVWPALGKRRTPGDILYWPRDD
FT                   QVVPFTHWAVYIGRRKLAPHGQSWMVDRCEVTGAELPEAVVHLWGAADSSTRDISRDAV
FT                   VVYNRVDEVGGTPYDGNLGYDARHTPMKPAHILERCLRALSHKVYEARFGGYHVLGNNC
FT                   EHFATWARYGWNQSGQVSDATCYGAVGLGALIGGPIGGMFGYALHGIASKEIGSLRRTQ
FT                   SNNFKDHPEDPDEEVDWVVDSLLRNTEDHFRLLDEEARAYAKRREHLPRGATLTPDEEE
FT                   AEERKRTLLHFDSRSARLNVAGWDIFGGERAAPNEGDGPRRDDVDAAEPAPRETNPERP
FT                   RQRDPVEELKGIATGVGSLAASLFGGMLKVGGALASEIASQHNAHQEKLRLLREREEAE
FT                   RRERGDIAPPAGVVIEEIAD"
FT   CDS_pept        join(779883..779885,780040..781071)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640545"
FT                   /orf_name="MICPUN_105954"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69206.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199CB84"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG73"
FT                   /transl_table=1
FT                   /translation="MVFPGDSGKHDWPIMSYGEQFLWLQEGSGTADGASKRDRSAGGSN
FT                   VERGEKRAAEPSQAQGAPRKKATPGPRVKNRICQVVGCDIEYSSTHECRARACQTHCSA
FT                   LSVRLEGQDPEQQFRFCYQCHKFHELDAFRNPDGTLRPRHNCYQSQALRLDRRKKKDAA
FT                   AKASKKNLDIVAVLEAQSGQIIDAVNLARASNAAASNLILANVMEVAKATQQTIANVQQ
FT                   RPGSHPSQQLPHTTKPAAAATAFAPAVSSFNPGFSASSSGAERRVPGDHPSGPSLGNPA
FT                   SPLDITAIDDKRHQRTMHVMGDAAGATRFEELAHVPPEETLQGRDGGEFSPDLLHSLLS
FT                   YPKP"
FT   CDS_pept        join(782250..782555,782604..784520)
FT                   /codon_start=1
FT                   /gene_family="HOG000064244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640546"
FT                   /orf_name="MICPUN_84462"
FT                   /product="Glycoside hydrolase family 31 protein "
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO69207.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG590097"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199CBF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG74"
FT                   /transl_table=1
FT                   /translation="MAGHYRVDIRRRLQTTVQTLDSVELKDDDDSPSVVIRGVLIKEDA
FT                   RLDRWLGHLGDVSAAWNDLTHQRQQFKAASKIKARYTLTFSPQSDRRLAFEFRWEDEIN
FT                   QIFMRYAHTPDERIYGLGEQFSSLEHNGKRLPIIAAEQGIGRGKQPTTFMFNRMFFGSG
FT                   GSWHTTYSAIPHYVTSKARSLFLTNFSYAEFDFTDDEKISILSTTPTNRLTGQIIGARS
FT                   VPETVEAYTEYSGRMGPLPEWVYAGGVILGMTGGSKRVRDVVAKLKDADVPLAGLWLQD
FT                   WGGARNTSIGIERVWWNWELDESQYPDWHKLREEAAAGGARLLTYVNPFLMDASGSKGR
FT                   LYREAKERGYMVRAVHGGVYRLGSEPGVSFGLLDLTNPDARDWIEDIIVRMVNETGASG
FT                   WMADFGEYLPFDCKLHSGEMPVAVHNRYPEDWAELNRRALRRAGLETGSGDSIGGDGVF
FT                   WSRSASTLTPKHARLMWLGDQLVSWDAHDGMKSALLGMLQGGLSGLGISHSDVGGYTAT
FT                   PGRHRTRELLMRWMEFSALSDAVFRTHQGNRPLHNAQPWDTPELLDHLGAFARLHRCLA
FT                   PYRRELMRECSLTGMPITRPLLMHYAHDPVASNVATQFLIGRDILAAPVMDRATPRVHV
FT                   YLPPGDVWLDVWTTQLSPIQPTGANRDDEDADDFDSHNHHAGYGAWVTADAPLGWPAVF
FT                   IRRGAGKPAQAAAAAMREWAMERGGLPGHRRVYPMDPVEKLVLGLY"
FT   CDS_pept        join(784696..784794,784917..787250)
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640547"
FT                   /orf_name="MICPUN_60763"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO69208.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199CBF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG75"
FT                   /transl_table=1
FT                   /translation="MTDQEDAAPSGNVEIYLRVRPDPRPSPLVTLNQNDNTVMWEVPKL
FT                   ETGGYVNNQREKYQFGFNGVIGPEAKQDEVFERVASRSVLGALEGFNGTVFAYGQTGSG
FT                   KTFTISGGHDRYVDRGIIPRAISRLYSEISKRHDATYSVQITYVEIYNDQGYDLLDPDH
FT                   ETTALEDLPKVQLLEDDEGNVTMRNVSTHRADNEEEALNLLFLGDTNKAITETPMNQAS
FT                   SRSHCIFTMQVERRQQGSDTVRRAKVNLVDLAGSERVHKMGLDGQTLMEAKHINLSLHA
FT                   LEQVVVALQEKAQGTGRSHIPYRNSTMTMMLKDSLGGNCRTVMIATASPRGDHLLEGIS
FT                   TCRFAQRIAMVTNEAVVNEEVDPALIIKRLRIENRELRDELRILRGDNDDGREELTESE
FT                   MERLRAQVADYCKPPAANEEPTLELGASMLKIKAALRIFREIVLQGGGVVVGKGAAAGE
FT                   AGEDGAWHPEELRSEIKRLSLVVKQRDDEIDVLVSMLRKGESGEKGAIKATEMLRESRS
FT                   RGLDDGDGDRDDGPAGGRDRAKAPVSSRGLRAPAAENDAFARVFANEPRASREPDVPFP
FT                   ASPGGIAALVADRTRAFDHFRALNDRHAAVEENKVVLKNKFDDAKALGECVTRSKGEIN
FT                   RLKGLIEEMRQTRAATRGGARDKRDADDDEKRLVVAIDAERAAHRRAFDELRDAKREID
FT                   SLQKMTTQAGARLANDFERWFELLAERHRELGGDDSPPASPIGKAIEPESAADLSPAPT
FT                   MSPLRDATNSPKGRNVSAPSQTGAPTTGNARADADIKAFYEARERLLRMRRESELLA"
FT   CDS_pept        join(787422..787498,787601..787722,787882..788090)
FT                   /codon_start=1
FT                   /gene_family="HOG000265640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640548"
FT                   /orf_name="MICPUN_101929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69209.1"
FT                   /db_xref="HOGENOM:HBG562356"
FT                   /db_xref="UniParc:UPI000199CBF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG76"
FT                   /transl_table=1
FT                   /translation="MTLTYSDAMVPYFGLYAFTMCWDPDMFWGPNGLGQLPYFSKELGD
FT                   STTAGGFFARMVGLGFLTMFLGKTRFGVSDDAWMKTTVTFHVGSLWWFYKLTTAAGWTT
FT                   WVWQLQCLLNVVFAAWGVQSMGGLDKLLKQD"
FT   CDS_pept        complement(788271..789386)
FT                   /codon_start=1
FT                   /gene_family="HOG000265053" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640549"
FT                   /orf_name="MICPUN_60765"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO69499.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG562357"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199CBF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG77"
FT                   /transl_table=1
FT                   /translation="MADEIPEDGPLTLDQAYAVLEVSDEHKGNLDKVKMAYRKLCLRWH
FT                   PDKNPPEKEKEAKQRFTRITAAYHTITTNNFDYQRWARSYEIPPMQTLEDVLKMALSGR
FT                   DPFEIEAMLRARGDYRPAQNFGVDVNVPWTAGKAHDPTFDVEGPSGYRKTMSIEDTRRH
FT                   MELMWDEGKVAGTSEDRPWERVGGVGFDSESAKRGPLVLGDGDDVGEILAGQAPGWRRD
FT                   MRPGDAGAAAIAETINDIGVGLFNAKEYVKAFGAYTECVRLAPDKVAYLGNRAAAGLKC
FT                   KGKERDVVADCERAVELQPDYVRGYVRMGQALLAIGDRGEHGDVPTLRRAKSMLKKALE
FT                   LDPSSAGAKKTLKEVGMSLMLHADSDDEDSD"
FT   CDS_pept        complement(789727..791433)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640550"
FT                   /orf_name="MICPUN_60766"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69500.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199CBF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG78"
FT                   /transl_table=1
FT                   /translation="MDRIVAPKARISPAFRGVASRPAARRPLAVACRPTSAASKSGPNR
FT                   RAAVLSLRGSGRLANVAFAASRGDDDYFDEEDVDDSAGFALEPEDERVEEMMVDPSMST
FT                   PVMAPVEREEEDQRKVLGGPVCDAFSALVLEMRAGGHGSVDEASVAQVSSWSNPEPWSS
FT                   FDGMDGYQVKSCLGDVRRTLKTYAKLSAVPGALSDRLMGAVGAAWLTTAGNDKDAAFVW
FT                   GGAEKHAQLLNDVCVHKVLFRDEPAEAGNRLAADTLMVLQDLATSRVQLSEDVETVALA
FT                   ACAAFSAQLNHLNALDEACQKLHAASPPPTADAVAAAKQGIYRLGGRKGYDRLAEATGN
FT                   RDQRRNDRRESRFDRGDRFGDRQGPPAREGDWDCEDCGFTNFAYRSSCKRCGAGGGGGG
FT                   EGGGGPIRNADRGYDRGYDRGGYGDRGSARSFEPRPGDWSCPQCSFSNFASRSYCKQCG
FT                   ESAPGGRGGGGGGWDQGGGRDGGFYGARESRGSSGVRSWNSERGERGGGGDRDRRGGRG
FT                   RGGGGRGRDSYGGFGGRERSTPGRGGRYDYDSPQSDAGGWDDRVGSDFGGY"
FT   CDS_pept        complement(791685..792773)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640551"
FT                   /orf_name="MICPUN_60767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69501.1"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="UniParc:UPI000199CBF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG79"
FT                   /transl_table=1
FT                   /translation="MPKGASAARPSRLTSSPPAIAGCQYNVQRPILTLPIRSRPIRSTA
FT                   KAPLPAVIDGAPTGGGGGGARKRKGKAAADGLAEKMASAAAMGGDDVDMDEGAGGKTLG
FT                   ERLRAIEQTAADLPVDARAPAEKQKLTATDRAVLDALGGKGAPPKADSLATLLSQALVA
FT                   EDRALVERCLNVSDAQTVANTVARLQPHVAVRLLAAALDRMRTKPSRGEQLARWMRTVM
FT                   LHHSGFITTSAKAQQAVMELQQTVEAHVAMQRPLLSLLGRLDLLLHKQQQVPDGEDGDG
FT                   DGGEGPLTVYTEGEDDVNVLNEVVGNEESDDEWETDDEANDDEDDLDGFDDDDDDDDDD
FT                   DDDDDDGEDMEDDFDGEDEEDE"
FT   CDS_pept        <794042..>794749
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640552"
FT                   /orf_name="MICPUN_76288"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO69210.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199CBFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG80"
FT                   /transl_table=1
FT                   /translation="WETLAGMEREIKVLKEVALLPLVYPEAFDALGVNPGRGVLLHGPP
FT                   GTGKTAAVRALLGAAARGPRPVSFFNRKGADCLGKYMGEAERSLRLLFQEAERRQPSII
FT                   FFDEIDGLAPARKSGGGSGDAHDQIHGSVVATLLALMDGLSPRGSVVVVAATNRPDAVD
FT                   PALRRPGRFDRELHFSLPGPAARREILRLHTREWRPQPPDRTIAAVAARTEGAAGADLR
FT                   ALCSAALLSALRRR"
FT   CDS_pept        complement(798392..799291)
FT                   /codon_start=1
FT                   /gene_family="HOG000248360" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640553"
FT                   /orf_name="MICPUN_60769"
FT                   /product="Pirin protein"
FT                   /protein_id="ACO69502.1"
FT                   /db_xref="HOGENOM:HBG518911"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199CBFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG81"
FT                   /transl_table=1
FT                   /translation="MRLIKKFKAHSQKEGAGFVVRRPIGGPHLLDSVADPFLLLDELGP
FT                   VEYAKGEFPGAPWHPHRGFDTVMYLKEGEGAHRDSMGNSGVLRAGDCQWMTAASGIVHD
FT                   EGRDHPGGTLHGFQCWVNLPAKHKMDPPKYQDVPSNVIPTFEPSPGVSAKVIAGTCAGV
FT                   DAVVQTLVPIQYIDFVLEPRSTFEHGGESLAAELETVIVYVYSGSGAVGGTEASSGDTI
FT                   VLGRNEGGGDGVILESGAEGMSALFLAGKPLREPISRHGPFVMNTREEIMQAFMDYQNG
FT                   TLVRHKGTMVDFEGKDEL"
FT   CDS_pept        <799584..>799850
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640554"
FT                   /orf_name="MICPUN_74000"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69211.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199CBFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG82"
FT                   /transl_table=1
FT                   /translation="LYEVLALEPSATDGEVKTAYRILQKAVHPDLAGEYASAAAALVNE
FT                   AASVLTSPADRARFDRDRSEWLASGRGSSDQSLMDPSPLSAWSG"
FT   CDS_pept        <799884..>800073
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640555"
FT                   /orf_name="MICPUN_74808"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="iron ion binding"
FT                   /protein_id="ACO69212.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000199CBFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG83"
FT                   /transl_table=1
FT                   /translation="RHDAAFVDESACIGCLKCALIAPTTFWIETRFGCARVVDQWADGR
FT                   EAVEDAVAACPVQCIHFV"
FT   CDS_pept        complement(801136..801441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640556"
FT                   /orf_name="MICPUN_60771"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO69503.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199CBFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG84"
FT                   /transl_table=1
FT                   /translation="MAAEVTKVAVSPRARRGGFGRFMLWTAVNAAKANGASEVRLRVES
FT                   TNEAAVKMYEQQGFVVDTGRGVDGVSFDFYGPTRHALNMVVNVEGDNWVLPRVLGP"
FT   CDS_pept        complement(801726..802382)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640557"
FT                   /orf_name="MICPUN_60772"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69504.1"
FT                   /db_xref="UniParc:UPI000199CBFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG85"
FT                   /transl_table=1
FT                   /translation="MKGTNPITQGHRWQKRVKQRLKKQQLEEGQWEQLEDKKWEEVRAQ
FT                   KQREETAAAAEADLDPGARAIFAAADAGTDLRDEEGLDAEELAAVRAVKAAKAAAQARL
FT                   QRVQREGEQSEESDALPKKRKKPHQLPAPASANPFAALVRSRPDPREADIAPAPTATPP
FT                   PPPAEPAHNPEPRKYRAGLAAEIAKKRAIGVAGVTGGSQKKLKKLLKKKRAAGLA"
FT   CDS_pept        802473..805538
FT                   /codon_start=1
FT                   /gene_family="HOG000265239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640558"
FT                   /orf_name="MICPUN_101933"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO69213.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG562363"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI000199CC00"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG86"
FT                   /transl_table=1
FT                   /translation="MEPRGGSTQPTRRRKRGDPLTPAQAVEAIRARVAANGSERLSLKG
FT                   RTLDGPAAVRAACDAILALHPPTVTLNLTGAEVCSGGADALADFLMNERCAVEELCLVD
FT                   NPRLGVHMADTGVAARDIPDRGEDEPVTDGGGTAALARALAKNTTRLRRLNLGGCGLDD
FT                   GAAEALAAALAARDASPSLESINLRSNDVSDRGVAALAAALSTRGGCPLKEIALANNPS
FT                   VSSASLAALEGRLRVNRRADLVREAFAACVENGGRCSLRRRGLDDDDAFALASSLADAD
FT                   AARSLARVCVGMDLADNDIGPEGVRAIADAVRLGTSRSVVAVSVAGNPGGEIHPSKTPS
FT                   THARILHGCCAANLLRNAGEGEALKSVGDRALGDDGAEEVARYLSQEHGYSHRHRAIGL
FT                   QHNDIGPRGARALAEALARLPNLDEVAMYSNRIGVEGAKWLAGTVRSCRTLRVLDLGGN
FT                   DVGDAGCIALAEAIVGHPSMEELHLDHNGIGIDGATGLLGAMQMTEDSRKGRGLRRVWL
FT                   HGNVGVSEELNARVHAIAGRNAGAAGERPEQIPRDDLAALEAWEDDVAIEAEGEAAAAG
FT                   GGSLPGGFKETSTLFANRVATAAAAAYRRWFPDHAANTRGTAVIAAIVAHERDASSPFD
FT                   APGHGDRLRVLSLGSGTKFMPREVAAAAAAGGARRWESVVHDSHAEVLARRAFLRMCYR
FT                   EILDIARETSTYKVAGAAAPWRLLEPAGHAGGFQMRPGITLHLYVSTAPCGSCSMPAMA
FT                   GGASNPDASFAMRDVDDVTWNELWSGVAARHEAGVFAPSKPATTVKGAAGRGEQAPAPG
FT                   VVFARLRDAEKVPGVTLSCSDKISRWQALGIQGAMLSHLVPRPLAFSTVVVGRKFNPDR
FT                   LRLGTCCALRGFASSAAALRVHPPAHCAALGTTVKLEGSAGAGERIERRERADAGDSDE
FT                   SLSWARGDARASRHDGRTGGPVGGGGPVPACSRAALHGMFRRAVAALAGRGDLAAVPRD
FT                   LESKPAPEVKRLAEAYSAGQFALFRGLVERRR"
FT   CDS_pept        complement(805710..809276)
FT                   /codon_start=1
FT                   /gene_family="HOG000100777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640559"
FT                   /orf_name="MICPUN_60774"
FT                   /product="Predicted protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO69505.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG562364"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI000199CC78"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG87"
FT                   /transl_table=1
FT                   /translation="MTKSETNKAPEVSKRGGHRPHRNSTTSSKKAGSEMVVEEVARMTL
FT                   ADGRPVVDVSVGGKSGLKGGIPTPNAIPAPNAIPAPLPLPKSAAATSGEAVGDKPKKPR
FT                   GGKGKGGAKDNRPADSPAEGANGEAKAAKPKARRGKGGGKEKPDAGNVVEVEVHHKVEA
FT                   NGSEGKKAIPAPKGGAAFVPPKSDGDAPINEDSKSKAARKGVIPLPKGHPALDSAVKPE
FT                   GAEKKVKAKKEKKPKAERVDKENGDANGEAAADADTADPTATPKPKKKKEPKEKKDDGS
FT                   GVNRTLAQTAGKEIRRHLETGNVDAAMSVFDAKHKVGGIDLQTATTLIMGLVRACHLAE
FT                   SIQVADYLKERNMKMPLRQFTAIITGMSQRANPMDALEFLNALEHIINYESKAVHNYHF
FT                   HFAKLVVQEFLEEALQTLDRVANAPAFGLQESGLAAMDVVINSSHKGGQLSLNIPALGY
FT                   ELQRGLMKGDTVLLSRTGEAARQMGGEMPKGPRGNGGDIDLENLVMPTGPRRDNTTGPV
FT                   GRGGARGGGWRADYEFEAEVSAMFPNLSVKLVGCTQAQAQTVRGGGWRVDKLANRTSFL
FT                   RQLNALQDMVEVKAGTSQKAGVDPAIRDILVAGWDHNRADINAIPDMCSAERHENLTLM
FT                   QRQRMIDNAMDLQAMAHMNKSQTDALEAALFQRVTLIQGPPGTGKTHTAVALVQMWLRN
FT                   RTSPILCTSDSNIAVDNLVDGLSRAGVRVARIGRPEAVRQDLMQFMVESIAGIEPGSNM
FT                   SKDQQYQAINGVLRRAEVVCATCAGAGSDILERFSFQACLIDEATQATEPATVVPLTKG
FT                   CSQVVLIGDQKQLPPTIISREADAAGLGTSLFERMLARGIRAFMLKVQYRMHPAIAAYP
FT                   SKAFYSGALLSGTPPSARRAPMGFDWPVPAVPLAFVDVPDGYERSDGSSQTNPVEAQKV
FT                   VNIVKKLAAGHDVIFGEIGIVTPYSAQVRAIKRLLNGNKPEVRSRFDAPADPNTLQALE
FT                   VCSVDGFQGREKEVIVFCCTRANPNGNVGFLADPRRVNVMLTRARRGLIIIGNLGTLRR
FT                   DPEVWGPWLQWAGDNGLICGLAAADADSASRLATIGMSSLEEIGGRGAGEVMTMGAMLS
FT                   PTMWAGGGGSASGGNLADLGPTMKEQRDTDVPDAWDDSDDDDDDATGVTTETESVTVKG
FT                   STNSLVGLADSAWDDESDSEDS"
FT   CDS_pept        810511..812769
FT                   /codon_start=1
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640560"
FT                   /gene_name="SBEX"
FT                   /orf_name="MICPUN_84396"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO69214.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199CC79"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG88"
FT                   /transl_table=1
FT                   /translation="MIPENETDEEYVTRVRLRPIHGRLALCRNEPSLMPYEHLLYGRYQ
FT                   RFEGRLEEIEKNHGTLQAFAESYKEYGLHPKPDGAPGDVRYVEYAPGAKRLSLMGDFNG
FT                   WKAWEFEGERDEFGKWTLDVPAAAGLKHGSQVRVVMESHDGRQFDRVPAWIQRIVQCCD
FT                   EESGETRCYHNGVYHDPPEGERHEWRHEKPRVRPASLRIYEAHVGMSSEETRCGTYREF
FT                   ADDVLPRVKELGYNCVQLMAVADHAYYASFGYQVTNFFAAAHRSGGPEDLKYLVDKCHG
FT                   MGMQCFMDVVHAHASDNAIDGLNEFDGTGGHLFHEDPWMGWHGLWGTRMFDFGKYETLR
FT                   FLLSNIRYWSEEFKFDGFRFDGVTAMLYKHRGIHWDFIGGHAEFYGDHADNDACVYLML
FT                   ANQMLRDDPKFGPAAVTIAEDVSGQTGVCRPVWHGGLGFDLRLSMGPPDHWARLAHEPD
FT                   FNWSPSRVVGLVTGRNPEPAVSYLESHDQCLVGDKTFAFTLMDAAMYGCMSKSRPEGVH
FT                   PAVERGVALHKMARLLQLTLGGEAWLNFMGNEFGHPEWVDFPREGNGESFQHARRQWSL
FT                   RDNDDLFYADLERFDGALMRSDEDCKLLASNRGGFTPTVHHCRDDSGVLAFHVGTNCLV
FT                   VANLHPHESYPFYRIGSERAGRYELVLDTDAKQFGGWGRIDPEVTKPETEGGPCDWQGT
FT                   GVCLYLPSRSAQIYRLVDEWDVPEVDQYVYHNDNDLGYAGGYDDEYDTGGGGDDAVWY"
FT   CDS_pept        813544..814635
FT                   /codon_start=1
FT                   /gene_family="HOG000265238" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640561"
FT                   /orf_name="MICPUN_83941"
FT                   /product="Type II secretory pathway family "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69215.1"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG562366"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI000199CC7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG89"
FT                   /transl_table=1
FT                   /translation="MAILGSGIPFFHVGIGPIIAASIAMQVIVALVPSMKELTKDAVGQ
FT                   HTVQQYTRYLMFVVAIIQSFLTASELRQFYVEGLSPLGYYWTIVPVFVLGSCVLAWISD
FT                   EMTDFGLGNGSSVLITMSVCGAYWNAAKYYAPALLTASLEQILPFVGAGLALIAGSVLV
FT                   QTGTCKVPLLYFQGPSIPGLPRVVRKDVDHIPFKVNPLGVQPVLVAVFMCDGFMWLNKI
FT                   LDPPGFIRAATEFLFSNASPMYYVTFFLIVFGFSYLDLQDTPKDVSEYMVKIGARIPDV
FT                   RPGEATVRYLSELQSGSRFFGGLLLGIVAVACTMMDQWMKATVGISVGFTSMLIVVSTI
FT                   LQIQRQVTALAQMPKLDRVISSL"
FT   CDS_pept        complement(814744..815556)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640562"
FT                   /orf_name="MICPUN_108794"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69506.1"
FT                   /db_xref="UniParc:UPI000199CC7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG90"
FT                   /transl_table=1
FT                   /translation="MTSLWTAGTPLRVPNTPARVSQMHRSDVTASLGSRRVSAQDRRSL
FT                   GLRSRRPLLERTRRDGSCKTGRFGPARASLGAALGEHAARVNLENILAPNLASTVTQTH
FT                   ATSVDEPLARISTDFSNAIAEVSLGHELEYLAAHPAHLAALAIGCGAVYYIVTRGRQKI
FT                   RRLKAEFLSHGIDLTNVDDRLDTLTYLKKMQDQGMLPLGLEVCAMKQAEMEVLFMGNDG
FT                   IAKWKKYYAERGIDIESAGDLDRVRKYVENLHHLEGCLLGIDMEALSN"
FT   CDS_pept        join(816050..816106,816264..817586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640563"
FT                   /orf_name="MICPUN_105956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69216.1"
FT                   /db_xref="UniParc:UPI000199CC7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG91"
FT                   /transl_table=1
FT                   /translation="MFSKRDKDDQMKATVTLLQNQLRAQAQEIGRLQSTVDTLVSEKAE
FT                   LQQKLDAPPANQIVNSILRSFTGSEALRLESVEEKVHCNSYKSHTDVRYRFFGAPGRFR
FT                   GSFPDIHNAKVEIATPESFGDAVKAQFEFKPLQPITTSKSRFSLDVGDLLGIKGAPTLV
FT                   VSPNPPFLINNRTEWNPQVEMQGETEDGIEWELRYTVSNDGAVLRSLEGELNYSHDVYG
FT                   DFTLSRWLHEDDMELWDKYGDWYGDSPGGLDSRYSGDPRGGSGDDDTDSDRSGSRTPRR
FT                   VSPRRALWGRGSKSPRGISPAESARSGRSARSSRSRRSFLGDVKPPTPRWLASWRREVI
FT                   DRDGVTGSAFEAKVGDAAAVANENAHKSGGNMSTAGGIINADNNWVTSDSWELELGARR
FT                   RLQHNLDGKIAARFVARELEAGMSYHFTEEFKGWHVNAKAVLSPQGISTPEFTLHHMWD
FT                   F"
FT   CDS_pept        818075..818953
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640564"
FT                   /orf_name="MICPUN_53116"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO69217.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199CC7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG92"
FT                   /transl_table=1
FT                   /translation="MAKFPTQPGCSKCRYAKRGCRRCVENFVPASAVRAAKVAEKAVAP
FT                   AAKPSLTSPLAERDPNVVEKRPRGRPPKSAQKPANGVTPKTPKTVQKTTEAKVALASPP
FT                   SPASAMGLATAQKNASTHKRKPTASEPATATKRAAVDVGVRWADRLEAYDDEAKATATA
FT                   VTTTMNDTANARLGAAAMVPGLDDEITIAAMGGVGRYGDRSDEDLCDFPPELREALKKV
FT                   SAGLVLGLHPVTLDRNAADDDDDDDDEEGVETGLTAEEERRRTQVAQLAAGTLNLANRL
FT                   RTLQQGPALVH"
FT   CDS_pept        complement(819067..822639)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640565"
FT                   /orf_name="MICPUN_60780"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69507.1"
FT                   /db_xref="UniParc:UPI000199CC7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG93"
FT                   /transl_table=1
FT                   /translation="MSANDNKIVPSDQSRSPASEDHDTRVATRAYAVRHGDTTLEHLSS
FT                   ERGLDYDEVLRLNPAVSARNGLLKAGDVLKLPKQGASGPKRADGVDGAAQSPGPSTAPS
FT                   SADDANAPAVVDARIVGEADPAGDAPRGDSRDDGADDTGDPVPPGSRRTSREDDASSSA
FT                   SASEGTTETTAESSSPSSPPPPSSPTDDASSRPESLDDVREDMRVRGVSAVRGFGGVVG
FT                   ALVKTAGASVDGIREAAAASSAALRESSEDLQRTSAWVNAEVTGIATKAGEEIENLRRS
FT                   RNAARKEGDDAAAEGGDPASESEESPGTAEAPAAGSTPPPPTPPGSPARLARTTDEERA
FT                   ERRRKAEEDAAARREKSKSMAEAVRGKLKSAQDAAGSLVHKMRQDEGTARMGREDEKRK
FT                   ENEGNRGLEEAAKARLAEAAAKRRAEAMARQAAREAERAARRKERDRLRDAQDKQRRAA
FT                   AAAAKPAAAKPAAVKPAAAKPTAAKPAAAKPTKQSEDKVQVDLKAKVEADRAKAERERE
FT                   ARRRDFEARRKAREERRKEEKGDASKVKPAESKPAFELPFQVKKSAAEPKPVQGEPAAR
FT                   IRALADRVRERPEETARVVASAAAGAAAGAIAGGLTRVGFVAAVAAMTRRAFENGLLAT
FT                   AGGIFWDGAGITAATRAKGELARVRAGGPDAMEPTFAESCRDARDARRLDLPARVGPAL
FT                   NFGRFLPGGGVVACLKLVLFGIAEERRAGDAGGASSADPAAPPGGADDDVAAIAALAAA
FT                   EAAVAAAEAAAASTPETTPAKDSTHAVVPKLSPVPPGSPTTPATTPPRIANAAEPSSTP
FT                   ATPPPRSAYPAKTPGKTRGGADDDDETDPLTPRTLGAVGMSGAASPPPASPAPAAPVLS
FT                   PRRPPPGEDATRDEYRVAELKLEGRRDALMQRYVAAEAAEGRTVDPTVIVPPSPAAPSR
FT                   RWLTKTSPSASPSRGVPKLDLTRLNGNAEDESLTERRMGGDGDDKAASDEADPGVAKKF
FT                   DDERAGDAELRWRVERLDRECAILEGRLAFREDEKTRELRAMREKETANAARRVKKSIW
FT                   HFATSLKRRALLAWVLELDEATRRKRLLRKALARMRMRTLSDSFEGWLEFRRKAKEQRL
FT                   ERKVAELERRAAAAEAAEVAAQRDREAARREAEEKAASLAEAEAREAEARREVAAIRGE
FT                   DAEPWSPASAATATPLGATTPASP"
FT   CDS_pept        join(823119..823155,823482..825370)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640566"
FT                   /orf_name="MICPUN_60781"
FT                   /product="Glutamate-gated ion channel neurotransmitter
FT                   receptor family"
FT                   /function="extracellular-glutamate-gated ion channel
FT                   activity"
FT                   /function="ionotropic glutamate receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69218.1"
FT                   /db_xref="GO:0004970"
FT                   /db_xref="GO:0005234"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR015683"
FT                   /db_xref="UniParc:UPI000199CC7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG94"
FT                   /transl_table=1
FT                   /translation="MRVSGTLSLRHRGFLSLVIALLCSLALLAAAETIVSPDEIVSLDD
FT                   LTFDLRVDDAAASPATSHRRLLAAADSLVNGSTSACACLQPPTTPPAGGTVFGYGCHAH
FT                   DNYTSCGSSKHCKDKWCYVASGSCTIENHLSDKSVPAEVSSDPLVSTATPAAGTTPLHY
FT                   SYATCGYVDRYTLTKSMKSLSGVTVKTMYLANTGGWKGTKCDETIKSGGIGTKDKCRGG
FT                   AYRFIELLQAAEGFVVEEVNKFEPVVAAQKPRGKATLGFNPKDFQLCVSAVGMGFLDLC
FT                   NAAIVLTPERTQIAPFITLFEEPVYLVSKYDVETESFAKKLRSAFAPFEWQLWFLILFL
FT                   VVVISGLIGSMEHRPGGEFEGRGMVTTTVEATHDGISSLLGGGSKFEPITLGGKFASIG
FT                   LGFLILLTISAYTANLASYLIVQRSRTTEVQSIVDAVRLRKTMCAHRVDKNGLLLNYPD
FT                   LPKELLIESPTRTQALKDAVDGTCDLAIAREEELQFQRGLGEACTMQFVGAPLFTLAVG
FT                   VPVSPRYFMRFQNAIARATTNGLVRQAMKETLPVNACPVRSAVNTNSGMTIDQMAGPLL
FT                   LSAVFSIFGILCHLASTRLTTGKKDAKGSTEDHDHVTSVRSMLIHIERQQAEILDHLGV
FT                   GASNAA"
FT   CDS_pept        join(825720..825729,825863..825959,826078..826159,
FT                   826492..826737)
FT                   /codon_start=1
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640567"
FT                   /orf_name="MICPUN_91476"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69219.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniParc:UPI000199CC80"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG95"
FT                   /transl_table=1
FT                   /translation="MAKEDAKAKAAKAAKMVKKGVKGKLLKKRFSPVFHRPKTLKKSRE
FT                   PKYPRVSVAPMQKLDQFQILKFPLTTESAMKKIEDNNTLVFIVDARSTKKQIKDAVKRM
FT                   YDIQTEKINTLIRPDGAKKAYVRLTADYDALDVANKIGII"
FT   CDS_pept        827130..828845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640568"
FT                   /orf_name="MICPUN_60783"
FT                   /product="AP2-like protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69220.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199CC81"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG96"
FT                   /transl_table=1
FT                   /translation="MPRLSAVEGDDASPLYRRAPPLASKLEHVEAPVDPTSSPFKHAAL
FT                   ADFDEALASFASSEMFRMCDVGDPWTTNGLELSASSGQTREDAAFAHAMGGGGGGGGGG
FT                   GGGGGGGGGGGAGGGGGAGDDPLVALASRHRYGHANVLVPDGNPWWSDPLERNVAAPNA
FT                   GPTHPGLFALTPAQRHALREPRDDAFDPPAPAPQRKRRDVAKRKRDGISRQGFGDTPKR
FT                   GTRTTSKYRGVTHHCRTGRWEAHIWEDGKQVYLGGFDSEQQAALAYDVAAIKCRGEEAS
FT                   TNFDMNDYAQELAALNSVGKEELVLSLRRQSKGFVKGSSKFRGVTRHQKGRWEARIGQL
FT                   VGRKYRYLGLYDQAEEAAVAYDTEAVRQKGFDAVTNFDLSEYADVLAEHHALRRARRTL
FT                   SHPIPEPDDPNAPASLPAASIKQRLKAASESSFGGMREGPAAEREPRGEAIDAVRAFFR
FT                   DAGVEKALTPMDPIREMATNAGNAAAAVAAARERNARTTWAPMNDKGTLLDDEGDLEEE
FT                   DVGGGGKTTIQALRAMVREARTQLASTQRQLEVAMIGTDDGMGTGDRDVDEGKN"
FT   CDS_pept        complement(829042..829593)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640569"
FT                   /orf_name="MICPUN_108796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69508.1"
FT                   /db_xref="UniParc:UPI000199CC82"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG97"
FT                   /transl_table=1
FT                   /translation="MMSLVSTPVVMARAAAPKKVARKIQAKASAEGASKSAVAGALALT
FT                   LLAEPALAQVQEISVIADADKKAAAAALAASLGADLEAKKNVSMAKNPAKTKNLAIGLP
FT                   SFSAPKISLPSGGGAPAAKKAPKEKASPSEATSPALGAAMLILFSPLAVVAAISLQTLG
FT                   RVIPQAAEGKDFFPKDTMPF"
FT   CDS_pept        832446..833267
FT                   /codon_start=1
FT                   /gene_family="HOG000005927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640570"
FT                   /orf_name="MICPUN_84456"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO69221.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG317761"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniParc:UPI000199C44A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG98"
FT                   /transl_table=1
FT                   /translation="MSLSQPANLVQLVRTSGLCILRQLRLEEKLLRSPGAGNWCLLNDG
FT                   TPDRSVVLGISGKPHQLVDVRRALDDGVRVIKRFSGGGTVIVDRDTQFVTLVMNAAAVP
FT                   DLALFPRQIMDWTGSLYGGRPHGVFADVPGWQLRENDYVIGERKVGGNAQSISKDRWLH
FT                   HTSFLWDFREETMKYLTNPAKQPRYRANRSHSDFLAPLKTYLPDRNALATRIEAALEGM
FT                   GLEVAPASIEQAEDAVAAFHRGSGVGTTGVVDLETALTLGPDDRAPMLTGA"
FT   CDS_pept        complement(833314..834687)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640571"
FT                   /orf_name="MICPUN_60786"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69509.1"
FT                   /db_xref="UniParc:UPI000199C44B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FG99"
FT                   /transl_table=1
FT                   /translation="MSTLSNISSAMFSVPHADSSRRRDANGAGKKANLGNKLMNAINLP
FT                   MAWYDLEETGAETVHKPSYLKIAFVLINIIGALAFAGQCFYHYVATVPETTVSAQDKSG
FT                   TDGWTCRPLVGDKIYGLNMTYDECMTKEYVPPTVDNLIRYGHYGLLVYSGFDGSQPPSS
FT                   YDGPWNFTTGLRYSINTMTLYHKPFPHLSDVVYSYPDTCVVPFYKGYEKHSKFNPQDGY
FT                   MSPTEMPFSEAYKRGYDYFNGYGYIGLANKELKWDSSCTLDTPWNCGQYGTFHPSNETD
FT                   YVAKCDGAISAAEQADLFENGTYSFPHVFAAPSELRWAAPASAQPYTEKGKGDYFVIYK
FT                   QKCVGITPLYPKTTTLKLVTDKSRPRGDDDFFGKQRCNFYEKQIGVESFEYLFSQPNCH
FT                   PCQIFKENAPFFCKREVRKTWVTIFALSISNTLFFMGILITWAPVVLRGLFSKEQQTE"
FT   CDS_pept        join(835139..835201,835266..836036)
FT                   /codon_start=1
FT                   /gene_family="HOG000100030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640572"
FT                   /orf_name="MICPUN_60787"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69222.1"
FT                   /db_xref="HOGENOM:HBG560307"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniParc:UPI000199C44C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA0"
FT                   /transl_table=1
FT                   /translation="MKFGQKFTEIIAATHPSVSDQFLCYKTLKKCLKAIPEYKATTANG
FT                   DTTIKPGEKRKLTDEQRLFLKTLNAELQKFNRFFISAEEDFVMKETKLEAAYRQVVNTD
FT                   GSRAPRFTMQRCRAACRALADFHGELVLMEHWVSLNYTALVKILKKHDKRSNLSLRSPF
FT                   LVSVLQQPFYSTEVLTQLITKTESRFRKLNALIASRGNEAEANGSETNGHVANGADAED
FT                   NEDVVATVSTAEVSLSLSRTKAAMECWNGLKDSDSIKRPLGDVPVLLQAKRARSS"
FT   CDS_pept        complement(836210..>837415)
FT                   /codon_start=1
FT                   /gene_family="HOG000259834" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640573"
FT                   /orf_name="MICPUN_84205"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO69510.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG630545"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000199C44D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA1"
FT                   /transl_table=1
FT                   /translation="PPPPQLLSVAPMMDYTTAHFRHLCRLLSRHTWLYTEMEVDQTLVH
FT                   TDHPRLDRYLDFPTATHPSVLQLGGSDPETMARATAVAAPYGYDEINLNCGCPSPKVAG
FT                   KGAFGAALMLEPELVRDVVAAMRENSGGAPVTVKCRIGVDDHDSYDDLCRFVETVACAM
FT                   VPTRTDGRPLFAIHARKALLAGLSPAENRTVPPLRYEWAYALARDFPEVAFVVNGGIDT
FT                   LEEAAEVARGVGVPTGGGRLVGTMIGRAVHADPWGVLSDADVRVFGAESNPRTSRRDLL
FT                   NEYVKYCDATRGRFGTTKDGYSVPSTRHLMHPLQNLFLGEPNAKVWRRRVDEALKEDAR
FT                   NPDVTVGDILERTLGVLSDETLDAPPGDGSTNARHGVKRSGVTLGNLPPMPTRGALVPA
FT                   SR"
FT   CDS_pept        complement(838142..>839599)
FT                   /codon_start=1
FT                   /gene_family="HOG000261941" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640574"
FT                   /orf_name="MICPUN_84627"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69511.1"
FT                   /db_xref="HOGENOM:HBG611705"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199C44E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA2"
FT                   /transl_table=1
FT                   /translation="RVVIVGLGPAGLFAALALAEAGVPVTVLERGQPVEGRGRDIGALF
FT                   ARRVLNSDSNLCYGEGGAGTWSDGKLTTRIGRNSDDVRTVLRSLVAFGAPPEILVTGKP
FT                   HLGTDRLVRILRNAREYLVGRGADIRFGCTVDRVLFENTDDTGDGRSMRACGVVVRKNS
FT                   RGDTGSERPGAPETLKAKAVILAAGHSARNLMENLLTDGIELKYQPFAAGFRIEHPQAL
FT                   LNELQYGEDLASLAAKGKGPLPVADYRLAHQCRSDVEVSASPGAEYVQRACYSFCMCPG
FT                   GQIVPTSTVPEELCVNGMSFSKRGSDWANSGLVSTITEADAMPFCAAPGREALAGLDFQ
FT                   RHIEREASRMGGGDLTVPVQTAPDFIEGRESDPAALPTSSYRLGVVPARLDLLYPPAVT
FT                   EAVRESLIAFDRKVPGFAGPDALLHAPEARTSSPVRVVRDSEDYQSATAAGFFPVGEGA
FT                   GYAGGIVSAAVDGLCAAGRVGAFVEGG"
FT   CDS_pept        840562..841479
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640575"
FT                   /orf_name="MICPUN_108797"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69223.1"
FT                   /db_xref="InterPro:IPR012439"
FT                   /db_xref="UniParc:UPI000199C44F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA3"
FT                   /transl_table=1
FT                   /translation="MASRRALSHVVSAFRANKDLVHARYHQPRSQLPAHLGSWVQPARP
FT                   ISSNNCLAANAAQAVGKASEEQAEHPAAKPVAKPAPAVTGSTAAEARIRGHAAESEVVA
FT                   KAPLESSRAASQMERGFQSGLPPSPSVVVIDTLELLRGFERAGFSAQQAEAITRATLAV
FT                   TKSSVDPLATKSDLERHILGQLSELREFKQDIGSRHREAAANSKHMADMVLAECEKLRA
FT                   ELRYTHEKVTSSQKLDLNLERGRIRDDLTAQDNKMAAAEARLDREMAAMRTTIEAAKND
FT                   VIKYAVGTIMSFGALSLGLMRLLG"
FT   CDS_pept        join(complement(843159..843684),complement(842794..843053),
FT                   complement(841561..842067))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640576"
FT                   /orf_name="MICPUN_84309"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69512.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG334875"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199C450"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA4"
FT                   /transl_table=1
FT                   /translation="MVVLATARDVTDEYKSKLQMKEAKEKSEAMVIAKSSFLANMSHEI
FT                   RTPLNAIIAGSELLSYIPDLTAEQRELTDMVIRTSHTLLALVSDVLDFSKIEAEKLALN
FT                   VKPFSIESCIDLSLEMQSIKANNKRLVLNYCIASNVPQRLLGDDMRIRQVVTNLISNAV
FT                   KFTPKGSVELKIRPSSGDSVTLLFEVIDTGVGIPPDDQSELFTAFHQVNSSRTRSQQGT
FT                   GLGLAICLKLVRLMQGDMSLVSSGVGCGSRFAFTAKLGRDRLEFQKQSTLFELEPDAKA
FT                   QVRVLIAEDNLMNQKVAVKLLHSVGFRAAVVNNGKEALDLFVEKADAGESFDLILMDLQ
FT                   MPVMDGLQATREIFGHVLARPGLARPHIVALTADVAESVVEECKACQMHGFIAKPIKRE
FT                   KLNTLMEKITMWVMEGRQPQYELDGDGWTYR"
FT   CDS_pept        845391..846845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640577"
FT                   /orf_name="MICPUN_101948"
FT                   /product="Predicted protein"
FT                   /function="cyclopropane-fatty-acyl-phospholipid synthase
FT                   activity"
FT                   /biological_process="lipid biosynthetic process "
FT                   /protein_id="ACO69224.1"
FT                   /db_xref="GO:0008610"
FT                   /db_xref="GO:0008825"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="UniParc:UPI000199C451"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA5"
FT                   /transl_table=1
FT                   /translation="MADAGQQSLDLCEAEQSELARRYVLTSELYIEEPWSHAGPRSVSP
FT                   FAPCAASRLPHVFDAARLTGDSVLWDLGCGDGRILHEAAARYGCRCVGVEIDAPCLDMC
FT                   KEGASRLGADVDNRCSWFLRDMTSMPSGSLGTDDSLGPDVPAPSVLLLFITGHGLKAMS
FT                   PWLKREWEEAPTPFAIVTCVEALDSCIDYNDGVPFDDADANPDGWHVYRDPVHAKYGVF
FT                   VVPPRDIGVHQWASSRPSAVDCGPDAVANHAPAIARGVLREADIRAVEKLAARLDAGRG
FT                   GTDGKDDKDDKDDDDASGEALAMRLSNAMGEGGDDAWSEVEDAYHSLKTHRVTHLHADD
FT                   ALATEAPAVRARLLRAAFDADAGRCESGGGWGLLPGRPVFLRSAEYHDYSSGGGVTEEN
FT                   HRDQGSVLTVSVHLEVSDDGGGGVFATWDGDGTRTEFRDLRRGDAVIFCSEKRHGVSPL
FT                   VAEGAVRKSVVLELWERGSTKHNRHR"
FT   CDS_pept        complement(846879..848012)
FT                   /codon_start=1
FT                   /gene_family="HOG000245143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640578"
FT                   /orf_name="MICPUN_84542"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69513.1"
FT                   /db_xref="HOGENOM:HBG635124"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199C452"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA6"
FT                   /transl_table=1
FT                   /translation="MVTRAASDTSGLGLLTWLGPVIPQGVLVTGVKAGWRAAWQTMMTE
FT                   LAPQSRDGEYQRPKYAFDGAIAEDPKARFPSVSERYVLYLGNACPWCHRVSLTVALRGL
FT                   EDRVRIVKMTDDAERASRGGWVFESDRPDPVFGARDLREVYDLQSGKSYTYEGRCTAPL
FT                   MVDAERKVAVNNESADIARMLNDVEWLGSVNGPNKSSRYDEGSVQLRPPELANDIDSLN
FT                   DWLYTKLNNGVYRCGFSTNQAAHNRAAVDVAEALEALEKRLRESRFMHGDKVTESDVRA
FT                   FPTIVRFDAVYATLFKCSSRRVADMPNLRAWMQDFYLLPGVRETVDVDGYRTSYFGQLF
FT                   PLNPGGIVPVGPTAKDLGLGLDPSRGSRAHSDLFHFK"
FT   CDS_pept        complement(848187..850298)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640579"
FT                   /orf_name="MICPUN_60794"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69514.1"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000199C453"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA7"
FT                   /transl_table=1
FT                   /translation="MVRSALQRTSQRRSVAKQMYLTVCPYKNIRPTLGGYFSAACLLCD
FT                   LSRALTLRRALALPRRRMTDETTPLIPTNERGAGPRTCGAQSEAARKSLRADVIAASAV
FT                   LFFAGALVVAFPVHKHPHVPMDYYAKTAYPYTHLRLGSYDANDVLRTAREARGFARTPE
FT                   RTERWLADRSAWMADPGDATVFQWKDGEFTMNLVKPTASELGMSEEPVTSDAMIKMWET
FT                   HDYAGLGAMGGEGKHDRVFKAFSALVVGAMHHAPERFSAGQPPFRVVTHQRDYLAPPCV
FT                   SNVPKGSRFHPCPVAKAWRAPVFNFGSALKNGDVFPAEVNMPDPEFIDAVLRNRRPAQA
FT                   ETSPLGVSQDGLAQATYSAQPTRPWKDRVGVIAWRGADVPHAPKMPFGADSGVRGEACV
FT                   SLLRSAGSMPEGDVGAYVAGNRSVASPDRVTSNQLAAWAGSERGGDFARRLTPRWRAVL
FT                   GSLSQSPEASVSPAAAALGISPVSVPRKKRWLDARFTVLAPNAPCSSALPDSIVGARMT
FT                   HDDKSAHKYLLDIGGVGGSGWMGTLSDLATGALVFRVESPTADFYDGELKEGTHYVGVK
FT                   PDLSDLREKYEWAQANQEEAFAIASAGAKFAKEANARDLWDRFVSRPMAAARAHYDAPG
FT                   QLGEHGRWEDEGAEELERNLVPIYRYAPQGNIRCDDCEESRAVLGTILMPDAGRVAQLA
FT                   SAAAAASGA"
FT   CDS_pept        join(850368..850445,850563..850724)
FT                   /codon_start=1
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640580"
FT                   /orf_name="MICPUN_84315"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="ACO69225.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000199C454"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA8"
FT                   /transl_table=1
FT                   /translation="MAPQQSIDPQMAAFLEEEKRKAMFNEVVAKLADVCFDKCVSKPGA
FT                   SLDRYESACLSQCALRYLETGQLIMSRISGGSMN"
FT   CDS_pept        complement(850806..851633)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640581"
FT                   /orf_name="MICPUN_60796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69515.1"
FT                   /db_xref="UniParc:UPI000199C455"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGA9"
FT                   /transl_table=1
FT                   /translation="MSGRGGRGGGRGGFGGRGSAGNPITIDDDGQPVIGNADGPPSLYP
FT                   PMPRMPPPPELTEREEELLRIHRRLNNFWRNSCYYMDDEPEAQEIPEVKIMTYRDRLAA
FT                   QEKAKTEKKAELHDVLESYKDHFPEELWAGRGKKRKRGAGDGASKGARAIGGAADSDDR
FT                   LERLARLEQEKGVGEEDVDDDVEKAAGDEDEDDEGTGKRGRPRVSENADRKPRHSENKD
FT                   GKKGGDKVGDDDDGDEDDFWDDDDDDYQRGADYDDDEGYDDDLGGGDDEEAFF"
FT   CDS_pept        complement(851803..852957)
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640582"
FT                   /orf_name="MICPUN_83973"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69516.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI000199C456"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB0"
FT                   /transl_table=1
FT                   /translation="MACLSVASLARPFSSRVSSASCRAAVVAGGQRASLLGASQPRWAL
FT                   AATSTALRRRANRGFLTVEAKKKGFAELLSDIVPKDEDYNGRPRLEKGKVSAKQHVPNS
FT                   IPKPPYADTGHLPPMNEDPQIHDAEGEEKMRAAGLLAAQVLDYAETIIKPGITTDFVDQ
FT                   KVHKMIIDAGAYPSPLNYGGFPKSVCTSLNECICHGIPDTTELREGDIINVDVTVYLNG
FT                   YHGDTSRTICVGKVTDEVQRLVDVTEKSLAEAIKICKPGTPVRKIGATIHAIADEAGFG
FT                   VVEKFVGHGVGKEFHSGPTVRHHRNNDPGVLVKGQTFTIEPMLTIGRTADRMWRDGWTA
FT                   VTADGKWTAQCEHTLLITDDGVEILTASPMKKTERFPAKEATAA"
FT   CDS_pept        join(853338..853355,853484..853609,853754..854857)
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640583"
FT                   /orf_name="MICPUN_97775"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69226.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199C457"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB1"
FT                   /transl_table=1
FT                   /translation="MPGRPKGDTEKFYNILGVSKNADANEIKKAYRKAAIKNHPDKGGD
FT                   PEKFKEVTAAYEVLSDPEKREIYDQYGEEGLKEGGMGGGGGGSPFDIFEAMFGGNPFGP
FT                   GGGRGSGRQRQRKGEDVVHGLKVSLEDLYNGVTKKLSLAKNVLCPKCDGKGSKSGASGH
FT                   CGTCKGSGVRVVVRQIAPGMVQQMQTVCNECRGSGQVISEKDKCGQCHGQKVVQEKKVL
FT                   EVHIEKGMVNNQKIVFQGEADEAPGTVPGDIIFVVQEKEHATFKRKGPDLFLEKTISLA
FT                   EALCGFQMTVTHLDKRELVIATNEGDIIKPNSFKAVYDEGMPTYQSPFQKGKLFIQFTV
FT                   KFPAPGDLSDDDLAALANVLGKPTAPIVTDDHEECTMHDVDIESEMRRNKQQQKQAHDD
FT                   SDDEGEGGQRVQCAQQ"
FT   CDS_pept        join(855261..855961,856002..856326,856420..856896)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640584"
FT                   /orf_name="MICPUN_60799"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69227.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199C458"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB2"
FT                   /transl_table=1
FT                   /translation="MRRAAVLVAILLSHTFTICVRAGGYDERGLTDRTLDQIGGPSGVK
FT                   RGAVEESGRLDPATLRSRWEAAARGDAPESKPAASAVPEEERLAKPSDEIGRAPAGNET
FT                   NRTMAPAGNETNRTNTTEESVTGGEDSSPRGEGEASPTESIEDLEAEDLRPAMDAAEAR
FT                   AKQAREADELERLADEAREEFGSSMCKRSESALISEPLAFFGDEDMRPGYLVSFGDSKD
FT                   AEIVTKWCYSSGVRHLDTNVFQLMNDPLYRYTVHQPWELYPDEFGWKTPENRGHAAAIC
FT                   FDQKYNRTRWVYWLVYGMAPDPPYHQPYNTSHKYEGVPPNTIERVGHLLTLTIKHHGPW
FT                   IEAVTLASNSWDLSRIVENKFEFHESEWIANATAVISEIKRHSKSIILRTSTLDYRYQH
FT                   KSAFLSDRLNCAMRKLSRTLKIPLVDVDECLLGVPSHRRVINGDKLHQSTLCSVLIAGC
FT                   VRAEVERSGFGMWYGWAFRDEGDSGDAKSVWLPSFRRWRQIG"
FT   CDS_pept        complement(857006..859045)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640585"
FT                   /orf_name="MICPUN_60800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /protein_id="ACO69517.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="UniParc:UPI000199C4D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB3"
FT                   /transl_table=1
FT                   /translation="MSTAPRCAVGAIRARASSRFDSKFAAGDYLRQPLHSRKQRGRCAV
FT                   VWRAEVAEPEATRGRIEQDNVDARIRAERMAVRLKLASTAGAKTGVGRPSSAPSFDARI
FT                   AEAEATNRSNKSKLIEEERAAVRARMGKFRMNRYAFVNTGANTGVFDRVTGEAAPVNDD
FT                   AFAIEDRVDLARERVKQAQQELANAKAEAEAKERDLGERVAKLEKLAGELADKRKEENE
FT                   GRDGGRGAERKAVLAAMKEMRVDGEAGGAAGPSTTAAGAGAKKIAVATSNPATASPIES
FT                   PEDAKARAADAIRARASSSLSRLRKHRKSRLSQASSLRKTPVTSTAAQEGNTVAEHDPL
FT                   RAAAAASSASAAKESEEASGKGQNQQTAVIPANDVLPKPIFVLSDCTGESAANTCRAAL
FT                   GQFEELMNLSMPTNLYIFRFLNDGGDAYKIVQQAKEDDALVVYTLSVPEMVTSVMTACK
FT                   LYGVRSVNLWGPLLESMEAHLMMTRIGVPMTERGASTVSRTHTSSEALSTDYYRMIEAV
FT                   EFTRQMDDGARPDKWKDADILILGVSRTGKTPLSIYLGQRGYKVANLPLVPRNGQLMVP
FT                   KYIDDVDPKRVFGLLINGEVLHDIRTNRLSSIGVKREDKSAMEYSTMRQVTQELSLAKA
FT                   LYARNPDWTVLDVTHKGVEETAARVMKIMYQSENANNYSLMKAT"
FT   CDS_pept        859179..860024
FT                   /codon_start=1
FT                   /gene_family="HOG000100778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640586"
FT                   /gene_name="GST"
FT                   /orf_name="MICPUN_113326"
FT                   /product="Glutathione s-transferase "
FT                   /function="transferase activity"
FT                   /protein_id="ACO69228.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG562382"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199C4D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB4"
FT                   /transl_table=1
FT                   /translation="MSTVASLPFIRPTNSFRRASRGTSRASAPRRASLQTVAADKNVLF
FT                   DVPVSNNGARCRLIIYWKQLEDEFAITNPSEVGGLKSEEYLAMNPQGKMPLLMTADGLA
FT                   LPESEVISQWICDEYSEVGPELKPEDPETRAICALATRIHDVYIVPIQGCMYRGLMDVK
FT                   TRADQLAEVAKQLDVIEGAMSLRDGPFVAGREPSTADAALFPTYVFIEYILPKHFGWKD
FT                   VFAGRPRTAEWWEAMRLDTCGARVYGEIRGGLESWESNGRWQTVGVTDAVKDASFKWAY
FT                   "
FT   CDS_pept        complement(860085..867233)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640587"
FT                   /orf_name="MICPUN_60802"
FT                   /product="Ankyrin repeat protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69518.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C4D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB5"
FT                   /transl_table=1
FT                   /translation="MSQLPPAFPPRSRLTVSTSGRPVDAPTGDAHDVSRAPPMGVDWDE
FT                   EASTRGDLERLSGGSDFSGYADSVFSGDSGYTGLSGVSGAFHNRALLPPRVRGNPLLDP
FT                   TAPDYDPSEHLKRLTENDASDDADRFSLARGLSMGLGSLALDDGYDAISTFEGTSRSDE
FT                   SRARSAARRDPDRRRYGDITTAASAAETGDAGAIDYAHRRGVDLDEIDGDGRAALHVAA
FT                   ERGDVIVAKRLMELGADPNVEGPLGLTPAHVAAYCGNVDVLDAVLDGGGNTNARDRDGS
FT                   TPLHWACSAGRLRSVRRLLRRDDVDTGVLNEKGLTARDVSERESCAAAVIEFDATATVH
FT                   NLAADGKLPMVRRALDDAWKSRRTTEEVLESTDAAGETMLHHACRNGRLEMVEALYAEY
FT                   GANPDARSGVDGATPLHLAAAGGHVECMRVYAVNAGFPRRLQQRTLMRTRSSNDGSKSG
FT                   RTNDDLFEFDDDGDDRARWLRRIKRVGAGGEAVPSGSTPIHMAAQNGHVAAVEFLIDQM
FT                   HADVEAKDDEGSTPLHVAVARGHVHVVACLLRRAAKVDAVDEHGCQPLHLAAERNNAAA
FT                   IKMLLERGGEELVVARNAYGHLPVHLAAAMGHFEAVTTLLPDEPANSGDNSEDENRENS
FT                   PAKWWERNSGDANDALHALRVAKRRAREKDRAARQDRRARKPGEPSRGRGVNVGGHLGW
FT                   TALHLAAHGCHLELVEHLLSIPGADPSPIDASGATPLHLAAEGGSTAVVEALLSAKGVD
FT                   STLRTDAGFTPMHIAAMAGHSAATRMFIRYARDRVVAIKQRARLAADEARARGEDAYAA
FT                   AEAVAAEEFAEDDAGEIINLDQPSSSGYTALHLAAMRKHGRVVQLLLNEGARVGVVGDD
FT                   GKTPLHLAAQSGAHSVVKMLLRATKGAAAAVVNDRTNAGETPVLLAARGGHIDAFDVLM
FT                   HAGADPFIPDERGNSSVHAACKSGSRDIFVRLLSHASRAHLGMEVFRVPNSSMERPIHL
FT                   AARNGGVHLVRCLIDRGADLSAGDDHGHNALMAACEANNPGAAALIIDQVKQFGSEVHN
FT                   DLTMAQMRWRTLKRAMPDLIAAVKLGVDPMAENGASEQALIDISLQRMGISDDGSKMRR
FT                   SASKQSVGFMEGEDGHLYAIDEELSDEESTETESDLGGKGYSLLAILEKAREQYKVRQR
FT                   DRYVNYTSPTDGYSALHIAAEKGLTAIVRLLLDCGANPDLPDGIRSNCALHFAAREGHR
FT                   RTCTMLARWGASQKSINDIWYTPLHLAAKEGDLEIVEALLDAADAAGCLAEVINYPRKD
FT                   GTSPLHSAVEQSHEDVVRTLLNRGADWDARTIRNESVMHVAARTGHTGILKMILKCRED
FT                   AIWALREEDGSESDGEGSGSDDSEAELEDDPMGSRDHTESMPLHWAAENGHLEAVRMLI
FT                   AAGASLIIGGMWRGSTAAHLAARNGHLDVVRHLHGVGANLNAQDMWNYATPLILAAEGG
FT                   HTDVVRFLIDRRVRLDVEDKFGTTAAQSARTPDIRNLIHFEQVLRKAVLVMHGATRLDL
FT                   FLGWRDHVLYGKALRARDSKGTWQMVFALFSENITARYYWLWRQWEQRGRRRRRALGKR
FT                   LEPVVAAMEATPGFAGLSHARVVELAEKMSKVEVDKGHDVFTEGDSGDNAYFVVVKGKV
FT                   EVFMTVEHEESKKGESDDGSDVEVVTTLRETKVASLRSGVGFGDLALRFDAPRMATVRA
FT                   MHKTSLLRLERDDYLRAFREERDAMDAAGLKKLAEELCEAEEGLEPDEAETRAAAAKTT
FT                   IAPEDLVAVKSLPRALEPWERELLATLLTVARYDKGERLPVPLSEADRLGINKFKQAAM
FT                   LLKQQTEKKANAAGLGALDKEDGYVGVVISGEIKVTCRVSNTGGFVSERVGPGGHYVAL
FT                   AEKKFGEATVSRRGAVSVEAVSAEPVVCALLQGPDIKALPRSLQELIFDGRTVPVRWDP
FT                   LPRSLARSTAEWPKSRQEEDEEQAKADENSKKDKSKSDDVNDDDDDDDDDDDDDDELVI
FT                   DDHGMKAELVKELTEAFHFVDADHGGDIDENELKSAARALGFEPDQRELKAMFDALDED
FT                   GGGSVDLGEFISKVTERIAEVTRDDALDVGFDCFDLARKGFIVLEDVAAAAKTVGDNVG
FT                   LTELDELMNLGEADANDDGEIDRDEFATIMDSHETTAPERREIIREAIAKQSEEAKRAE
FT                   AVAEMLMEYRGEGNLRQHLRDIFADIAGPDKDPEEDEIDVRDLIGALKRDSDGDGSLSE
FT                   MLQLPRRLRFDDGSRDRFETIFREIDTDGSKTIDFGEFFAYFRSLKKERCGEIVRAAVE
FT                   RMREDDSDSSSSSSSSDDEGGDDDIAALVEEDERRRKEEPEGVDAVAAGTAALARRWAK
FT                   KVHGKEKINTVVNTGAVAAAAMAQRWQRKTFAHRNE"
FT   CDS_pept        join(867367..867849,867916..868074)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640588"
FT                   /orf_name="MICPUN_112679"
FT                   /product="Selenoprotein"
FT                   /protein_id="ACO69229.1"
FT                   /db_xref="HOGENOM:HBG562384"
FT                   /db_xref="UniParc:UPI000199C4DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB6"
FT                   /transl_table=1
FT                   /translation="MATVVSLRVVAHVPTGAAPSGSARRRGANRVPGCKQEAQDSRRIK
FT                   SVAARSSPVDVEEPETKTEAFDDPLADVFKQLYPGGGVKRIKWGVFKEDVDASSVTTTE
FT                   EEQAELRAEAACSLTNIDADERARRGKAGTAFGIACALIAAVQLATGAPPAQRAVIAAG
FT                   VWDVDGTGLREIEDKSVAQKIRDKVNAFNGASVAISTALTIAYMAIPLTQ"
FT   CDS_pept        complement(868273..870273)
FT                   /codon_start=1
FT                   /gene_family="HOG000275160" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640589"
FT                   /orf_name="MICPUN_84428"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69519.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG396032"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR018153"
FT                   /db_xref="InterPro:IPR020564"
FT                   /db_xref="UniParc:UPI000199C4DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB7"
FT                   /transl_table=1
FT                   /translation="MTSAAASASLLGLTRFPAPRPSARSGVAVPAVHRRRFTAAVVPPR
FT                   AVAADADVETANLLPDALQWPARDQTCGTLREQDEGRTVTLCGWVDKQRDMGGIVFADV
FT                   RDHTGFVQVVSDADTPKEATDALAAMRAEWVVCVTGRVKKRTAPNDKVPTGAVEVAADK
FT                   VTVLNTVAKSLPFSISGAPEGDDDELREEVRLKNRVLDLRRPQMVRNLRLRAKTVRALR
FT                   KVLEDTHDFLEVETPILTRSTPEGARDYLVPSRLQPGACFALPQSPQLFKQMLMVAGAD
FT                   RYYQVARCFRDEDLRADRQPEFTQLDIEMSFTDMDGILNLGEDLMCAAFKEGADVDLPR
FT                   PFRRMTYAEAMSKYGSDKPDVRYGLEMAELADVVAGTEFKLFAGAVEAGGVVKAIAVPQ
FT                   GSRISNSRLKPKGDVFNEAIAGGAGGLAFARVGEDGVTLEGGKALCEGLQPVAEKLIAR
FT                   CGAGAGDLLLFGAGDEGTVNKAMDRVRQFVAKTLDMVPEGQHAVLWITDFPMFEWNEDE
FT                   NRLEALHHPFTAPNQEDVANGGDIKQARAIAYDLVYNGVEVGGGSLRIYRRDVQEKVFD
FT                   AIGLGKEEAEEKFGYLMEAFQFGAPPHGGMAFGLDRLVMMLAGAKSIRDVIAFPKTATA
FT                   QCLLTAAPGDVSDSQMAELHIAKAKRESEQQ"
FT   CDS_pept        870714..871592
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640590"
FT                   /orf_name="MICPUN_60805"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69230.1"
FT                   /db_xref="HOGENOM:HBG562385"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniParc:UPI000199C4DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB8"
FT                   /transl_table=1
FT                   /translation="MADSPSAGPPRGCVLPVCRAALSASSATSDEDQDPPNLTGYPFGV
FT                   KRIHLALDPYSRMAMPNRRGGEEVQKRPTSDIFWAFLMCFVTLATLGLVDRYMHVTHGL
FT                   PFMSGAWGTISVLAFGTVENPAARLYNCVTATVASAFIVATMVMLFGSCWWTRALSVAT
FT                   ALGFMMWTGSVHPPGAAAIMGCMDQAAFQQLGYWYVLYPVLFGSLFVLFMGHLTHKLKH
FT                   RYEFMVGGLFGDGWVKLRRAEENDRNNERLEQALNECENCTISYDEDDVLGTYTLERED
FT                   SQIEYTEVRRE"
FT   CDS_pept        join(complement(873011..873133),complement(871664..872884))
FT                   /codon_start=1
FT                   /gene_family="HOG000036743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640591"
FT                   /orf_name="MICPUN_53124"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69520.1"
FT                   /db_xref="HOGENOM:HBG713229"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199C4DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGB9"
FT                   /transl_table=1
FT                   /translation="MVRFGGVPMPEETVEDPTLQHNFKGHKGVVHACAFKPNLKQLVTA
FT                   SEDHSLMIWSPGVPNARAYKFSGHTDAVTAVAYSSDGTTIASGSRDRSIRMWTPSIVGL
FT                   YEPKALKSAHGGCIRSVSFSRDGTLLVSAADDKTVKIWGAPEGKFLHTLSGHINWVRCA
FT                   EFNHDNGLIVSASDDKTARLWDVRGQRCAFIYDDFKAPVRCAKFHPDGAAIATAGDDRT
FT                   IQVWDIRSQKLVQHYHAAHGDRVNSLSFHPSGDFLLSTSDDGTVKVWDLREGQLFYTLN
FT                   GHDGPSTCAEFSPDGSFFASGGADQSVMVWKTNFDAVLKKHAGATDVKLPAPFTAEAPI
FT                   LKDDPRAAPVMSTERAMEGLKAGSTPPLKENKNKEPVKTPVKKPAAAGGDGAIPEALAQ
FT                   TLGHIVGQLDVLTKSIGLIEERLSANEDRVKDLVGIAEKKSSSARIAK"
FT   CDS_pept        complement(873405..875135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640592"
FT                   /orf_name="MICPUN_60807"
FT                   /product="Predicted protein"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="ACO69521.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI000199C4DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC0"
FT                   /transl_table=1
FT                   /translation="MGACIGRICEPFTGRSHDRLTASFAEAALHPLETPPETPTGGLLQ
FT                   NGNKPSEEDKEDDDDGYESAKSDFSTCTWSSERSVGAAGSRSSQRTPPPPRLATLASPQ
FT                   PTARGDGGDPKDHDGDACTPDAWRALSEATAHLEDDALDRLEDDTPGASKRTKSRLGVA
FT                   ARLAKVAAGMRMLRAVGRAIYSAGGALDLTGFGGTPIRWHSGHSTLRTHHRGESTLRRS
FT                   NGEPRPSRAARMFCQTDRDFGRALGTVRLSICDSDNEKDYADPAIDGDCGVFPDGATPE
FT                   GNILRVVRSIICDLDVPRHLQKPFNPILGETARHELQLVGGCKVKSVIEQVSHHPPITA
FT                   FHCDGDGDWVIRGYFQPRPRLLGVHAVEVEMLGRRMWEVGPRDRREIYESDYCGFLWKF
FT                   LPRMKTSLSTQTWFVECKQTMLRAEVTHGRKRSIKGRVFNVLKPSETLFAIDGAYDSCV
FT                   FVKEPSTTKVHVLYDAEEAAAAEEVEADVAFQLPGDEKSSERVWGSVIDAMNRGAWDEA
FT                   RAGKRRVEEAERKERRRRKDAGEGPWRPRFFEDVDGDWVLRRLGDNADEPRGAPPRPDQ
FT                   "
FT   CDS_pept        complement(875281..876762)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640593"
FT                   /orf_name="MICPUN_60808"
FT                   /product="RNA binding protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO69522.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C4DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC1"
FT                   /transl_table=1
FT                   /translation="MSERANKRGRWGGGAGIPPGMGVQAPDLQEVPPPPPPGAASQSAG
FT                   QPDFSAAGVSAMSVAAAKAAAARAAAAIQQQLHGMGSGADVNSKYPGMPPAWGVGMTEA
FT                   QRDAAYAQHTRQSRRLYVGSLPKPVNDEALHAFFNNAMVNSGAAIDPSGGPSVVNTTIT
FT                   HEKGFAFIEFRRLEDAESALMFDGIVFNGSKLIIKRPKDYDAARNPIWAMRGQAPPQDE
FT                   VKLIGEELPIGTIIVDGKEVKIPLPPPLPSEWPRLPRRTPNGPHKMYCGGFHPLHTDLQ
FT                   VRQVLQSVGELKSFAVMPDENGRPTGHAFFEYKDPRLSAVAETVLTGIRVRNRRLVCRR
FT                   MNPDAAPEKPGESATYVVPDAAWPLLEPASARLAVYMAIREEHDALARREIEEAVHAEA
FT                   ARLARWDPDFISHKRVFDDACVFLEFKDGGALDGGDGGGGACGGNTAEDAAVRCSSGMN
FT                   GRTFEGRRIYVRYLPPEGEEDGEAEAGEGAVAVVS"
FT   CDS_pept        876891..877832
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640594"
FT                   /orf_name="MICPUN_60809"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69231.1"
FT                   /db_xref="UniParc:UPI000199C4E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC2"
FT                   /transl_table=1
FT                   /translation="MAPSETFLRLHELSRKSRGAEYMDAAALPSASHLEREFGLFNPEG
FT                   SGCCPTVDATGAVTCTCSGCERWSKYVAGTLGERWPTYKQYEVLTAEYVAQLARYLRSR
FT                   RSEIIGADDVGEPLRSLRVLELGAGDGRLTRHLREELDGHSVEVYATDDHSLGLARGSA
FT                   HGVVAADALDAIALAGGAARSPIDGSSNVPAACDVALVCWQPMGVDWTAAIRASASFQE
FT                   YLLIGEVDDGICGHRRLTWGLEDDDDAGDSEDDGNGEGAGRGHAMPSYVTDGWTRVDVT
FT                   DELGGRQICRTDERWLSGRRSRSTSFRRGARS"
FT   CDS_pept        complement(878000..878494)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640595"
FT                   /orf_name="MICPUN_108801"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69523.1"
FT                   /db_xref="UniParc:UPI000199C553"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC3"
FT                   /transl_table=1
FT                   /translation="MTMEEAPKVVAMRKEVEGTVRGGGCPPHKLAKKYSDSWFPGEITS
FT                   ETIGGCYEIKGKTECCGLLCRMCPLCLYNQRCSEDCVCVWPFLWGIPTALCCVMMPMCE
FT                   RESNGWVMRDKNGIRTGELLVVDKHGGTYACYSLKCCSSDFRQEPDCMGVKYGNRVRIH
FT                   N"
FT   CDS_pept        885253..885507
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640596"
FT                   /orf_name="MICPUN_60818"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69233.1"
FT                   /db_xref="UniParc:UPI000199C555"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC5"
FT                   /transl_table=1
FT                   /translation="MDARVGKRQCAMREAPTRDCEGLARARPFAFVEYTTHAGVMTGTP
FT                   GTCLHSADCSETHTRVFSLAHTSATVWETAVDYLRCAIS"
FT   CDS_pept        join(885666..887455,887558..887927)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22640597"
FT                   /gene_name="FAP125"
FT                   /orf_name="MICPUN_60819"
FT                   /product="Kinesin-like protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO69234.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199C556"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC6"
FT                   /transl_table=1
FT                   /translation="MSVAEIRMSVRVRPTPPGDPRAVNLDPRTGALALTTGEVFDYPSS
FT                   VVVGSDQDVAYDALCAPLVRHALTGYDCTLVAYGQTGSGKTHTMFGPPGCLVEARVRQW
FT                   RGESDGGKSTDAPRDWGLFPRAVLELMRTPGVRSIRASAVEVYHENVFDLMNAREQLSL
FT                   GSSKTKFGRRVQGATESGSDDVAARGGQGGVHPSCCTCHKCFQLQEKEKERARAERTLV
FT                   ASTRGSSRAVSEGTRTSWSSNAPASSSNAQTTRETFSTVGETLVPLDTPESLARFARSV
FT                   EATRTSKSHLLNDRSSRSHCLVKVRAKSSDGARVSLLFVDLAGSERVARTGATGEAKHE
FT                   AQAINGSLSALGRVVKMLGEQSRAKKGRGGAPRGHVPYRDASLTMLLRDSFGGGSCTSV
FT                   VVNVAGEPEHVDETACSLRFGERMSVVRNEPTTRVLGDVDARSSCEAPGGGRGSISRTK
FT                   VGTDVSRAAELKRRLAVARAELNALELSGHGGGFVKGGPVTEIQSLRRGLEKLKAVDAA
FT                   SAKLRVDMAEAQGERAPSAVKISHLRKALATSANQAEVLRSVVERQKTIKAIWAEPTVS
FT                   YARKAAEVRQIQSELEMEESYWVGRDQYGDRFDITMGPCQPEQTVQCRRTVTATRLDRN
FT                   HGWGMNLRFRCGGQVVSIGNSFTRSRSTTTSFTMSDGQCPDVVNRNNWEGHDRYSDRFA
FT                   IKVSGCVGAALGDAQKYDHEDKLIQ"
FT   CDS_pept        join(888137..888343,888761..889090)
FT                   /codon_start=1
FT                   /gene_family="HOG000265388" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640598"
FT                   /orf_name="MICPUN_60820"
FT                   /product="Beta-Ig-H3/Fasciclin"
FT                   /protein_id="ACO69235.1"
FT                   /db_xref="HOGENOM:HBG750250"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199C557"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC7"
FT                   /transl_table=1
FT                   /translation="MSLAVSQFASVRISAKPVARRNAPARMTVRAAGGGGKGGEEGGRA
FT                   FGNDAFGMVAKNANYGLFAAAITKTGCEGIMTGPGPITVFCPNDDAFVELAQKLGTTKM
FT                   DLMSHQALPNIVKHHVVQGAVTLADMSEGKVFTTMGGTQLKCSGGKVNGMSFKKNDIKV
FT                   GNGIVHAVNGVIPSQ"
FT   CDS_pept        complement(889283..889678)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640599"
FT                   /orf_name="MICPUN_60821"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69524.1"
FT                   /db_xref="UniParc:UPI000199C558"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC8"
FT                   /transl_table=1
FT                   /translation="MSPMENWNADEPPAVDPDYVEEPTAADVELADVEEIADDEVPKLL
FT                   DEADEIGAMRPRMRKSVTPAKKGAKEPAWPDEDEHADENFEHTDEFKRGGEADEDMEVD
FT                   EGVTKKEIKNIVAECDEIGALRPRRIN"
FT   CDS_pept        join(889915..892184,892319..892328)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640600"
FT                   /orf_name="MICPUN_60822"
FT                   /product="Predicted protein"
FT                   /biological_process="protein processing"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69236.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016485"
FT                   /db_xref="InterPro:IPR008710"
FT                   /db_xref="UniParc:UPI000199C559"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGC9"
FT                   /transl_table=1
FT                   /translation="MLRLGTWLALAILMASPRPGVDGYEPKRIRKVADLRDNMYPVMGH
FT                   WPCVLLLNATGSAGCSTREPVWATLQRCEDMGCVRSIAGDRTLLLPPSVFPRAMREYLD
FT                   GSAPVDEGWRGRVRGMLVEVGDGAGLNATDLGDASFSPQPAYPQAELRPANDPGTHQWN
FT                   PHGFGATDRRFEDFPIALLDFEGTDLARTFARVNHETEYVKPDRVASADFLMQSALSSK
FT                   QKLGVPKVTEENSAYCLAARACLPIGGYSVIATSPPRASPPVRSDDDGDARARPGRRTP
FT                   FVLVSARLDATAMFHDVAAGANAAMSGLIVLLAAAEAYAAALRAAEAAVAPGEAKATPA
FT                   KRVAFAAFAAEDWGYAGSRRFLWELAGGGADAGFGAANVGDVLGLGDVDAAIELGAIGL
FT                   AHRRIPPDVASPAVFVHAAPGVGGAGLADAIIKTGADVPGVSLRRSADGVPFPPSSTFS
FT                   LLRRDAAIPAAVLAEYDDRYIDPFYGGAFDSGVDAVDPARMARVAVVLAKTLLNVAAGF
FT                   PPGSAQLARATEGVDGAGVDATTRELVTCLVDPAVGFDCDRARALFSHATGRWSSRYAG
FT                   VLPGLLAKDHQSPLGKSDVQRFAWNFLANATADRHLSSFKSCASQEECGGGGGGGDVAE
FT                   VCVGATGDRGGFFGRQERLRSKRRRLIERDERRGDASRLGADDGTSALYGQLDGDDGTS
FT                   AEPGACVAASVGFVPALSHRLAFDATELIWRLGATDPTELALGGGEDPVWTESNWPGSV
FT                   GITATV"
FT   CDS_pept        complement(892423..893760)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640601"
FT                   /gene_name="UPF0066.2"
FT                   /orf_name="MICPUN_60823"
FT                   /product="Putative uncharacterized protein UPF0066.2 "
FT                   /protein_id="ACO69525.1"
FT                   /db_xref="InterPro:IPR001378"
FT                   /db_xref="UniParc:UPI000199C55A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD0"
FT                   /transl_table=1
FT                   /translation="MTSDGSTGRVASTTVAAVAVGVGVGICLYVSRSLRVSESYRARVP
FT                   GDPASTIGAAAVAPELARPKPPSSAPCAGVKPRAIVAVEQLGPPIAKVHSCFSRRNGTP
FT                   RQGGDLVPSARCVLTLAPGLPRDLLTGVDEYTHVWIIYVFHANTNDGDTRNGGAVKAKV
FT                   RVPRLDGKTVGALATRTPHRPLPIGLSLGRVVSVDARAGTLTLAGADLVDGTPVLDIKP
FT                   YVPFCDRVEDATAPAWVGKEASDRDEPLKISRVNAADGAADAVAAAYVRSVADRRRARL
FT                   AREADDASASSGGKGHKAGGTRTHRGKDGEDAAKSRFLGLSEEEKKAIRKEEKDRRRAG
FT                   LAPPDALYPSGEAFVEMVREVLALDMRTVRERRAPPERRKFQTYRVTLCDVEVEYSVDD
FT                   ETKVCTMLGGAAVKPLDRPGETKRDASRGGAVADAFRDIVAADTVD"
FT   CDS_pept        900685..901056
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22640602"
FT                   /orf_name="MICPUN_60833"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69237.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199C55B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD1"
FT                   /transl_table=1
FT                   /translation="MDSSPCSPDFTHSTSISLLARLLRQQSVPPAMNKKQIQLKKKEKE
FT                   RKDAAGVKSATSKESLAKQAKDASAYVCQSCRQTFMVTSKSKQLIEHCDAKHPKLPREQ
FT                   CFPELPDMLAREATGGGKK"
FT   CDS_pept        complement(901521..903152)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638205"
FT                   /orf_name="MICPUN_108802"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69526.1"
FT                   /db_xref="UniParc:UPI000199C55C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD2"
FT                   /transl_table=1
FT                   /translation="MAKTSRILILLVVFLALAPCEADAFSAFWRGLRNRGARQRLRAPK
FT                   PAPVPAPAPVGPECTGRTVTVKRMDPSGLDGHGWGMNLQFMCGDSRVNIGNSRGSQTQS
FT                   TVVNTPMHKGDCPARISKSNWLGGYTYPDFFDVTVTDCPGPAPVPVPKPVPAPATVPEG
FT                   PLTACYGEDAAPPFGYVHKAENLDFGIDRSSEAAIGFTSGYEKYQALSCDAPPVHKFED
FT                   CEWCKTHSCDASCPQVMPGKCADPASFGVCEPTVKGICDTLQQSHDGCTSGSKAVVEKS
FT                   KEYLSVDVQNAPCAAPIMEDTFASLKKYKLAYNDWAMAFNNASQVCKVGANIREYNGIS
FT                   FMSMHKSLEDVERVANDACAELDFDAEAARPKNAELGASVRNADVCSKLKDLTASMIAD
FT                   ADTSSAQIQCFAAACVDLKAAEQVKLDALVAAHAEYEAKYLAYSAAITAYNQKVSDKNA
FT                   LKAAVMESYEIFNPIKTTTVAKFDKDNVVYQKFESGAAKGSCGLSDCEMESVCGYAIAA
FT                   DADYYVEEKRGKCVQKNKDLVEHCHK"
FT   CDS_pept        905612..906817
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638206"
FT                   /orf_name="MICPUN_108803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69238.1"
FT                   /db_xref="UniParc:UPI000199C55D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD3"
FT                   /transl_table=1
FT                   /translation="MSADKICSDGPVVEPVVDKGPECSGRTVTVKRMDRAGLDGHGWGM
FT                   NLQFMCGDSKVSIGNSRGSQTQSTVVNTPMHKGDCVARIDKSNWLGGYTYPDFFDVTVG
FT                   ECPPPPSPPAPVVDKGPECSGRTVTVKRMDPAGRDGHGWGMNLQFMCGDSKVSIGNSRG
FT                   SQTQSTVVNTPMYKGDCAARINKSNWLGGYRYQDYFDVTVGECPPPPSPPAPVPVEPTC
FT                   SRAVTARRLDANHGWGMNLRIKCGTDTVTIGNSDRQTKTVYSNAGIKGCPSNVDRNSWV
FT                   GGDRYGDRFDITMGPCQPEQTVQCRRTVTATRLDANHGWGMNLRFRCGGQVVSIGSSGS
FT                   RSRSTTTSFTMSDGQCPGEVNRNNWEGHDRYGDRFAIKVSGCVGAALGDAQKYDHEDKL
FT                   IQ"
FT   CDS_pept        complement(907242..907799)
FT                   /codon_start=1
FT                   /gene_family="HOG000264848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638207"
FT                   /orf_name="MICPUN_101968"
FT                   /product="Predicted protein"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69527.1"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG558231"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000199C55E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD4"
FT                   /transl_table=1
FT                   /translation="MPAPAARFVGVLAAVSAVVAFVRASPRAAQMDSLVLGDPSIMRQR
FT                   ANGRSTERAPQGDLLWGADASTADRICTRNRHYAEHSGYFRTTNFLDEVASDGETTYYD
FT                   SVSGKPLFVAPRGRSFDEFVRESKAHGWPSFRDEEVVWENVRVLEGGETVSLAGTHLGH
FT                   NLPDGKGNRYCINLCCVAGRPA"
FT   CDS_pept        join(907824..908159,908287..909537,909618..909686)
FT                   /codon_start=1
FT                   /gene_family="HOG000265049" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638208"
FT                   /orf_name="MICPUN_60838"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ACO69239.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG562401"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI000199C55F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD5"
FT                   /transl_table=1
FT                   /translation="MTRGQRRERTDTSQTPSPRLGHVPLEFTSRMRVSVYSTSVHSTSC
FT                   LGAYTAAARDARRLRHRRLATTVCRNKREISSKLNLDLDLGQVLGTVKRNEGLYDNLPP
FT                   GKVGLFGLRETFAYLNDPNKFIRTRVEKYGPVFKTAFFFKPAVVFGSPEAIREFKDFEG
FT                   DLPADAALPETFRELHTEYGALRMSGERHKATRANFGKVLGRSALTHYTPILAKLTRDF
FT                   VKGELLEKRTLQPGYDCRQFCLKALFQLFLGTVPPQDIMEKMYFYNEGLLALGKLSPEF
FT                   TEGKKALEDLQEFCLKHFRTVRAQGKLDDPEYFFLKQYSQATDENGDLFTDERVAVTTI
FT                   LMIWGAFIEAAASMGHTTWLLMRNPDKAKKVRAECRSSFSREELDSGKLTLDDVYTKLT
FT                   FTECAIKEALRVMPQTAGGLRVNPETRTLAGFTVPSGYVLTADPRIAFLNPDFFPDPED
FT                   YRPERFLPAENPAITPDNFFPGGMGQHKCPGISLSNLMVSIYLLYLYSCFDKWEPDMSA
FT                   EEMDSEDPQYIQVPIVIIDDRYQLKLERNWQYEM"
FT   CDS_pept        join(complement(911793..912008),complement(909931..911511))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638209"
FT                   /orf_name="MICPUN_105962"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69528.1"
FT                   /db_xref="HOGENOM:HBG562402"
FT                   /db_xref="UniParc:UPI000199C560"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD6"
FT                   /transl_table=1
FT                   /translation="MSRSSLIPTQESGYGSTPAVVSAKKESSPFTRNRVIALACSALGL
FT                   IAVVGFGSRMNSDAALGNPFQQIMHAQAKQYEALQASKAAGIKMLSTMPVRPVFAPNAR
FT                   AQLGASEYQRCVAHDSKPSEGYNVSDSDQIRRDLVFDVSREDYPAVTAYNDSKTLLADV
FT                   SCKVTPPGKFLDTELCMSRTDFCDQSCKMPVPANCDYTTKSFGACEPSVRTICNGITTF
FT                   HYECETMQDELQHVTNEYDALSPGVPPCRVDADAPFAKAAYAQMKYEAAYVDWVNAVND
FT                   ATEVCTIGHALWVHNLGLYQAHYDAMENTIGDLKALCNASNPEEEFDISEAVAEASKSY
FT                   FKPSSGPHKGRKLVWWQQLCEPSIAALEELLKSLEIASPQLMCFAETCQMKKAAEADAF
FT                   EALVAAHNKFSIAYSAYTTEVDAYNKKVEAKETALAVAIAAFESFHPVKDKIAMSYTKV
FT                   VSAFEKVDEAFDPENPVCPVIPGVYPLLDPCQTQTLCHEMMKKHFDEYVDVDTCSAKDT
FT                   DGAKHAICNPPPSPPPPPPSPSPPPPQLSPEERAARARAEALRRNGASASGIPGFLDAA
FT                   MKDKVKEKVVQAVVDELEESRR"
FT   CDS_pept        join(complement(913453..913756),complement(912667..913343))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638210"
FT                   /orf_name="MICPUN_60840"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69529.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniParc:UPI000199C561"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD7"
FT                   /transl_table=1
FT                   /translation="MSGAPVVVVDGTAVDGTHPASPSDWLKTLPQLGAYTTGRTRGGGA
FT                   KVAQWSSHVARLRSSLATLTATTFESDGEVAALIEPSVRRVLAECVERNVAGPPDEGAD
FT                   RGELMVVIAVCASDGGGWTTHAHATPLPRFDREPTTVLVAAPALRQTRPNAKDVAWPAT
FT                   RAVYDELKTRMAPDGIGEIILTPDGGTTLLEGLTTNLFVARTRVDMPYHGVADAKSSVE
FT                   LVTAPRDSVLPGLARDAVIRASAAEGLPVREEPVLASDADCWTEAFLTNAVRLVQPVRE
FT                   VRWGSSDGNSSDGAREERFLPDPWGSISNRLYRRIVASLDDDLGP"
FT   CDS_pept        913962..915320
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638211"
FT                   /orf_name="MICPUN_60841"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69240.1"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="UniParc:UPI000199C562"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD8"
FT                   /transl_table=1
FT                   /translation="MPADEKHLSALDALLEEPGATVTYKFLARHLDISANLAKKLLFAH
FT                   VSRSSGASVATHVVSGWVKSGDVRAHVVRLARGVDGEVEAARKAMDEVTGEHVYSVSKA
FT                   SSDHPALTAVPASSVKQTDELFDAPPETPNALRDNRHSAVACALVKRAEGPARRVTEKP
FT                   SPPAAPAPAAKSASAAVKTEPKKTEAKGPGPFAGFKPVAKSDVKPEPRPAAAKPAAKPT
FT                   GGGRGAMAAMFAKAPPKKAAAPAPPPPAPKEDEDMSDEDGEDDEEEEVMEVPRHRRRVL
FT                   MEDSDDDDVEPAEAAPEPEPEPEPEKKTKAAKRKSTEPVAAEEPSKDEPKPSPAKKPSP
FT                   AKKPSPAKNQMDKFVTAPTPASAAASGKKTKKVVTVMDEETGEEFTKTIWVDEAGNEVP
FT                   EGGVGVAAPAPAQTLMDKSNKSSPKKKAKSPVKPKPAAKPAAKGGIAGFFKKA"
FT   CDS_pept        915602..917410
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638212"
FT                   /orf_name="MICPUN_60842"
FT                   /product="Galactosyltransferase"
FT                   /function="galactosyltransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69241.1"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0008378"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="UniParc:UPI000199C5F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGD9"
FT                   /transl_table=1
FT                   /translation="MARGATETSALLGRPSSARGTGLAVSSSAAFDDAPGDVEGGFAPD
FT                   ARPSQHPQHLRTKGRGLLARAVAGAALVVACVALAGFGASRYTVWRLGDEPVAGLAASA
FT                   ATAPQTKPRLLVAVISWQGGFDDTDAQERTWLPLLKDSSPDIEVDYRVFIGRDPEPTGE
FT                   GEETEIPAEAYRRRRMLRFEGEQTRRGPRVENKAEISPSAGAGGVAGVGGGAGGGGAVA
FT                   ATTSNVDGAGATSFEFDFQPMDDPFAQADDNPRRASQLLENYASDETVIYKEQQTANDT
FT                   PLTRTGLTPADHVVKLDVDDTYEGLPSKVVAAILWGTANDYDYFFKVDSDVFMMPTKFM
FT                   AFLKRNAIDKGVDWMGSENKMRETDENPSGWKCSLSRVWHFGKCSRPELNSMPYEGVNP
FT                   ISVDGGHGYFLSKRAMRGVTEYVDAMYDLMEKNKYVNIYEDQMVSHILINQGFLPVDFT
FT                   GVDVFNVPGITQLAAQNSCTLMTGPIGPAVGENLNKMANLRMSTGINMYETIFGFTPMS
FT                   IDERMLPRSLLEVGIQPYVTREDMLLKFGYWQRRMENEADSMRNEAEELGVKLPADDAE
FT                   DTTTYETKGEGGTEPVSEAPAAETKV"
FT   CDS_pept        complement(917499..918077)
FT                   /codon_start=1
FT                   /gene_family="HOG000265851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638213"
FT                   /orf_name="MICPUN_84118"
FT                   /product="Putative uncharacterized protein "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO69530.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG697469"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199C5F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE0"
FT                   /transl_table=1
FT                   /translation="MDHREFTPLEPETLFYRPATGDDLTVIAEIESNSYPPDEAASPEN
FT                   LRYRVENAGDYFLVGCSAGSGPGGADEIVSYVCGTLIKGETLTHESMSTHDADGDTLCI
FT                   HSVVTEGGHRRKQIGTKTLKAYMRWITTATPQVERVLLLCKRNLIGFYEGAGWKMVGES
FT                   DVVHGKDQWYEMEQSAARFRALVASTEQD"
FT   CDS_pept        918315..919400
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638214"
FT                   /orf_name="MICPUN_60844"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69242.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG562406"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199C5F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE1"
FT                   /transl_table=1
FT                   /translation="MQSVLAAGRALARPAARLGSRSFVAPRAASLRAPVTIPRAPARCF
FT                   SASAEQVVEKGDKVSIHYVGTLDDGEQFDSSRERGEPISFTVGGGMMIPGFDKGVVGLK
FT                   VGDKKDLKLSPDDAYGEVNPANVMKVPKQEVVGAVGEEYTVVGSKLMVGQGMTATISEV
FT                   GDDEVTLDMNHPLAGKTLNFDIEVMDIERIEVKHRDKFKCFFDIEIGGEPAGKIVMELR
FT                   GDVVPKTCENFRALCTMEKGFGYKGSPFHRVIPGFMCQGGDFTNRNGTGGKSIFGAKFE
FT                   DENFVLKHEGEGILSMANAGPGTNGSQFFLCTAETAWLDGKHVVFGKVVEGMDVVKAVE
FT                   EVGSQSGKTSKEVLVVDSGEM"
FT   CDS_pept        join(complement(920291..920421),complement(919587..920145))
FT                   /codon_start=1
FT                   /gene_family="HOG000214250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638215"
FT                   /orf_name="MICPUN_97779"
FT                   /product="Cwf15/Cwc15 cell cycle control family protein "
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="ACO69531.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG631510"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI000199C5F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE2"
FT                   /transl_table=1
FT                   /translation="MTTAHRPTWAPAKGHEEQGGARMFGPSQKHSKLDDAAHTVLKTRN
FT                   EGQATIKELMERDFRAELEERERAHFKKKLGGAGGTDAVGQLTAGDGDTDAGPRFVPKA
FT                   LDADDSDSDDASGSESDSDDDEDDTQALLAELERIKKDRAEETARRDAEAREAEAMERA
FT                   EELATGNPLLNLGSEESEYDFSVKRRWDDDVVFRNQTRGEPKHAKRFVNDTIRSDFHRR
FT                   FLNKYIK"
FT   CDS_pept        complement(<926130..>926397)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638216"
FT                   /orf_name="MICPUN_74700"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69534.1"
FT                   /db_xref="UniParc:UPI000199C5FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE5"
FT                   /transl_table=1
FT                   /translation="CFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSVKFRQAK
FT                   GSIGHAFTVCASTESQNQMSFYPFVPQEISVLFELILGHLRYLL"
FT   CDS_pept        complement(926790..926945)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638217"
FT                   /orf_name="MICPUN_53133"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69535.1"
FT                   /db_xref="UniParc:UPI000199C5FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE6"
FT                   /transl_table=1
FT                   /translation="MGKHHDWRPRGSVCALVTTPACAVPPEVLEGGVNSVSSTHLSCDG
FT                   MNLSRS"
FT   CDS_pept        927517..928395
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638218"
FT                   /orf_name="MICPUN_101975"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69243.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199C5FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE7"
FT                   /transl_table=1
FT                   /translation="MSYPCAASECTNVGTKKCATCRVVSYCCKECQKKDWKTHKKQCAA
FT                   LAMSPGGATYREVYKDKEGVHVFEDMESGRSFTLGGAGDDSVPAVQCAMQMIRDMHGFT
FT                   GPYTLQRIVNGKPVTPPPPHRMAVGDEVLVATGQESINPPYTDGWKRGVVRSLGDQDKG
FT                   DAFAYKVTLTDGSVVPAHRDDPDFVRRVDDNEEGKAIRFDVGTEVECRIGPSMWTRGVV
FT                   RQRNAELPGWGRGWTDDGEEHPGWQGPKDTMAYIVTPEGKSFDENDPYSTLSVPADKDD
FT                   YIRAWEPRSRG"
FT   CDS_pept        complement(928656..930092)
FT                   /codon_start=1
FT                   /gene_family="HOG000226736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638219"
FT                   /orf_name="MICPUN_108805"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69536.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000199C5FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE8"
FT                   /transl_table=1
FT                   /translation="MSVSKGNQVTVTNDGATILKSIYVDNAAAKVLVDISKAQDDEVGD
FT                   GTTSVVVFAGELLRQAEQLVNQKVHPMTIIQGFREACTVAKEALEAAALDHAADEAAFR
FT                   KDLMNIARTTLSSKILTHDKDHFANLACDAVMRLKGSGNLEMIQLIQKPGGSLKDSFLD
FT                   EGFILNKKFNTGHPKKIENAKILIANTPMDTDKIKIYGARVRVDSMAKVGEIEAAEKAK
FT                   MAAKCEKIAKHGCNLFINRQLIYNYPEQVLSDLGVASIEHADFDGVERLALVTGGEICS
FT                   TFDDPEGNVLGTCDTVEEIMIGEDRLIKFSGVAKGEACTIVLRGASSHVLGEAERSLHD
FT                   ALCVLVSTVKDSRVVYGGGCPEMIMSKAVEELAAKTPGKRSLAMEGFAKALRMIPTIIC
FT                   ENAGLDSSEIVSQLRASHGRGDHKMGVDILTGETGDMEQCGITECFRVKQQVLLSGTEA
FT                   AEMIIRVDDIIKCVPRQRDQ"
FT   CDS_pept        930783..932558
FT                   /codon_start=1
FT                   /gene_family="HOG000265223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638220"
FT                   /orf_name="MICPUN_60853"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /biological_process="DNA recombination"
FT                   /protein_id="ACO69244.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG558717"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniParc:UPI000199C600"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGE9"
FT                   /transl_table=1
FT                   /translation="MFPPGASAAASSRGASQSHGSLAEFIRRCCEDVGRGDDVDTIAAV
FT                   TEVLRVNKYRRPDDLATFSEKEAMEIGVPLRLAIAMRKRLSGAGMAIDDAIAAVPKPEP
FT                   IVSKPPAPKSMFPTLREMAEEAARRKETRVAKEAEAATSTRTTTDSPPARCAPMRVEHH
FT                   GNVTNTRATRRPDKTSMTDYRLRRDEMPASLIDELDALRRFLTVRRLGAVDEPIKEVTA
FT                   MKYEDHLRGLLGWMRSHVKPNFPIEKLTSLRAAFPTPDRRGAQLAFEHIQWLVNERKCS
FT                   ANYELVALRAFIAAAKFVHGGDEDDVGSGDGLDKPYAKLGLVQQLRKISKETGRRAERE
FT                   SPVADARVKWLDWSQYLGVVDALREECAALDKDGRRRSPSAVAWSVQRYLIFGILSCVP
FT                   DRQRTVRELEIGRTLFQERAVKGGATLAGEGESPSSASGKAGEYRWVIRHGPDDYKTGR
FT                   DYGVRPPMVIHPKFYPALEDFVANHRHHLCEPAHGLLFSTRSGAPLRDKDVHRILTSTS
FT                   YRLTGKRVNPHLVRDMIITHLRGTDASERELEALAIYMGHSLAMQKGTYDRRTKEEKVA
FT                   PAIDLLDSVNAKMRA"
FT   CDS_pept        complement(932633..932998)
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638221"
FT                   /gene_name="CAL"
FT                   /orf_name="MICPUN_97782"
FT                   /product="Caltractin/Centrin"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69537.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C601"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF0"
FT                   /transl_table=1
FT                   /translation="MRALGFAVKKDEVDAIMREYDRDDSGSIEFPEFREIMMERMGDRN
FT                   PQDELAKAFKIFDDDGSGVITVRNLRRIAKELGEDVNDEELIAMIDEFDQNGDGVIDEK
FT                   EFLAIMSKGADAGLVED"
FT   CDS_pept        join(934022..934063,934209..934679)
FT                   /codon_start=1
FT                   /gene_family="HOG000100779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638222"
FT                   /orf_name="MICPUN_60855"
FT                   /product="Predicted protein"
FT                   /function="signal transducer activity"
FT                   /biological_process="two-component signal transduction
FT                   system (phosphorelay)"
FT                   /protein_id="ACO69245.1"
FT                   /db_xref="GO:0000160"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniParc:UPI000199C602"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF1"
FT                   /transl_table=1
FT                   /translation="MGKTKKTLEELEDERSALEQEAYDEKTKLLNRSQFQELLELQNEE
FT                   EPEFVAEIVEMYLADAKEMLNELSKLFSEEKVKEAEDGKPNYNTVRAVLHKLKGSSSTF
FT                   GADGVQQKCEELREHCINEDLDKCRTGEGSLEELQSNVDILSEFLAKYTAKIKEIYELS
FT                   QEAKADE"
FT   CDS_pept        join(complement(939265..940008),complement(938164..939009),
FT                   complement(937895..938028),complement(937339..937681),
FT                   complement(936095..936943),complement(934775..935692))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638223"
FT                   /orf_name="MICPUN_84561"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO69538.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199C603"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF2"
FT                   /transl_table=1
FT                   /translation="MMYPLGLLIKGLVEEKENKTQELMSIMGLQTWTLATAHAVTYAVL
FT                   FTLTSLIAAGTLHRKVFPTTDAGVLIVFFLSFMASAVPLGFLIAVFFSRARLASIVGPF
FT                   ALFAMVMPRYVFFQTYENQALEAKRAASVLSPTAFTFAADLLASREGAERGVTWATLYD
FT                   DPLSLGELMGIMVGDAVLYAAMAWYLGKVLPTAHGTPLPWWFVFSAKYWRGPGAGAGLE
FT                   FGEGSRARSGGMAAGCLSAEFARGTPAVSPLSVALYEGQVTGLLGPNGAGKSTTIAMLT
FT                   GLTPPSGGDAIVAGHSLLGSLAECRRCLGVCPQQNVLFPALTCAEHLRIFAVLKGVPSR
FT                   DVDREVAKKLREVGLEQKADARSVTLSGGMKRRLQMAMALIGPSKVVLLDEPTSGLDPR
FT                   SRRDAWKLIRAAAKGRCVVLTTHFLEEADLLCDRVCVISNGKLRCAGSPPFLKNTLGGK
FT                   YALTLTFDDDRESKDRLTTSEHAGVALRLVRRYVGDATLSRARGGEATMELPASAAAAF
FT                   PSLFAALERARRGRVRLRGYGVSMTTLEEIFLRLAEDDRRREEEEEEGPDEDRRVTSGR
FT                   WLKRKDDLREMLRKRWIIARRDRRGFFFQIILPILVNIMVMCVLFLEVNPAGPNRDMTP
FT                   CMFTERTGGHDVPDRTRVPVAVGVNSSAAAEALAAALSSERGWISGPPPSGVHPGAASL
FT                   VRVLERYGNEPLLFLHNTSSHHAVPAAMAATHSAVMRDITGVADAHVTAGSHPLPLTTE
FT                   EEASLRVWMNTLAAFFLLLPFSYLAATYAAFVVKERATRAMLQQLASGCDYRVYWLGAA
FT                   IWEWLNHALVCFVTWIWFFIFDLSSVVGTRDKAFCTLVLLLAYGAAAVPLSFIYSLGFT
FT                   DHAQTIVALSVVNFVTGFVLVNLNYVMRTSEHEGTARTGEGLAHVWRIFPPFLLGEGLI
FT                   AISTSEFAIDRGERNEDESWLDTFSSTGDTPSPFEWELSGRPTRVAVDRLSLRIRRGER
FT                   FGLLGVNGAGKSTTLKVLCGDHPPTAGSVTVCGHDVSASLRRVQGVLGYCPQFDPLLEL
FT                   MTGRETTRMYAALKGVPPRDVDAAASAVLRGVGLAKFADAPCGTYSGGNKRKLSLAVAL
FT                   VGGPRVLLLDEPSSGMCPLGRRMMWDTVERAAEGLTVLLTTHAMDECEALCERVGMMAG
FT                   GRLRCLGSSQHLKGRFGEGYVVDAKVASAADGSGEEGARKAAAVRAALEAAGGGGARIA
FT                   EAHAGRLKIRLADAEVLAGAFHALERCRAEGVLENYAVTQSSLEDVFVRVCK"
FT   CDS_pept        join(942397..942597,942781..>942925)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638224"
FT                   /orf_name="MICPUN_73803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69246.1"
FT                   /db_xref="UniParc:UPI000199C604"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF3"
FT                   /transl_table=1
FT                   /translation="MLPVRRRRPPRAAVHAPAQGEAVPPLRILRAPVARLPARPLLQLL
FT                   QDRTQERELPGGEGRGAGRAGAESQDVRQVRRTGPRRQGVRSRRRRHESARVRVLPVRG
FT                   GRAPREGVPQR"
FT   CDS_pept        join(complement(943691..944636),complement(943423..943646))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638225"
FT                   /orf_name="MICPUN_60858"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69539.1"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="UniParc:UPI000199C605"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF4"
FT                   /transl_table=1
FT                   /translation="MMGVRHVYVLLATIVASTLATAQAQVSGDCGGGKNGNRPSNNCAV
FT                   NRPYSSYGDETYWDNCANPYYCYYNSAPKYGSTGPYGFSGWNPCSNVVGAYSQGQCRDC
FT                   VGSFGSWGSCSSTQCGVYGTRTRKYTQTTTRSGRGAVECPYSHNHVESESCYPGHCPPP
FT                   PPSPSPPPPSPPSPPPAQPDVHLYSQREEKPCDGDEYCCAETTWNKMGKFGFESGCSRT
FT                   VRAERFVVNAEPKSVQHTSQPVVSSNVTGLREDSTYAVEVYAFQSGNETAATANVSFTA
FT                   DGATHQFASCDVSTVASDACAFRRCGTFDLTLAAGSGEGVRLRVCQRRRGEFRVLREDA
FT                   GLRNSLARRPRRRGEARRRRLQARVRAEELGGGRTGVAAIAGGARVEAV"
FT   CDS_pept        join(945272..946151,946440..948568)
FT                   /codon_start=1
FT                   /gene_family="HOG000030627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638226"
FT                   /orf_name="MICPUN_60859"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69247.1"
FT                   /db_xref="HOGENOM:HBG595777"
FT                   /db_xref="UniParc:UPI000199C688"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF5"
FT                   /transl_table=1
FT                   /translation="MALTTEQQTSHLSRLQQEILAWDYYRMGGEDDPGAAAGRTLREVP
FT                   KTFASINEYLDVFEPLVLEECAAQVCRGEEGDARPSNVAAVLSSERVDGFHVVKFVLGE
FT                   EAMREFRDNDLILAAKTDPAPDAETKTTGKGDKDKAVEEKNASAGGKKDKKGDAKEDAD
FT                   GDDERASVYENMYALGFVDGRDSRNVMRVRFHLPEAGGGQGVFKRRAALTDDDFTRFRS
FT                   MRNALATPKKAWYLMHLANMSTIAREWLALHAFPALPFAHTILGGKPAAKAAHSSWELP
FT                   EPLSKAIESAYNADSQLTALKAALEKQPITLIQGPPGTGKTRIILSLLSVILHAVPGVK
FT                   SGQEIDLKRFLETRDERKPLSPAENASVHRRAAPWMRGVLNPRDAPPPPRDAPPVPPPP
FT                   PEKPEVVGETENRRTKVLVCAPSNSALDEIVLRIMQSGLLGPNGSPYSPTLVRVGVNVH
FT                   HSVESVSMEALVRERVGEVGDKVAAAAAAAASSEKKFERALEKDRVKLAILDEAAVVCS
FT                   TLSFSGSGMFARMTRQFDVVVIDEAAQAVEPSTLVPLCYGAKQVFLVGDPRQLPATVLS
FT                   SIATDHNYDQSLFKRFEQCGYPIHLLKTQYRMHPAIREFPSTQFYSGELEDGPKMAAKT
FT                   KRPWHDNMLFRPFVFIDVAGKEYQGGGMSWANDDEATLAVALVATLVKNYAELASGEKI
FT                   GVISPYKAQVKNIRRRLAETLGEERARKVDVNSIDGFQGREKDVCIFSVVRAPAKGRGL
FT                   GFVADERRINVGLTRSKSSLIVLGSAKALKGDDNWGGLVASARDRNLIVKPGGKDYKAF
FT                   VAKHGATYDADDLSGSEDEPEEAIETDEEDAYGAATGVEHGGDGGGGSRAGVKGHVHRP
FT                   DWLVSSHLAVEAAEALRRNAGSPALPGVGADGFAAKGVEDELVSEAPGKVGDDYGGGGG
FT                   DDDGDEDPYAPEPETQTRSAPRSKRTRASATTATEKKTAAGEKKTPEKKGRATAAKEDT
FT                   TSPPAAKRTRSSR"
FT   CDS_pept        949423..>950391
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638227"
FT                   /orf_name="MICPUN_84219"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69248.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C689"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF6"
FT                   /transl_table=1
FT                   /translation="MVDGRVNELELDGLGLTGAVPAEVGRLSALRVLYLNDNQLRNVPA
FT                   EIGQLTSLVTLDLHANQLTSVPAEIGQLTSLVRLDLQVNQLTSVPAEIGQLTSLAGLFL
FT                   SRNQLLSVPAEIGQLTSLAHLYLSRNQLTSVPAEIGQLTSLAHLYISNNQLTSVPAEIG
FT                   QLTSLTELYLNGNKLTSVPAEIGQLTSLEKLDLAGNQLTSLPAEIGQLMSLTELNLHAN
FT                   QLTSVPAEIGQLTSLTELYLNANQLTSVPAEIGQLTSLESLFLGNNQLRNVLAEIGQLT
FT                   SLKWLYLEDNKLTSLPAEIGQLTSLMMLHLNGNQLTSLPAEI"
FT   CDS_pept        951314..951769
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638228"
FT                   /orf_name="MICPUN_60861"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69249.1"
FT                   /db_xref="UniParc:UPI000199C68A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF7"
FT                   /transl_table=1
FT                   /translation="MAIILFSILAVVIVLTSLTTSTYSPSSSSSSSSRHVNDPLGLPHF
FT                   VTHEVRDDPVGSWVHHAWEATEHVVDEVAEEFEEFGEDTARVFEPRETNPRRAGTFGEN
FT                   GRERRGRDGRLEMDDWNVDDEGRAARRREKSGSGARARAEGGTKHHG"
FT   CDS_pept        951898..952902
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638229"
FT                   /orf_name="MICPUN_60862"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69250.1"
FT                   /db_xref="UniParc:UPI000199C68B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF8"
FT                   /transl_table=1
FT                   /translation="MTVPSTPPRPPASPKFQLPPTTVSPGPGGTRLERVLDLVTSHEAT
FT                   IAENELRVLDLTKRVAEAEDAARARRDEDRRARDAADASLRAELAAVKEAVRRVERDVA
FT                   SWSDERDALRAEVRDLADGCRADADAALEETKAGFKAVLQDVVDRVAASLDAVRTDAVA
FT                   TRGNYASADEVAALRERFAAAESAARAKEAHGRETMNAMLDAMEQMKRRTAKLVGFYNE
FT                   QLEAAERRRAAGAGPSTDSFGFSSGRSGDRSDQTGELARLLEENASLREQLARASSSRP
FT                   GHHRAAVEEAALACGSVEEAVRRTGSFDSLDGDGADAKLTRSIRDSIGSVNGC"
FT   CDS_pept        join(complement(953265..>953510),
FT                   complement(<953043..953189))
FT                   /codon_start=1
FT                   /gene_family="HOG000006347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638230"
FT                   /orf_name="MICPUN_73223"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69540.1"
FT                   /db_xref="HOGENOM:HBG595165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C68C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGF9"
FT                   /transl_table=1
FT                   /translation="LGRVLEAAETGDENVLAVALPALSVSVDTTGPDGDTALHLASLYG
FT                   HARCVEMILAAGASVTVRDADGGTPLHDASAGGFEPITPLHMAARGGYPNVVRALLSAG
FT                   ARPDVKSDAGLYPWNYADEGSELEAML"
FT   CDS_pept        join(<954191..954493,954593..>955144)
FT                   /codon_start=1
FT                   /gene_family="HOG000233030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638231"
FT                   /orf_name="MICPUN_71355"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69251.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199C68D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG0"
FT                   /transl_table=1
FT                   /translation="LGEPLGRGAMGVVRVATRKSDGCKFALKTIPKAGPQSLSGKTPTG
FT                   EAMSIWERKVRDEVSLHFALGASLDIVTLHDGFEDEAGVHLLIDLCDGGDLLSGASCWT
FT                   PFSEATAAPMIRGMLRALAACHEHGVVHRDVKPANFLFMRESDGRNRLKLSDFGLAARI
FT                   PAIGATLTEQCGTYAYLSPEMARRRPYDFKIDAWAAGVVAYMLLAGEPPFADWDAIREG
FT                   RSPTKDGLLRNIRRGKPDTPIENLPLSPGAKSLLQNLLHVDPDKRMSCKEAAEHYWVRE
FT                   KGAA"
FT   CDS_pept        956366..957406
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638232"
FT                   /orf_name="MICPUN_60865"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69252.1"
FT                   /db_xref="UniParc:UPI000199C68E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG1"
FT                   /transl_table=1
FT                   /translation="MDDSDSDDDLVASLVGSGMRGGQKAVGDQLARFRRGESRGEILAA
FT                   RRADDMPASSPAPPPARTSNNLSARAAAVGASSPRAKLLWKKVRDNRLADNGERPAEDA
FT                   AAEQSRFWRMNAGASAFLFGVDKDIDGRRKNRAEKVMKRVKQLSKRSKFTRSPEFDEEL
FT                   KQLEPLTSFQAHRLCRDKGLAIRNREGHPIPLAKLKERLLHLEHGRSSADWFHASPFGR
FT                   NKRGYWAPIALGLVQCLLISAFTVGLTYAVYLVGASYHDKYACDRIWNWLNPQCQVADF
FT                   VRTTAKQWVYRWYWQVGTVIAARAGHWADKMSKEASRLALDATDNIAKHLGDGEDGDAI
FT                   PDEEFD"
FT   CDS_pept        join(complement(959305..959508),complement(957489..959156))
FT                   /codon_start=1
FT                   /gene_family="HOG000231291" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638233"
FT                   /orf_name="MICPUN_83902"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO69541.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG380192"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR021911"
FT                   /db_xref="UniParc:UPI000199C68F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG2"
FT                   /transl_table=1
FT                   /translation="MLRAAVERFGAHVAVGAGAAGAAAAAAVPTARCAKDEAKTVAPSF
FT                   DPEALERGAKALREINSSPHAKNVISLSTEQERTKAAEAQAKQAEMQALAAQHATNTER
FT                   VRWEEQRKTDEARAQQQAQIKEYEDQLARKRYNSEHEATRQRNAEMVKMQEDASQRQES
FT                   LRRQTEEQIQQSRRETDRQKAEHERELIRAKSIAEAEGRIAENRANEDVIRRQMLARIE
FT                   AETSKAMQLLQETLSTVGKGFSGLLEDRQRGAAFVGGITALAVGVYGAREGSRMGFRML
FT                   ERYLGQPSLVRETSRNIWGFRPQAAQAATATAAQAGEGASAVAKASPGAGGILGDVVLQ
FT                   RNLESRVKHLAVATANTRKNSAPFRNVMLYGPPGTGKTMAAKRLARYSGLDYALMTGGD
FT                   VAPLGADAVTRIHELFDWASTSRRGLLLFIDEADAFLAKRSGGVAASETAPGVRAALNA
FT                   LLYRTGELSRDVVLVVATNRPEDLDAAVLDRMDESLEFGLPDAEARQRMVRLYFDKLIA
FT                   RGEDAGDDAPAQGLLGAMGIGKGGKRGGGKKGTPIAVSADVDDAALKAVAEQTEGFSGR
FT                   EIAKMMASVQGEVYGSNAPELTLDILRGVVSHKVAEHAARGAGFGKK"
FT   CDS_pept        960074..967885
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638234"
FT                   /orf_name="MICPUN_60867"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69253.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C690"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG3"
FT                   /transl_table=1
FT                   /translation="MIIERSPDEIAAKLALMGDKLGHSLLDIRERAIASLNFKLSNDLL
FT                   TFKDVGSHSGVLRALLDWFGHEDSVPGDERALAMLRRIVEEEPTAAARLQNLGAEAALL
FT                   EVTDGASRQLAAQIESLVEKIATGGADVAPQEPPSSPPGPEPETANADVPESDDAEEAA
FT                   EEPPAEETAEAEDSTEVEDSKEEDSKEDAPAEEEEDAPAEEEEDTADEEEDTADEEEDT
FT                   ADEEEETAVEEEEEDAEAAAGEVDDDDPAFIRLDPALKDMFRKNPRLATAYWNIVRTHG
FT                   LESESSRAAAVAADAAAVAAVGDSRTLETATRGGSLHLRRCRISPRDDARLLELSVRLR
FT                   HADDPCLLMAALTEFTDCALKDLPPQALLQRPRCLWAVISLARAREGPTAAHNAHRATR
FT                   GGSPIAPAAVRAAALAALKDFVVAIKGALGHANDGAHAVRLGPRTTTPADPDDVEDILL
FT                   GGARENSYPPPVPCSDDDDELNDDGVPGRDPLHALPVAHLLAVSVVPLLAEPAVAGDAL
FT                   LVLHETLPLLELTPADRGDDAEALGVVDVEAVATRLGVYATAMERALATASAIASASGE
FT                   DELLPTGECPAFFPALAMTAVMLAAAGADASAIAARRGKIPARLVTRLETAAIDELLAA
FT                   AVPGLRKVTLAALDVLGRPSSKAECAAAEAAERATHAAEVAARDDAAAAASRSPSDAAR
FT                   MTMEALPALDFIAEDESEPLAARLIATLLTATASATAAVPEGAEGADAFEERRRLGDGV
FT                   EDARLATSELLRHVSPAARRGAYAALAAAAEIAMAAEAGGAAAAVSAAARAVMVGPAVT
FT                   GEIVSGGLADPDTRLNAAKCLDAIACGFGGRAGKSESPLASAAARALLPWLPWLECDLD
FT                   DDVVGPAAAAAAAAAVRAAPADAWTPLEPLLRGLFHHSARRRAAAATGLARAMGTDAAT
FT                   HGTSGEEDVDASIDGEEGDAEGAAAAAQAEIERQARVDPFGSVVRHADNKFAVDYGEVR
FT                   ASPLAASVFGGKDVGNLVDVMMTHTLGTSVRVVAGDQLSLCAADPSLHKVVCSREVLAR
FT                   LAALAAAALAPEAERVTNDVGVAALKVLATCVRHSREARVFFSEISRASPAEAAQPYGQ
FT                   SSPVLPLVFHPRAAVREHLAVFCAYVVFGKVADLATTHAGLGVVPDPTAMHVPASIARQ
FT                   LRFPVPIRPMDAGALNKARLAASRASSPLEAEGTDRARVRAMLAQRREVRRLGGAAGVL
FT                   ATVERMMYEAGGDARTVGPVARVADATLRWASPASSAMVSLARLAQARSHDDATAACAS
FT                   LRGVLAFGPPGANAILAATWPKRAARLLHTPPRSPEDARLWASLASTLARAMRVATAPA
FT                   PLDRLAWIAEAVKRAAVPVVRAVAVGGDERFAPGFIASPETFRIRDAKPIVSDPVSHDP
FT                   DSFNPEERGEMSAASSAAAKAACELAARVLDAAVALSSAATYGGFVDSPEAASAASAAA
FT                   ARVAGLVLCETDLCEAVTETLVADARCEYGARVAAVECVASCARACALASASRTSADAE
FT                   SPPDASGAAADLADIVVEPLLTYCCTARIGADPTGPGAPSSARMDARRRIAEEMAGTVG
FT                   SRWGALVDAGVEALDATCEAAPGTAWSRAWASTGATFWLARLARDCRASRRASAWRLLS
FT                   RAASPDARFTCALLATTWPDAPAAGARVALDYTEAPAVRAAACQFVAACLSTTAAADPL
FT                   TLLQQPVPDVVPLLNGGEIWRGLAEVLVACSGEGAKAGGSPHPYATADADGGSPGLEPA
FT                   VTDPAAAAALRRGAAAALLACSRLSPVIVGVALSPRAFSGDANFDSNEIPEIDDEAEDN
FT                   WPPSLAAALRALDPAPWRTCLAAPPPEVLAWANPPAKAAEDAAAAAANVAALVGAIAAA
FT                   NLENLEPAASDLENDRSARAVSTASRLFAAPRIACDTSAVPQMAATLAAAAGALVTRPP
FT                   PRAGGSPSRLDAPRRASVCRAFARSASGLAAVLAAAPDPGVGDAATNAAWQCVAAAPLS
FT                   CALILDLAAAGASGSIHRSVVGSAGAGLTVAATSACELLATLFRSPQASAIVMEAAARQ
FT                   GGMGGPVGARLATSLMRLWHAQAVGGGGGGEEQWKTPGAAAAATPHTAVSAALRNVLAY
FT                   SASAKRAAADAELTATLLRVAARAHRIIAYERRAADAAAELERDLRGYPRTKPVPPPLP
FT                   PAPRPLAMPADAVLGECVSLLKHVLYCSPSATAAAAEDDETMGAFASAATADRDGRSET
FT                   ASATGHAAAAARADAMAHGAMPAMHALWRHAVSDRHLCHELMGLAANLMAGNDDAKRMC
FT                   VEDVDAGDGGKPISFAERMLRLAFRNTSPAATTRLALAPLAALAGQPDARRWLLRSQFL
FT                   PKTMEQFAAAVGKRDAQRQVAAIRALADVAGGGGDDGRREVLRAGGGELMQLILEVLAS
FT                   AGVAGHRINDDEDDDIDVILKLPGLAGPDAPKNSVFQTQLPVAALEALLLLRNLCFHTE
FT                   AKAHVTANPRALDALVAAAGASDPGARAAAADALLALTHNGQRISTLLRKGRRPARLRR
FT                   FAARASKAVAAGTSGRARADVHAAKCLDVLVREVLRIGDAGDDAFGHSPDSTLLDISEA
FT                   DVRGIGREPSDGLAIGPAWVH"
FT   CDS_pept        968094..972206
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638235"
FT                   /orf_name="MICPUN_60868"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO69254.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="UniParc:UPI000199C718"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG4"
FT                   /transl_table=1
FT                   /translation="MIDAKDAAGPMRGPGLLVACKFGCEDAAVREVQRALGELHGTGKK
FT                   ITLSTSAATLEDGNASDRSDDTAAKGEGRSMSIEEHARRIAVAHKGLAWLRYDGISQKH
FT                   SPRDDETVDEGFPGKMANTRADAVEAFAALVGRRDVPAAALKSCQYIFPVSSCVAATEE
FT                   ALEAAVVTECDAAVRDPSSKLSAPSCRVAVAVHTRGDDSRAASANGAPPLARVVARDAA
FT                   LRALMNARSSASLPPATLDLHAPEIVVLITQWRIPTAGDRDGPNEPVCGVSIMAGDLVD
FT                   VRAKNIAPRKPSAHKRPAAATTTTEKKKKPNQWKPGDRSAGISKADKVYDADFSEHRPL
FT                   KAEVPPARTVMSDDEATRLFDAAVDKRVKAGLFRVRGEGVSNDTMSNNLERLRAASAAG
FT                   LALRLVHGTGDGFDGATADLLGPAVLVEQHRRWACVDPLLRAVTKRLGDKTPVYLKRRW
FT                   SKAPGERGGCLVSGVPVSGGGEGVDDALAAEARRAADEAAAKEGKDTHRDGVVVREPGD
FT                   DGLKFGLWLTGEEHVGVFLDSRPARELVRQISNGKRVLNLFSYTGGFGAAASAGGATCS
FT                   HNVDAKTPCLAAAKVNYALNGLPHEGDWRAFQRKDVVRFLAMTARSEVRYDLVVVDPPP
FT                   RFSRNSDWAFEAERHTGQLLAMCVEVCADTGAGVLIGSNALAVSDARFEEMIVEAEELS
FT                   GRSLVAKEWVGAGEDFPPCPYRPAARFALLDVGDAPEGGVARDKGQRTTIAEELGARDE
FT                   GGSGGDDTDGFETANDDEVAGDESPPGESPPPPQPPEADFACLMCAHPFPSRNKLFRHY
FT                   NDATEACGAWCASHGGVAAAAELVNAGKLERPTFDPPDFAEKSGKVAKQSGAERRGGKQ
FT                   RRRGNAATEDANRREASDAELWVGGLHGEHAYPRALKRLVHAAIPGSSGIDQPIVRLVV
FT                   RKGWRERGTGRWIGYGFVRFRDGEEANAALPHIDGASPAEGVSLVANFAATPKPLPGVG
FT                   QNLPGVGQNRESGREPLSRVKSDSAFESSADGSAYGSACGDSDADAGADADADDADADA
FT                   DDDGPVAPGRDPSHLAVARAWPKRTLAARARAAGLPSVDAYLGAVADGSNHPRRAELTA
FT                   RALRFSRGAPVPEPLLANLRVALETARWPPVSHRPKVDSERYLVLRREVLGANDPRSDV
FT                   VDPYAELKSAANAVLDWAEPGFEYDHLAITRNFVGSPHVDGEDKSHQYAVALGDYGQGG
FT                   ELCVESEDGATRWVVDTRDSIARVDGRCAHWVRGWRDFGANARYSVIYYVTRPRCATAL
FT                   SFAVDEGWSPGDGAIAGAGSAAPASDGSIDVAALSLCTFRSVEAAVGSAVRVVGALFPW
FT                   PRAMETAWEAFASVLPSEGRWWLIRLS"
FT   CDS_pept        972489..973787
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638236"
FT                   /orf_name="MICPUN_60869"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69255.1"
FT                   /db_xref="UniParc:UPI000199C719"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG5"
FT                   /transl_table=1
FT                   /translation="MHSTALASLAGVRPVAVLPARGIRAPRASDARGGRTRRVVAMIST
FT                   RRTAVCVPSARRRRDAPSRPLAASGADGADVDDDVDALATRLESLKAKSRSMLDEASQL
FT                   EAGIDASENDEVISESTRFKRAPKSSPGLPTGKMGVSTADAVADQATGSGWSKSPQSQS
FT                   QSQPPQPPTTNALLAGVIAIGGLAAAGAASAAGVAAGSEPVLAVAGAAAGFALLKAGQF
FT                   IGSNLKEKAVPSLGQQEGKAKAKEGAASKAGGGGYVAPKQAAAATKIDEKKAAARAAAA
FT                   SKDADAILAASSFVSSSDLDKERLRRALRTIASTQKSTVTAAAIGAAKVPAGYVNNEQE
FT                   RKIYEIKQRSKQLLPLNEFMAKYGPSDEAYGKARKEAKELLAPGNVTWKPRDTWLKVIL
FT                   WDCICYPLQVPFLFLAWLLGFSWGENPPPPKSA"
FT   CDS_pept        join(<974401..974466,974703..>976079)
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638237"
FT                   /orf_name="MICPUN_66672"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69256.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C71A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG6"
FT                   /transl_table=1
FT                   /translation="VPPAVFANWKPSERVQALSVNQCEEIRRRMDVTVEVPPGTDEAPP
FT                   PIESFEDMNLDTKIMMDIKYKEFDKPTPIQAQAIPVICSGRDVLGCAETGSGKTAAFSI
FT                   PMIQHCLQQPEIKRGDGPFAIVMAPTRELAQQIEKEAKIFSRSSKGFKTTIVVGGTNMS
FT                   EQRMDLKNGVEVCVATPGRLIDHLHQGNTNLARVSLVILDEADRMLDMGFEPQIREVMM
FT                   NLPKPHQTLLFSATMPVEVEALAADYLNKPVKVKVGAVSVPTSNVAQHLEKLVDSQKVD
FT                   RLCELLLEEKAEAEKFGGQLPMTVVFVERKARADEIMTLLNAEGVAAAAFHGGRSQQER
FT                   EAALADFTTGRCAVLVATDVAARGLDVKGVQHVVNLDLPRMFEDYVHRVGRTGRAGMTG
FT                   RATSFYTDRDSFLVAQIKRALQELENGNAFAFATGKEARAKEREAAKAWREGRAGEPEQ
FT                   AAVGGVDIIVDDKFKHMKLSASS"
FT   CDS_pept        976555..976824
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638238"
FT                   /orf_name="MICPUN_60871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69257.1"
FT                   /db_xref="UniParc:UPI000199C71B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG7"
FT                   /transl_table=1
FT                   /translation="MATKSAGSRLADVVFKAVATGLFATTVVTGGWFAATAASASHHYD
FT                   RLAREADERKARAEAAAREEEERRARRWGWLGGGGGKQSSTESK"
FT   CDS_pept        complement(977008..978429)
FT                   /codon_start=1
FT                   /gene_family="HOG000244862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638239"
FT                   /orf_name="MICPUN_84143"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69542.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG298928"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="UniParc:UPI000199C71C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG8"
FT                   /transl_table=1
FT                   /translation="MASAVPHRVGDTFRVKGLRLTDHFFDVPLDHGFRAPGVGDVPADN
FT                   SRTIEIFAREVVAADKRDDDALASMPWLVFLQGGPGFECARLTETGGWIAHAVASHRVL
FT                   LLDQRGTGRSSRVSASALAKIDGGVDARASYLTFFRADSIVADAECVRKTLLGPGDDAK
FT                   WALLGQSFGGFCIARYLSVAAESVSEAFLTGGLPPLVHEANAAEATYRALIERVRTQNA
FT                   KFYRRFPNDVQRVRDVVAFVRNQPGGRVATPSGGELTVRGIQALGFSWLGTSGGMESLH
FT                   YLFEKAWEVPHEELSYAFLKSCEDVHSFDTNPLYACLHESIYCNGGGPSAWAAERVFNE
FT                   HRKMFSADNALGSSDPHKPVLFTGEMVFPFMFDEIAALKPFKNVAEALAAKTDWPVLYD
FT                   VDALARCDAPVACASYVEDMFVDFDLATETASRIGPNGARVWSTSEYMHSGVREDGARI
FT                   LKKLMEMARDEEPLR"
FT   CDS_pept        join(979006..979050,979298..980728)
FT                   /codon_start=1
FT                   /gene_family="HOG000174713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638240"
FT                   /orf_name="MICPUN_60873"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="squalene monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69258.1"
FT                   /db_xref="GO:0004506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316608"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="UniParc:UPI000199C71D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGG9"
FT                   /transl_table=1
FT                   /translation="MGRGGEAQASGSPPEWDVIVVGAGVAGASLAYALGNEGRNVLLLE
FT                   RDLSEPVRIVGELLQPGGYLKLKELGLEHCVDNIDAQKVYGYAMYKDGGEALVGYPLEG
FT                   RGDDVAGRSFHNGRFVMRLREAALGCDKVTVRQATVKKLLNTNGQEWVDGEGVPIGGVA
FT                   ATENETEQKEYFAPLTVVCDGYFSSFRKKLTPAAAPVSPSTFVGIIIDGDPNELLPRPG
FT                   HGHVVLGDPSPVLFYPISSKEVRCLVDIPAHVKMPSVASGAMAEYVLTKIVPQVPEKLR
FT                   DPLVKAVEGGAFKSMMNKTMPAQPSRTPGAVLLGDAFNMRHPLTGGGMTVAFSDVVTMK
FT                   SMLSPLPSFADAAAVGERVDAFYAHRTRPALTINTLANALYKVFCSSADSSMEEMRRAC
FT                   FEYLRLGGSMSAGPIALLGGLETNPLTLVAHFFSVALFGVGRLMVPLPTPARIWKGVNL
FT                   LKGAVKIIVPIVSGEGLVRMFVPSKYREKARII"
FT   CDS_pept        join(complement(981416..981496),complement(980820..981276),
FT                   complement(980780..980784))
FT                   /codon_start=1
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638241"
FT                   /orf_name="MICPUN_60874"
FT                   /product="Predicted protein"
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="ACO69543.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG381378"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016721"
FT                   /db_xref="UniParc:UPI000199C71E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH0"
FT                   /transl_table=1
FT                   /translation="MAQRPTAPRGRNPEQTGQAAWMATEKVNAELFTLTYGAIVRQVLH
FT                   DYEDCVEDVNKKLDSMGFDIGCRLVEDFLAKTSTTRCGDFKETAEVVAKVGLRLFLGIG
FT                   TRVGEWNPEGTECVITLDTNPLADFVELPEKYRDLSFSQMLCGVIRGALEMVSVRVTCE
FT                   WARDALRGGDGYAIRLL"
FT   CDS_pept        981723..984014
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638242"
FT                   /orf_name="MICPUN_60875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69259.1"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI000199C71F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH1"
FT                   /transl_table=1
FT                   /translation="MTQSGAIASRAAAVGANAGRDRSDRAGRRAAHTTRALRPDRADPL
FT                   RSRHAPGGGGKCARRDDAATLGAFPPVAPLGLRARGGSAPTPARRPTTSDRRGDTVVVL
FT                   FGVDPAPANQSSGLDADVGFGRLATEEEADASAAERLKRLQTLVLRKRLYFEVLAAAET
FT                   TERDPPERSKELLSKLESPEELGELIDDYENRCDRIADIDAQVNRLRSLCVALIEENDE
FT                   GLALAFEGSKVDDVVTSIGAKVDAAVTDLSKHAAAILSSLPYKSLDDAKAAVGDAKARL
FT                   DAALEEEGGNTALRPVVKTLDRAATKVKGARGLVKTGVSKLREKPLSAAASAADYTKGV
FT                   WQRLNGKMDGSARGLDPALAGLPECSSKADERSLAVLKLSLEVQDRDKQLADASKARDQ
FT                   VVKNSSRDALSRVRLARDIRESDDKVSDVRRIFAVRTLQVEMERILSQLEEEAADAPSF
FT                   AFRADELELLVAEFGVMDASLRKLVSAVDRGASELISDEDLTELATDIPDLKARLGIAD
FT                   DGLASMSLELMSERAKNTVDESWGKLTEGAEFMARGVKMLGGDIVSSGRFFGRAVMGST
FT                   LRPREVQTIRRTTLDIFTFVPFIIILIIPLTPVGHVLIFSFIQRYFPALFPSQFSSRRQ
FT                   ELMKKYEELSLQLKQAEQNQELKQESEAITRAQAAVESLMMGGASEAELMAAMGGTGSR
FT                   GASFFGLKGLERMPDSKKEAAKAAAIKDVAVGDADEDPTIRELREAATRAAESLDSHDD
FT                   DDEKGGGFAH"
FT   CDS_pept        complement(984092..985288)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638243"
FT                   /orf_name="MICPUN_60876"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69544.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199C720"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH2"
FT                   /transl_table=1
FT                   /translation="MTSTCVVRASAPGRDHPRVTTPRPRKVPGPKPLSALLSLLSASKD
FT                   DSQKAEALDPATLAQVRIVASSPKLRTVNGDPVRAAGLGGNRNVRQPKALAPTARAHGV
FT                   NYFFAYSMRDDQIGDYLDGLAELCSDPKMRKKIFVAVGTEDFTDREALTAHVERCLSRL
FT                   GTSYIDAFFLEYVPRGAEAEAVETIRWMRNEGGLVVSEGGRAGVDGVIRYVGASTHDRC
FT                   AGNRLLRSQRNGRGFIGEEPCEEEEEGEEEERDDGDEKTATDLDFEPCELDFLMARYNM
FT                   AHVKSERTLFPLATARDVPVVAFTTTRWNSLQKEPAPEGWTEGAPPTTAECMRWALAAD
FT                   DAVEVVLNSAPTTETLGAWCEDWAARGDKVAMGADEVAKWRRYGELVYEEDAPFETYT"
FT   CDS_pept        join(complement(986301..986438),complement(985604..986200))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638244"
FT                   /orf_name="MICPUN_60877"
FT                   /product="Predicted protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO69545.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG592869"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000199C721"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH3"
FT                   /transl_table=1
FT                   /translation="MGTSSSKSKRAKAAKRAQDQVTEVDRQVLGLKTQKRKLNAYAKRV
FT                   EEAIARETSKARELAKSPATKVKALNALRLRKVQEQLLDRVEGWILQVDELLLGIESAQ
FT                   ATAVVLEKLKMGNEALRNAQRGYSLRDVESVLADMDDAREHEEAVRAMIEGSLSAEDDE
FT                   VCEAELAALEALEALEATEETETEPSEATTTRVAGTSGAVPTMPDVPEKAPNLPDAPLG
FT                   LGTAGAVEEEEEEEERREALAA"
FT   CDS_pept        join(986777..986813,986907..987631)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638245"
FT                   /orf_name="MICPUN_60878"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69260.1"
FT                   /db_xref="InterPro:IPR012458"
FT                   /db_xref="UniParc:UPI000199C722"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH4"
FT                   /transl_table=1
FT                   /translation="MAANRVFAYLGAGFTGSFLYDNLDDVTRVGGGFLRALARQQHDAP
FT                   PAAVADPSIRELQLQIAALASQLSSHAPLSQHRAPLAPTNSSHGAVATVTATAGVACVY
FT                   LAASGVALSDLAWVTRGAFRRASKALATGVKDLSTALQRVREETKLRLDRLAARLDDVD
FT                   ECVKRTETIAEKLGEDIAQLHAKVDRVHAAQGVTNAGVRLLCAAATAADPDANEIDRRR
FT                   GSARKLASGSERDLDEDLVAIETTLRALAAP"
FT   CDS_pept        join(complement(990176..990192),complement(989979..990032),
FT                   complement(987761..989810))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638246"
FT                   /orf_name="MICPUN_60879"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69546.1"
FT                   /db_xref="UniParc:UPI000199C723"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH5"
FT                   /transl_table=1
FT                   /translation="MAIKDRPGQPKRDMKPHPLLTKLMRERLREHSAHLEQQHAEFGPE
FT                   TSDASLGAADRTVDSDAVSTPGSHFARDKSPSQRRVSAVLKVEKDKSGATTTAESSAPG
FT                   SSRSRSPGSGGRPNVPRTDRPTSSFASSGRKSPSHRSAKLGSAKKSGSIPAFLSFSFGW
FT                   GGKNKEDSPEMPKKRAPKLSEKEADALYTRLYNEKKLTPERDPEETFKPKISKKSLAIG
FT                   ARVHARESGRMDRVEYLVKKGTTELRDRKHENGLHMDPDRSAGDVRTVPPNEWFMDSFG
FT                   RLSKTGDRYVRSIRKAEDDKIAEGCTFKPTLSKATQELVKNTPYLQHTNFYDRGLEWAE
FT                   RKKRAIAAQAKAREDEEERECTFRPRTAGDAPAFVRRIAAKKRAEKMALAGVDADNEVD
FT                   LLDGVGGAIASATSRSKGWLPPTQRPKKWEETLGVGYDPNEPTGAVTGRAMMLGGATPG
FT                   GAWETPGGDGGAVVEVGAEVRVVNGIVLPHAPADHPGARSTRKSGHVPLHSAASHYRRR
FT                   DEGVNEVDKLEDEKLQSPDIVDDVGGVSPDYFEKLHLERVQKARIQEQEKIARLYRHDG
FT                   KNWENRVTKPKPFSFNKRGEGDRFKALRRPVSARLPGSSLTASVSSLKNAVYRDADEDP
FT                   PGFEAYYDAVGARRGPPGWSKGPTGTGTGAATSGDEDESQEEFFDAPAGMEGGRGRMRE
FT                   RHNDAGWGSYDY"
FT   CDS_pept        992096..992803
FT                   /codon_start=1
FT                   /gene_family="HOG000264594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638247"
FT                   /orf_name="MICPUN_108806"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69261.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG730259"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C724"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH6"
FT                   /transl_table=1
FT                   /translation="MEPEDGTWRERRAQVLVDLKQFQAAIEDFDAAEGLYDKDYKSLGL
FT                   LSNRALAREGLSDWSGAVRDYTECINLSREIGGVPPYVLNSRGNALSSLGRYDEALGDY
FT                   EEAAKTFQVMHNLSGAIYARSNAALTLAELGRDEEAIHEMEAVARRAAGSIDMRAALAA
FT                   MHWSRGEEDEAERDWNWACEKINSGVLTEGGPALDGCALYRDSDWLGRIRRWPPSMVSK
FT                   MDDFIRLRKPSNA"
FT   CDS_pept        complement(992870..995116)
FT                   /codon_start=1
FT                   /gene_family="HOG000265240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638248"
FT                   /orf_name="MICPUN_101993"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69547.1"
FT                   /db_xref="HOGENOM:HBG562428"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniParc:UPI000199C7AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH7"
FT                   /transl_table=1
FT                   /translation="MAKAKEMFDSDSDSGSDSEGSDASDSGASSGSDSADANVKGAKDS
FT                   FTINEKFAARFEHNKRREEKQRLEEKLKREYIIGDGGSDDDSGTSSSESDEGEIPRKME
FT                   EQFARALAKIKKRDPSIYQPDAKLFSDDDSESESGSGDEKKGKKKKPKKQTLRQVVANQ
FT                   LLEGGARAFEDEDADDAEPKDDGKKSYVEEQADLKRAFKDAAEGSDGDDESSDSDSDSA
FT                   GGLRVKKKAGDAESDSDSEGMGDEAKKAYGEYFDAEEAEDGASKEEAFLRDFIMNEKWK
FT                   EDETKLNIIGGGHGSSSEEEVEEAEKFEAKYNFRFEEPDGANIVSHARRIEGTVRREDT
FT                   SRRDKRRERKERKLAEKERLKAEVRRLKNLKREEIQRKMAQIASVGGLAGAEAVAAANL
FT                   NKEFDPEEHDRLMAQMYNEEYYEAGPDEDEEELEKPVFGDLDEEVAALVGKGGVDGAGS
FT                   AAVGNERLAKLRDALTATGSGRVDDGGDDIDDEDDDAEDEEDDFDGSDGSDEEAGSDGD
FT                   EEAPNAGNKFSKRAAKRWKKELMAKMEEYYKLDAEDFIDDMPCRFKYKQVAPSMYGLNT
FT                   KEILAMTDKQLTQIMPLKKLAPYRHDSDMQTDAKVKARAQRMAREFLAEAEKSQKERKK
FT                   NKGKKKKKAAGADDDGSESESEDEDAVAAAAAEERKASYGAKAWGKHNMDNKPGRKRKA
FT                   AEEAENGNGHHAEEKIAAAADDAPAAGQGKNAKKNAKKRAKKKEAEAAKAAGMI"
FT   CDS_pept        995365..995952
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638249"
FT                   /orf_name="MICPUN_60882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69262.1"
FT                   /db_xref="UniParc:UPI000199C7AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH8"
FT                   /transl_table=1
FT                   /translation="MPAFSKGTRSKGVHRQFNSAAQAGNVQKSKKARKDAYLTKEAFMK
FT                   EALARHMAVAEAKVRAALNPDDAAAVATAGDATRSAETAAGAPAAPVATAKPAAKTTPG
FT                   GGKLRSKIGAEYMQGALRWEGKRKKGGGEAEAIGHLMKPLKGDEEEYGAGKGGSTVDTE
FT                   TKLPAYARGKMTIQKKKKKNKRKNARAARGAE"
FT   CDS_pept        join(complement(996865..>996961),
FT                   complement(<996065..996747))
FT                   /codon_start=1
FT                   /gene_family="HOG000265026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638250"
FT                   /orf_name="MICPUN_71908"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69548.1"
FT                   /db_xref="HOGENOM:HBG610041"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C7AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGH9"
FT                   /transl_table=1
FT                   /translation="NEAARRAAWGKTGVVGLREAGLEQVPSDVWDLGSSVRVLDLHRNR
FT                   IASLPAPNVAALVNVTKLRLSGNDVQTLGDFFHSLATLPALTTLALEDNAIAVFPTPAP
FT                   GSFPRLEELTLDGNVLTSLPDAFGEGASMPSLRRLGVSGNALTSLPPSLGRCAQLDAID
FT                   ARRNAIVAVPESLAAASMLRSLLLDGNRVGVGGVPTSVLVGCTQLCELSLRDNAASMEE
FT                   LREIDGWDAYETRRVARAGKVLESRVMLGERAFDEGGD"
FT   CDS_pept        complement(997514..998449)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638251"
FT                   /orf_name="MICPUN_60884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69549.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199C7AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI0"
FT                   /transl_table=1
FT                   /translation="MTGEDDADPWDAVTTDRVEGKGEALRATRDLPKGARLLRVAPLFA
FT                   VPYAAELTRLCGGCFQPRGAVCASCGSARLCSRCGAGAAGTLHGLECHALARLRDGEEG
FT                   LTLAHSDLRLLLRALAVRSMRRAVDAGGDPAAIAAAEDGDVIVDGYDALEGLMSGVDGG
FT                   DDGELPHDAVATIAEVAKQARFLLAASCRCSMDECVRTLGRLQLNGFEMTASEPEEGAD
FT                   EAEGGGHRPVGVGVFPSASYTNHSCAPNCAQRFDGHGCIVVETARDVRGGEELTIPYVD
FT                   VRLGRRERRERLRKNFAFDCACERCAAEAD"
FT   CDS_pept        join(complement(1000581..1001011),
FT                   complement(1000273..1000532),complement(999521..1000176),
FT                   complement(998627..999319))
FT                   /codon_start=1
FT                   /gene_family="HOG000237853" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638252"
FT                   /orf_name="MICPUN_84046"
FT                   /product="Predicted protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="ACO69550.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG562431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000199C7AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI1"
FT                   /transl_table=1
FT                   /translation="MKDAASVAPEEDPTVDGAEEAEPTPTPTPTPTPASERTRTGNVED
FT                   LLSRTRGGPPLFFSPSAGDLTLAPPDVSKPLMLYVPGLDGTGFAASTQFDRLERSFDLK
FT                   AMHVPPTDRSDFETLVETIATFLEEETARREAAGEKPRPADGSVYLLGESMGGLLSLGV
FT                   ALRRPDLVDRLVLVNPASSFDRSPWPSVGPLLPSLPEEIYGGVPYALAPVLFEPAALIT
FT                   GGLDAVARAVIGDSIAALVDALGSQFPTLGALTAVIPRDTLAHRLSVLAAGCEVVNAPG
FT                   ALRSIDVPALCVASSEDLLIPSGDEGPRLRREMRRCAVEVLEGASHAALQKDECDLLEV
FT                   MARNGFKPRAAQDPPPLSNDEGFMPPSAAELERAFESLEPLRRITSPVFFSTKANGQIV
FT                   QGIDAVPLGTKGAPVLLVGNHQTLAPDLGFLVQEFIRERGTLVRGLAHPVGGAPGGAPG
FT                   GVGMFTTFGAVPVSGMNFYRLLDAGETVLLFPGGVREAFKRRNEEYKLFWPSKPEFVRM
FT                   AVRHGAVIVPFAAVGAEDGVDIVADADDIARLPFGLGEAAIERSRAVPSARAVDTRVTD
FT                   DGVGEETFVQPLVVPKTPRRYYFKFGAPVYTAGLRETGFADDDEAVQAMYDGVKADVEE
FT                   GIDWLLRRRRDDPFGDTAYRVLYEAASGKPAGTFYADENVETRA"
FT   CDS_pept        join(1001615..1003517,1004040..1004987,1005140..1005669,
FT                   1005991..1006659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638253"
FT                   /orf_name="MICPUN_101995"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69263.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199C7AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI2"
FT                   /transl_table=1
FT                   /translation="MSNPSVPGLLSFFFLFLAFLSSPAVAHPNFPGGCSALTGHGVGSY
FT                   GNNPGYWKLELDGGNTASLNDRVVVKLYDNSDGGYPFKGFILKTSAGTLTAKSSHAAAV
FT                   SACTGAIGHTESSGKTVAEAYLDLPSSEGTVTVTAEVVYSKTWVSALTLDIEVVKAWTQ
FT                   VGNDIDGTSQNDQLGNSVSMNTDGTRMAVGARGSNTYGTTGGGYLRVYQYDQTKSPAWQ
FT                   QMGPDIPGGAIDYEFRGEIVSMSGDGTKVVSIGGAFSAAAVKVHEWSGASQEWTAMPGF
FT                   PPAEQNGYMYAVAMSSDGMRVALVKNDVNGISGIGLFVYELGSGGTWSHVNTYPGLSSS
FT                   NAGYAVALSANGIRVVVGIPEHGVVQVYDLKSPANVWEQVGETMSGGSRFGTSVAISAD
FT                   GTRLVAGHPGSISPSYESTSSTEPYARAYTLNSGSWVQLGSDVKMGQTSTSSLIFPYFF
FT                   GSSVDMSDDGSLIAIRAVAMSAYGASDGMASTHLYSLNSATNDWEKTGTSIKAEEANDA
FT                   MLGLYFNPRQLSLAGNGNYVAIGAPGNDGAAPGAAGHVRVYKNPSLAQGSPAPAAPAPP
FT                   SSNSSSSSCSSSRATGGNVTTFGEYTIHTFTSSGTFTVTDSSLTEVEVLVVGGGGGGGG
FT                   TPNTGGGGGGGAPNFSEFPGSNGGSGIVIVRYKSATCSDQSCATDYYHDGASCVACPTG
FT                   SNRLPDTANQCLCPKDYYRSHTQTCAACPQGTTRPAGDTVPGGDATACSAEPSSSPSPS
FT                   SSSSSPNSAQDKKAAAEKTRDSILADITDARLKAKAKLLADAAIAGVKVQRLTAKLPAA
FT                   DEDAACSTAFTKAEMSASDGACVAKAASSGKRRLSATTYDVEIMFSSAVVSDDALTKAA
FT                   DALKANGVEGVTSKTSVDPIAELKVIPGIDTSKLQTFDKEATEAAAAAPSVSTPAPPPP
FT                   PPPPSPPPPSLVQDDDDAATGGAMGKPKFYGVARGRAPGVYATWDEARAQVDGIKGAVH
FT                   KSFSTREEAARWVSARNPDISGTMMTGEARPSAGVPDRASARSPPTSPGKPRAPRSASS
FT                   MGGARALSTSARDGGDPIAAAEGANGKDDEARENDAASAPPPTPPLADGSYTLYFDGAS
FT                   RGNPGPAGAGALIRRDADSRIGAGVNVAPGADDGAASGAGFGGGSGFGSGGGTGGGLAK
FT                   GTSRAQSMRPTDPWWGAGKVRGVHVAAGHKRERGGGVRVRAAPAPVVVDLTAPSDDEEG
FT                   AGAGARPTATGSAFGGPAFASLTASSFAYPARCGGGGSRSWRWPSPPAIAAGAVSEARG
FT                   WIGSASRLRRSVAVAVPGPTHAPSHNVVAGASRASSSSAAAAAAAAHRWLPILRGSVRW
FT                   MSRLVA"
FT   CDS_pept        complement(1006759..1007430)
FT                   /codon_start=1
FT                   /gene_family="HOG000240215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638254"
FT                   /orf_name="MICPUN_101996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69551.1"
FT                   /db_xref="HOGENOM:HBG605013"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniParc:UPI000199C7B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI3"
FT                   /transl_table=1
FT                   /translation="MATKRDATEALRANALWASDSPDDWRAALDAYAQRRDALNHEKLT
FT                   RLDPWFFDRLTVDVRARKPPCMTAEELVNMVDWKMSRGKVRPNLLNYAKAHSEATVKDA
FT                   TRDAIARLRSASRTEDIPKALEPVVKLKGVGPATASAVLACADDSVPFMCDDLIAVALG
FT                   NLPSSVRYSESSFVELCDVARRKGRKVGLTASEVERAIFSAACLDKKPKAATAGANKRK
FT                   R"
FT   CDS_pept        1007559..1008032
FT                   /codon_start=1
FT                   /gene_family="HOG000100780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638255"
FT                   /orf_name="MICPUN_60889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69264.1"
FT                   /db_xref="HOGENOM:HBG562433"
FT                   /db_xref="UniParc:UPI000199C7B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI4"
FT                   /transl_table=1
FT                   /translation="MEIERREDADADDGDGEPLVATVDATEGIPTRRARDLARRLWYLG
FT                   WFGLPLAWVYCAWMFWPHIAPDPPDASDVGLTAGVGDDDADDDGGGGGGAYPSERTRRD
FT                   PVVAKYAELSMRGAKIAGSVVVAWAATFLLGGERVVGETLWNRWSITALPPLA"
FT   CDS_pept        1009183..>1009476
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638256"
FT                   /orf_name="MICPUN_84425"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69265.1"
FT                   /db_xref="InterPro:IPR022035"
FT                   /db_xref="UniParc:UPI000199C7B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI5"
FT                   /transl_table=1
FT                   /translation="MQASIPPSMHDALRAHFGVSLELCASPLNARYRRFCSAYLDVDEV
FT                   FGSFGDCLKFEPDAGSFEVNPPFDPVFMGAVCGHMERLLANASGAMSFAVIVP"
FT   CDS_pept        complement(1010342..1010656)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638257"
FT                   /orf_name="MICPUN_108807"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69552.1"
FT                   /db_xref="UniParc:UPI000199C7B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI6"
FT                   /transl_table=1
FT                   /translation="MSKADLVMYLDAASEHCLVNEHAQAAIAKLPTFELNKVYTKVPAK
FT                   VRGAVILVYSPTMSSTGWMKAGDNTDILNHLNFQTQPNAGKMSLDDAAVAVADQHRRRL
FT                   "
FT   CDS_pept        1011266..1013608
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638258"
FT                   /orf_name="MICPUN_60892"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69266.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR005160"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI000199C7B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI7"
FT                   /transl_table=1
FT                   /translation="MASSWRNIQDEDDDEEEEFRPEVRPTSTITSNPRGGSENPRAPPD
FT                   PDPNDARPRGGVPTFLPPSSDDRGLTERPPPAPQPPQSDRESIVFLIDASPAMFLPAPA
FT                   SIAASGDNRVATHTTAGGSSRSFVDVAVDCARSVLRSRIVSTPNDRQGVAFFATTNARG
FT                   TADDAGAGAGGGARENVWVEQRMNVPSARRIQDLADLVGADGNRRLREKIGVEGGEENT
FT                   DGGGDGNRTRDGVASYYDALLRAHHVAREMLNDHAPGAKVRKRLLLFTNRDAPLAGGTG
FT                   EDGRELISAWREFRDVHRIDVTLYSLPYTAGGGDGYSDFDPAVFYENLTARDDDDDDEG
FT                   RGANPDDRNPEPSGRELVPYAGGHELVACSADRIDGLSATFQKKSRKRRRVRTASLRFG
FT                   SDENDAIAVALFAPAAEAKKPKAVNVHAKDLTELHAETRHIASADGAYVSRENLTRRFV
FT                   DLGDSAGRAILTPADVADARRACDREGIHLLGFRPRGAIGRWARTSKPARLMVPEEESR
FT                   QAGSTAAFTALCEAMVAKDRVAIAAYARTDDRFAGVRCVALVPCVEAAEAADDDDDDDD
FT                   DANDLKIIGLHVVDLPYLDDVRHPELAHATGGVVAGPDAIAAAEAAIEANRVDHYSPLD
FT                   VPNPSLSRHYRALEIQALDRAWTESDELEAGDVTKPPDAAELEKLGIKEKMIAFKAAVY
FT                   GTNHDAEALEDAAAGPGVKRSGAGAGKLGSGLGQTLADIDFRALAAANDLERVTVAKLK
FT                   EFCAANGLAVGGAKAALCERIKDHLLG"
FT   CDS_pept        complement(1013790..1015709)
FT                   /codon_start=1
FT                   /gene_family="HOG000265254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638259"
FT                   /orf_name="MICPUN_101999"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO69553.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG738627"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI000199C7B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI8"
FT                   /transl_table=1
FT                   /translation="MAAVVDFLERCDDPHAALSQMLDELDAKALTTSIVDLRCAEEVIH
FT                   AVDKHNGTGAFAAPDGQGTAALLDDEDGITIVDAFDMPRYCYDTQRKVFHENAGKVKTI
FT                   NASAESKIELYRERFLLLQQRVARHRMFVKPAFSASGAAAQRTYCELTPLTGLLGHSVG
FT                   TKYVMGCLSQLEDDRFFLEDLTGQIQVDVSHAATSSGLYTENCIVVAEGEVRKSDGVLE
FT                   VRALGFPPAESREDTRNATNFLDFVGAGRLRPKDIERMVEEEAASTSDMFVVLSDVWLD
FT                   RESTFARLRTVFEGFDSLDAIPSMFVLMGDFSSQPFGPTRFGFGDYAKGFDKLAELVRE
FT                   FPRLRQEARWVIVPGPGDPGVSSALPRPPLMPSLTESLREALPRATFASNPARVRYRSQ
FT                   DLVFMREDLQSRMRRNCILPPTEIEDAPAEKAARARARAKALARQARLERNEARAERRA
FT                   AARAKKLRGGKGGGKGGVVGGGGAGSGDENAEPNGATAEDLFDAVMEEADGGADVDADV
FT                   DADGDDGEEIVSDDELSEEEEEEDEEASEWENRPLFRHLAATLVQQAHLAPLPIAQLPV
FT                   YWEHDHALRLYPAPHCVVLGDRTEQQALAKFEDTELVNPGCFADDGSFAVYRPATREVE
FT                   FSAV"
FT   CDS_pept        1015948..1018968
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638260"
FT                   /orf_name="MICPUN_60894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69267.1"
FT                   /db_xref="UniParc:UPI000199C848"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGI9"
FT                   /transl_table=1
FT                   /translation="MRRAVCAARAKESGSREFELGWRAAWSSGQAVQTTSAFRPFVWDV
FT                   ATQWAMAPKQRSKVYASAPAAGRPVFDEPERIPGIPMKAPVPKFPKKAPSSARRAPTAE
FT                   ERRKTAEDAEKRARAELDAEVAARLAEADAMKVALADAARSIRAVLAKGLAPREPGQAK
FT                   PGGRIIRESSKENRGANVVGTEETPEERNAPLLAKFRRAQADRAEQDKVIAAMRGLLRR
FT                   AGATPEMIDRAVDRELFPGVENPSDESVVAPGSSRELLMREVRRLRAREKAASGVVTAK
FT                   TGGPRAPGGGGSFEARSRLAAVAAALEDVANGRAPAASRPSEHPGTLGTIGTVGTLGTV
FT                   GTVTAPPPIALASPRMPPPPPIAIPPPSPSPSVLSDIDGAAAMDALERRLGRQLEHQAR
FT                   MIEATTRQLEAQHREDTARLEREAKARAEEVKRARRESEQLVAETAERVVDVARRSLPQ
FT                   TPVPTPRGRDIGAREEPGGDGGARGDKASDKAADKAATKMNERMAEVIDDLVDELRLGA
FT                   ETAAERDESRKQEHALVAKRLEEVTKSHSMNLKAAKADIARVTKDEIAKLDKVNEERAR
FT                   DLAATVLASEQVLSIRVEEGVERNASEVKAAVEAARAKEEAARAKDIADVAEKIDEAAS
FT                   AATARAASLERELAAALERLELELVGARGETAKIRREFEETAHTRAETRVAAAEASAAV
FT                   REVAKLQKRLLAAQVDARLGWRETQRLHAARMENMAAKLVEYTSRERRLSDELHERGVQ
FT                   LELERREHARLRGMHAEMWKETSVARRGRYEAELAASTAAEAAAAARDAAVREISKSRD
FT                   VALAEMARLRAHYESIAAANPKAQGKAEAATVVEALNAELAEALRQRRSVEGDLQDALR
FT                   RLRLHAADLVASRREILSLREALERSGAAGDGDGGDAAAADASRQSRPVEPVRSGEPLT
FT                   PREFDAPPVMFQTPPAVYPTSRGSIAIVDEDEASETGETSEGSPEMRAMLKASAEARER
FT                   LEALTRLRFDEVPLSPK"
FT   CDS_pept        complement(1019059..1020582)
FT                   /codon_start=1
FT                   /gene_family="HOG000265256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638261"
FT                   /orf_name="MICPUN_108808"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO69554.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG562437"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199C849"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ0"
FT                   /transl_table=1
FT                   /translation="MGLMSKAKFKNVDFYRKIPKDMTEGTIPGSVISMLAALVIGLLLV
FT                   SEVGSYLTPKFDTRVVIDRSADGEMMRINFNVSFPALSCEFASVDVGDAMGLNRFNLTK
FT                   TVFKRAIDAKLNPLGPIQWERGHENRKEPEHADDAATAVAIKAVEEHAERKAAMPNSDK
FT                   HAEAVFELDAKSFEDEKKKAAVLLVNFYAPWCPWSRRLDPVWKASALQIHAKYPKDHAN
FT                   RVVVAEVDCTKHERLCRDQHIQGYPSVRVYTKSHDALHRGYDHDHTSYHGDRTVEAITT
FT                   FAEELLPAWKATDHKDTELAIRQPVETQTVKKIDGPGCSVTGFVLVKKVPGHLWVTATS
FT                   KSHSFHAESMNMSHVVHHFYFGQQLTPQRKRYLDRFHSREKDPKGDWHDKLAGGTFTSE
FT                   EDNVTHEHYLQTVLTTIKPSGSPAPFNVYEYTQHSHSLRSEKELPRAKFHFDPSPVQIS
FT                   VSEERQKFYHFITTLMAIVGGVYSVMGIADGFVHNSIQAWKKKELGKFG"
FT   CDS_pept        join(1021032..1021129,1021283..1022534)
FT                   /codon_start=1
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638262"
FT                   /gene_name="TUA1"
FT                   /gene_synonym="TUA2"
FT                   /orf_name="MICPUN_94939"
FT                   /product="Alpha tubulin 1"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ACO69268.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI000199C13A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH4"
FT                   /transl_table=1
FT                   /translation="MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGG
FT                   DDAFNTFFSETGAGKHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFA
FT                   RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGK
FT                   KSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERP
FT                   TYTNLNRLVGQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKA
FT                   YHEQLSVAEITNSAYEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT
FT                   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMY
FT                   AKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESAEGDGEDEEY"
FT   CDS_pept        join(complement(1023929..1024188),
FT                   complement(1023283..1023823))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638263"
FT                   /orf_name="MICPUN_105967"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69555.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C84A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ2"
FT                   /transl_table=1
FT                   /translation="MAPKDVFAMKISDFPESLRPILEEIDNEGDGMLEIDEITEIFQMF
FT                   AAQKRAAKDGEIALCTLPKELRPTLAVFDVDGDGTVSGTELAIAAKLYHESKKQNKRLM
FT                   KAVALLLFVLLGLVGAIVGLTATVIEASKETKTDASGITRVAGSDVPASSGSIIVQNSL
FT                   HDSYALDYTALDATKSLYLQNADGTAEYSYTITGWTKDTNAKNVVFYSARGDTIAVDEL
FT                   GDIIVKDSSDSELLAIPKNGRKLTGFFSALMTSGSFMMMQAGAF"
FT   CDS_pept        1024989..1025837
FT                   /codon_start=1
FT                   /gene_family="HOG000264885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638264"
FT                   /orf_name="MICPUN_102003"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69269.1"
FT                   /db_xref="HOGENOM:HBG619559"
FT                   /db_xref="UniParc:UPI000199C84B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ3"
FT                   /transl_table=1
FT                   /translation="MTSGLAISVAAVASRVVSGPRALRRATNGATSNHTPANRWTATST
FT                   RLSAVTDLDQADQVSETVFASGTDAKVAAFCVEQMVDEAAMLAASTFPISPDDLIARTK
FT                   AILANKNGVENPALLASDFKFVAPVVGPLPKDDFLQAFDGFKLEEGFPDANAGYYAFRI
FT                   DPFEPNRVWFDTRFRGTNTGPLSGGSLAATGKKVEAPPQACSMLFNERGECTQLTAGYV
FT                   MDKQVGNTGGLGGVFGIFYAIGYGLPFPEAQPWKKSKRYNLFLKFSEFQKFVKSLGGGS
FT                   D"
FT   CDS_pept        join(1026031..1030799,1030887..1031844)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638265"
FT                   /orf_name="MICPUN_105968"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO69270.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199C84C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ4"
FT                   /transl_table=1
FT                   /translation="MRVPVSGGAVESGVRPEESNPWGRGSSGSYAARWGACAWPLRKED
FT                   PGSRSEEAVCVWGGAPCADEREILLLPVDPNGKRRRIQSTGEHPRARESAGVAAVKRGA
FT                   SVAHVVYGGFAQDAAAASATSDPPGAEGEPLGDAFLIDGNMRWRALVPFGGVAPPPRGG
FT                   HALVPIASNKAFVFGGRGSDGAHLGDAWILELHSTASVAAGWSGKNVDARWEQSPVRDR
FT                   DAPAPQPREAAGAAYVAPSKSAGENARWTSIGNMVRQLDPKSRTPGGTPSAPPSAPPSG
FT                   DGDGDDAGDGDKGDKSYGGKRGEVWIFGGCDESGVLDDVWRYDVDTCAWHPTRRPTGTT
FT                   KRGQAGGGRGVSKAAAAAGAEKKNVAWPPGRFGHAVVVVPARELDPTAAARLHVADESP
FT                   CAVIHGGCGAGGEVLNDVWAFSFERERWTRLSGDSPETSGEFDRAREVSRGSKWTDAPG
FT                   RCAHGCVYVAGALRLFGGIASGTQLASVHESVNVYLSATAAERARDRGAVFSKSGDKPL
FT                   ADAENPALSPPDPPPPAAARGRTLAGLDPPPADTLNASLDINTEDGGDQGARLTALKGL
FT                   RWIDGESGRKKRKEETPASPPAGADVDTGADVAADVAADVDAEAEAADAKTPSPDASTD
FT                   FEFGGEGDVDVGVDKYRDEIGAAMAHIAATGRLKSSKRRAPPHSEEGSPIAKPTTSART
FT                   EDLPPTVIKPRRNRALGTGDVEVPAAVAEEEESPDSALPEEAALGPSRGGRGGGRGAGG
FT                   RGGRAGGRGGRGRGRGAKPAGDAPVPEAHWLAPDAVKPIAAPGVRVVSEGSMSDEDSRD
FT                   SENKDDKGDGDSENARALEKAREAEAKAAAAAERAARLKEEAARAAAEAAAAAAGDDDD
FT                   DDDDEDDFRVVQKGSGTEPPVHLDDTHVNGSRGSKGKHRWSAVSVGPTPPSLKGRFQEA
FT                   GAAWASAGLEVIKDTPPVSDQGHPTGVGAGKTPEEKVAEAEDDQELNTHAYDLFCVWRR
FT                   MSRDDEESDDAITAAWDAMDPELKLHFFEQARIARSGGEADVDVTLHVVRKELESTADP
FT                   DTDEAARAAALAAGKTPHTATRVLRFDAEHEGPGTEGEDGGIDEAGLAAAIMDVDHSRK
FT                   ALATPEEDRQRLEDDAERPPAVSNAQTKPQRTGLGVDVDGSLLGKKFEDGEITGGFEAG
FT                   YFLSCVVDGVRCRGVLFSPVLALQKCAGDGTPVVVLPSYCDPGRMVYDGALQSVVFADD
FT                   EGRTKEVWGKDYVNPQHPGDKTVKGRAAQVVDGGKQPHPAPPGADERERKRDREGVGDL
FT                   ADGGVGAEGRVKRSAKESADGSAPSAPAPAPVAASPAEPAPEPGSRQPEKRGRGRPKGS
FT                   KNKTPGEKAEKAKVAKTPREKHAADGAPTKRGPGRPPKISQPTPPKPDEGANALVDPLS
FT                   PDAAAPSAPSAPAPADTGGKRPRGRPKGSGAKGKAPGAKRARLTDGALQNVLNLTAGVV
FT                   EDIGAVVGDLSSDDDDDVPIAAMVPSATKSAASPAVPTVPTVDGVPVKRPRGRPKGYRP
FT                   SLMKKKPPPPPAPASPLEAQDDEVDFEVDGDDDDEPILRPSGTLDDVVERTPVKRKPGR
FT                   PKQSRAKGSLDHFASSEATRQFAMAQDAFDAKTGELASIRDDPEAVKARASDGALVLVT
FT                   RVAGYVRSWAIPLAEAEEIVRTGDRPTVPELCGVRLAVRRDNPGECENPFAGYLMAQPH
FT                   TGLPPAQYMHGHQKKLADVVDLPSVGPITVVRRDLGSFGAPDMQALYALMHEIVDAYGD
FT                   KGKAGDESARARMCVSEFQIYRALRPTGLDTQDVHPPPHLLRPRVRLKGLKSAPALNGL
FT                   CGYRDAYDDVKRRWHVYLDGKTGLDKPLGIRAENLEIFSDKIEACAKTCANAVEDLLVA
FT                   GRRRCEREGKEWISEEEVSWAAFSGVFPAVPPPQ"
FT   CDS_pept        join(<1033582..1033772,1033839..1034223,1034419..1034770,
FT                   1034926..>1035347)
FT                   /codon_start=1
FT                   /gene_family="HOG000170094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638266"
FT                   /orf_name="MICPUN_66851"
FT                   /product="Predicted protein"
FT                   /function="DNA photolyase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO69271.1"
FT                   /db_xref="GO:0003913"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="UniParc:UPI000199C84D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ5"
FT                   /transl_table=1
FT                   /translation="VVWFRQDLRVRDNPALHAAARTGRPVVACFVWCPKEEGGWPMGGA
FT                   TRYWLHHALGSLQASLRARNAGGTSSPSSSSSSSSSFDELAAVVRECGAKDVYCNRVYE
FT                   PWKIARDRECERKFSAELNVRFRSFNAGVLYEPWDARPDATDDACWNSGYGSVRFFLRG
FT                   CARLGEPPPPLPPPPTMRVRLPADKRARSYTEHGGVQSNPGNGQSNGQSNAPKASTERF
FT                   RADVRTTARISPYVRHGELSVREVYHSAKAIQVGSRKSRARSAAVFLRRLAWRDLAYWS
FT                   LWRFPRLCDEPLRPQYATQWWALPWDPVAWQFGQTGYPLVDAGMRELWATGYVPNYVRH
FT                   VVAGFLIEYLNVDWRHGQLWFHDTLVDADVAIQGFMWQNGGHSGMDQWNFVMHPVYAAK
FT                   SADPDGEYVRRWCPELSGLPREYVHCPWEAPATTLAAANVALGRHYPKRIV"
FT   CDS_pept        1036563..1039382
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638267"
FT                   /orf_name="MICPUN_102006"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69272.1"
FT                   /db_xref="UniParc:UPI000199C84E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ6"
FT                   /transl_table=1
FT                   /translation="MSWRDALKTAASPLAARERPPSASVVGIGQHRLDGTDEARGGGLA
FT                   PTREPDPRDALKNAFAPTQPTTLELCVNVYNLHRDFTARAPLLMCALLVEVPPPTLPYK
FT                   MPAAWKRAPERHRSWRVAGSTEPTRAACNASCVRFAVPVVVDKLIGGQRTLENKKAVIA
FT                   VYRIPDADEADDAHIAADENLPLDQRPKLTPERLDEFEYLGEAKLRCNELVRAVHDAQK
FT                   LHADDAATAQKRTEPSTLNTRGDRDFPARGELRNVKPRALVRDDGVARSPVGNARAQYA
FT                   LVKSPHRDPSTNPPVPGVLSVRAKNPDNDAFDGAAIEVLACTPVHWPRPSPADAGRYVA
FT                   DFAVRFEPIAHPSAADLELVFLRLLRWAGDGYQPVYGSLVTCADIPTPPKLATPVDRVG
FT                   TGATRRYEVSIPTLHVPVACVKSGGATDEDDEGGFGDGDVLPDGSVSWRIEIVARMKTG
FT                   HDLLLGWVDTTPAELNDAGDVATVNTPAAFECDLHRGESDYEAARLNEAVGERPPTLLV
FT                   TRWKLRPGANPRALRARIDRAVKTAPPQKPQKPEPGGGAGDEKSAPGEVGRVTVPKGAN
FT                   PLADFGFGPAVPKKAEEKRAKPAPAPAPAVEDSESDDTDGSGPGGSDESSSSSSDDENR
FT                   DEAANVVDEPNAKTKTKIAKTKIAKTKIAKTKTARPASSSAAMPSASKKKTNSTALSGK
FT                   PRPATATATVSGLRAAPPKPKLPDEAKGFQRTKPTQSRRRESESADALESAPAVTPMQA
FT                   LLNRTLGVVVPSGGDGDGKKGVVSGGGEKGAARVFQAVKGVVFLRNKTPIEEEEAEDEM
FT                   DEFFDRSRVTVRSTRSKAAAAIAAAGETGGDASPRDVENRQGAPARPGTPPEDPRDYEP
FT                   NPELIAAADAAVRDAMAERLGGLPKAELVETAMRVRKELLSKCRGELRALELRRKREER
FT                   AAVGAMGGR"
FT   CDS_pept        join(1039528..1040166,1040349..1040435)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638268"
FT                   /orf_name="MICPUN_60904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69273.1"
FT                   /db_xref="UniParc:UPI000199C84F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ7"
FT                   /transl_table=1
FT                   /translation="MPTYFEKLAAAKQAIAAKSKESYAPPPRLHVDENTGLNRQGLDYV
FT                   DPINKTKGSVALPPFAKPVVERDEATGEYYVSEDRAYDSTATQAAPELATRFHLERFPI
FT                   DEQGREGMGPAPFARATFDVVAEQDTQSAPYTHVDHAQYKSVVYDEIIDPYHSEKSPFR
FT                   IESPMAHGLEKDPSAPKAFGAYTWTSLDAAHPGTNTMRFDVDPSGGPPKMVHQGGGGGR
FT                   AEGIGPSRQGRAAGGGVGE"
FT   CDS_pept        join(complement(1041649..1041993),
FT                   complement(1040755..1041501))
FT                   /codon_start=1
FT                   /gene_family="HOG000049778" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638269"
FT                   /orf_name="MICPUN_84414"
FT                   /product="Predicted protein"
FT                   /function="rRNA (cytosine-N4-)-methyltransferase activity "
FT                   /biological_process="rRNA base methylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69556.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0070475"
FT                   /db_xref="GO:0071424"
FT                   /db_xref="HOGENOM:HBG302779"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="UniParc:UPI000199C850"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ8"
FT                   /transl_table=1
FT                   /translation="MAAAGATLGIAGGLVRTGARAIGPPRPNLPAAAARGLGRARRLRA
FT                   GASTSSATNEARAGEDDGDAPHVPVLMRQVLDAFDGRSLRCYVDGTMGAGGHASAIIRA
FT                   HPELRTFVGFDLRIHTVQSNFRHMRERLAELQLADGGVDAILMDLGVSSMHLDTPERGF
FT                   SFMNDGPLDMRMGPSAKMSAADVVNEWPEEEIARVIRDYGEEKHWRLLARRICDARGIA
FT                   PIETTRQLVHALGRIPGVKKGRSGGIHPATRTFQGIRIAVNEELAVVEEAIPAAVDALA
FT                   PGGRLAIITFHSLEDKLVKRAFRTFAGIAPASDRPLSAWEPQPEAPPKIVKLVTRKPVV
FT                   ADDDEVGANARSRSAKLRVCEKL"
FT   CDS_pept        1042124..1044655
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638270"
FT                   /orf_name="MICPUN_60906"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO69274.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199C8D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGJ9"
FT                   /transl_table=1
FT                   /translation="MRGGPRPLFDDMRRGRRPVRGKLGASLVGAALCLLFGWIYLSGNG
FT                   SARDEGPTTTTTGTRLDGAVPTRVPTVAVADPTPGSFAGAARDGAGARPTRELDLSRPH
FT                   HREAAAREAASDAIAKHAGDDRHALFEKGGTFTPGGDALKAKVAEAKARGAPAVNLRRG
FT                   PANDIDPAAYPDARALATLMHDLALPRGELVAVTFADSKFAALTVNWATHLRDAAVPHV
FT                   VGALDKNMLQLLTRLGAPTAVYDLPYADLDGSSAHASKSWKAFARLRISQVSALLRMGF
FT                   DVLMSDVDVVWTKDPRPFLQCGYDHPWAGKDAGKDAGIGLGAAGETGAHALEKWERDAV
FT                   EMEGGESPDEQAMFLRKHGRGVDDCMGVSAADVMVSSDNLSPLSDRNEGAAYARGGIFN
FT                   TGVVFLKHTKNAKAFAEAWNDNLNQDQGRFAPLTSDQQVFNAMVRREGHWPGLDLKALP
FT                   DGFPVTRVLVGNGLPNGEAFNLGVLPVALFQPGHVAFLQRVKEVLPNFNGPYGVHATYT
FT                   FDGSTSSAKRLRFAEAGLWDPAADDAQVGLGGVEADDATFHAGGVPRVLTWDPAVATRG
FT                   IDESVPSIGSHLEAGGRQLELLRDAIAMAQLTNRTLAVPRFTCFCDKVWGGHDNIFNFN
FT                   CHYPGSKDSGHIPGPCPMDHFVSPAKLRESGVAFVALEELRRAPYEFAGDDFGAVRVEF
FT                   KKDAGGGGGGSVANDASGATLPVGADSAVVVDALGKLRDVPLLKLTGEMPRFAGFTTQR
FT                   AAREFNARVTNVAMKSAPEWCSECHPQGCRELIPADVVTSGRLKPVRNVHDQFCADFKQ
FT                   PEPLRTVGKESFLAMAGALVDSATMTEDDGL"
FT   CDS_pept        complement(1044850..1045473)
FT                   /codon_start=1
FT                   /gene_family="HOG000263779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638271"
FT                   /orf_name="MICPUN_108813"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69557.1"
FT                   /db_xref="HOGENOM:HBG688529"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniParc:UPI000199C8D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK0"
FT                   /transl_table=1
FT                   /translation="MVLGLNFDLLDQLSFYGAYHRHPVNKAIHLVFVPCIIWSALVWMA
FT                   GYVPEAAEGVSLAGAFRAIGVPRFLASAAVPNLGALALIAYSAYYVALEPIAGTSWFVM
FT                   CGLPMWLSASWFESAVGWDAAWRWALALHLLAWYAQIHPGHAVFEKRRPALLDSLAQSL
FT                   VLAPLFVWMEVMFACGYRPGLRSDVDRRVKRAVEERERGGAKDD"
FT   CDS_pept        1046189..1047523
FT                   /codon_start=1
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638272"
FT                   /orf_name="MICPUN_53147"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="tryptophan synthase activity"
FT                   /protein_id="ACO69275.1"
FT                   /db_xref="GO:0004834"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG303148"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniParc:UPI000199C8D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK1"
FT                   /transl_table=1
FT                   /translation="MGFPPIFGGAKDQGATFPKPKDERLDPAILPNTDGYFGEYGGAFL
FT                   PPPLVPIIDEIKAKYNELKEDPSFWAELRLLEKHFTGRPSPILHCERLSEKIGGAQIYL
FT                   KREDLNHTGAHKINHCLGEALLAKKMGKKKLIAETGAGQHGVALATAAALVGLECDIYM
FT                   GEVDMAKERPNVVRMKILGANVIPASHGLKTLKEAVDAAFGAYMEDPVTQFYAIGSVVG
FT                   PHPFPAMVRDFQSVVGREAKEQFKELTGGKLPDNLVACVGGGCNAIGLFTAFLGDEKVK
FT                   MFGVEPSGTDLKTVGKHAATLTLGTPGVIHGFKCVLLQDEGGEPAAVNTCASGLDYPGV
FT                   GPQHCYLKDIGRVKYETATDVECVDAFMSLARDQGIIPALESSHAVAYAIKLAKTLPKT
FT                   ETILVNLSGRGDKDVDYVVENFGAKYGVSVPKYEMPKAEAALSAA"
FT   CDS_pept        complement(1047805..1048920)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638273"
FT                   /orf_name="MICPUN_108814"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69558.1"
FT                   /db_xref="UniParc:UPI000199C8DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK2"
FT                   /transl_table=1
FT                   /translation="MVRNLCENLSPERTDGSCEPEAIVTRTPASVAIGNRGNNSMDDAD
FT                   FGDVFGRQLPSRDYPDANAWWDPDASGTSSGGSDSDGGDCVFLENDIDGFRSTGGVMSC
FT                   GNQAGAVWAYNCGVGDGRQHSGKFTFYPRAAGWSTMVPDDLETSANVRKFVEHALGHRT
FT                   GGRRGGAKAAESSSGSFQNAEADAVAGTKLARGNPLAAFGGWLLSLTEETRDGDGGSGS
FT                   GSGSGVGSSWWGGLVDAILTPVRHVARAVFQFMLGAVLKFMLGNKYEFECPLVTVSDVV
FT                   DSHELDEIDLLKVDVERSELAVLKGVRPEHWAMVRQVAMEVHDSAGGTKELEECRRLLR
FT                   DVGKFDEKRIVAEQPDDLEGSTLWNLYASRA"
FT   CDS_pept        1049601..1050881
FT                   /codon_start=1
FT                   /gene_family="HOG000265272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638274"
FT                   /orf_name="MICPUN_53149"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69276.1"
FT                   /db_xref="HOGENOM:HBG562444"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000199C8DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK3"
FT                   /transl_table=1
FT                   /translation="MPSAVMATSIATRGAVPGPSRGLGAATRRIAYRRSRSRFGTLRLR
FT                   AEKDDDDAAPSQGPEDDPRSPANLMRRAMSMRAKIIKVKLASLGVSSKDLFEKEELARA
FT                   LANAWGEKLKGTVTLPLRQLVGMPGNPRAGYVVVTLDVGEAGFVDFLIDSGATTALISP
FT                   QLREMLGASAIDGAPIRGLGAGGETVRQKVTIAGASVGALELGALDAVVTDLAASGLPS
FT                   VVGGMLGLDFLSRFELELDFADKAMRFHPIGSVATGALDVDSLVHIPLARHPTGLRTVS
FT                   CRLNGCERFPGILDMGSFFSVCNWMAAARAGVGPDNPVVKNAAMTAVGVDGRPMAMSTA
FT                   PFDLEVCGDGTDEGGQGLRSEYKGECCVGDLPAFASLGATASPFMTVGLDVLGRGRSVL
FT                   SVGADAVYLTPGDAPGGMWDSEGPIIQ"
FT   CDS_pept        1050965..1052530
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638275"
FT                   /orf_name="MICPUN_112718"
FT                   /product="Ph-domain-containing protein "
FT                   /function="binding"
FT                   /protein_id="ACO69277.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199C8DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK4"
FT                   /transl_table=1
FT                   /translation="MAADSGAPGDAPGAGSSSSSFIGGVEIKTRLGTDVSTGGGGRSGH
FT                   DKLLDLRAERHADAARADPTDFDAHYSWALVLQEQAERAEQSGMDPNRRDAILIDACAK
FT                   YAKARDLRANSISTLYNWGIALGDRARLKGDAGDAAEARAMWRQACEKYRAAVECDASR
FT                   TQSTQALNNWGLALQQMATLERDPGVRERRLLAAVGRFREAIRRDPGFHRAVYNLGTIM
FT                   YALSERARGHGGRDPRGGRSEHASNGGASNVHPEDSNQPAPLGSESAPTSADELQTAAA
FT                   MYICCAQASGARPVYASSLRLVRHTLPLPALLAGTLTTAPPALGVATAHSWRRRWFVLD
FT                   HEALWTGESWPADVGAASGGGGGGDGGAGGVGDAFGAVGAWNHSSTSPRWGGDAIDPTD
FT                   DRDERREERRARRRRRAAAADETLVARDGPWGVHVKTSDVASAQPCAESSLPPGFAFRV
FT                   GMADGSSHYFVCDDAPARERWVDALTLVRHVAARGRGEALRLELVSDATVAPQLRNKGQ
FT                   GKAR"
FT   CDS_pept        join(1053383..1053481,1053695..1053916,1054139..1054525)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638276"
FT                   /orf_name="MICPUN_113347"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69278.1"
FT                   /db_xref="UniParc:UPI000199C8DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK5"
FT                   /transl_table=1
FT                   /translation="MADPFKSDSGKRRSALTSAFEELALHTAALNDEDGFSAHVTYDAV
FT                   GNVRVTENEQTLDPPVGSSLGRPTPLRGRAFNVPDDDDAEARSYGRQHGSSQGLNMLAA
FT                   SARSRGATQSTESVKMAYSWNPGTVLGGGGSEKPSVFATSRRVPIADRGESMHGTSGEL
FT                   ARALAKVVVVHPPHEEEDECCEMTAGRTQRGSFSSLLLLEAQELFDTMETLGDSPEDEV
FT                   IESANRVAVAAAN"
FT   CDS_pept        complement(1054774..1057599)
FT                   /codon_start=1
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638277"
FT                   /orf_name="MICPUN_84188"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="valine-tRNA ligase activity"
FT                   /biological_process="valyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69559.1"
FT                   /db_xref="GO:0004832"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006438"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniParc:UPI000199C8DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK6"
FT                   /transl_table=1
FT                   /translation="MATSVASEVHPGANHADLPKNFEQGDVEERLYKMWEENGYFKPSD
FT                   TAAGEPFTIAMPPPNVTGALHMGHAMFVTLQDIMARNARMRGRPTLWLPGTDHAGIATQ
FT                   LVVERSLEADGLTREGVGREEFERRTWEWKKEYGGRIGNQIRRLGASCDWSRERFTLDE
FT                   GLSEAVLEAFVSLHDRGLIYKGTYMVNWAPKLQTAVSDLEVEYADEPGTLYYFKYPVEG
FT                   GEGDGAYLPVATTRPETILGDTAVAVNPADDRFKSFIGKRCVVPFSNGRTIPIIGDDYV
FT                   DIEFGTGALKITPGHDPNDYEIGQRVGLPTINIMNKDGSMNGNAGAYEGLDRAECRTKL
FT                   WADMESQGIAIKSEPYQTRVPRSQRGGEVIEPLVSEQWFVKMETMAKPALQAVETGELT
FT                   IVPSRFEKIYKGWLTDIRDWCISRQLWWGHRIPVWYVHESQAALDAARSGTGKGSSPTY
FT                   VVARNEAEATAKAKAAHGEHVVLYQEEDVLDTWFSSGLWPFSTLGWPNEEAADLAKFFP
FT                   TQVMETGHDILFFWVARMVMMSYGMTGKLPFHTVFLHGLVRDEKGRKMSKSLGNVVDPL
FT                   NVIDEQGCDALRFTLATGTAAGQDLNLNMDRLASNRNFTNKIWNSGKFVLYSLEGMSDD
FT                   ERVELVDAAAAVPSSLPDLPLAERWIVSRLHAVVDHVTSAHDRYDFGEAGRAAYSFFYD
FT                   DFADWFIEGAKSRLYGDDPAAAKTTKAVALYVLDNTLRVLHPFVPYVTEEVWRSLPHRG
FT                   DSIMNQSWPRLDAERDAGAVGAFETVQGIVRSIRNARAEYAVEPAKRIPAFVVISDATL
FT                   MEEVAAELAMVGGLARLDAEASRVCAAAPADAVETPGDFVQTVVSDGVEVYLPLSGIVD
FT                   PAKELARLGKQAGKLEKEVDGLAGRLKSPKFVEKAPAAVVEKSKKELAELEEQLASVRS
FT                   RMSQMEALAAK"
FT   CDS_pept        1058166..1059425
FT                   /codon_start=1
FT                   /gene_family="HOG000265346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638278"
FT                   /orf_name="MICPUN_108816"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69279.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG557811"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000199C8DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK7"
FT                   /transl_table=1
FT                   /translation="MGVIAQPDVVLLGRRVAADQAFVWLAAGTIVSIALASYLEEFVLK
FT                   SLPNYDFFFTMAFFELAVFGVVSHVTIRLRAATELASLGGDGAVASPGRAAIGPPPRWS
FT                   DVKWWRLEPRAAPLRLYVIGATCLALYASLGKLAYKYVNYVTGTVLKSIKLVPVMIVSV
FT                   TWLGRSYPPHDYAAAGFLTTSAVMFGLGEAESNREANYAMGFALSFVCLGLTAAQSNIA
FT                   DACMRDHGAGVDENMLYVNGVGACLVFAFLVISGEVFQAFAYFTRFPGAFALLFVRSVV
FT                   FYVGAWLYTLLMKHFGAVAAVAVTTARKAITVMLSFALFRSDKPLTAKYAAATALFFGA
FT                   IACEYHKSEVRRRREERARGGAKEGGRRGGDDDTAGGGGDSPGDDSGEGGRRRPGRRSE
FT                   DGRGGATREMDRELAPVRIK"
FT   CDS_pept        1059799..1068099
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638279"
FT                   /orf_name="MICPUN_60914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69280.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C95A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK8"
FT                   /transl_table=1
FT                   /translation="MANPPRTPSRTSALFAAAARGNLSSLRIVLEHGVGEGLNVDSPNS
FT                   RGDTPLHEACRNRQWPIAAWLLAHGANPDLVNAFGQDASDVCPDAAAKDIYASILASNP
FT                   IDASDVASFESTLESARARRAQEELEELERELLGGERAANEVPAGPAATTWRPTAADGR
FT                   ADGDSPSEFSFERAATPEAMGGHRVIARRMEADFDANAPSVEPSPNAASPPRMSAIDAA
FT                   MESAMKRAKEVLRASPEDLLRAARAGAAADDDDDDPLSPEMFAHGSNADGTAMASAIKA
FT                   ELRSARKNMAEIRRRIDEEIAVASSPKRRTSVGSRTAVRRGGAVGGDDDPFPATETPPS
FT                   TPPGTPGDAADLLRRMFGPAPRISVDGKRLDGDDDDDLEEASDPEEEVPIRRGVIRKAA
FT                   LAVTEQGVKLQHARRRIADLENAMKERDEFEANAREHLRSAEESARQLRTLSERLESEK
FT                   KELARSEARRAELERDLDTVRGELETERGARRDAEARVVANGWDADDAKRSADQSRMEE
FT                   RRSAVAFAELTARLEDSRATLASTEAALREARYGLQTECNRAAASEAELFAVSTERDQI
FT                   RLDFDDARKELETLRRGLEDASERAATFEARSEAFATEVESLKRRLAASKAQTTSALEL
FT                   GESAGAAVDRLELECQKRNAECARLAEENERLRKNADEEIERARKNADDRAAAFEAGEA
FT                   RARDLESKLRTTSADLDFVKARLEGAERERDCAENLLKESGAETERLRDLKEATALELG
FT                   KNRALSESVFVLTEKLAAAEAELDATRAARDALGAEHESAKLALSTAHDAEEARRQRAL
FT                   RRVAGRLMHRGKSSAFARWREVADDAERARAALRRALGKFANASLAKAMARWRECLDSA
FT                   RESERAERLLKRHFGRFAGRSKACAFGGWRDEAKKARRLKVLGQKLLGRFDARFVRRLF
FT                   QNWKVHLAQASKRNRVLGRVVDRMRGRVVSAAFDKWRGFIVERERLRRRIGRVLARFAD
FT                   RARARAFDKWASTVAERAAVRASLARTLARFANRAVAAAFATWTDSVTEARRLRSTLAR
FT                   VASRFSNRTLSAAWERWAELVREKRRMANALDRVVRKMRNRVVAGAFATWIDAVAESER
FT                   LKAVLRRVAGKFANRRLAASWETWVATVAESERLRALLRKVAGKFANRRLAASWETWAT
FT                   ACEARRAEDEERKRTASKVVARLAKSSLHRAFGRWAENVLEKRAAALEAEADERRRADV
FT                   LNRAVRRLANRALAGAFATWRRAVDDSRRARLLELEDERVRLLGEREEVGSAVFENGRL
FT                   TERVEALAAELESAKARISSAEARAEEAARAAARERVRARKVSDDCELIRKNAAARESE
FT                   LRIELASSGAGVGKNADAATVRELKARCRDLKAENKRAKDEIERVTAEAKKSVDDLNAR
FT                   LERANEAATKAKSARIRARKAGEARTQAEEDLAAANALGDALSAELREREEELRRAEAS
FT                   LAASREETRTVARAERDAASLLLEGKRVWESLERALRDQIDAAEARRLEAESRLASVAS
FT                   TAERRVRLAEEEAHELREQAQTQTRSASAGDDGEREDVESLRAKLQRALADAAAAEERA
FT                   SDAEAATRSAEAKIESMRWPKSLTSPGRADSDLSGRESSLVDRAADQRVATLRWYAAAL
FT                   NSRRASAVKRVASLEADLKKEMKRSEDAKRAMLEAAAGVRQRAMDAEADAAARHSLETD
FT                   LAKLKADLAKARRMNVEGQMTRSSLRIELAEAKASAEALAKAMADAELPTDTPDAHRAR
FT                   EETVKRAATERGAAYERTSYRYAAFTPPASPQFMSPTVVSATKTVSGFYAKTPSRASSG
FT                   AAINRGQQPRQPSPRRGDLRDPRAARPIDHPPGVGHAAHKPRTQSSDAAFRDILVGAAD
FT                   YSTDVPHALLRARLHAAHRAAHELRARCAEHAAAAASAKAEAANASVEAADAARAATEA
FT                   TAALAESTRHKSALESRVERAEGAVAAAESAAVDARSDAAASEADAAAARALLRVVVAR
FT                   EFKRSNSDSVAEESNADESNAVASPNPPQSAPRKDLDDERRPVDEDDDDLAMIRARLQV
FT                   AEDAVSEALESRASSERALAEGASALAAVIAERNALAARCDACVAELGDARAWTARASA
FT                   EVFELRLDADAQRRRGDECESIANRLDAELEALIKTSIKTSPHGASDGTYRRRSVEGVE
FT                   AAALGAALAVNRARLAHARSAMRASEAEKLALAARVNDAEDRAKAAVADAERARAALRD
FT                   ARAFVVYASGGERSKADEEEEEEEEEEGDSIRRLEELEADRAALTSKLVDATRERSALE
FT                   EVLNRERAKCVGERARADAASAALEAFASGWWTKPSPEEGRGWPAGPSSPEEDWSFFST
FT                   AAAAAAERARCFAIADANVELHARVAELVALAAAKANGRDDDANGHDDDDTKGRDEAAD
FT                   RAASAASSTAANLLRDLGVAVDATDAAAAARDAAATAAALKSELVEVTRALEGSTLEAE
FT                   ALRREMSAERERETRRRSRAEQKEDTKGSTERKGDPNLVGARLAEAEARLAAANARIAF
FT                   LESALVRNGASAKDGTPLGTPLGTPAGTPTGTPAGTPPNSAARANTSNESLEDLRARLR
FT                   SATRRADAAEAAAAEAEAAADAASHAAADADAACAGIRDAANARARAAEARAADAEERA
FT                   AALADAIAGVEDAAAESVELRAELVKARTDLERCRGETAVGRFEAARETVQKLAAGDVD
FT                   GAIAKAEAAMDASRDAARVWSERVASGGHSPETLGERARELLDAGGVAGRAREIMADAL
FT                   AQEMAGH"
FT   CDS_pept        join(complement(1070747..1070830),
FT                   complement(1070492..1070564),complement(1068365..1070049))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638280"
FT                   /orf_name="MICPUN_105970"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69560.1"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199C95B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGK9"
FT                   /transl_table=1
FT                   /translation="MQAGVMHPSASTQDLIRATRPKFPEGLKVLVVVRDEARHAPIKKL
FT                   LQEIGYKVTCANTLDKGLAVLESAQGNSDVNAHFDVALVEEEQVAPIMRDAMHPGTASA
FT                   TTASSPLFGRFTTMAKDVAIVLMHEDEDVASKTYMIEAIKVGVVDVVKYPLVKQSMRTL
FT                   WQHAVRKIIRQQATPADVVATAGGGGASGGGAGKKRSSEDRGRRAPGGLSVGPDGQRRS
FT                   DSGDSSASEERALKRQSNSPTTVLEDESNPGGDKAIKAGTAGGATQGGNNSNAKKPTSA
FT                   GGAKAKPQARSTQQWKAAEQRGRRLAIKPHTAMVQGQQGAQMGGRVAYWNPGSQMMQGT
FT                   TQTMTVNGQQVQVWVPMQAGSYPTPAGQQQQPGAGGTQPAGVSGAQSAGASAGAGSASA
FT                   AAGTSSAGTQLASDGTQAAGAQPGQSPQQQFGPSSYQGGVPVGPNGQPLPMMYPQGMVL
FT                   VRQANGQMVYMQATPQMMQQHQMQQQGQYMQFAPGPYTHGASGDSTMVGSADDKAPAGS
FT                   LAGPDLNLGDVGLKGQPLPLGLNLRRTNSLENMMGGGLLPNQIDANVFNDAEPMEDDAL
FT                   DMLLRDGGGNLFDNMDDSMLAEAAANSAGEFFGMVNA"
FT   CDS_pept        join(1071768..1072282,1072459..1072831)
FT                   /codon_start=1
FT                   /gene_family="HOG000265261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638281"
FT                   /orf_name="MICPUN_105971"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69281.1"
FT                   /db_xref="HOGENOM:HBG610174"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199C95C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL0"
FT                   /transl_table=1
FT                   /translation="MASRLVVSGIAMPRTAAAARPVHRAASPSPSKASRATIGIGRPVK
FT                   RNRSQPSTAASAVEQASGASTSSPVDCLPALPDDSLPDAVVQFLRREGRHAVFSATKVG
FT                   VVEVNEVEGGRSLREYMSLPASQYSTLDGERVERVGDDTFVCTLGAFDFLGFRLQPVLT
FT                   ARVDVRPDGQGCVIRVVSAEIHGSGVVESVNGMFEIDSVNRVGWNERCNPGTGQCEIAS
FT                   ETKVTVYLLVPKWFPFTVKATERTGNFVVSQVVNQVVPRFLSQLVTDYEAWAAGDESRE
FT                   AKGADLFAVDLETK"
FT   CDS_pept        complement(1073008..1073739)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638282"
FT                   /orf_name="MICPUN_60917"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69561.1"
FT                   /db_xref="UniParc:UPI000199C95D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL1"
FT                   /transl_table=1
FT                   /translation="MSDPDMSSPASSGATTPSDGSWVDVASAASAGAEGDEPPTTTTTT
FT                   ATTRVSAGPRKARGDDDGDASADAGGAGAGFERGSSRPPAKSNPGPRNTPDISDAVAAL
FT                   RRCAARRLRALAERLEHSDDEDEDEEKDEDEDRLAKKLARVARSLAADIARRVARAVAE
FT                   TYVACRLGFARHLCPRSERSGTAGEGWGVASRPRRRPRQLCAPPWNVIAPILVGLLVGL
FT                   AWKRACAGGANQHPPPPKCGL"
FT   CDS_pept        1073899..1074924
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638283"
FT                   /orf_name="MICPUN_60918"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="ACO69282.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="UniParc:UPI000199C95E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL2"
FT                   /transl_table=1
FT                   /translation="MRNAGGALRSFARAARWVHAREPGLALDGCVARLSDPAASSSNAT
FT                   IANAPTRVAPSWALAARRNHRNVAGDAAGRRSRDDAAPMTRVTRRGMAKETPRASGVPK
FT                   GHTLSSEFNNARSQGLRAFLLSPGVIADPYRGPRPWPSLSSFLGTSGWKALVRMISRPV
FT                   HDVLTLGQCQQIKGFTRDNFKAEAGQLYRQISQLIAENHVTSLRHLVTEKALTDIKREA
FT                   KTREKAGWGKIVWEIRDLEKPVTLQGRMIFPNPQDKQMAFAQMTVGFRSHQRYAAYDAK
FT                   GRLVAGDPNGFLPVEDVWVLEHAFKLPNARWRLAARLPALAPGEKAPRDADDAPLVSGW
FT                   M"
FT   CDS_pept        complement(1075086..1075751)
FT                   /codon_start=1
FT                   /gene_family="HOG000161320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638284"
FT                   /orf_name="MICPUN_97791"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69562.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG629877"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR016706"
FT                   /db_xref="UniParc:UPI000199C95F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL3"
FT                   /transl_table=1
FT                   /translation="MAAYGDGLAAAAGPVGARAIHVYPVSNYTFGSKAAKADKDATVAE
FT                   AMIRYKDKYEKEGMRRTVEAILLVNQHDHPHVLLLQRTMAGGGVEYKLPGGRLRHGEGE
FT                   VAGLQRKLHNKLSPSEQSLRIEHWECGDCVARWFRPAFEPNYYPYLPAHVTKPKESRTV
FT                   YIAQLPERCKFCVPKNLKLLAVPLFEMYANEAKYGAVAASVPYLISRFHLNLESKQDK"
FT   CDS_pept        join(1075920..1076493,1076553..1076560)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638285"
FT                   /orf_name="MICPUN_60920"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69283.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C960"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL4"
FT                   /transl_table=1
FT                   /translation="MSTIWHPPLLNEDPVIVKEEPDDDHHQPPAVNVEPPADDDGEDEK
FT                   SEDLAGKMSTIWRPDLDRLRASVAEMEGSESEEEKKDVTKKGVKRKRAPPTKGPCEHGV
FT                   KWRSHCKVCSACPHGKSRYRCKECGGASICEHGRQRSKCKECGGSGICEHGRVRSRCKE
FT                   CGGASICEHGRERSYCKECGGSQICEHGPL"
FT   CDS_pept        complement(1076660..1080265)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638286"
FT                   /orf_name="MICPUN_60921"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69563.1"
FT                   /db_xref="UniParc:UPI000199C961"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL5"
FT                   /transl_table=1
FT                   /translation="MARFLNTVGSHRMESACLRAGWGTRAGLPRAVRRRATTTSSSAIP
FT                   RALLGPSTSASRKPTTARSAHASASSDDVSGVSGSTAAMDATDANGSAAQNNAIANGSA
FT                   RNGGVPSYADWWTRADAVAAARVAAEKDFDCDEYELEQAMRSLAPADAASPWWEVIELA
FT                   ATFGAAGGGIAAVLMQEAAVAALVAALPLVAAGARNRKDRVRSRVAAERLVELREETRA
FT                   MARKARRDVAVDDAASRAANAVVPRVSDVVAGAVSGVRNEIRSDLNDVAIKSIALEERM
FT                   RALEAAVAEQTSSARASAREAGAVAGMLARDVAAARVDAREGVETIERELRRATDALTE
FT                   SAADAKGEVMKELNVLWQLMESIEREAEGMRGDEATAAEGSQLSSQLSGLMEEVRASAE
FT                   AARASAEAARAERLELVRDAAKEALEAYRGADRGAEGVASSSSARVDEERLAAALDEIL
FT                   AKLKSNQDLVPGLPGVGAVSGVTVTAKLDAEQWTLLGERLTQLEQASKEAAEEAAQYTG
FT                   KAVGRMRAGVREDLMGVSETLANIATSAAMANIAAERARAAGRAPANAKAAPDDAGEDV
FT                   GASEYASEFVSANDVKDFLPEPDDDDADGVIDEIFGIGASDPFEDGTPFEFESLRREEV
FT                   FIGRDEAAKKSETLKTKFDAVEKMAGRNNGGRAPGGDDDDGEKRTPINAREGVTQEAAF
FT                   DNMQRLLARRAERDGDAKGTKKDEDVRGGIGATPAASFEDTAAARSFEAGKEAARRLKA
FT                   KKEDEAKAPTEKETDGAERKGDEDAKGAGGIDGEAEPEAEPEAEPEPELAETAAEPPTE
FT                   TVETRAETPRSLGQAEAARRALASVAAPSDSAADSGDSGSVPTASAESIREALNEGLAL
FT                   LRRARDAARDAGDSPAAMVDADDELAAAVTALRRASALADAAAGESPGDESPGGESSSP
FT                   GGSSRSSSSPAAAAAAGNLANALLARGRLQRRLANAAAREEARARSAGIRAGVEGAVDF
FT                   HAELAEEFLVLAGRSFRRALVAGSDGPGIEPASSPGATRALTGWGAALALRGRMVFEAG
FT                   DPESSAEAAALALAASEKYRAALETPFATDPSSGFDGAQRAGTLMDWGDALRLAGEATR
FT                   DAEGGFGRSGDGSGGIAGGLEFFEQAARVFSEAARLDPAGCGAEANRLAAACEDAMYEA
FT                   SGDGGDGDDGRDGGWAPARGGDPPPSPFPPYEPWR"
FT   CDS_pept        1081111..1082292
FT                   /codon_start=1
FT                   /gene_family="HOG000264879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638287"
FT                   /orf_name="MICPUN_53154"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69284.1"
FT                   /db_xref="HOGENOM:HBG562453"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C962"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL6"
FT                   /transl_table=1
FT                   /translation="MPSDDVKIVSCAVGRYHTVALAADGTVLTFGLNDKGQLGRAGTYG
FT                   VADGDACVCDSGGGCACGGEGEGGARIGGDARTQLAYEEGDACVGGAACRDGVARAVDL
FT                   SEFGTAAVAVAAGRYATAAVLASGEVVTWGLNLCGSSRGEADDAKNSSSDGAPPPITRE
FT                   SLLRDPRAAATPRLVRGLASESGGSKPVVVVFGYAHMAILTDDGELYTCDTGFDGYAGG
FT                   LGSKYTPNGDKRLGRDAPDEASALAPRRVHVGGAQGGAQGGADGGGSKVSAVSLGRCHA
FT                   AAATTNGEMFAFGCGALGGKDPRGFPVRVPDAPSDVYDVACGEYFTLASTADGGLFGWG
FT                   DGNSGQLGTSGDGKKDNAAVEIDLGARLGEKTRVVAPVAGYQHAMAIAVPGES"
FT   CDS_pept        join(1082854..1083293,1083375..1083739,1083863..1084437,
FT                   1084516..1084770)
FT                   /codon_start=1
FT                   /gene_family="HOG000262225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638288"
FT                   /orf_name="MICPUN_84511"
FT                   /product="Predicted protein"
FT                   /function="acetyl-CoA:L-glutamate N-acetyltransferase
FT                   activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69285.1"
FT                   /db_xref="GO:0004042"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="HOGENOM:HBG545264"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199C9DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL7"
FT                   /transl_table=1
FT                   /translation="MVSWEDSKSPKPGDLDGIGADKFVEFFRQASPYIVNHHGSVMVVV
FT                   IPGEVFVAKDILQGIVQDVALLQSLGVRVVLVLGSNKQVEEGLVDRGIGSEVVDGYRVT
FT                   TPEALEVAMEAAGRNSVLTQALLSRGINVAVTRRHGDRGNDASNGAGSATGVSGNFIQA
FT                   KRRGVVKGIDFQYTGDVVSVDVNAVRARLEMGDVVLLSSLGFNAAGEVLNCQAYDVAVS
FT                   VAVDLRADKLVSYLSPADMPRDATTGTRMKYMPLSVAEEYIIDIARHGAWSAETMEAVG
FT                   GTAEALPLPPPAGQSDADGWMLDSWRWLRTDGGDGMDNPFSVGSSPWQRLTERGLQWRV
FT                   EGCPQEVCAAVFSCKAGVRRAHLVDYTVPGALLLELYTYDGVGAMVSRDRYEGTRPAKP
FT                   GDWIHIKSILQPLAREGTTVQMTDEALIAEVSKGNFSVMERDGKVIACAALRRYEWNES
FT                   NNVAAFAVRPGYRNEGRGDQLLQYLESRARGAGIEKLFLLTTRTADWFVERGFIHAGAA
FT                   IDSPLLPPGKQAQEGRNSQLYIRTLKD"
FT   CDS_pept        complement(1084825..1085541)
FT                   /codon_start=1
FT                   /gene_family="HOG000251927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638289"
FT                   /orf_name="MICPUN_84610"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69564.1"
FT                   /db_xref="HOGENOM:HBG659267"
FT                   /db_xref="UniParc:UPI000199C9DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL8"
FT                   /transl_table=1
FT                   /translation="MDAVIDELTARLAAAAFYGDGDGDARVFVGIAGSPGSGKSTLASA
FT                   VRDRLNAAAGAEVCVVFPMDGFHYYRSQLADPDMFPDPDEARARRGAPWTFDARAFVDR
FT                   VRAARANDGTAGADPTRVPAFDHEVHDPEEDAIDIYPTHKVILVEGNYLLLTDEPWREL
FT                   WDGDGALLDERWFVATTVDDAMARVTRRHVAVGRTPEEAKARADGNDRPNGELVWASRG
FT                   NADVIVPSYEWEGAKT"
FT   CDS_pept        1085791..1086432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638290"
FT                   /orf_name="MICPUN_60925"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69286.1"
FT                   /db_xref="UniParc:UPI000199C9E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGL9"
FT                   /transl_table=1
FT                   /translation="MLACSNAPNQNEPPMRPALLLALVLAVASRALAGGAGGEFAVDVR
FT                   GDGEPLHDAAFDAEGGGGTASEPAGDIDDDSQAWTSEVEVTEEEGLDHADVASASQRRA
FT                   AEAEALEAEALAAAWAADADPEPEPRAPDPLDEERRRKLVQAEDAQWARERRAYADVDR
FT                   ISAQLDALGAGDYDAKTRAKRQGLQARLTAARTVVAQLEERGARLRAGEL"
FT   CDS_pept        complement(1086560..1088173)
FT                   /codon_start=1
FT                   /gene_family="HOG000265237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638291"
FT                   /orf_name="MICPUN_60926"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69565.1"
FT                   /db_xref="HOGENOM:HBG562455"
FT                   /db_xref="UniParc:UPI000199C9E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGM0"
FT                   /transl_table=1
FT                   /translation="MGSPTSGSKRKKTTEKGLRMAATVKEMDGSQGFDAVVVCTSNAAQ
FT                   EAYWQERLEATRGQAAKAGAVIVAVHEDWAADGAGNGLGTLYAYTKAKAKAALQGADLD
FT                   AVLASGGTVGIYHTAGKGTRLAPLPGAENNNKPGVKLPSLVEIAPGVTSELTILEAVVR
FT                   QTGCYAPHRAGRCSVFWGDQIFVPAAGHLPSGSHHADILAQMGPMPSEEEWTLKGLDKY
FT                   GLITVNDAGEAAQVEKVSFETANKLLASFGTVTSVGPSLGSFSLSHEMLAALLDEFKSE
FT                   IAGKQAKMDSDPHFWMPLTLAKDAYVSVMITKDETAEAAGAHHDRMQAFRAKLPGTRGV
FT                   FGAIDVGEGCYWWDYGQLKLYLTNNVLAMKDTEEAAALRDYLKIPDGGTQASELGAGVA
FT                   LAGGSIVLASKIGSGSVNNTIASHVTTGECNANGCMLINVTARKIHANNCIVYNVVDDS
FT                   EDGLVLPDGAVVTNVFMESGDKLVQTSSVTTDGGKVFKSRLSANPYSFNDVYKMNQDTD
FT                   VRAAYAKGAAAHAALAATIG"
FT   CDS_pept        complement(1088580..1089869)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638292"
FT                   /orf_name="MICPUN_53156"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69566.1"
FT                   /db_xref="UniParc:UPI000199C9E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGM1"
FT                   /transl_table=1
FT                   /translation="MGEETVAELRVPHVDDAVKRVSALDVAGDDGERADLAPADEEAAG
FT                   NTGTIDDVKGGDVKARAVALIDDDRLLQAARLLRAHDVHVPIIDPRDAADVKLNAFIPK
FT                   AAVMGDLIESLKADPRGPGTEWIVQCEHSGRRDVSIYYRMDKETQTKLTARIESPIRKD
FT                   MLVPFLSVLNESELYKSWLPNWTMPRLRVRRSDKLSQTGRCSQVVLVTVDLPWPFSSRE
FT                   CVLDAWGVDDIDASGDICVLVDSMTPGQTMRCGTIVPDVDEKSIVRIDFTGGFLFRKLP
FT                   DGWDAKRDATRAASSWFGTASGGAGSDVPESTGPESRRASFDSAHSDDDTAGGIDGTQP
FT                   CTDDRILVSVQMYMDPKLAYVPTSLLNFVIRTVMYTMWCMLLRVAEKVRDGRSEPHRAS
FT                   IAAKAGELYDWVRERTGAMLARIFAPQPVA"
FT   CDS_pept        1090018..1090968
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638293"
FT                   /orf_name="MICPUN_102021"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein bi