(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_14

ID   MICSR_14; SV 1; linear; genomic DNA; GRV; PLN; 1160640 BP.
XX
AC   CP001576_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 10, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001576.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1160640
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 10"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(complement(787..3915),complement(460..717))
FT                   /codon_start=1
FT                   /gene_family="HOG000265351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638387"
FT                   /orf_name="MICPUN_61664"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69888.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557065"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C563"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW0"
FT                   /transl_table=1
FT                   /translation="MSGYNTGFGFGGGRGRGRGRGGGRGGGGGGGPSPALLTANIKNAR
FT                   TLEELLGHCTAHRSKLNHIHLSAAWNSIGHKSGNLSPDWWRAHDDELRSLASHTAKVVS
FT                   ESSEVRAREIANIAHGVAKSGRGGDLADLMDALARAVEKRASDCNAQELANVSWAFAKA
FT                   DHCADVALFDALSKATLAKASACNSQELTNLAWAFATAGRTQDEALFASLAKAVEHTLA
FT                   SFTSQGLSNTAWAFAKVGHLEATLFKAISLAARSKLKTFNAQDFANTAWAFAKLGQFDG
FT                   ELFTALAKDAARHGEGHNAQGLANTVWSFAKAGHLDEGLFKGFASQVRRKLKDFNSQDL
FT                   ANTAWAFAKACHPDESLFASISGACVACLDDFNAQDLVNTAWAFAKLGHFDQSLFAAVA
FT                   RRFRDSGAMNDDQLGAQFIANVAWAFSKASEAGKLEQATSEELFRDLATAAEASVADFT
FT                   AADLANVAWAFANANQMDPTLFQSLANRAENFLDDFNDEELDNAEWAFARAGMHRIVKR
FT                   LKQNRKRAVEDAAAAKAEVGEVDVSGCGTIVVAGGGIGGAACAVALQKRGFHVVVLESD
FT                   PSFDARKQGYGLTVQRQDAVNAMGIDLAADDAPSTSHYTFDDRGHILGVFGEAFGGRDT
FT                   GKERKECKNSGRFIHIPRQVLRLRLLEAVRPGTIRWNSRLEGFKTSKKKPKSIRVKLTG
FT                   GDAIDAALLVGSDGIFSTVRRKLALPGDRLNYVGLMVVLGIVDDSILNVPLTKRRIFET
FT                   VDGSTRIYVMPFTTSSTMWQLSFPMEEKEARELAKDQNALKMEITRRCAAWHEPIPELL
FT                   ANTPLDGFSGYPVYDRELLEPGVLRKAATDAGISRVTLVGDAAHPMTPFKAQGANQAIS
FT                   DAVLLAETLADSVRKYGADEGFEKALPTFEQKMLNRSSRMVVGSREKAKEMHSNLALRP
FT                   ARKVQRETDVDMARVIKMLRAKGVGAKTSNDERGLDAVVADVMRLCASGGVMEVVENDD
FT                   KKQKRDRAHTSTDGKIPSKKQKLLSHVDGEWVKCTLIKTKENGQHKVKLKGGTKCSQRN
FT                   RYSLVKLYIDENELTSVPAKIGQLTSLEWLYLSSNQLTSVPAEIGQLTPLWVSYLDDNQ
FT                   LTSVPAAISERGAVLWAWIGA"
FT   CDS_pept        4098..4982
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638388"
FT                   /orf_name="MICPUN_61665"
FT                   /product="Predicted protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ACO69616.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniParc:UPI000199C564"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW1"
FT                   /transl_table=1
FT                   /translation="MVGETLVTLGFASAAGLRTRGPRSARTTFHGPLKKNTRCTAVCLF
FT                   GINFSFLRFGKKDEVSPTWFLDTKAPSARTAPPGFEKEVKKLRNAGVETHDFGVSYLQQ
FT                   EMRGDEVKELQRFLQEESFFMHRGGPTGHFDRETRDAVKAWQRKHGVVQSGGWGYQSRA
FT                   QYLTLKEPPEPLFGFDAGTSGVISNTKPWIQASTKKCTKAAVVTAPVNLPRPSTMSVAC
FT                   KGWAAFSAVALSACYARVLAWVEDDEAAAAAANDADTKWEREKVDAATSIDLAFEEAMR
FT                   RIDASYKRCIDRL"
FT   CDS_pept        join(complement(7055..7124),complement(5142..6799))
FT                   /codon_start=1
FT                   /gene_family="HOG000230373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638389"
FT                   /orf_name="MICPUN_102516"
FT                   /product="Predicted protein"
FT                   /function="IMP cyclohydrolase activity"
FT                   /function="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase activity"
FT                   /biological_process="IMP biosynthetic process"
FT                   /protein_id="ACO69889.1"
FT                   /db_xref="GO:0003937"
FT                   /db_xref="GO:0004643"
FT                   /db_xref="GO:0006188"
FT                   /db_xref="HOGENOM:HBG498048"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR013982"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000199C565"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW2"
FT                   /transl_table=1
FT                   /translation="MATSAVRATITMSRVSVRPAPRTGKKHVARDVRQRAKSESPNGAK
FT                   PRALISVSDKTGMTDLAEGLNALGYEVVSTGGSAKAISDVGVEVTTVDQITSFPEMLDG
FT                   RVKTLHPAVHGGILARRDLETHVEAVKKHDIGYIDVVAVNLYPFRETVASGGDFAKCVE
FT                   NIDIGGPAMIRAAAKNHPFVYVLVDSADYKPLIAHIKSEPSPEDDLKFRKRLAWKAYQH
FT                   CASYDSVVSEYLWSEIGEGQPAPELCVPMSLHETLRYGENPHQPAAVYTDDSLAEAAGM
FT                   GVGRAKQHHGKEMSYNNYLDAEAAFSCVSDFPTSDPTCVIVKHTNPCGVASASGSDGDI
FT                   LEAYRQAVRADPISAFGGIVAFNCELTEEMAKELREFRSPTDDETRMFYEIVIAPSYTE
FT                   KGLEVLKGKSKNLRILEAKPRTPSSTLRQVGGGWLQQSSDSLVPEDIHFEVVSNTHPTH
FT                   EQYEALKFAWRVVKHVKSNAITVATQGRLLGMGSGQPNRVNSVRIALEKAGDEAEGSVL
FT                   ASDAFFPFAWGDSVEKACQAGVKAIAHPGGSMRDQDAIDCCNKYGVALLTTGHRHFRH"
FT   CDS_pept        join(7559..7717,8098..9357)
FT                   /codon_start=1
FT                   /gene_family="HOG000020210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638390"
FT                   /gene_name="HEML"
FT                   /orf_name="MICPUN_61667"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase "
FT                   /function="glutamate-1-semialdehyde 2,1-aminomutase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69617.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0042286"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C566"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW3"
FT                   /transl_table=1
FT                   /translation="MSAMSASFTVAPVRHAQAIRRSRKATGKVSVRRGVVAKAVEAAPK
FT                   LVTTKSEAIFKAAQDILPGGVNSPVRAFKSVGGGPIVFDKVKDAYCFDVDGNKYVDYVG
FT                   SWGPAICGHSNEQVNAALKAQIDKGSSFGAPCELENVLGQMVIDRVPSVEMVRFCNSGT
FT                   EACLSVLRVMRAYTGRDKIIKFEGCYHGHADPFLVQAGSGVATLGLPDSPGVPKAATNT
FT                   TLCAPYNDLEAVKKIFEENKGEIAGVILEPVVGNSGFIVPDKEFLEGLREITKAEGALL
FT                   TFDEVMTGFRIAKGCAQEYWGVTPDLTTMGKVIGGGLPVGAYGGRRDIMDVVAPAGPMY
FT                   QAGTLSGNPLAMTAGIETLKILGEPGSYEHLDKITKRLIEGILEAGREAGHEVCGGSIS
FT                   GMFGFFFCEGPVRSFADATKSDTDKFARWHRGMLEEGVYLAPSQYEAGFTGLKHTEEDI
FT                   DFTIAAAKRVMARI"
FT   CDS_pept        complement(9524..13768)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638391"
FT                   /gene_name="FA1P"
FT                   /orf_name="MICPUN_61668"
FT                   /product="Flagellar autotomy protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO69890.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="UniParc:UPI000199C567"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW4"
FT                   /transl_table=1
FT                   /translation="MSGQPSAPKRTAQLELNAANLAQQRQQPFEARMPRIRGKAGAKDL
FT                   LPLGREGAVCSLCGMAGHDAEVCADRPAPKLTIDVSDLDTTQDPLEVSMSDLPDSPSAL
FT                   FPKPTAAEMLARRKQLEAEEAEAKAKEEAKKKALDPGPRMDGGGAEGGEPPPTEPRVIP
FT                   PKPPPPKKWGVPPPPKDKLPIRKEHTAAPPPPGPPRPFGTPDMRLDRMDLTKDLAGFEQ
FT                   ERARIREKAVHDLTEDVVDTVLSRDAAVNLTRESIENVIEKAAEEQAAELKRQQAEALA
FT                   KMGVGGDGAGPDAGSGQALVQEARAKKPLPGVQTPHSILPGYPPTEPLKPKPRARQPNV
FT                   IDDEADAVRDMVDEAIIGAIDANAADDNAVHDLMATVLTNVIEGPPPPEDEFPEEGGSA
FT                   ALEAALRDANEQTSTLRVRLEEANRESARERSEHFARVESLVMELHEAREEIASRTDAA
FT                   TEAELREQEALAAINALKAQYDAERQSAREDAEAVKVAARMASEAVAEEAKRAKDKLEI
FT                   ISRNAERDAARAKEQIENLRRQLDVAEIKAKKAADISSEALADAKGDLMHAREEVKEWA
FT                   RKARAADGRAAAAEEKANKALARAEAAEASEQRLLTLQRRTKEAAGRREELEVAAATAA
FT                   ATAVAAGASISAPKSKASGVATRQSVLGKSKQTAKDEGVDPALAKARASAVREAAQDLE
FT                   REKAAAAKAASDAKRLQRKAIEAEEASAAARAISAPPYLKGLFIASRAFVCASPDAAAE
FT                   AEALAKELGSLGYPSSVRPDGVDAAPARAKSAAAVVVHASADGDAGCQTEVAAAVAAGR
FT                   RVVALCEGSPPSWLGPGTVAVGPAGGAKAVVKQLGPPATLLERIPANSIAAIAGAGAGP
FT                   DLMGLAGLTSLRLPDASPAIVDALIDILKERTCTIRSLLLPGCGPDVAVRIASAAFACA
FT                   SCQSLSFGGASLPLGEIRKQGESLEALDLTADAGADGIGLRDAEIAALKAILGEGDAKY
FT                   GANVTKLVLPPLLSASQTRKVVEAIGCRALPSINGVPASMSVKEGASPYSLDIAGTPCG
FT                   VPGLVTLSGAVTKLAKGDVATLRFLALGETALGPKGGIALAEILRDGSCAGLERLSLPG
FT                   AGLGAEGVEAVCAALPPKLQALDVGSNGCGDQGAKAVGEALKRCANMKRIGLAANELSE
FT                   VGARALAPFIRDHASLEELHVTGNRVGDRGCSALAMAVRSTNAPIVKLALNENFNITAG
FT                   ACKSLAQCIASSRTLQELDLSKVMIGAEGAKALAAGLSESPALRVLELGSCKLRADGAK
FT                   FIGEALVRNLSLERLGLSRNSLGDKGVFELVAAGLQGSRSLRDLDLRHNSIGPEGAKRL
FT                   GAMLERKNFVLKNLELAGNKLDASTESKLVARAASLRTRPSALGVPRKALTVSKIVEGD
FT                   ENQEGMNIEVPT"
FT   CDS_pept        13939..14103
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638392"
FT                   /orf_name="MICPUN_61669"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69618.1"
FT                   /db_xref="UniParc:UPI000199C568"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW5"
FT                   /transl_table=1
FT                   /translation="MRALLCIPRFVGRNPGARASSPFPRKQRFFRGHGQVGPTCPAATA
FT                   RIRNPHSTT"
FT   CDS_pept        join(14215..14626,14729..15996)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638393"
FT                   /orf_name="MICPUN_61670"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69619.1"
FT                   /db_xref="UniParc:UPI000199C569"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW6"
FT                   /transl_table=1
FT                   /translation="MMIRTDRNRGLTPKRPQRTPGPSMPHPAPPRALVEAVRARYPLWQ
FT                   NLSLDNVAQARQHPLPWLLKTIEEMYDSRYAHDCAELEFIAGGDPDDADELIGAHPFPE
FT                   YVQGYCGRQYGVKALAEKAAWEVMCNAEAARSAGLHTSVDLFCAFCNRGYDDEELMFFL
FT                   YCRQTLLQECSRALPQTNHMAPKGADKRFVAGVPVPPMCPAIELTETRAKNITRSVFGK
FT                   NGGGVLYQAVRQLITDYFRERRDAIESEASSEPYAEKPKATMEAYYYLKLMLSAYRDTR
FT                   PDNAIDDGEFSYDDDEEYEEEAVYRASFDASPQGVSKAKDWSEGNGRGQGGAAGDSTAT
FT                   PASFVTAQQKMEGGTRGHTATPANESANEAVPDSESPAANESAAVQSTTKAMARSSIGK
FT                   SHHKSTDPKGESVRVVRRAITESCGKYCDVLLQVAQDLPPPVLAELKRKAVTALDGHSQ
FT                   ELFSGALAAAFGADSGNGAGPGGAGRIAQSEPDVVAAVSKSVTALLRKAQNGADPAESG
FT                   AAEAREVARLVLASRTIRSHVEPLLTRLLSELDDDETSGIVE"
FT   CDS_pept        join(complement(18331..20007),complement(18216..18254))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638394"
FT                   /orf_name="MICPUN_61672"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69891.1"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI000199C56A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW7"
FT                   /transl_table=1
FT                   /translation="MSSREPSSAGPAGPGPASDVSENAGTTKASIRGALAAHVQSLGWE
FT                   EREFSDVTVTALGKVSRQDDFEAPNPLLNPAMSRPRETSNNAPKPQSQQEYPLHRLVLS
FT                   RSPYFSVLMRGPWKDATSPTLTLEIQDPLVDEAAVEVALGFLYEKVPEELTPELATRTL
FT                   AAASFLDLQDLCELCADVIVSDIRTETLCEYVKLTTLSQYKTVHDDLVGPDHARNDKLV
FT                   SPYGKHGDKIKDACWGYMCQNSSRILKPGIDLFSNTNSDFGYAAWGSIVPALNLGLVEH
FT                   LFCSDELHVEDERDRFLMIVKTGGAILERLMRGEYHDNGGDDDHARKQCDRIERLIGLL
FT                   KNPSSDEHVTRDDDVPHHVKYLCLKVLASVVYMGSKVRYEHVEDATDFDVTHIHINDDW
FT                   KFSGEKVSTGFPLEERTLRWLEDIFPINADDLLKLLCLDLGIQTPKESFYNGFHAHKQN
FT                   TRYFVERLMEKRKEIAKPLTVAAAGAETAARRLSEMGVSGSGNTLTELAPEGGFEWTEH
FT                   ELDIFDGLRPFRFSVTFPNILNLNDGQARHSEEKFYAGSLWKGTTSNLRRRCQQ"
FT   CDS_pept        complement(20249..21220)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638395"
FT                   /orf_name="MICPUN_53628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69892.1"
FT                   /db_xref="UniParc:UPI000199C56B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW8"
FT                   /transl_table=1
FT                   /translation="MTLPVVVLPGNQTLPKSSKSPQQRCPAAVPRHSFQHPSARGPRVR
FT                   VRRVAVTMAVTTKSDGQMERMNLAEYEQLLKDAEAKVADAERRAEEAESRSRDREAEAA
FT                   EAFEAWRKRLVEVAADQVAEEASEWQKVVEEKDAEIARLRAAATEGPPELHTRVAQAEG
FT                   RASAYERLFFNHVEFIRECARRVPESRSYWDGVGHELRAATEKTEAALRGEDPPTATSG
FT                   GVDADDDGDGGGVEGAGGSGTSTAVQTPSGGSTPLTSPSKPRVNRGVATEQAAPVLQPE
FT                   AAKERQRAEDAARARAELESRMASGGDGGNAASTSSWYWPFS"
FT   CDS_pept        join(21219..21350,21434..22042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638396"
FT                   /orf_name="MICPUN_61674"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69620.1"
FT                   /db_xref="InterPro:IPR010756"
FT                   /db_xref="UniParc:UPI000199C56C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHW9"
FT                   /transl_table=1
FT                   /translation="MAPRNLRKKRVADSDDEEDEQGAQALRERMEDAKTLIKNRVKSKG
FT                   VGAEALALGSGKKDVDADEDADDGKHAQFAAGAAVDVDGEDPNMLRYIEQELAKRRGAG
FT                   GDEGGDGAGTSGGGAKSAEERLWDTPDELRVKKTEGEETADRWLTGIVEVQLPADYKIK
FT                   NIEATERAKAKMLEKIHGGGDGAAMDHPHSRQAELAASRAALRVEDDGGFQKAEASANL
FT                   KLQRKEFATSFGRGFGTKAKKPRH"
FT   CDS_pept        join(22325..22858,22981..23457)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638397"
FT                   /orf_name="MICPUN_61675"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69621.1"
FT                   /db_xref="UniParc:UPI000199C56D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX0"
FT                   /transl_table=1
FT                   /translation="MSRRAGFTGSARERWSRNPSRVESDSEEGEEATTDESPDAYRWGP
FT                   YPFSTYSLDNEFPAATRQLALNECAREFRRYYEGLQAPNIHLGFSLMSFVFMLRLLKPV
FT                   LFPGYSVPFEEGWEYISDGCRVTHVLENAVPWVLTIFLLRFGFQSHSGTGRLLRPPHVI
FT                   WYHVIMILLTMGSCARHTLQCPIPGGMKVELAMRLFVVIGICVAWRPNVPWMAASRFSC
FT                   WATYVHLVRENRPGVLAWWPLVIADFCLIVGLPVFAAWKLEQKARRMFFDECAMTSVWS
FT                   NGGGFRGRRAARSSGSRSRSSSHGAATPRRMPSPPPLPERRSWWEEVIGVRAAQG"
FT   CDS_pept        23769..24536
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638398"
FT                   /orf_name="MICPUN_97921"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69622.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C56E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX1"
FT                   /transl_table=1
FT                   /translation="MATSAPARVLPSLLPDGSGGGDDAGIYACLFDMDGTLCDTDPLHH
FT                   EVFSNLLLAHGKNGGVPIDDDFFHKHIAGRTNEDIFADLWPELSVPEREAMWEKKEEDF
FT                   RALAATKLRRLPGLTELLAWIDARGIRKVAVTNAPRPNAELMLTSLGLDGYFEHVVIGT
FT                   ECTKAKPHPDPYLEGMRLVGAVDASRCVAFEDSPAGAAAAVAAGIPTVGVTTSQPSSAL
FT                   EGVGVSLCVKNFAEERLMLALESRGSREDGSGA"
FT   CDS_pept        join(<24881..25189,25498..>26652)
FT                   /codon_start=1
FT                   /gene_family="HOG000245621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638399"
FT                   /orf_name="MICPUN_67708"
FT                   /product="Predicted protein"
FT                   /function="DNA photolyase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO69623.1"
FT                   /db_xref="GO:0003913"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="UniParc:UPI000199C606"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX2"
FT                   /transl_table=1
FT                   /translation="RVVVWFRNDLRLQDNYAVKQAESIATRTAGCDVLPLYVFDPRTFA
FT                   PSSWGSPKCGGHRGRFQLESVLNLKRNLRAIGSDLLVAVGKPEEVIPKYLLDAPGAKNE
FT                   EVCSEELRVDAKVKSAVKSAGNLNRLDKIWGSTLYHKDDLPFRSDASDLPDVFTPFRNK
FT                   VESKSEPREPVPPPAKGALPVPSDMTEAFAFEPTVADLPFANEDERAIAAAGAHPDGVL
FT                   PFEGGESAALARVRYYVWESEKIATYFETRNGMLGGDYSSKLAPWLAHGCVSPRQVVAE
FT                   VRKFESQRVENKSTYWLIFELIWRDFFKFFALKHGNAIFFSEGTAGGKMGGAGYKGGAG
FT                   PWRDDPAALAAWKEGKTGYPLVDANMRELAATGFMSNRGRQNVASWLALDAGVDWRLGA
FT                   EWFENKLLDYDCSANWGNWVAAAGMTGGRVNKFNIAKQTKDYDPEGEYIKYWVPELRKV
FT                   PAKYIAEPRQMPGDVAQSAGCVIGVDYPAP"
FT   CDS_pept        27519..28604
FT                   /codon_start=1
FT                   /gene_family="HOG000264497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638400"
FT                   /orf_name="MICPUN_108959"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69624.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG597124"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000199C607"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX3"
FT                   /transl_table=1
FT                   /translation="MSSPKDAAAGVPATSTVLKIIGCVVGVVGSLLVYGILQERIMTRP
FT                   YGEGEDEEFFTFSVFLVMNNRLVSMCVAVIVLAVIRGAVAPVAPIYKYAAVSCSNVIAT
FT                   TCQYEALKYVSFPVQTLGKCAKMIPVMIWGYFISNKRYGLYDYLIATGVMVGCTIFALY
FT                   GPTTSSHGGSSKKSEKETGMYGIALMGGYLGFDGFTSTFQDKLFTGYQMETYNQMLWVN
FT                   FCSAVISSFWLMSDSSMGDAIAFVKKHPAAMSDALVLSAASTLGQLCILFTIKEFGALL
FT                   FATIMTTRQFLSILLSCILFMHPLTWQQWIGTVMVFSALYGKVIIGGMKKKEPKPDKPD
FT                   PEVGYGAEERKGLMEGAEKSS"
FT   CDS_pept        29257..31017
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638401"
FT                   /orf_name="MICPUN_102525"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO69625.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199C608"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX4"
FT                   /transl_table=1
FT                   /translation="MDFLADASFLQTPLAEGLGLGSDVKSSAGGRPMVHRGFAARAREV
FT                   RAHVRAAWRRARERGDRFVLCGHSLGGAVATLAAVAILAEADDDESRSAAAEALRCVAF
FT                   ASPPVGNSAWRRAVWERGWGPAFTNVCVPEDPVPRLLFTPRRGATVDAPRQPPTRDTSR
FT                   EANAARRLPRLVPMTQRRSDETQGDAGGGTGKSSYLRAAGRAIRPEYVHLGPIHHLLRG
FT                   GRIVSSDAHTISDDEGVAGAAGGDVAATTDETREGGPGAIAAVRHAVLRHTMRTYRARM
FT                   VELCDGAVGAKPGSHPRRPPSSTGILPRPVGTAIDATPNPRPMIAVAVVSVGEDGASFA
FT                   ASTSIRGLDLDLCDVKAGVKAEVRGWPCVVAHTSPMCSPSELAVRVSAPSFNGEKLPDA
FT                   DAGGPSVFGWAPMILSCGGDFGDARVGVRVTPRRVWVTAGDDVDVDDVTDVTDAFRETD
FT                   GGWIDFRSVVSVERRRWSIRRLLGSLGGAPDRPPAPGDVFVVVTAGDVAEDGATVRVTP
FT                   GTNVRDARRALLGALRRTERDALAHAADALFDDPRRRKSPFRQGFAFGAAAAAGAAFGA
FT                   ALRRDFEGEG"
FT   CDS_pept        complement(31341..33554)
FT                   /codon_start=1
FT                   /gene_family="HOG000264494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638402"
FT                   /orf_name="MICPUN_61679"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69893.1"
FT                   /db_xref="HOGENOM:HBG557107"
FT                   /db_xref="UniParc:UPI000199C609"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX5"
FT                   /transl_table=1
FT                   /translation="MSLAISSTTALKGVRLSMTRGARGTVASRRVAVRVNAVSADRGSD
FT                   SKIQVGVRHSMRVTRLRDIVEVSPDLWGPTESSAVPSKKARRGDGLTQATIFKELLLAS
FT                   KHFRLYSQKIHGDGDVYGVRFLMGSPRMEGLDDVFRVTRCVAERDEGLMNLVPDSSGMM
FT                   VAEIMFPLAMPLDNTIEDLSSLVRAIETQIIEESTVCLMEKGSDDRSVFHGERRLNKYF
FT                   TGMYARAPDLLHRGTCTSSSPTPGALEASKEMLHRLWEGEESADVVLIDEVRARVEELF
FT                   CGGNGRAVVHPSGTDAETMPLLQAVLASRALARRVPELDRPVDFRDGAQRGNVISLVAC
FT                   AGEVGSGTTEAAEGRFFSKAVPLGGNRVDMGQELPALHDLAAMESVELVARGGDTDVGR
FT                   GKADYDAIVEAKAREALASDPAAVVVLHTVAGSKTGLVMPSPAVADTLVAEFGERVVSV
FT                   LDACQMRHHPNLIPRWLNDQGPILMTSSKFFGGPSFGSAVFFPHRAVETMNDQLGEESP
FT                   ATVAAIAEACASYLTHHDIGDVLPKLHDAMPPGFCNSGVLLRWAAGLHEMETLNDATEA
FT                   NGGIANTEKHVRAWVHAMREEAQKFSPHLEYVPAVDYEGDWQLGGVNTIIAVRLRSGPD
FT                   EDFFSTADLKKVYALMTADLTEFISPESTMAERRVASQKCLTGQPVDIPGGSVLRTVLG
FT                   AAQLKDLVSGKQPLDQMIEDDRVLLSKLALIARQYDYLLSHSL"
FT   CDS_pept        35659..41205
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638403"
FT                   /orf_name="MICPUN_61680"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69626.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C60A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX6"
FT                   /transl_table=1
FT                   /translation="MSLLASLFGAGKSGSAPPGPVSSVARSDGSKRSGGSAAVNAVDLG
FT                   EMRAKAATDKLRVVNEAIAEHDTYLATLAIYERLITVYRAKKAGLEALAAARGAMRDAV
FT                   DAVTTPRAGITETNGANEEKGTGTRYEVSPEELLEQLGPEPKPPAQRSPVNEPRIAADG
FT                   TEGPPIFLLACAALEGSADAARVLPELLKRGADANARGTRHDHGADVPALCLVVGAMEG
FT                   VAKIVAASEEAAEEDVDGGCQRRTSTDADDIVNEKADDVDNEAVPRPTRTRPASADDLA
FT                   DFATALLAAPNLDVDAVGRLGRVHESARNGHLNARYRGLVPYGGAVGSEGTALFLATCA
FT                   ATANALDGDSRGAVAAVHVAARLMGSGADVNAIGARPGWWARCGPRLTPVSMCLAALEQ
FT                   TASLTDRAAYVSSRVAIASLASALIRGHGFDHAVEATFSHRPDADELRVRRVAPGDAST
FT                   IHTGTTKNFGSTSSNAPPVYASGPALWHACCAVVEGAGAPALSLARELLEMGADPNCVG
FT                   SRPGHCAAGTPALAMCVAALEGRAAEDGKKAWWPSTDGVAGSRVPSTLSVRASVSDGAT
FT                   TDGGSAPSTSSSRRDASGGGKKLHPVDGEETSETDAEAEPREEISWMARMIQSAADTAA
FT                   EIGEDFASLQKNIADAAADVVNAAAAAVGTTLDSHDDRERRARTDALELVKALIARGAD
FT                   VNAPMEIRRPHAEDLITRNAYPLGLALGVYAEKPEITEALAAAVKLLDSGADVNAVGVA
FT                   NYPVVAPPLHVACVAVHKDLPLSAMLFDRILEAGADPSACAVFPEGSECPPVVELLHAL
FT                   REGERDRVLIASMIERLIDAGADVVRSHPEVYLPEPHPAYAAKERDFGIAGDDKRPVTD
FT                   QSSTNDPMDTNGSDVEDAESALGRSARRQAASFVDARGSGAGSVSGSSDSEGDVSMADA
FT                   SDAGENDGENVGATRPKHRTRVGTCEYTPLFWALEAVYGEGHDEARQCVEWIVERRGWE
FT                   VDEQQGLNHQSWVEGSLVACAVAAAVEAAAPIDELSIPPAPPGADPKGVDSGGSQATRP
FT                   AGDGTSPPLASLLEGWTGHRPVTDQSPTDAARAAVGSPSPGAPLAKNDRADVDEGPVDN
FT                   VERAFRDPAYHHPASLIHHFPDIAHHNLLLERTREEMPQTKPIQKIVKLGALGRFRGRT
FT                   KGILGASRFDKAAQGRFAPVEKAQAQAKADAVSDRPAEISAEEAKAGAAPIPAATTVTT
FT                   VTTPPTDDAEPPRALTARDAALHADIDAMGAPSQAGDDAESPEPDLEPSAPIEYVPFDP
FT                   VAHKARAVARRSSRLSACIKTANIMVRHCKRVDAGAVNPLLAELGAGALTPFEFTPLFA
FT                   ALHGAACARGREQLIVALHFATTLLDAGASVVGEDNSGRHAPLEGVGGAKNAGRNLKGD
FT                   SAASSTSALRSYPLMWAAAAVLRSDYPYQKVDDACALVKRLLVAGADPSEVNLRVSVPG
FT                   DETESGPGGFKTGRKASKEGLIRGARVLHLWDERALLLEIHSADAWQRALTLRMKLAEM
FT                   LSQAGARSVFRPKTRPGDLAKTALAAEARNRRFDSHDGDAHPWTKDEADAAALMERASV
FT                   PTRYHGWRRPVDDDEAGPRDDHLFSRGDLFHDLRGRHTDEVPGYGAPAIIPGATRIVVL
FT                   NEKDEGKAGVVETKKVSRDELVNERDVPTSVLVSRMTIEADAKVAADKIYAAEGRDAVR
FT                   DLLGRDNDSDTDDSDTDDEYDDYHRANDDRNTAKAKTRAQLAREKWRRSMDKVAHGRTK
FT                   SDQIALRRMRSSDASDKNRSMGEMARMALDGLREVVATNVTSLRLGSGAGGGDEVKYFD
FT                   DEADWLASSSATGRRRRQPTVRRELYGPHTERL"
FT   CDS_pept        complement(41323..42252)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638404"
FT                   /orf_name="MICPUN_61681"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69894.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199C60B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX7"
FT                   /transl_table=1
FT                   /translation="MASSERDSTVIVPDNLEEVRARLEARRKKQLERAIAARADYEKRM
FT                   EEEKAAAAKRAEEAKNPQKNKADGKKEYPKPKPQGEMSPTQQQKQNGQGKKGGSAPGVS
FT                   AKIIAKNPAAAAPKASAIDANAKFLAAAAARAASVDDGATLEPTIGAGNARKPKANTPA
FT                   DPKSFEEIMAEKQAKPAEAADPNLKTKTMTVKSGDEELEIKYSVHVPEEAKKRLEERKR
FT                   AREEAKGSPAPEDKAPAAESAKEPEPPAEEEKPKKKAKAAEAKEDAPDFSGMKVADLKK
FT                   ELVKRELPVNGLKAELIARLNEYEASRA"
FT   CDS_pept        complement(42384..42878)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638405"
FT                   /orf_name="MICPUN_61682"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69895.1"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniParc:UPI000199C60C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX8"
FT                   /transl_table=1
FT                   /translation="MEARASGLRGRLAILARRAIHPAMPRSHADAPAASLVHVDVTGSH
FT                   GASTRHRAEVWATERASSRGFVATTVSMSKGDADAPRQFDPDDILAPLREKVERDMAGL
FT                   TEQTPQQAALERERARREEMAEAFEDEDGKNRVTGEWNGPRGPEPTRFGDWERAGRCSD
FT                   F"
FT   CDS_pept        join(43066..43467,43626..44528)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638406"
FT                   /orf_name="MICPUN_61683"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="riboflavin kinase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO69627.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008531"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="UniParc:UPI000199C60D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHX9"
FT                   /transl_table=1
FT                   /translation="MAASVRGTPLAALTRASTHPRARHSAGHRGASSARISRAAPPGAD
FT                   AAATQKAAHVAEITARRDEMVAGCVSCTMPDEGDRGDFLADVALGGRSVEAKGEGSSLR
FT                   VLVVGAETGKLAKSLMDRGASHVLVIDHSQAMLDRAAELFDPPSTVGNVPCVRFLRTDV
FT                   SDVKPYEGPFDAVVFNDSLASEHDPADALRRASLLLQPGSTLVISQRLDDVDHTPALPS
FT                   MDVAAMIADLPLEAAGSAAEGKAMEREGWLAAGASSASAARTEDCCGGSCWTFEVPPLY
FT                   AMRDAVEMRAKVVSGFGRGSKQMGTPTANMDPTVLAPQLERMRRGVYFGFARLPDDPDN
FT                   DSWSKCVINVGQRPTFADGDGVTIEVHVMRLMGRDFYGETMECVALGYLRPEMRFKGLR
FT                   ELVGRIMTDIGLARNALDAESMRGAVDGKNSWSAD"
FT   CDS_pept        complement(44777..45079)
FT                   /codon_start=1
FT                   /gene_family="HOG000264486" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638407"
FT                   /orf_name="MICPUN_108963"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69896.1"
FT                   /db_xref="HOGENOM:HBG557140"
FT                   /db_xref="UniParc:UPI000199C60E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY0"
FT                   /transl_table=1
FT                   /translation="MLIMKADQAYPGKFDWTYNVRDVLERTVPPGTSWKDVNQAEKPIE
FT                   GGDQAIWRKGAFEVLRLDTNELLYSKYNTGEHLVDGKGGPEGKLGSFIDVVLGSQ"
FT   CDS_pept        join(45659..46451,46529..46533)
FT                   /codon_start=1
FT                   /gene_family="HOG000265217" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638408"
FT                   /gene_name="CYCD1"
FT                   /orf_name="MICPUN_61685"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69628.1"
FT                   /db_xref="HOGENOM:HBG739099"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="InterPro:IPR017060"
FT                   /db_xref="UniParc:UPI000199C60F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY1"
FT                   /transl_table=1
FT                   /translation="MIVTNVDNFYVTDDRIINSPSRERGVSEEDEFAMRVHGCELVQEA
FT                   AVLLKASQQVACTGQVLLHRFYAKRSMVKFDVRRVAATSVFLACKLEECPRKLRDVVNV
FT                   FHRMSRRREKKPLTHLEYFSKRYEDIKADLVRVERHMLREFGFCIHAEHPHKFVLNYLR
FT                   MMGQDSAMMNAAWKIANDSLRTTLCIRFKAYKVAVACIYLAARKLRVVLPEDPPWWDLF
FT                   DVTKEQIEMMCESVLAVYELGKTEYVALGPEPPPGATSPTKPR"
FT   CDS_pept        complement(46826..47746)
FT                   /codon_start=1
FT                   /gene_family="HOG000068104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638409"
FT                   /gene_name="PGP"
FT                   /orf_name="MICPUN_96626"
FT                   /product="Phosphoglycolate phosphatase "
FT                   /function="phosphatase activity"
FT                   /protein_id="ACO69897.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG646794"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI000199C610"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY2"
FT                   /transl_table=1
FT                   /translation="MAVKAEVNQLKDGDKKGLVDSVETFIFDCDGVIWKGDSLIEGVPE
FT                   TIAMLREMGKRLIFVTNNSTKSRAGYLKKFLGLGLEITAEEVFSSSFAAAAYLESVNFP
FT                   KDKKVYVVGEVGILEELDGVGIQYLGGEADGDKKVTLSPGQLMEHDPDVAAVVVGFDRN
FT                   VNYYKIQYATLCIRENPGCQFIATNTDAVTHLTDAQEWAGNGSMVGAIKGSTKREPTVV
FT                   GKPAPFMLDYIANKFDIRKDQICMVGDRLDTDILFGKDGGLRTLLVLSGVTDEATLKSP
FT                   ENEIHPDYYTSKLADLLTIKASVNA"
FT   CDS_pept        48159..59471
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638410"
FT                   /orf_name="MICPUN_61687"
FT                   /product="Mastigoneme-like protein "
FT                   /function="receptor activity"
FT                   /protein_id="ACO69629.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="UniParc:UPI000199C691"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY3"
FT                   /transl_table=1
FT                   /translation="MGRRSRGGALAVLVILLANVLTLAAAPEEVQPDREGAGGARWAED
FT                   DEKRASGDDARGARGFSPVDPRRIACATPDVDDADATRYLAALDFDIGVLDPPFHPLTL
FT                   EYVLSIAPNALAPRSAPGDASASPHAPAAFLGVRALACDPEADVTVGNARARREVTHRP
FT                   RPGGAFDVLEAAPSDVEATARTPLARGDTVVRIAVHVGHDDEDAEVDARTVYTVHARVL
FT                   HENEDEAFEAFEASDVADDQSRDESERLRERTRRARSVASETALERAGWTVVPAPLRSA
FT                   PSAPPPGMPPGFVAIGSVAARADAFPGVATAVDAPGPASSPGGASGTNSEWTLEIVAVP
FT                   RGGTTSLLREEDLDGRTSMGPAGARMVGPVAVRMGSAANRARFSFRLDAKPSMGAGSSL
FT                   SLLYRACVVGDEACADAPPRRIALDVVATPPAPPPALVARISRKSPRPFSIPRPFSSTI
FT                   PGPFSTPAATPHGSAGRAARRWLEITSLPSRGTLVLCGVDDGEDGDHPRSGSHPSLSFA
FT                   VIDRPRVIAGDMSGTPARVAYVPARADDPRERGSLETRARAACESGHAPPATPIPAGPR
FT                   ARKAAARRALLGEDDDARRRRSPATTTTTTDGFTYRFVSEGLPSPSVPVTVYVDDEDDD
FT                   ETNRSTPAPRQTRRLLAEQISPSTASTSSVGSSATVTVPASAAAASSPTCVEVAIGDAV
FT                   DDWTCAPSVQPGDRKLGHAGPITCRKPTYEVTIVPTVSGASEDPVSCVVVGATYDAGES
FT                   CPLDGVGDETSRVRGLSATFASIPATLVGLSACAADAVLTVWARSTCAVDVQLTVRVVR
FT                   ASPELDSGLYPRKRLADCLHVPQSTLYVCPEDSTQAPRPASCPSSIASGEGDVLVTLPA
FT                   TVASTPGGGVDVPDTLTVRWEVFTAPHPDNALVYQYEASDGSRGARFLSGHTSPVRVTD
FT                   PGGRVIVTPTPRGGAAGARAWPGSPAAMIRYVACVVEDGTCANGGVAEIDVSARPRVFV
FT                   NDVLTTTKGAISEAFRLDARDSDGDSLLYVITSLPADLRGVKGTTRFCADGDPDTLTCK
FT                   GSPYSLTQSCVGDCLILCSAGAQCVSCVESNQLVCPGSQTPARNPLIYYTAGTCEECGG
FT                   RPVGSIQFKVYDGAQFSTPVSEPGAQIDFHVNAIPVATSPGAPVGLLARIPADCDAECA
FT                   ADCAAVCARSCAEYRERHTGVAAGVCEANNLSGECDAAACEATCAVARCESGYGFAYQL
FT                   TGTDDDNDVLSFSVIGVPFYVRDNGDGTATNVPLGKVYQTAPGNVNQIISPDQNPSAAG
FT                   DWGAVADSNGVIRYVPAKDSHGRPYGGSINGAITFRVFDGFSTSDNFGEVTFAVDTPPT
FT                   ATAVHSTVNEGGSLAMTLAVADPVDCPSGQCGRLSDGTFSGAVKALVTRVSPAGGAPGL
FT                   FIHPPDDTPTATPVELRCDGEDGACDPPLDIRDVKILYVPPPAVNPAVSLAPRGTESTR
FT                   GVITVEYVADDGALRSTSVASTITYVPKPRADDVVIRVTPLAPKTLVPATRVPVSEMEY
FT                   YSGVTVGYVRVSLPPTDATLSFCGDQNVADADRVHTMLYSLQPSTEGELWSLQAPSGYG
FT                   GAFYDSNGNLIDEDEPTPGAQYVTSLSSMQVNPSYFGQQVEQRVDNEPRQVLFLPKAPA
FT                   HGAPGYNTSFQFRVCVTEASGNSRVCDPDKYSDIATATVVVLPHNLPPVAVAPPTPPTL
FT                   REDFDAVEGVLITLGGSDPEGETTQAQIVIPPGFSISCGDNSDECGSLWQVDFVTGKAT
FT                   NKINPDDCDLSTPCPVTDPLSRVRFIPDVGGHDPAGPNGAPYVTFSYVVTDGVMLSLPV
FT                   EVSVRVNAAPVIPSAIRRVFVDEDSSGILPVNMLASDSDGDELTVQFIELPGAYGKPEF
FT                   FHVESGAKGAPMDSGRLPVSNRPGSLQVWFEPPYNTSGDKFGCCLHRECPTEILRLNPT
FT                   TQQYLQSTCQECSMCATVNTACECDYNCCPQRHFYGKIVYGIKDSFGMRSKTNGEIHLY
FT                   VRPAPSAPLVMPDYTVVAYEGTPTEIDLHAADNDSFCYEENVTYISGYTVIPAAFPGLP
FT                   DTVVTQYDWKYVVKCNEEVLSAVLVDAPLEDEGLGTLSTPDGVPPGNLYKVQQAYSTYA
FT                   QFPDAWFGPGSGHPQEISRTEAVAEGRAMWLMGTTKVVYTPPPIAAGYPFVTLRFGIRD
FT                   TTTKYSPRTTRVRVVVRHKLDDRLSRFVRLPNWYFRDISTSKLANETVDWWLYPYGFNA
FT                   SFIPEGLRDGTHWLTPKRRDEMGAFLMPGGRNDIGQLGLGHAMNLRAPRLNDDADVKPL
FT                   ELERLSAGEKSTLGVSTAPGNSSRGNVYSWGDGAHGRLGHGDVYPRTSPTLVRGLAGKN
FT                   ISAVAAFSGHAAAVTATGELYTWGSDSDGQLGRPRRPGSLRGPAAEAFDPVVKASTEPM
FT                   KIHRVTAGGLDRHDVIDAAVGDAHTLALTADGTLWAWGSNRAGQLGRLDCAERSHHPKG
FT                   QPRLANASDPDSPVVFGGYEKGNGTGCEAYGAPATGRIATPGPLELSLRFRPYRGHPME
FT                   RLRVRDMDLEPVKFRAVAAAASYTVAIRADPAPGTPEAAAIERRRDAVLDKPPPLDLIS
FT                   DPIDMGDEEYTAAAATAGGQVYTWGYGDVGQLGHGLGFVPVGIDNIGQRVMVPTPVRAL
FT                   EGVDAVKVSASRYHALAVSRDGRVYTWGGGLYGQLGHGDRYPRFEPTLVAALIRVNITD
FT                   AVAGTRHTVAVCDLGEVYAWGSNEFGELGVDPRPVKPNEGMANPTLTLRGWLFGDAPTP
FT                   SYAANPPPPTASPGAPSGKKRRSVLGMDTEEDPTGKFDVIFERLRDDVDESGRSGMTHA
FT                   SFGALIAGVKPAIPPPWENVNGTLDELVNQRFGSMLGQSRDSAGVVEYLTLPRLVRGLA
FT                   QVSEVAAGDGFTLAVRKACRPGTYLDPDTGACVDCSPGTYSDDLSSLECTPCPRGQAAT
FT                   TAGSSRCTPCDPGHYASETGTAQCVACPAGTFVGFGGAASADQCVPCSPGTFADAPGAA
FT                   KCEPCGAGTYQELSQQIACVPCPASTYLPGTAARSRYDCLSCPSGTFRAGSGAASCDPC
FT                   AAGTFTETPGSAFCWPCPVGTYGEGEGNTACESCPAGTYGEKLAAEKAGECPPCPAGNF
FT                   SDSLGATACGACPAGTFSDVDGSTECVDCPPGTYGVEEGADSIDQCLNCPIGQYNPGSG
FT                   KAAEIDDYGFLTECFPCAMGTFANATGLQECFQCPPGTHLNKTGSIREADCYDCDYGTF
FT                   APVGGMDECLLCPPGTYMNDVGATECTGCDPGFFNDDFGSGNLTSCRPCPPGTYSDVVG
FT                   TGNCMLCPEGEYNPNYAQTECTKCLEGFYLPVKNSTEESACLPCPLGTYSNVPGLGQCL
FT                   ECPPGSFSEKEQAVECELCEAGTVYGLPGGNSSLQCDACFPGTHAPVPGMPECLPCPAG
FT                   SYNELDKATECTPCDPGLYLPFEGSKNAEDCVPCQTNPVGTFAAEPGTAKCAPCPVGTY
FT                   ADEEGLKECKKVPEGSYLDVSGSNSSDARTLCPIGTFAADPGAAICTDCPTGSYAENEG
FT                   SVLCTMCEPGYFLPIEKATSRDQCRRCTKGTRSAAGAGQCILCPPGQYGDKEAMPECIM
FT                   CPPGTFNPNAGEESPAACVDCAIGYHNEFPGKALCLPCPAGTYGNLTGMPECWKCEPGT
FT                   FISVEGSIFPSDCALCPMGTYSDQHGAGQCTQCPPGTFNSYEGQDVCTLCPPRTYGPES
FT                   GAKSIELCEYCPRWHFNTTPGSSRVEDCVYHHSPAAGVFTRVAVWFAVVFACIAVAALD
FT                   ERDYSIYR"
FT   CDS_pept        complement(59564..61669)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638411"
FT                   /orf_name="MICPUN_61688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69898.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199C692"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY4"
FT                   /transl_table=1
FT                   /translation="MSTPEVTASAERDGSYVIRVKLPGVTSAKEVSAVVEDDPANGGCR
FT                   LEVVSPPEAHRVPRYRLSHPVPFVALEGTSPDVKFGKKTATLTVTFERIDEVRVPGLEH
FT                   FETNDALYLATHPTKGRCVRARREIKPGETILRCDPFVHVVHDRRREDHCAGCFKTLQS
FT                   SCVECGDFCGVKYCADDCRESDVAHVAECSMVRTNAGTGADLRGARMCLRLIHKRQTDP
FT                   ARFAEVMAALRCEKKSPSPAATKLASAVRHAAALDPSEVEDMLGKTRENSHGVVDWKLR
FT                   QLGTGIYPEASMFNHSCAPNAAVSFGAGGTLNTCCIGVDDYEARAMEVGPKGYVPLGRP
FT                   RAIRKGEEVCIAYTELYRPAASRRLTLEKSKGFVCECVRCANASVLRALDTELHAATDG
FT                   NEEVADEKAKEWEDGIDASRAAYAIGDFKGAVESAERVLESSDGVLRDGHFLRLEARLA
FT                   AIEAHIEMASRSDQKCKAPGWRKVCDLCVPTLQHLMTHLPFYHPGTVEITKHFGLAMLM
FT                   VSAELADGQPDYRVRRDLDYYRNHDSDVISLPNHNLVKLWINSTSAFITHGTVAQKVYG
FT                   VTPFRVLSGLNAPDDRMHYMKRVGGDEYNIAAIIKETTNAGYGEKVRVDYAFMDGSLPP
FT                   LPKSFSNFRAPLSAQMSPVDQAANIRAYGKLYNMEPKWIKHMLEDLEEYHEMVASEMLL
FT                   REIRGMH"
FT   CDS_pept        join(61807..61857,61992..63067,63138..63159)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638412"
FT                   /orf_name="MICPUN_102532"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69630.1"
FT                   /db_xref="UniParc:UPI000199C693"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY5"
FT                   /transl_table=1
FT                   /translation="MGSYQRDDFLAFIQRVLGKDYTRLAPVLKTLDVTNARQLRHAIAA
FT                   PYDPRVEGANLGTRPEFHHHLGGPCVLNALLAKSGRHPPLPTAALRDLAAATGGDDVDA
FT                   DVEDMHPAASIAVYASTLAERRATSAELRGVHARDIAERLHKSKLSSPHALRRLALSGS
FT                   DGALSDASRLPEPECVDLGELASIELRGDPDAVLRGEGTAFTAPHGVFLRREKLDAGTD
FT                   FEDNKFETHHPEGWTTFLACAFAKATGGVAMTWCESERTRSRLFRAPNPALTDPNCVSA
FT                   ISTNEWERKSPWTRLLARRPVGSAHVDVHGRRDPDGGDVSAEIGDGDCDVGVGALEAVN
FT                   VELADSLRTALADGLDRCLARWRRRREARGEFDSPAGVRSVW"
FT   CDS_pept        join(complement(65844..65935),complement(65616..65694),
FT                   complement(65222..65380),complement(64966..65058),
FT                   complement(64514..64705),complement(63858..64394))
FT                   /codon_start=1
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638413"
FT                   /gene_name="CYCB"
FT                   /orf_name="MICPUN_95175"
FT                   /product="Predicted protein"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69899.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG750484"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="UniParc:UPI000199C694"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY6"
FT                   /transl_table=1
FT                   /translation="MGAGSRRALGDIGNTNATGQGGLPGGKGAVKENASESLSDMSTLL
FT                   NNFREKTSRAGLGGVTKWGRTSQRTSQYKPRDISNATGGTMTTRTGEPATKRESYTEYI
FT                   QGRAAKEMPDIDALDRENPLAVTEYVNDIFSYWFRVEPDTQVASNYMGIQTDINDKMRA
FT                   ILIDWLVEVHLKFKLMPETLFLTHNLIDRFLSKKVVTRKNLQLVGVTAMLLASKYEEIW
FT                   APEVRDFVYISDKAYTREQILSMEKDMLNTLGFHLTVPTPYQFMSRFFKAANADKQFQL
FT                   LASFIVESSLPDYSMLKYPGSLLAASAVYVAMKTLGKGEWNEVMEAHTRYTEAEIRPCA
FT                   NAMARLQRKSASASLSAVHKKYSNPKFMEVARLPAPAGLGEDA"
FT   CDS_pept        join(complement(69392..69609),complement(66881..69080))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638414"
FT                   /orf_name="MICPUN_61691"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69900.1"
FT                   /db_xref="InterPro:IPR011502"
FT                   /db_xref="UniParc:UPI000199C695"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY7"
FT                   /transl_table=1
FT                   /translation="MDPDRSSVPVIATLPMGGGAVTGPGAGVLHVQWGLGNELRVSRVR
FT                   GTEPSGTGATPTEESDEISSGAAYVVQWACVTGAHRELAEETLPHFEQLKERVALAMHR
FT                   GEGPDGVAAASVDAASRFARSVANTLDAKVETLEAASAATGERTADLEHVSLARAAWQL
FT                   AAVYFVEPGEGTGVVTERLVEWYRRNGAALNFGGAGALPVRLRALIDGVAEAGDRPETA
FT                   GGFWDCLAGLVAMGWSDAAADLVALHSCWAEWRQGMAAARPAAELLEAVVALIRTAPRM
FT                   ATADDTPPNTGDGSYPPSAATSLPQFQAFREAWTRQVRDVLSDHSLFDAVTDDATSDGA
FT                   RWSLEVLAGDETALARACRGGWLELMIASARHQYPNLRAAEHASLAERCVGITGAGESP
FT                   ELDELLGAIIAGDASRTTDVCARYFSPWFIAHLAQMLAAAAGGPAVAYEYGGGERMGSR
FT                   SASSIAAESHVMTYCASLATRANTRHLALRYLPHCADRGAGAAAQILRRERPPPGSLPP
FT                   DPGRSDAEEDPDVAFAKTLRSLELCADAGLVDVGLGVARAAAADARARGDETGAVAWLH
FT                   RAGDVAGVAALALEQLPTPHVASADPSGAALALVRLAMGHPGAAEAAAEMNADGARADG
FT                   AWADGEWRSAGATAAPGPAGFLDALAALRGALTELARAGTTASDAAGAKRAVGSAAVSA
FT                   AARRAGGKLVALLGHSAGQSHLWTEALFHAVPLLEGAHASLTAKEIQLCMARLEQVSGA
FT                   GTVTKGDLLRADVEVVNDERDLRAAAARTALARAYARACVSGAGGGRGIVAR"
FT   CDS_pept        join(complement(71579..71658),complement(70958..71195),
FT                   complement(69881..70798))
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638415"
FT                   /gene_name="GAPDH"
FT                   /orf_name="MICPUN_104954"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase "
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69901.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000199C696"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY8"
FT                   /transl_table=1
FT                   /translation="MSAATTAALTARPVLAGKRVRSAKTVRCTARVSTVTRASKDPVVN
FT                   ALSEVLPAASGEKIRVGINGFGRIGRLVMRASLVRDDIEVVAVNDPFVTADYMAYMFKY
FT                   DTVHGQFAGDAKYGAQVECDPAEECPMGFIVDGKSIAVFAERDPVNIPWGANDVDFVVE
FT                   STGVFTSLEGAQKHITAGAKKVVISAPSGDAPMFVMGVNSDEYTDDLDIVSNASCTTNC
FT                   LAPLAKIIDDTYGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGANIIPSSTGAAK
FT                   AVGKVLPALNGKLTGMAFRVPTQDVSVVDLTVRIEKPASYEEICAAIKEASVNGDLKGI
FT                   MGYTEDAVVSADFIGDERSSIFDATAGISLSPNFVKLVSWYDNEWGYSNRVVDLIALMH
FT                   SKMPSKVSGGAR"
FT   CDS_pept        complement(71991..75929)
FT                   /codon_start=1
FT                   /gene_family="HOG000264484" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638416"
FT                   /orf_name="MICPUN_102536"
FT                   /product="Predicted protein"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO69902.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG557196"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="UniParc:UPI000199C725"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHY9"
FT                   /transl_table=1
FT                   /translation="MDYDVESWVEEEARRGRGRRASHAPAPSAAPSPFGIAQSQPPATT
FT                   SKIPGGDFGFAPPLPGAVPATPFTPGFGGGIGAFGKGADATPYATEAFLRRAPPTAKAA
FT                   KIPSPDRSTMTAPAHTRMDDDDVLDDAHADHSPGDDARTAAAKDLETDDAPHERREEFA
FT                   FADVLAAVRAGEVTAREAAGAFEEACWERSFELREESASCVHRTVKAAELARAADLLQA
FT                   EAGTWSLVWFLLGDGAAIEADGAASEAAARAVIARRQAAGGDPASAIDSGVPNPAPTPI
FT                   PLSARIRIAARDQSGDPVTFRLNRVVAWLEGTARAAMQRERAGLVPVPDEHAGTHVDDF
FT                   ASGECAWRETASALDASATTDGRGRNLCRQLDPDGPYRTSSALHPTNADGEDRLLRATW
FT                   RLTRAGMVDAARELCVHVGQPWRAASLGGAAGFAPAPVGAAADDAFARSAAKPVADALE
FT                   RAEAEAEAGADPAATRAALVRATVDAARSAAAEREDEEAASECERGGGAAKRALWKWAC
FT                   AETARQTSAWANGNVASYSRFESALYGAFAGDLRWMLGACDGDWESSAWAHFRALLDAR
FT                   VDAVIDGRDPGTPGPVLVDDDDDGSGDGKRKLGDVSASDGVSGEADAVGAGLLAGLNQV
FT                   ATPRWPTPEALAAIPPTAEAILDALKPLGGDGEHRRAQGCLILGRTRELVVDNVLSWLF
FT                   PGVDLATLDGDVDEASVHAALVDSPVRSPELLRFATHLLLFLRELLPDGGGLQPDGPLD
FT                   RHLNAVVARFVLHLVQSKRYHLVPRYARHLRASLLVETYSRFLTRLAPASAELKARCLD
FT                   EACAWIPREGDGGVRSIVVRALDDSREVVDARGVPDAPSLSRGPTHRERVLEWATLAGA
FT                   ELHPEAAVHACALIRQLCLQRSAAARLRGCDRPHLTLDPRDFVCGEERARRIVARLLPA
FT                   DLQANAAERGRPGAATELSDWAAYLAACAAVGAWRDLAAARDARAALDAEEGATADLND
FT                   LNDLNDSGGEGARLAAEAATAAIGAIVDLASPRLADSDGFYAPDVMDSFDPGVDGPGYW
FT                   MDSPALVDAEEAAMETENRSPTVRLVAVALPDRSGGGGGGGDGGARGVERTDPHEVAAA
FT                   LAEALELRVGAIADPVVREAVRCHVEVTRGCVGDGARAEGAKGQVLVEVTADIDALNLP
FT                   VAPGTPPAAIGAAYDAAAVAARDVVGRARREIALVTADAIKGDLPRIRAAGVRGLDPPP
FT                   LDVQSADGSDPEMIRLVCRAVCWPSLLLEGVEIEADLGSGSSAVCELVADAGRGLHELF
FT                   SRRELTWMLHLQRQGEVNAIAAGTRGRD"
FT   CDS_pept        76097..77053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638417"
FT                   /orf_name="MICPUN_61694"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69631.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199C726"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ0"
FT                   /transl_table=1
FT                   /translation="MGDGETLHYQSVVPDAGADGDAAAEGFFDLANARCVRYTVAVGER
FT                   EAREGRGGGEGDGETNEASGSSRADGSEVELVVEQDQSLHDSCGGIVWESAYALEQYMR
FT                   LNIGRICASPPVKRKRGLSRCKVLELGAGAGLLGLAVAARGAKATVLTDHPNAMPLLER
FT                   NVRRNSALFETRAELVGKKRKKRGDANADTETTTTTTSTSKSKPKCMPLDWTNDAHVDA
FT                   VAREGPFDIILATDVVFNESLVAPLLAAIRACGGPRTVAYVCVQERCAAAFDAFRRGAS
FT                   GALGSAREVPREELGFVDEECVLFELKATRDVFGDAG"
FT   CDS_pept        join(77232..77408,77474..78022)
FT                   /codon_start=1
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638418"
FT                   /orf_name="MICPUN_91735"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69632.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000199C727"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ1"
FT                   /transl_table=1
FT                   /translation="MADALAEMSTDALMREIQRRLDCQSKPDKRLILVGPPGCGKGTQS
FT                   PKIKAEHCLCHLATGDMLRAAVKAGTPNGVRAKTAMESGALVSDDIVVGIIEEAIKDVS
FT                   CRNGFILDGFPRTVPQAKMLDEMLGKKGVAVDNVLDFQIPDEVLVERIEGRWIHAASGR
FT                   SYHTKFSPPKIAGVDDITGEPLMKRKDDNAATLKSRLDAFHAQTQPVIDYYKSRGKVNV
FT                   IHANKPSKNVEEQIASALK"
FT   CDS_pept        join(complement(78652..78748),complement(78206..78489))
FT                   /codon_start=1
FT                   /gene_family="HOG000039853" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638419"
FT                   /orf_name="MICPUN_95185"
FT                   /product="Cytochrome b5 isoform cb5-d "
FT                   /function="heme binding"
FT                   /protein_id="ACO69903.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG629516"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199C728"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ2"
FT                   /transl_table=1
FT                   /translation="MTAEETKPEVKGIKMEEVEKHSSVDDLWLVIDGKVYDVTPFMDDH
FT                   PGGGEIMLSAAGKDGTQDFEDVGHSPHARELLKKYYLDEFAGGVGSGKIATKSGGGGMS
FT                   LLAVLLPILVVALAFAAKMLTA"
FT   CDS_pept        join(83278..83625,83684..85057)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638420"
FT                   /orf_name="MICPUN_53640"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69633.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI000199C729"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ3"
FT                   /transl_table=1
FT                   /translation="MPVPDVNAKRTVNTYDPDGKRLVSVWAANYTVLMTDLVATRMADG
FT                   TERYPLEAVEAMFNSLFPDEFRGIIPIFDHREVDRLLDERDELLNTYNKLKERQSRSYQ
FT                   TMYAKRVNDVMTAVDAAWYDLQQCERAVVLAREAALQSDPGPSCFVVFATQKAAAQAAQ
FT                   CLLHSGSRRNFRVQPAPGPDNVNWQSVLYRRNQSMRRVFFIMPMIILLILFPSGIFTVG
FT                   ISMACNVEPPSGLRGFLTWYCSEEAVVFQSIVSGLLPPILLTLWEVFVVSFFMMYLVQA
FT                   QNVHASLSNTDRRFLRYYYVWVFVNVLMGGITGGALTGFVEDLMDSSNTTYSLQQHLGR
FT                   VLPISSNFFLVFVFFRAVYLPVQRLIVPHPGIICWAVRKYLCIFKCAVTPRDRTIKYSP
FT                   RGVRMGREVGVFLMTVMLGLTFCLIAPVMAPACVLFFVMNFVVWRYHVLYVYERGYESN
FT                   GSMWFTVVELTVWALLISQVFTSFVLFSKAAWIPGLALYLTVPYYLYRYYVNLRSEFGS
FT                   GSAWSVPLGEAAKAPPADFSAEIYTHPSLRPAAMGWHPDVGKVWRGYPGVAGKTTF"
FT   CDS_pept        complement(85220..85885)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638421"
FT                   /orf_name="MICPUN_108968"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69904.1"
FT                   /db_xref="UniParc:UPI000199C72A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ4"
FT                   /transl_table=1
FT                   /translation="MAKRMYQSMRWNISRGDVPPAVDGGAERLATAPRLNDFFVFCDFT
FT                   SRVPVWSAHLTHAFYEGTDLPATYDMVGRDHLEFTLPLKTLWAKHFGADSRAGSPAGKV
FT                   MMAIMRGKDAYQVFNVSLVMRDKDTDDIIPMVTDKDIFEKGTDAELAYLDDKLEEFVGP
FT                   RSNFGGRLMHPKLMNEMPAVSRFKAMCDDPDVTVEELEKELDRLKTLGAVPRNVQQVA"
FT   CDS_pept        join(86697..86912,87011..>88434)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638422"
FT                   /orf_name="MICPUN_102540"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69634.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C72B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ5"
FT                   /transl_table=1
FT                   /translation="MDQRRPSTPGEDHPEPPPFTLEGKRVFVAHVDSRVGGVLGRAFRD
FT                   AGCDVRGVRDGEKEVEFAKETYMADYDRHDGMRRAALAAADIVLIPLAVAPDTEAAKDT
FT                   IETVEAAAADDGKKRVIIGVSSASSWAGGTRPRGNGEETAAADLERRVPVRGPGKLVAD
FT                   AERLVARAHKPGRLECFCVLPGMLYGEGEFDDGFLGLCRGAWEGGAVPVFGDGLNVLPL
FT                   CHAGNVAAVALELAAEALDQNPGFRVPAVPDAIDPTATGTLNLNPKPAIPAYPSAVDSL
FT                   QSRYVLAVDEDTPGATQISVAASIAREFAVPLVRFPASSLALSERLTPNLLTHAEFCSS
FT                   DIARRAIVANATRHRGGWGAPVEVDDPSLADVLDVEDEKKEEEKATGADDGDGGGDAAP
FT                   AEGEDDGSPWELAPPKVGGAPAVIDAFLERNNLVPLRLVVRGPPLSFPEAIAEQIAEAY
FT                   SVASLTPASLVRHWLPKCDQEVKDKCGYVEPEPEPEPEVEAAADGEDAAEKPKEKTEAE
FT                   LAAESAAKKKEAEETYAGYAEDVKLDLIR"
FT   CDS_pept        88568..89674
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638423"
FT                   /orf_name="MICPUN_108969"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69635.1"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="UniParc:UPI000199C72C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ6"
FT                   /transl_table=1
FT                   /translation="MRLKPKPKGAEGDADGGADGEGEGADAAPAEDEEPPPELPEETAE
FT                   EAEARRCADPSSAPSDVILLKIADGGQHARSLKEKHPEEYEAYVEWARAEEEAAKTADG
FT                   AKRSHADALKEWRKANKGKREGDEGYEPPPAEPSPACTDVLVAHLVYTWTQKSVKSVTL
FT                   HEVDARGTAHARTRRAKKSLGEPRNFRGMVGLSVDAPDPAEAEAARLEAEADAADVERR
FT                   RARRERSEALRARQEKEAEARELDALHARSASLRAYLASEVMPVVTDAMLQMLRIRPED
FT                   PALALSDYLLRYDRRVAIEEEAERAAKAAMERALLEEEKKQEKERRLEISRRKAAEARA
FT                   AIKPKSVVRFVPKVPPPRPRPPPAEEAA"
FT   CDS_pept        complement(89747..91981)
FT                   /codon_start=1
FT                   /gene_family="HOG000245252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638424"
FT                   /orf_name="MICPUN_113739"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="cysteine-tRNA ligase activity"
FT                   /biological_process="cysteinyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69905.1"
FT                   /db_xref="GO:0004817"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006423"
FT                   /db_xref="HOGENOM:HBG327651"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="UniParc:UPI000199C72D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ7"
FT                   /transl_table=1
FT                   /translation="MSSGEKTFPQYGPICGCCAPVPWWSPPDAEEASKDGPRRDAPRLL
FT                   NSFTKTKVPFVPLDGNRVGWYICGPTVYDSAHMGHARNYVNFDVIRRVMTDYFRYDVRF
FT                   IMNVTDIDDKIVMRAHLRRSEAMIAAAEAVGGLDALIAPLKALLASGEKNLGEQEALTA
FT                   SLCAAIVAKDPTKVADPDWTVQDGYLALAHAFEAEFMEDMRLMGVARPDALTRVSEYTE
FT                   KIVQYIQTIIDRGYAYESNGSVYFDVPTFEQSPNHKYAKLNKEALKNVELAMDGEGALA
FT                   ADASEKRAENDFVLWKASKPGEPRWPSPWGLGRPGWHIECSAMCSDILGEAVDINGGGI
FT                   DLNFPHHENQLAQSEAHYDIKQWVNYFVHTGHLHIDGLKMSKSLKNFITIRAALKMYTA
FT                   RQIRFLFLLHQWSDPMDLTPVQEGDAVTGFQQMEAAVIAEKTFVEFFHSVKGALRGLGC
FT                   AAGYSVDQEHTWGDEERALSSAIDAARAGVHAAMIDNINTPAVIKSLKELVGGVNKYLG
FT                   SVAADAVRPLLVESAARYVTMILACLGVAETTGGIGLGDIAGGGGEGRGSDSKEEAMAP
FT                   VLDLVVKFRDEIRALARSGADAKALMQACDRVRDVGLPELGVKLDDREGGALWKLSTPE
FT                   ELRREAQREAEAKAKKEEQKRREKEEAARKAAEKEALAKVSPNELFKQGEYAGLYSKYD
FT                   EDGLPTHDKDGEELAKAQRKKLAKTQAAQKKEHDKFLAKAAADQLGKAVI"
FT   CDS_pept        92218..96177
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638425"
FT                   /orf_name="MICPUN_61701"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69636.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C72E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ8"
FT                   /transl_table=1
FT                   /translation="MASSSMAGEDGSPSSSSTMTSEPPPPDRGTLREAVAALYTSPDQN
FT                   QRAAADQWLQWFLRSDHAWPLSIGMLRDATDLTSLEALFCARALHVLLRRCVSKAEKTQ
FT                   KSHAVLGEGDWIGMRDCLLPMAWNFAVKTVLHDVRGAGSIPGEAPPRTVLTQVSLAIAA
FT                   LACKMPNWDERAVVRDLAGYFGVDAEAAPDAVVNTVVALGGGAGSNPGNAANNAEGHNK
FT                   LSPEGAAAVTRAGAGCLLQILAVLPDEVTAREISIHPGRRAAVADGLRAAAAEVVHPAL
FT                   DALARRLWASGDDVPGGDDVNGRILLQEAAAAWCGFHPEAHGSCPGSCLEAAVRCLCAP
FT                   HGSHHPKLVDASVTGATAVLVAAVHRPERREALGACLGALRAAARANGPIRDEYETAAG
FT                   QSRARIAEVLASVATRASEPPPDDGPRAPDPLGTGADAAADRKYIPYRDFRKARKERKR
FT                   ADARGIDEHGNLREVEVPLTRADVEVLCFCLDALLEAMEAGGVSPAAALEPWSAMADAW
FT                   ETWKNASAKNVLSNANAGASALLRRPAADPAIVRCAAAAAAAGARCVRMPASAGATATD
FT                   DRRDDYEYPNSDDDEEGDEYREERDELGEGLRDAACAVDPNAFLPVAVAGLTASIDAHA
FT                   GAVTAVTAADGGGRSAVDASVKSVEGWTFVLFATARLVGKDGPRAAVGDAIFTVERLVT
FT                   RVPVSNRTTELAVWTIGGLCKALSAVTEAEVLRAALGAVVTGLNSDDPSVSRGACVAAM
FT                   RTCESCARILALPADQSTHSQNANDAVGAIARCYANGGPWAPPLATLRRGQEPMTTILC
FT                   RGLARVAVAKSPGSASEAACVELAGPAINALRNAAATLAAASGECAAHPSHDALVRALQ
FT                   AANALSRMAAECRVVAGALAEASAKSAAEKKSAIPDPHPDQHPGSFPSVAAAAIADALL
FT                   PAADEALAALAAAAPVFSAAGVGVVANHPAVDRRIHDASEALEAVGGLLADVVAAGRVA
FT                   PDRLATSQCTGIALRLALNAYASDPVRCHPLLDVVVAALASVGPGARSNPKLSSELGAV
FT                   ARAALDAALDAYDRAGLRHDDAARASMFKLTQASVRAGCASLTDLAERVASLAHESLVT
FT                   GSSGESALSSLTFAADVLSAAAMLNPSRHAPGDAGVRGGVGMGKVDPGMGRLASNLARA
FT                   AGGRGDLPGWASDAHEDAIRLADAFHVVLCERGAGVALVRAMLECANGLMPPGLVTDVA
FT                   AALYAAWMAVGDGRMAEWLHGALGGDRDGFPRDSTTKEQKEDFIGLLLFLHADASGHGD
FT                   LGPSRLGKTGEKHDLRRFKRCLKAFCGGKKSGSGQ"
FT   CDS_pept        96632..98674
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638426"
FT                   /orf_name="MICPUN_61702"
FT                   /product="Inorganic phosphate transporter family "
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69637.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniParc:UPI000199C7B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHZ9"
FT                   /transl_table=1
FT                   /translation="MTVERRPHRRSRAVVLTFALLACAPVAASAHRQKPNPSSAGGGGR
FT                   RLLQSTPAAAEVTGVAAVVDGRDVVLPAALATCDAGVLECDNRKFLKNLEKHRQRVLDS
FT                   SSYAPDGIAPPPPPACANYDGRFEEPGRLSWVLGLAAGFGALMTYGIGANDAANSWGTS
FT                   VGSGAVSVTAAVLLGGVCEWLGAVGLGYGVSKTIKGTSKTDDARCWACGYCDSEMSLYM
FT                   VAMCASLAAAAVFLMLVTFTAMPVSTTHSIVGGTVGAAAVGVGFGCLNWDWNSGGLSAI
FT                   IASWVISPVFSGIIGVISYWLTHHTVVKPKLGGSPRRNAMIGQPILWSGQTFVIVFLIL
FT                   LKAQPTKGWTYREQAKIAGIAAAVVFALVATILNPIVHRSMPSVAAKRRREELEAEAHA
FT                   PLDAKPLRRPTRFRSIHEGLYRFLVSATTGGSSTSSNDSGSPRCETANAAAAAATNASQ
FT                   PTSVMGSISTAIGDIVVRDSDERSRTRAGFLASSARITEEEFAAGMSEEEVDATYAFKY
FT                   LLVFTAALESFAHGANDTANATGPFSAVYLTYSQGLDDCRKPETPAWIMAVAGFGVFLG
FT                   VATMGHRVIRTIGKELTDINYQRGFCIEFASTLTVVLATVMEMPVSTTHCQVGAVVFVG
FT                   AAAFGPGSVRWGLFGRIVLTWVLTLPIAGLTAAAVTAALRPAIVA"
FT   CDS_pept        join(99190..99230,99283..100276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638427"
FT                   /orf_name="MICPUN_61703"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69638.1"
FT                   /db_xref="UniParc:UPI000199C7B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI00"
FT                   /transl_table=1
FT                   /translation="MRNQDFYFTCHVISMHAALVRASVRVNASTRPLSRLANRARVALR
FT                   SEPFPGASIDIGNRRNIAAASLRGRRALLLTAASFLVSLSPARAAVDPSSSSPNPFASG
FT                   AGPDPSSCEPVGRSPVAFSPVRTKATMGAGDAPGGADDTLAEYPGTALTRMENAVARAR
FT                   SLTEEQLSGDWEDVRGLLLWAAGLRDIRDAPPGEGYTGHCFNDFNHVDATTMTLDVSDN
FT                   ENRGAVRGIAFGNRLGPGIRVASDPDLGPGGTWCTCAQGGAAEPPADVAHLQFRSKIAW
FT                   KLVWVPTGGYARFVLVDDAGNALATGTPTGSLPALNERKYNYEIVRGGRYARAADAYAG
FT                   GGAR"
FT   CDS_pept        join(complement(101310..>102275),
FT                   complement(<100923..101228))
FT                   /codon_start=1
FT                   /gene_family="HOG000012706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638428"
FT                   /orf_name="MICPUN_66770"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO69906.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="HOGENOM:HBG408914"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199C7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI01"
FT                   /transl_table=1
FT                   /translation="ITKGLVRRTAVDGVVFVTWANNHYKDFARFWTMRLKSLGLTNFMV
FT                   GAMDDELYRYMTEMGVATWHMGSKGIEKDAVKKDFGWGSQNFHKMGRDKIRLIRDFTKV
FT                   EGISVLISDIDVAWLRDPTPFFKRYPSADILVSTDLLRSEIALDPPLQTPHLVDGEGLE
FT                   FHVCHAASNIGIMWFRPTRGSQQLTEEWVRRIEADDKLWDQNAFNDLKALAGACAYRPD
FT                   GTGLTDTAFGGRVTMGTLPVSQFSNGHTFYAQRLHTQVGLEPYAVHNTFQFGGTPGKRH
FT                   RAREANAWLGDEEINYFDGDPELPEKGMFMSYTPRIPSAEAEIVRKNKELVSFQIKQIK
FT                   TAAAIAQKLGRTLVLPPILCGLDRVWFPHYGRFPGSAFALPFVCPVDHVINMDLADASK
FT                   FREWTFYSHPEFPAEMRESVATVEV"
FT   CDS_pept        103482..104840
FT                   /codon_start=1
FT                   /gene_family="HOG000117912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638429"
FT                   /gene_name="CitT_3"
FT                   /orf_name="MICPUN_104955"
FT                   /product="Divalent Anion:Na+ symporter family "
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69639.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG321139"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniParc:UPI000199C7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI02"
FT                   /transl_table=1
FT                   /translation="MFSVALGLAVYFVVPCPADLTREAWRLLAIFCTTVAGLVVKPAPV
FT                   GMWCFMSLTFTVMTKTLTFEQGLASLTNQVIWLIVVASFFARAFIKTGFGDRLGLLFVR
FT                   AFGSDTLKLAYGLQTAEAFLSPAMPSTTARAAGVFVPIVNSLDDRTKTYLMSQQLQGGN
FT                   VTSCLLVSAAAQNFLCMQIATGMGIPFTNPFMDWLVASSVPSILGILATPIVIYLIDPP
FT                   GVKETPEAPIIAAKKLEELGPIRGNELKMVGGLAITVFMWIFGTKIGVSPALAAMIGFS
FT                   LLMIMNVISWDEALEQKGAWDTLLWFSVLISMSGQLNTMGVVPHFANAVSSSLAAMDMG
FT                   WMQVFALLHGVYFIMHYFFASQSAHVGALYPAFLSMMLASGTPPMLAALTLGFNTNLFG
FT                   GLTHYASGQAACYFSSGHVPMSLLWKQGAYMSVVNLLIYSTVGMAWWKMLGLW"
FT   CDS_pept        complement(104956..105627)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638430"
FT                   /orf_name="MICPUN_114001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69907.1"
FT                   /db_xref="UniParc:UPI000199C7BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI03"
FT                   /transl_table=1
FT                   /translation="MFAVARHIPPVRTVSSRQTRADATGSRRVRSDAHGNATCALSRAG
FT                   DDEGRVVGAGARAASALLSAAFAANSVLQPGIAFAFGSEIALSDVKYEPTECPANQYMP
FT                   NKKNTVCLKFTATADNSQRRNVEAANIFGFIDDQQNNSAATVNPTGGSRTVLSGLDAPI
FT                   PAGRSQVSFIVTVFKDSLDLGPLKLRGFKAEPSLSDVEKRFKPFDECEMDPETPGCAGS
FT                   F"
FT   CDS_pept        join(106022..106088,106211..106686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638431"
FT                   /orf_name="MICPUN_61707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69640.1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniParc:UPI000199C7BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI04"
FT                   /transl_table=1
FT                   /translation="MRGSVSQVAAGTIKDDDKVPDPDSRAASTRRDFLAAQVVAAVTAT
FT                   QALVPHDAWAAVERGLDLPDDYFKKARDAVKTLVASLEFEATNPSDADRFRKAEPAKEA
FT                   VKAFIKDWASAPAAQGERAHDDIVLAVRELGEFYKENGSRSRLSPEARESILAKLYDAR
FT                   EALPPAPPSLADRLLGL"
FT   CDS_pept        complement(106787..108148)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638432"
FT                   /orf_name="MICPUN_113897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69908.1"
FT                   /db_xref="UniParc:UPI000199C7BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI05"
FT                   /transl_table=1
FT                   /translation="MEPREEGERLARDIQSRLEAHAQASTREWFQTQGLGRWRGCEQAC
FT                   IRARTLEAEQEGRPCDASAAAWWGEARYHASLELMRSEFADDKLSGMTMFQVRERPESR
FT                   ARARAHRSQKTKKKSPRLSSDPRAPSAPRRATRPTPRLTTVSRPQSTASQELVLPDPNV
FT                   SARLFGDEDDDEEDDDDESSSPRPAGSSMSIADADAKPSGEFLPDALALFDDPSARGVH
FT                   DWSTSDAIAFKVLGPYVAAHPRRRRTARFVLAWATRPSSRGSPPVNPYRRRAGVVAFLN
FT                   YVDGETDAGVITHADSSNDAFPRSGRGLASSPVTHRGRGGDGLFGDGFVAELAKACGDV
FT                   LAAVDSETPAAARRIPRGAERGAGGAEVSVRASDDEVQIDDPTLSPMAAEAWAVDGAWA
FT                   VLGLCARESARVDRARIAAERGGGNRRTFPCAVNSGGEETHAGGGASKRARTEA"
FT   CDS_pept        join(108661..108705,108917..109939)
FT                   /codon_start=1
FT                   /gene_family="HOG000003788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638433"
FT                   /orf_name="MICPUN_102547"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO69641.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG397932"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI000199C7BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI06"
FT                   /transl_table=1
FT                   /translation="MTETDVNRGSRLAQQVRLVQWYPGHIARAERALREQLKAVDAVVE
FT                   VRDIRIPLATTHPDIPDWIGNKLRVLVLNRADMVTDAERSRWVSWFKKRGEKHVVLTDA
FT                   KTGKGVKRVMEVASSVAKEVNEKRVAKGLLPRPVRTAVIGYPNVGKSALINRLTNSKTC
FT                   ASAPRPGVTRDLRWVRVGGDLDLLDSPGVLPGRLADQTAANRLAMANDIGEASYLASSV
FT                   AARLIEEMKRHERWSSRRGGLKEIVEKRYKFGPDDDIDEMTGEDVVCYLAAKAQDDDLE
FT                   RAGTRILNDFRKTALGSFALELPPRGKRGDSVASYNKTDYRRQVHFISDEDVRYHDPYR
FT                   GDIGTVRASRPSKEE"
FT   CDS_pept        join(complement(111883..111916),complement(111090..111698),
FT                   complement(110071..110927))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638434"
FT                   /orf_name="MICPUN_61710"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69909.1"
FT                   /db_xref="UniParc:UPI000199C7BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI07"
FT                   /transl_table=1
FT                   /translation="MALAAVSILARGAGVDAAPGDVTATDVNTTVTRPSFSVVGRLFVH
FT                   GPSGNVAVGDISTYNDTSGAPARKLEVDGSAMIRGDVVFHNSNGESSIVVLDSNANALA
FT                   VKDAGASPITYWKINSASQRLETHAPIHVLDTRIEAKDNDANGLQITAEAGNPIVTLDT
FT                   TDAAENVKVAYPINANDATDSCATSVDGTCSALASVVTTGGLTVGKKTFMTELNSFEVN
FT                   RSITRRLLPEDDDEEHEEHGSRSRFSTHAVIFRSRSPPPGFRPPPLSAGTVRVADTTDV
FT                   SVTNSETDVDGSVRLAGGLAVEKSAAIKAKLSVLSDTNGDSSGIGAALYVKGGYHAGGN
FT                   TYVGGGSMIELAGKSAKVGKSVNVTDSSAAPVTLVTLRLKPGTSARLSVDVSCQWTGGA
FT                   PATVAAEFSVHHNSGAAPEPDAGTTPPRTGLVRATQRVGTASDDGYFDFVVVPDDSSGG
FT                   VGVEKDFAVKVFTADAGSGNAPALATALVVARVTGDFVSLT"
FT   CDS_pept        join(complement(115323..116207),complement(112122..115265))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638435"
FT                   /orf_name="MICPUN_61711"
FT                   /product="Set domain protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69910.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199C7BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI08"
FT                   /transl_table=1
FT                   /translation="MTGRDRRRNAQPNAAMYVGYADDDEDVESIMAKFQAIEDAKGAKG
FT                   GGDGGSAGDGGSDDKELTEEELIRATGARAPPKERVDYSAQLGHGSRANRKGEVVVAGT
FT                   VELVPGHVPPEEIDPADATDAFTRLRAGEGFAPEEQEKCDVRCGNDARDPASGPPSSGI
FT                   VPGVDVAMVELKGFDAHTREKIAENMPNAVAEHDVDEFIDLVAQTMRLDAVAGADPSLE
FT                   LAAKTIAESKAATNAARACAKALVKLCAKDPKEFKAKSKGVGLVVIKDGGIPKDAYLGA
FT                   YCGELYPGWRWFEKEAAAQAVRRDVKRDDEVPTFYNAAVERDLHDPRGYDVLFIDGMVK
FT                   GSVLTRASHSCQPNAEMRVRVREGKYSVEMVTTREVRTGEEICWDYRCQTDSEKEMRRA
FT                   ICLCGSKNCRVSYLHYNGESELAAFADERCAVLHDAARLLASCVDADALRLPETLNLNP
FT                   KGTPGKGTPGKRGNNGGKRADDHWKSALIAAGVRADDEGMLAGLPQWARKFASKCVATA
FT                   HEEKKVLTHSLYESAKRRAYEAIDAARAEAAEYETDPEAWKKRFPRTVSTPPTVPHEPS
FT                   DADLGADAKAEASGIHAARIQSLAVTMDKVRRVLAVHARGGDAEKPAAGVDVSAAAPPL
FT                   RLLNDEDAAAHLVAYASRLASAANVDNPFDALSVDRLSAADDENGSDEDARRWVRSDAA
FT                   RRILREMADNLWKRSLEESGASDTDRIARLACGDLAYLASQTRNFFAPVAGGERFKSPY
FT                   VAMGSHGSRDGAGVVRRMDYPKHSALGFLCTWREEYLERPCDRLATDARGGLCLPRFDR
FT                   GALANYSTQNPGKNRRRAHASIDALSAHLCGEMAARGGGKAWAPIDGCWRWDFDLDAGD
FT                   ERDGPVLGSPVVDAALGGDVRPGASAAAELAAARRAVLGDDVEDARVADAELGKAVASK
FT                   DGNEEEKKEEEKEEEEKEEKKEEEEERVALGAAETDADAVAAEPTLPIPERSRPSPRVV
FT                   TSPPVNRWGEPEPDVPCVVCGDVGDATDFILCDGCPSGGHVDCLNLPANPALSRNGTES
FT                   AHSRDDWFCDACEGGKLAGIQPPGRGGFALAAANRAALERARERNGGVATVSAVPGATG
FT                   AVPSVGPVAAHNLAEYHPVHLTTNCEVVALPGDPPPPPPTMPLTSSGGNKRAFWEGNAT
FT                   LGDDGKPTKAAAEAIAKRRRVGGGGPGSFAPFPMPRDCPLGVIVECGGAWGEFRVLEGL
FT                   VHCMCAGCEFGIAYGLQPTNVFGLQSFEFHGGKGSAGKWKASIRAHPDGLPDEYFAQVD
FT                   VQLAAGDDAPLAAAVTAAAGPRRPGRPPRDTSEGLGPWLERECPEHPCLARSRNKETA"
FT   CDS_pept        join(116565..116571,116770..117815)
FT                   /codon_start=1
FT                   /gene_family="HOG000240562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638436"
FT                   /orf_name="MICPUN_113331"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69642.1"
FT                   /db_xref="HOGENOM:HBG610978"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C7C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI09"
FT                   /transl_table=1
FT                   /translation="MAGAGDLPPGFGGLGGAPPGGMPGMPPGAPFDMSKIKEMLEDPSI
FT                   KEMAKQISEDPSFKAMAENMQQAMAAGGAIGAGPGGAGGMTMPGMPPGMPPIDPKAAME
FT                   AMQGVMKNPAFMQMAEKLGTQMMQDPQMASMMASMQDPATTEKMKAKMEALKEDPEMAE
FT                   IMKEIETGGPSAMMKYWNDPKVLQKISGAMGDVMPGFGAGGPVQAETEEDGEDEEEGED
FT                   EDDGEETVMTAASAGDADALSELIAAGADVNASDSEGRTALHFACGYGEMKCAEMLIDA
FT                   KANADAVDKNKNTPLHYAAGYGRADVVKLLVDAGASVTLRNLDGKSPLDVAKLNDQEDV
FT                   VQALEADVFL"
FT   CDS_pept        complement(117952..119937)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638437"
FT                   /orf_name="MICPUN_113330"
FT                   /product="Camp-dependent protein kinase "
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /function="kinase activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="ACO69911.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199C7C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI10"
FT                   /transl_table=1
FT                   /translation="MVESMRAQVAAWRPLLDGVGFFADATDAMQRSFLACVLRTTTFRP
FT                   REAVAKEGDECAGAWMVMEGEAHAMAKLVGGDERWVAGYWPGDGFGFNSLVWGHGTHLE
FT                   GDNAFEGDNNASDGDKVGDKVERRLAFEATMRCGEDVDGTELAFVGRETFARMFEKSTR
FT                   SWRRMRRTALESAARVVETRESKRPAPLRPGDPNIARMIAAMAAAATDDRGDGGGGGGG
FT                   GGDSPRPRTPRTPSPRRGRSPPPPPLVERQSADPTRIHVGRHMPDELLYPEEFETESEG
FT                   EGERDENGHKNAQSGAENVGPTNAGDETPRELRAGGAGRGGGVRSGRDARGEEELRRRR
FT                   RRDGKGSTVRDANRPVRRREPLGPNPRGPTRLARLVAALESHPAFEGAERAVLSAAVQD
FT                   MESCIVPPGKPLYRHGAKGDYLYVVEAGTLDVMAPNPTGVGSPRTVETVGPGGVVGDVA
FT                   LTFATTREHTARAGPVGAKVWGMRRCWFERTAGRAVHGRRRLIRRFVHDVPILRGLPVH
FT                   EQYACAEGFREALFAPGDVVIRQGDEADYFYILEEGGAKCSVRLPGEREQFPVAQYGAG
FT                   SYFGELEFLGDVRKGAGGEKKRSETVGGGGGSNKEWRRRKATVTATTALRCAAIEGARF
FT                   AELVAEGTELRRRMVREARTYVNSIH"
FT   CDS_pept        121169..122269
FT                   /codon_start=1
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638438"
FT                   /orf_name="MICPUN_97932"
FT                   /product="Predicted protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69643.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI000199C851"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI11"
FT                   /transl_table=1
FT                   /translation="MTPALERRLEAVSARHDALVAALVADPPPRAAEIARINKELARAE
FT                   RVVRAYAAVKERRHETASLEQVIAESAGVDAEMAQMAEDELATLEETTPALEETLAHLL
FT                   LPADEADDSGVILEVRAGAGGDEAALFAADLLRMYEMFARKTGWRFELVAANASEAGGV
FT                   KEATASLAGDDVYGRLKFESGVHRVQRVPATETQGRVHTSTASVAVLPQAETVELDIRD
FT                   DDLKIDTMRASGAGGQHVNTTNSAVRITHVPTGVTVVMQDERSQHKNKEKAMKVLRARV
FT                   YELERRKLADARADQRRSLIGSGDRSERVRTYNYKEGRVKDHRVNLLLNDLPGLLDGGD
FT                   ALTQMLDALKLEERRQLMAEFSVSSE"
FT   CDS_pept        join(complement(124453..125649),complement(122392..124353))
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638439"
FT                   /orf_name="MICPUN_97933"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69912.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C852"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI12"
FT                   /transl_table=1
FT                   /translation="MPPRKTPSKKKATGDGGYTPWTATAAEVCAELGVDPETGLDETKI
FT                   AKLRSEYGFNELDKEEGKPLWKLVLEQFDDALVKILLVAALVSFVLAFTEERAPGVELS
FT                   LVDFVEPGVILLILVLNAIVGVWQESNAESALEALKEMQSETARCLRAGEWISDLPARE
FT                   LVPGDVVEVRTGDRVPADCRVIRLKTATIRLEQASLTGESVAVNKTTEPVADAGCELQG
FT                   KECVLFGGTSVSQGACVAAVIDTGMRTEIGKIQAQIQAAAEEEDDTPLKQKLDTFGDQL
FT                   TLMIGVICLLVWLMNYHFFISWKWGGLSDPFSITEVDFNFAKCTFYFKIAVALAVAAIP
FT                   EGLPAVITTCLALGTRKMAKKNAIVRKLQSVETLGCTSVICSDKTGTLTTNNMSAVRLV
FT                   VQGTSYDPSDGGVVGLVGGSLDACVTAVSRVCVMCNESTVELKDGAFRCAGEPTEGALK
FT                   VLAEKIGVADAAANAKIVKLRAADPAKGCQGVADHHAAQGAKLATLEFDRGRKSMSVIV
FT                   ADGGKGSNKNSLLVKGAPECVLDRCSKVLLPDGSVTTLSPALREEIVATVAEMSSSALR
FT                   CLGFALKTGAELGKLGGYDGGEQHPAHKDLMDPGKYESIESDLTFCGLAGLRDPPRPEV
FT                   RGAIDACKTAGIRVVVITGDNKLTAEAICADIGIFDSPSDAVGRSFTGREFSDMPLAKK
FT                   KKLLATPGGCVFSRAEPKHKQDIVRLLKEADEIVAMTGDGVNDAPALKLADIGIAMGIT
FT                   GTAVAKEASDMVLADDNFSSIVDAISEGRSIYNNMKAFIRYMISSNVGEVVSIFLTAAL
FT                   GMPEGLIPVQLLWVNLVTDGPPATALGFNPPDVDIMTKKPRRKDEDLISTWAMVRYLVV
FT                   GLYVGAATVGIFAVWYTKTEFLGIDLAKDGHTPVTWHQLTHWGECETWKGFAGGKFTAG
FT                   GVTYSYTGSDACDYFHAGKIKASTLSLTTLVVIEMFNACNALSEDISLVIMPPWINPWL
FT                   ILAMFSSFALHFLILYVPALATIFSIVPLDLNEWLLVCAAASPVWIIDEILKFIGRNFV
FT                   SAGR"
FT   CDS_pept        125967..126557
FT                   /codon_start=1
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638440"
FT                   /orf_name="MICPUN_61716"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO69644.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI000199C853"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI13"
FT                   /transl_table=1
FT                   /translation="MAQKAPMTVTFVTGNQNKLKEVRAILGEEHADKFTLEARKVDLPE
FT                   LQGEPEDIAKEKVMLAARQIDGPTLVEDTSLCYNALQGLPGPYVKWFLDKLGHEGLNKM
FT                   LAGYDDKSAYAQCVFAYVDGPNGEPKVFVGTTDGKIVPARGPTDFGWDPVFQPDGFEET
FT                   YAEMDKAVKNGISHRYRALDKFREFILAEAAGR"
FT   CDS_pept        join(complement(128973..130458),complement(128609..128876),
FT                   complement(126814..128410))
FT                   /codon_start=1
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638441"
FT                   /orf_name="MICPUN_85385"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69913.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C854"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI14"
FT                   /transl_table=1
FT                   /translation="MRRRTRRVTTRASSRATGAGASTRAGTGKKHGGSEGGDEGTAGFG
FT                   VDAATLRELCEATPGEGRVARIRDLGGLDELARALRSNLRDGLAVTFDDAHARGEDAAV
FT                   VVVDDRDARIDAFGANVVPSRDVATFTELLLRALDDDTLKILVACGALSLTLELGFASS
FT                   SNHNPTAWIDGAAILAAVAVVSLVTALNDAQKQAQFERLNACAEGGCRVRARRGGEETA
FT                   VAIADVLVGDLLLLDAGDVAPADCVIVSTGDCVEVAVDESHLTGESDDVRKTSAGAPVL
FT                   LGGSKVLEGQCEALAIAVGANSQAGLVTAMVRGQDGKSAPGVGKSAPGDASRRSLSADD
FT                   KTVLQGKLETLALAIGRVGFYAGAFVALTMSASYTQRLFLGGVFAEGAVGGAVWGAVAG
FT                   SSPQWAQIAEQYLRFIITGVTVVVVAVPEGLPLAVTLALTFSVRRMLDDNNLVRYLGAC
FT                   ETMGGATTILTDKTGTLTRNEMRVRRAWAGGREFRFDELWSGLADAIRCNSTARDTALG
FT                   TGTAGDGTAGSGTAGSGRFGSRTELALLDFAEVLDPSLPGTRRTFGCPFDGGVERIVPF
FT                   TSERRRTSSSFDHSFGHFRQYVKGAVLDVLPLCSHALDSDGSGVRAVDVEAVEAVAKAW
FT                   ASAGLRVLLVARKECPPGFDCKRRDLEESESGWEGGLTLVAAVAMEDPLRDEVPASIAR
FT                   CADAGIVVRMVTGDSLATATSVAKKCGILPLDYHHPSSFDSGYEDVDDGVGFEDGGVAM
FT                   DGETFRERITDPASGEISQTRFDAVWPNLRVLARSSPSDKFALVTGIKASRRSRRREVV
FT                   AVTGDGTNDAPALRAADVGFAMGVAGTAIARDASDILLLDDDFSSAVAAVKWGRNVYVS
FT                   VQKFLQFQLTVNVSAVTTACVCALCVGESPLTAVQMLWLNLMMDSLAGLALATDYPGED
FT                   LLSKPPISSDEPIVSHRMRWNIAAQAGYQLAAMGTLVWFGDAIFDVPSARGAIDPEPWN
FT                   RWDFAGAADYFDLIDAASRVSRDAPTVHYTLVFNAFVLMQLANQVNCRAVDGRYDVLAG
FT                   VTGNRIFCAIFCAEIAMQVAIVQLGGEVFHTRPLDGGQWGACVGIALGSLPLRAGVTWW
FT                   LNRRETREA"
FT   CDS_pept        complement(130655..131407)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638442"
FT                   /orf_name="MICPUN_61718"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69914.1"
FT                   /db_xref="UniParc:UPI000199C855"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI15"
FT                   /transl_table=1
FT                   /translation="MPRNGETQLVQTERDEGIRLHTGATARPCARIGSTAPTAPSARAH
FT                   GTMSEAKPSSGDATLDALVRDLSAKVRATDGRWVEENAPKDGAKSIYDDFEGAIASAPR
FT                   IDGTPGGAVQSAADALEEQLAAFDAGGVGSAGVPIVDIDSMDDDAMGAMLGGGGAAAEF
FT                   NSFADDIVAMMLRHEEKKRAEGGPALGEAIGSDQGGGLAGKFDAVGDEMGGLTIAEKGR
FT                   EGGDGELKGLMATLSSQLREEKAKKGGK"
FT   CDS_pept        join(131478..131549,131733..133418)
FT                   /codon_start=1
FT                   /gene_family="HOG000264459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638443"
FT                   /orf_name="MICPUN_102553"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69645.1"
FT                   /db_xref="HOGENOM:HBG592264"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199C856"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI16"
FT                   /transl_table=1
FT                   /translation="MADVGQKRHNNDWGGGSRDRKRKKNFAPKPGQAARREIDVACAKG
FT                   DTAAAFAAFDAAVDSGEPLQPHSFNVLLHLCSGGTSTGGNYKDDAKTADGATPPAAKVV
FT                   VPPKDAVHPERANAIFNKMVELDVQRTEMTYTALARIEAASGEPRRALDVVKRLIDERL
FT                   TPKLRTFAPALHAFCMKGDIEGALEAEAEIANAGIEISEAEYAVLLNAYADAERWEDGL
FT                   ALLRRMREEVRTLSTPLVESTRRFFDRHPGWRLEASAEVDEATGAASSTPSGKKMQLAA
FT                   INLSASDRAALLAGIGKLAREREAKSSFDGFVRWLAKRGPLPYLVDGANVGMYNQNFHE
FT                   SRFNFNQVEKAMNALRPLARDTHAARRDACGEGAEGAEGAEGAEGAEGAEGAEGAEPAP
FT                   SAATEPNRAGDSPPGDSAPGDSPPGDSPEDLGLTDAGDIDVEALVSKPGVDVPVNFLHV
FT                   RRVRGGPANHPRAKALLDGWKRCGELFVCPAGSNDDWYWLYAAVASGDDAFLVSNDEMR
FT                   DHAFQMLPAPRLFAKWKERHQVRFHMSAATGLEFYHPPPYTACVQEGSDLDWWLFPGDD
FT                   GEWTCAVRK"
FT   CDS_pept        <133851..>134609
FT                   /codon_start=1
FT                   /gene_family="HOG000096858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638444"
FT                   /orf_name="MICPUN_71136"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69646.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748611"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C857"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI17"
FT                   /transl_table=1
FT                   /translation="VSWYPRAFHLHNFMSHEECDRILEIARPRVRRSTVIDSVTGQSKV
FT                   DPIRTSEQTFLNRGTWDIVTKVEERLAVVTQLPAYHGEDMQILKYGLGQKYDAHHDVGE
FT                   LTSASGKQLAAEGGHRVATVLLYLSDVEEGGETAFPDSEWMTPELRKWAEGQKWSDCAE
FT                   GNVAVKPRKGDGLLFWSVNNENAIDPHSMHAGCPVIRGEKWTATKWIHARPFRWTAPPP
FT                   PKAPPGCDNKHELCKAWANAGECKKNPGFML"
FT   CDS_pept        complement(134814..136550)
FT                   /codon_start=1
FT                   /gene_family="HOG000241130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638445"
FT                   /orf_name="MICPUN_108972"
FT                   /product="Choline transporter like family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69915.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG596570"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniParc:UPI000199C858"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI18"
FT                   /transl_table=1
FT                   /translation="MTLIPADSVCLEACPTTTIASGLVKAAFTCDYYGKSGVTVSSPPD
FT                   FWATDYYDKLSALQQLNSLAMSGPCYPNFVPYTPVMNRCVPTVTEEQLLLLSSANTGNT
FT                   STGDITYMLASMSGDSDKIQEYLEDLLKAWMVIVLCGFLGGLVFSIVWMTFLRYFAGCM
FT                   AWVTVISFNVILIALTLYCALKAGLIGADEVGISNSGTSSNATLIGNTTSWSIGEDTEN
FT                   AETFEYVTYLMAAITGLALLFTLLMIRRLMIAIAVLKVASQAIAAMPLILFSPLIPFVL
FT                   NVVFFGWACLVAIYLYACGDLKKDDAGNVSISWDETLQYMSLYHLFGIFWTTQFIVGLG
FT                   VMFTAGAIAAYYWQRESMPKSPIRRSIHRAVRYHVGSIALGSFIVAVVQFIRAVLEYID
FT                   RKTKKMQEGNPILKYVMCCVKYCMWYLEKVLKYINRNAYILVAVKGYSYCYSAIHAIKL
FT                   LIMNMARIAVINTVGDFLTWLGKIVVTGICGILAFLMCDMSMYTDPDSANYLTSPILPV
FT                   IVTVFIAYQEADIFMGVYEMAVDTIMLSFCEDCNTSGGPHYAPPLLMSALGKSTKKTKP
FT                   GE"
FT   CDS_pept        137534..140167
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638446"
FT                   /orf_name="MICPUN_61722"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69647.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI000199C859"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI19"
FT                   /transl_table=1
FT                   /translation="MRRAASVARAAFRARARRDSAEPLLGGHAGHSFLRCAGRAGSDRR
FT                   APTARALARPTPPRSPFIADPRIIGARRYGSDDDRGRNPAVVVGASRGGLCPTCSSAVQ
FT                   PMWPKALLPNEVGGGAADSGPTYWCASCKDVCKDPVRRGGPADDDMSGGGFDADAQGIY
FT                   AAMPSRAAAARAVDPKMGFTSHGMLPTAVPGGGVSDAATGATATVEGAGGGVPFGVPST
FT                   GGGGGGGGAFGGGGRDPASPPSGTRFADFDARLASLPTPRRMVQMLDAYVVGQTHAKKV
FT                   LAVAVYNHYKRVWSAERDGTLRRESPGSTASDAPPPRVDNHFRGTHDDDPASASGNDGR
FT                   GDRYVQHKASTEAWWPVNDDVAGRDDVAAAAARAAAANYARNEEERRRLRAYQNTAAAS
FT                   TSTADRVDRTTTNGCPFDSSGSVPPAEQLDAVRLEKSNILLCGPTGSGKTLLAKTLAEF
FT                   VDVPIVIADATTLTQAGYVGEDVESLLHKLLQAARFDLAAAQRGIVYIDEIDKLTRKSE
FT                   NLSITRDVSGEGVQQALLKMVEGTVVNVPEKGGRKNPRGDFIQVDTSDILFICGGAFSG
FT                   LEHVVDERRNNNAHERAAARDRPLRSGGVSDGEKTPAGDPGLDRSQTAASLASALGATR
FT                   ARLADDEPPSLAEGADGSVLPSMATRRARESAASREPFFFNYEDGEEEADHAAAEARRI
FT                   AADDAIADTESADLVRYGLIPEFVGRFPVTVPLRSLGEDELVRVLMGPRNAVGRQYQRL
FT                   MRMHGVDLEFTDGALRVIARAALRRETGARGLRTLVERLLTEAMFEVPDAPDVVKVVVD
FT                   ESSARRGLGLSLFAADDERKTVGAGGEERAAGGARLVYRVKGGAGGEERAATDAEADDE
FT                   PRAATV"
FT   CDS_pept        complement(140227..142092)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638447"
FT                   /orf_name="MICPUN_61723"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69916.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199C85A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI20"
FT                   /transl_table=1
FT                   /translation="MDRPARVIHELVGRAALEVELGDWISLEPREAAKRMMTQLSSRPE
FT                   FKEAIAMRTESVPQEFLQSAHISDGQHTAGDDGDRDDPNEAAVEDNLVGCEVTLKGLKS
FT                   DPDKNGRIGKVKAWLPDRGRFAVVLLTDDGFEERARGPLALKPDNVEKVEKEGGAWGER
FT                   GVAHVEHIPGAGRGVVADRELMSAERDNLLCEPAYATAVNRKQATTRCHRCFAMLAGPP
FT                   LIECPCAMARYCSSECRRAAREDPGDHCAEECAKGGLWTAITHETPVLATRIVRKDRDE
FT                   LKRGIKRRRRYTDLDWRGVWKATRKDDERRRGVVAQACIAAVCAGLDEGDVLTAYLVAD
FT                   GNTFTVKRPVGPKPVAPYDWREIFTMAECAVASALFLDASMLNHSCEPNCFASFPGREM
FT                   RIRNTEKVQSGGQLFISYGPVAGGAPRDVRRSLLSDAFGFECKCVACVGRDRVSSIDFM
FT                   RLKEAAMEHDDRAMSLVQSGDDSPEVLQTATLAARESMGLLHQLYRWPSLTLAMEAARV
FT                   AAVESASAGCVVRGWSEGRPNGRVRGVILTMAKDALLCLGAHTEKRRDRGEADGVVERA
FT                   RDFLVNLLISHRRHKPAGWDDDNVSAQVAFFCMMHEIHNGPNPHQ"
FT   CDS_pept        join(complement(143667..144819),complement(142312..143588))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638448"
FT                   /orf_name="MICPUN_61724"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69917.1"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C8E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI21"
FT                   /transl_table=1
FT                   /translation="MRAGRPSTALGRVSFGRNIPVNHESVAWAHPENDPIDDAPLDPWA
FT                   DDPELCGIPGGHASRDIGRHEEEAAPGRRRTPPRSPSPLAGATSGLVRRWAPNAWTVLA
FT                   AATLVQSCAGLAYSFSVYSGSLREVYQSQSAVDLLGSFKDVGAYFGVLGGLVFDAFGPR
FT                   VTLLVGAAMHTAGYLGVYATLRGDVPGFKNVPPLWRTGCVIALAANGNSFFDTAVLLAS
FT                   MNNFPTEKGTVAGLLKSYLGLSSAIFAQLYVTVAPPHNDDDASTPRPADGAAAAASGDD
FT                   ARARVFVLMIALVGGAVATLAAPFVREVGKPDVGAGSSVMSRGSDAAATLAKLTTCTVA
FT                   LVGCAAAAAALNDAFGPLKRVVNVALTCVVLFALASPTMALFANGKLSCGVAKPRSALR
FT                   SKHGRRMRGTDRGPGSSRGGGRSVTFDSSADVGAWDDGDSLGNPLLRGRGTTTDSGFVD
FT                   DDSGNFPSDDEEDASSRSSDERGRLGDDDEWAANRAQILGREGAFLHMRDEGEREGDFD
FT                   GDLDVVHGGMGGSAPLMSGTIGHHSAGIEQPPLLGRDSSNLTLSECAACPEFWLLWCSI
FT                   AASSGAAMALVNNMDAIAASAGVGDGAAAGMVSLFSVCNCVGRLCGGSVSEWALHRYTV
FT                   PRPAALCVAQVVVAIGTLALRVAPVRGGVFAAVSLVGFALGAHWGLAPSMSSEIFGAKH
FT                   AGAVYGGLSVAPMIGSYGLSTGVFGRMYDAVAAAQAAAAGVGSDLSTGNSTVPPGGGDA
FT                   SACVGPDCFSGAMGVCAAFALAATVPCAVVSARTRHVYAYHRRRILASAERAVVYS"
FT   CDS_pept        148128..152120
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638449"
FT                   /orf_name="MICPUN_102558"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69648.1"
FT                   /db_xref="InterPro:IPR019316"
FT                   /db_xref="UniParc:UPI000199C8E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI22"
FT                   /transl_table=1
FT                   /translation="MEGSRRSIISFLTLLVAAISPGVQCASSDSWVTPQTAGKMTHVMT
FT                   LPREIVQATPSACPWDEPGLVAWTPPSGAAPDYTLPANSKVLIDADATVGNVVIPTDSE
FT                   LVFANADVELNAASISVLGKLRIGSRTCRFGSTKTARITLTGAASDPAASSALHKGIVA
FT                   SGSGSVEMYGALRQPTWTRLATTAAAGDTTIVLYECVEWAAGDVLLITTTHAEDHRRHN
FT                   MNEKRTISAVECDERTVEGATHSFGKVTLASALSYSHYAARGEYQAEVALLSRNVVVRG
FT                   DATSVPTDAQPANTICADTKRSDVPCAPSYTCEVGGTPSSNCGPYYLTGHGGHLMAGDS
FT                   STAKISSVEFHRMGRTNEVGRYPVHLHMLGTGGVDSFVSDCSVHESYYRAFVVHSTNNT
FT                   LVTRNVAYDVIGHAFYLESGEEEANEISFNLGSHVHPIGFAEDMTGQNTNDEFQEDASH
FT                   PAVIPADVAASPFYFSNLQNNITGNAVAGGGFAGFTMVGFRKVINGGSFTPSDYVPEDR
FT                   PTMEDGFYGNSCRSVGWFWNLAPCFYVGGMLYEDAGDSNKLKYVPARVTSSSDKRHPKS
FT                   IVDGTDTWNIFVNSRAALCPVANGDWNVRGRWYNVDVVDIGDRSMNAFGEQSFRNVYLK
FT                   CRTDNTDGTATMSPATTLHEKMWPDMKFKGFRSYDTGQKHLVEDWIVDCGSQASPLMDT
FT                   YEIRRAQIWSFPHGVNINQHQIIFRNITYVDAPDQKKLFSYDVGSKDTYSTYYMTFSDA
FT                   DGSMTLRRENNNKPCAPTIAGTAGMIHSVSSGGDSDDLIHLPANMWYKLTGLDEAISRG
FT                   TNTADDRCALHTESEYPFWLCDQGKVNVGSFMPVPNNQDSRDSKKEFGRLTHWGDTIAQ
FT                   GVPMSGQAQVTGPFEHSKRGGWFIRFYQSGDNSASTAAPKKLEIDKVQLAAEKQVLMIA
FT                   TEYPSGTTFAITRKYGSGSGDVYTYTAASSVEEVRGDDAGTTYFFDDTYLYLRLFPSGD
FT                   KHEYFVDGPIWVPNRKGGRETTVEATWSSGSGCGTDNWCPLTSPADPPARDVGVVENPM
FT                   TVVETAACPTQSTLWPLRLQASSSSSSSGSGSGSGSGSPPSEDKKDDKKDDKKDDKKDD
FT                   KKDDMKDDNNKKDLSADEKAQKLEEKKKQAEETKEKMLAKIEKKLQKKADKLAKAALEG
FT                   KKVRKLKAKIAALTEEAACLKFYEDSKMDSSLGECVATKVTSRRRGRRLLAENYDTELI
FT                   MTEDEISVDALQAAEAALVASGAEGVTSAASVDPIEELKVIPGVEADDVATFEAQVDEV
FT                   VALSPAPAPPTSAPPPPTLEPAQSGTSRAARFVTAVVLAASAVLLA"
FT   CDS_pept        complement(152679..154337)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638450"
FT                   /orf_name="MICPUN_108976"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69918.1"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniParc:UPI000199C8E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI23"
FT                   /transl_table=1
FT                   /translation="MDFFRKAADAVGGLILDSDSDSESERGGAAAGRAGRRTAAEKNDK
FT                   TPMDDHWTDGGMDLGADARGASGSDDGAPPEGADGSFETSDDEGDEKLIPDAVWGALAA
FT                   ARGKISEVASTVRADVASAVEVVRHDLSEFNDRAVDETAAFAGDVAAAEYSAGLGLDAN
FT                   LGDGDDDDDTAGDDGPRLDPDVARAFDATVDALDDVGHRVEDFGVRVLGASKRFFKNLK
FT                   EELALDDEDDDEDDEDDGGGFTSRVGLGAGAAAAAGGGLAAKFASDRASSKPRAGSSNA
FT                   ANPNPNPNPGRPKPQTLEQRVAAMQRDSATYCDEPEDLAGFERWTSGFDADSPTVLDEI
FT                   ESVLEGNAFMAELQARIVPLVVTREEFWQRYFYALRRIKLEFGVEKEEEDEKDEKQEEK
FT                   KKEEKEEKKKKEEEKKEEDEEEKKEEEQEEKKKEKEEDEEGGKQIESENAEEAPEAHFE
FT                   TAKPPAHPRVAAVSAADSADESGVTSDGSWTKVQSDGEIVEKEAATAEGRMKGVDDSAP
FT                   AEKTGREKEAVAPPVAKEPAAADDEIDEDWGMDSD"
FT   CDS_pept        join(154538..154887,154981..155896)
FT                   /codon_start=1
FT                   /gene_family="HOG000168000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638451"
FT                   /orf_name="MICPUN_85739"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /function="racemase and epimerase activity, acting on
FT                   carbohydrates and derivatives"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO69649.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016857"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000199C8E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI24"
FT                   /transl_table=1
FT                   /translation="MPAVAAVAAVAPRGSARRRRWSSAPRRAGANTRANATSTKRGGEE
FT                   ALPEEEGSWLVTGAAGFIGSHLVQRLLSTGAKVIAVDNIDDRGPYPPAWKEANLEVLAD
FT                   TARRTRASGSRLVVDEDDDDGALASNPRPMPPVSRVIHLAARSGVAGATADPEGATDAN
FT                   VASTAVLLDLASAHECVSFTLASSGSVYGECAVDVDSGEPVASREDDSTDHPTSPYAAS
FT                   KRAAELMAHAYASLASAPSAPSAPSAPSAPMRVTVARIFTVYGPRGRPDMAVYRFVAAL
FT                   LKREKIRRFGDGQSTWRDYLHVDDVVSGLLAAARRGEGAEVGADAFAIVNLASGSPTRL
FT                   GELIDAVASAVGLTNGADEFVTQAPGRPGDVGGTFADVSAAKSLIGWEPTIGLRDGVAS
FT                   TAGWYASEEARAWGGGGGDGDT"
FT   CDS_pept        156090..161120
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638452"
FT                   /orf_name="MICPUN_61730"
FT                   /product="Peptidase S8 and S53"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69650.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG557369"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000199C8E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI25"
FT                   /transl_table=1
FT                   /translation="MRRRRAFLAPLAALAIFAAIVSVARADVHAPVGFGRGQTFLLSAR
FT                   RVFATEAGADDARVEPRRRLVENDPRYGTAVRRVLLEGARDGPSEGGGEGAGTRDESGP
FT                   PRHGTDTPKRRDGVGVARLARRTVDADEELAAEANGTKPRLTSPRPGPRGGLGASAKRA
FT                   STTRDTGDDRPKIPTTDGPERKNLDPRWRLLLLDDDDDDDAVWSNPGDLGADAIASSSS
FT                   QLLVVTDGRAGVAAQLADALATNGGALGEIVPAFSWTAIGGPRAANAASAVPGVTWVGP
FT                   VRPEDAIARAWDPLFEAIALGDRARVDDAIRGFDGGFVGGRIAARVYPPSLSTPDGTPD
FT                   GTPDGTPDGTRGIVDALAARIRDGFATASGDPLASASASADKKFVSVSFAANAAPRAVG
FT                   WLASLRAVHRVAPVLRVRPERFSKGFIPRSSGRFGAGGRSLSNFEATEVVQGGELAGVN
FT                   TKTPFYDAGIDGAGQVVGSGDSGLEARHCAFSAPGKVVMHRSLTGDTRDQSGHGTHVVG
FT                   SIAGDLTSDGSGSKYDGVAKKASVAFTDMGYEVNATRLCYCLSSATCSPNAANEDWDGQ
FT                   YDGTLANGELDSSTFTLGGVTYPVSNLHACKDGAGDRACTKYDRSCADEGMTDWHHPRG
FT                   VLWNLCCVFSVVNGEQTASCTNECAHDRTLNEKNFLCKYNGKAMYTEADETCSTYAAYG
FT                   VTEYFPDGFVKESLKSMSDIATDMYDHAKAAGASIHSDSWGGNTPAFDVQTNQVDNYAW
FT                   SNLKFLPMFAAGNEGQEAEANTPADSNGKTYKYTDGRGTLGNPTNAKNCVSIGAALSDN
FT                   SEPIDNSMLATKFGDKWDNRTDWTWQVDIGGSEGTHWSSSLIRGFRADVTISAPSGGDH
FT                   SLDGRAAVVADPVVLCSTILNTAEMKDKVVIFRWSSCLTIDLMIDRMQQMVTAGAAGFI
FT                   VYVFDWYEPERFKLLAANSATGWTIPTIVLPGKEGELLRQLVDQRGAGVTLGISGPILP
FT                   PKNKFENMASFSSLGPTYNWLIKPDLVAPGDSIYSASILTEAEVAGGDTCKKVDKDGTS
FT                   MATPVAAGAFALLRQYFTDGFYPSGEKKSSDAFVPSAALLKAVMVNGAQALTGFESDGW
FT                   PIDPPPSTKQGWGRIELAASVPLPSSVKLDVSAQKTPTNLIVVDDVDDKMTASSERGLC
FT                   VDVDGSIEDLRATLVWTDPPGSMAAEGALVNDLDLQLFFGDAGAGKMLWPLSGDDLDGN
FT                   FPFNGDGYNNVERVIWSKPDVGRYWINVKPWQVQVPQPFALAVTGQVTEVAGKKTKASC
FT                   LPPPPPPPPSPPPSPPPPPKPQAPPGAAIIGRAVSTGYLSGCLVYLDANSNGKLDADEP
FT                   QYTTDKFGGFSLESAAGGDVRVSASRSIAGSEACADSFTGIAPGVTSLASGGVKPGTGR
FT                   VVTALTTVAKAIDRVDSQSRVKEVFGIPAAVDIATTDPLAALAAGGDGGKELLVATTLV
FT                   TNLVSTLTSLLEKASGDASTAESHVVRALAAKVVDASGGAAGGRRMRTLLASSSFDLAS
FT                   EETVTSIADASVQNAVAAGATAPSSAATAAVVKLSSAAATVLKTDIAAASTPEVMMTSA
FT                   AAVSAVMQGSEVKTAVADAGGGGALATLTQLADASTMSSKVATAKQTVSVDLPKAPPPP
FT                   PTSPPPPPPKQLVVDSGGSTRRPTAAAVMAVAVAWLML"
FT   CDS_pept        join(complement(162287..162340),complement(161367..162164))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638453"
FT                   /orf_name="MICPUN_61731"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO69919.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199C8E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI26"
FT                   /transl_table=1
FT                   /translation="MASPILRFINAHHVLNTMLILAYPAWFRAWARVTFPDNLDALELW
FT                   EKQCGISCAVILLVRGLRAESLDQFVSTVFFYCKAVGAPLAYFADPLDPDGPGGRCVAV
FT                   YLALVLILHLFVGHPTHDWLPSKIVALTPRTFEDDVMSDKESKESEKASGKWKKVEWLV
FT                   LFYANHDARSSHVAPTFAKISDEFATDGLRFGKLDVARWPATARRMNIDVEAIGRDAVV
FT                   PTIMLISGGEERLRLPEVYDDGTRVKFPVQRTRRVDIVKGFGLEERHAKTRPKDRDAKK
FT                   RD"
FT   CDS_pept        join(162826..162930,163121..166996)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638454"
FT                   /orf_name="MICPUN_61732"
FT                   /product="Encodes a protein with hydroxyproline-rich
FT                   glycoprotein motifs"
FT                   /function="copper ion binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="ACO69651.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniParc:UPI000199C8E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI27"
FT                   /transl_table=1
FT                   /translation="MSAPATRARGAAPTWDEEVDFPNEALQSETESDSASDGEAARWTR
FT                   GVPTAPAGAAEIARRSPHSRASDDSALEGEGTRPTEPDELPGAFEGETRSVRIEGEGKM
FT                   RFVPADLEIRAGDVVRWEQSERCPVNHFLEIVAVDDDAEVHVAESSDVLTPANPWRHRF
FT                   DAPGEYHYRSLVHTYMKGTVRVAPRILGSLKADPADPYEFVDETDEVADVAADVSADVD
FT                   EDGDKDDDEEETGNDAEYSLLPSGDEDDEDRVEDPRRTLPTAAEADAKLDELIAVMSAG
FT                   GNNDKLETLEKSFGSMELLTSGKGMAGLDAMRRRRMTMGASDRGDADIWRGRPPKKESP
FT                   TFKSMIKPPPEAVQRALDECRREADSTERVKAAMKAMGRADQPASGLIGLPEVYQKVQA
FT                   SVAGGAWEFGEEFALDVLVADGDTFKCRCGKPFAAAMNATRHVASGQCMWNKDDRKKKK
FT                   KDLKKNKDRGPAATKEQLAAFLVAMSPQARVDFFKSIGTDRDGREWQTKWLVLRAIKNR
FT                   HEDHFLTGFHPEKIWGPGESLQRHFARVRRAIERLGIFDGDKRLNGSGDIVGEAVKVFH
FT                   QYAANCAVLRDYIEDPDQARDMDPGDLSKLIASIDAVSEETFLSSGKYGGAVDNPDAMC
FT                   AGINQEAALAYMTEVALVNAYVAARSAEAEAEQRKLLAELDEAAADEERREARRAKEKA
FT                   KKAKAKANKKKGVTGVESSPEPAAAASAAEKEKDSEADFEKDDDDRYDDRYDDRYDEEE
FT                   EEAERAREKERAEAEAEAARIARRRAAEAAAEAAELAEKEARELAAAERRLEMEMAARD
FT                   RAKAAAEEEATRRRSGEFDPPGVGRSIAGGGLLGVMANGVVASPYGKARPKKPSPNQPG
FT                   LGKPPQRPNAAASTEASADAVAKAPFVPPLPPGPPPAAAAAAGRSPEGKPHATTATATS
FT                   PAARAQSAAPVVKPRPAPFDPSKQPTRASPAPVVSSASVAAPGSSRHPGGAGRGKGGYA
FT                   GTGGKGGGYGSAAGTGVNSGTGASSLSESDYRSSDAESGGTGARRPSRRDRAVARAAAK
FT                   AEAAQRGSGRESGNSSQSEQKIDVYRRDAPRDGGRDDPAGPGPAKSLSEVEGMLLAAAE
FT                   RTEAQARRARAAAEEAEVSLRSKEKARLQAAAEEERRTRREEAEARKSAAAAAAAAASA
FT                   AAPKVKYCTQCGERQTEGARFCSGCGVPLAKPADADDDDASSPPATAPAPPPPPPPPPY
FT                   AHYPAPPPPPYAGYPGGAPGVPPVDLGAEYSALYLQHYHAALAAITAQQQQQYAQGHYA
FT                   GAYPGGYPAYDPHAAHPYGATAAPGAPPPPPPVPRGPPPRES"
FT   CDS_pept        complement(167078..168391)
FT                   /codon_start=1
FT                   /gene_family="HOG000264469" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638455"
FT                   /orf_name="MICPUN_61733"
FT                   /product="Transcription initiation factor IIE, alpha
FT                   subunit"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="ACO69920.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG557372"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniParc:UPI000199C963"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI28"
FT                   /transl_table=1
FT                   /translation="MSEHKKLARLVARAFYRHSSTRDRLARVGNAKYDNSRTAEVLIDA
FT                   LTRRAWVKEDDLARAVLLSSKQVRKALHYLEEQRIVRRAHVKEKDKEREERTRARAEEN
FT                   GVEEAIIAERIRAIEKKIVTYVCLDYSRVVDAVQLRLAAAHADLKYRVEKGPVSVLYKC
FT                   TSDAEVCGKRYSSLDAMRLLDPTTGLFTCQVCRGEVVQLGGGEDGAPPEPRTKEGMKAI
FT                   LAKFETQTAPVLRQLAKVRGLTPPQYGTLNEWTRARRRAFANAAGNGGQGLGSNGQGLG
FT                   SGGGMAINVDNLEDTTFEVTLGLTEEQEAELEAAANPKKAQPEWLKGSVYVDDEQTETN
FT                   EANDDETKEETEEDRLKKNEEAIKEEWLRAYLEAIKGAGAAPGDDDGAAAADVVGGGGE
FT                   MAKSHASTDALVDAAVDMADAAADDEEWDDVEEDWEDA"
FT   CDS_pept        168509..173089
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638456"
FT                   /orf_name="MICPUN_61734"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69652.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C964"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI29"
FT                   /transl_table=1
FT                   /translation="MRPPVVAFGAWPSRPPAHVVTSATASGVADGDVQLWTGGEDGGIV
FT                   QWRVPGPSRSEEAGADASDDLDPTPVAFLSGHTDRVSALCAVGDVVVSAGDDGVVCAWS
FT                   IAKGASRCVARRAMGGEGCRVTALCEMRSSTRGGVRCVAAACAACGPNGAPTIALLNPR
FT                   TLAPVNVDGAATLSAPSDASHGVPISLACRKPKLATTTPRSSTPGGCEWEWEGDLVARD
FT                   ASGRESAWGGPGRRRDDDARGGELSRGCEGGARTAADPSEEDDAGLARLGVVRSSRVRT
FT                   PSSAPEKEKRENEEEEEDVEEGLAATTDDDEETVHETPTSTAVVLLEVSTPRRAGDVEI
FT                   EVTRDATVTVMALASDGRTRTRRRASLSASWFPGESPPGESPPDESPPPGQQRAGSATA
FT                   TCFVGGGSLAPSRVVAGCDDGDLVIGTLPGGGGGDSPSSSFTIERAHAGAVTRATEAAG
FT                   LLVTGGNDGVVRVWSLDQTHTGRPELRASLRHHSFAVTQIISAPVGFGGVAPRPASQDE
FT                   FPRRLHTSAGVHTGGKDRFVFTVDASGALGLVDVERGRCEVFIPGVAGHPRRGPGHRER
FT                   LAELLLDVGRGALALRYEGTHDRTFNRVRVWDLFGGGVMDRDVVGGAAAALASALRSTC
FT                   HRASARGYPAWSPPLVSGDDAKISTAVSRPPVNGDWTQPGAPYVIANAAHLLNACRAIV
FT                   KKHSAGRVGIGTVDEEGGVDGEAARALRMVAAAGHAWGVDDSVDAAASRALRAPSPRTP
FT                   RASGGDEASSGSGVRSTRAAVGAGGAVTISAPRGEYAQKDLGVWGREAATLRALALEAC
FT                   AASLHEMAPAGGGGEGDRDRGDLALVRAFNASVHPLHLPTLASLYASPSADVRAAARSL
FT                   LSNACNACAGRPAHALPAIFRETPSEALRECPKASGLEAWGAFEDAFDDNAGLEVFRDP
FT                   SRDADSSRLAPRGCLGACVAAAACLANPPPGTHPALHALVVPALLELMRSCERVSLAGA
FT                   AASMLGEGVERIGWGIGEPGGRFLEETLREACDTAEALANPSGIEPRGTSPSPRTSVTG
FT                   VTGVTSPRMKGRSPRASADWTDRRSPRSPGSPVGSSRSPSSGGAARNGPAGIPSAPRRH
FT                   PVGTPAERATARDAIDSLLFAAARSNPASFAKFLSARIQTAPPTSSSHVVALAALARVA
FT                   RESPHPRELLAPHVHALMNAVLAALNPANASLRRNCLVAATAVVAELARRLPNVTYHRA
FT                   TSRLAVGIDSPAPSGGTVAIVYDLALAATWRTLVDRDDHPAEEARRFIDGFGAGFGHMW
FT                   ATGSGTSDAGAESPRSQRTSGDGWWSPFKDLGRGRRGGRRSSDGGGGGAFVSDSPTSPE
FT                   ARTARAHAAMAAIPVPETPEQRYAAAAAAAATAMTAHRADPPRKSFEGSRRSFQSTPAT
FT                   PVTPIVVDDSARIEVMAWDEKGERLAAYLDRRSVVRVWNVASNSVWRPTSLFTRAQPGV
FT                   AHGGDASAVGYSHSVRCVVPSETSGGSNENDDARVARERTSLAWRDDKTVTLRRGGIDA
FT                   SFGVSD"
FT   CDS_pept        complement(173228..174883)
FT                   /codon_start=1
FT                   /gene_family="HOG000165037" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638457"
FT                   /orf_name="MICPUN_85803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69921.1"
FT                   /db_xref="HOGENOM:HBG330635"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C965"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI30"
FT                   /transl_table=1
FT                   /translation="MVSREKKLKRELNKRAKKFMKGDTVNTKNIKDKKTKAHVRYANVL
FT                   ADNAATDAALHEKWLLPSTPGAIEVEGDERTWRIKQDEIMKAVDINAARKAFDLSLPTL
FT                   GPYSVDFTPNGRDLLIGGRKGHVAMIRWSDYKLVTEVQLKETVRDVKFLHNGQFFACAQ
FT                   RKYAYIYDNRGLEVHCLKDHTEVNRLEFLNHHFLLCTVGDQGVLRYQDTTHGKIIAQHR
FT                   TKLGPCDAMRQNPTNAIIHLGHSNGTVTLWSPNMGHSLVKMLCHRGPVRSLAVDMTGRY
FT                   MATCGADSQVKTWDVRMYKEVHSYYSAVPAVHVDISQRGMLGVGYGGRVQIWDQALSGP
FT                   KAQAPYLNHQFRRGEIVRDFAFCPYDDAIGVGHSGGFSNLIVPGAGEPNYDSMIANPFE
FT                   TRNQRREQEVAQLMDKLPPEMIQLDPDGIGVVRAVPKEVQKERREKALEAEMAARRDKR
FT                   EANLEKTRMKGKNKTSKRYRKKQANVVDDKKLRARMLAEETKQKAAKARGEGGRATGGG
FT                   AEGGGAMPAQTAGAASSAPVAPKDVSAALRRFYK"
FT   CDS_pept        join(175399..175662,175850..178840)
FT                   /codon_start=1
FT                   /gene_family="HOG000201177" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638458"
FT                   /orf_name="MICPUN_61736"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69653.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniParc:UPI000199C966"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI31"
FT                   /transl_table=1
FT                   /translation="MRNDGDALASTPEDAEVDAGDVVGEVVKQPKDAPSRDEPTSMGWL
FT                   ARYCRHCERNPWTGFLSVFFTVLVMAVVVGAFGLARFDTENDKEWVILEDEVTSRTDAA
FT                   EAALKLRDRSIGKVAGAAILPREKESEGATLMFQFESTVDGVSVFNRESILLMKEISDM
FT                   VLATPGYADVCQLAYDGEGENATSLGCVPPVSPLNYFFPTVTRHANGTVANVTHDGLGA
FT                   DLVTDIDAVVRSFDADRRGMGYFLDGGFDPQTLHNRMTRLKYPVGAPLKGFNDNSRDEE
FT                   KQENKVGKLWLDAVEKALFERFGMSAGFLSSPYLGIPSERDVEVRWYAAYLRRRDSQLI
FT                   INYDLAWAFASILSVWGYMAFSTGSVFIASLGMFEILMSLPVSIFIYKLVFRIAYLGNI
FT                   QVLSIFIVLGIGADDVFVFYDAFKQSALVPHVKDNILDRVTYTAERASKAISVTSFTTM
FT                   MAFLATAMSKVMPISAFGILSATMVFFLFVVNVAFFPPALMLYDRYVGKMCSCARLVGD
FT                   KAANAEVPGSRPASADGSPTSTATLSNDAALNDTARVRIHAWESSEKTPTLTLAPTPTK
FT                   AATGGGRVRRVTVNPFALRGSYAADRGDGSDDSSMDDAESGTKNFAMDKKRLRPVEWFY
FT                   REPFFRFIKSPARHAILVAFVALLLYGAWGANKLEPPAQQEQWYPSDHMMQAFANKREA
FT                   FASSDEDRVIVVDVFWGLDGMDVSSVNRWKPAERGELRLTQTFDASSPEAQTHLANACD
FT                   ELKAATCDAPGCEGGTLLRNGAAARVICPMRDFAKYQSALNRTFPAAKESFASEMYEFL
FT                   STKHGKFLRKHVGFEAANADGSVPKMFYYRVTADSSLNYPAVARTARPVFERWESVVDS
FT                   INAKAPAGVNRAFSTGYWSWTWMKTQEALVQNTVQGLLLCFVMAFVVLVVSTADLRAGF
FT                   LATVAIAGTVTTVMGVGVHGIMGWDLGIGESIAAVILIGLSVDYCVHLANAYVEAPAWM
FT                   TTRERRTQHALMIMGISITASAVTTVISGSILWLCILKFFSKFAFLITATIVSSFFWSV
FT                   FFLPAALITFGPLPDDKWSNLKPLFNAMCALCVRRR"
FT   CDS_pept        join(179106..179835,179896..180569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638459"
FT                   /orf_name="MICPUN_102565"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69654.1"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C967"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI32"
FT                   /transl_table=1
FT                   /translation="MTRRAGAVLALALFVVVSPLDRLGVAADSPTLSAGARHTCAIDAA
FT                   DALHCWGDDSDGQTRVPADVAAWRAVAAAKGGCHTCGLALDGAARCWGCDANGEVSGVP
FT                   TVPGGNRWISVGAGKGVSCGVAAVDRAVRCWGRFMPQVGANPWYGPWSRVTVGEDWVCA
FT                   LSANDAKARCRGWSANGQTNVPPSLANAAWLDLSAGFQHVCGVLATFPRSLACWGSGAA
FT                   GESTPPTPTEEEMAADPSSSIGSWGAVSAGTHVTCGIVGAQRRLKCWGKALDYVPGSEY
FT                   AAAFGEFGQVAGAADVATWGTIVSSSGGDSSGGACSWDVVATGKHHACAIVAQPSSSSS
FT                   GAQYTNDSSNVSSNVDASLRWAAKEPGSTEPGRVVCWGDERGGKTRVPSAGVTLPWRAW
FT                   PATFDDAVDVVAPPFGFTAQRTAAVGTCATVSAALGGRSVAGGSGWDVFVSLASATLAT
FT                   AAIALASSR"
FT   CDS_pept        complement(180672..181898)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638460"
FT                   /orf_name="MICPUN_61738"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69922.1"
FT                   /db_xref="UniParc:UPI000199C968"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI33"
FT                   /transl_table=1
FT                   /translation="MWNQKPLSSPGGSPKLGGQQQRSNPFASSRPLAGTAAAATATAPS
FT                   PAGGHHRPGHQPPPQHPGANATTPATGPPPTAAYTPHVPAAGATAPPPTASPQRAFYPT
FT                   PPEMHPQAGIGTGGVQMTGHETGGYGAMGPMAGGGVPQPSQQQARSYHQHHDRPHQHQH
FT                   QQSQQQPTAYVPAPYPHSNATGVQSAPSPGLFVPRTADASLGPPPGPNASSLVPPANMP
FT                   PPFVPPTFGGTTPVSSGRSSPAGVAPPDGRSVGVGVVGTAGPPISLRGREKYCSGGAWV
FT                   GPAPEWPKPPPDATIANADVSRVRPRHAPVVTTLREKFESLYAHASGARKKELDGISTK
FT                   IGGMFVFLNEGTGETHISDNVADSLAALCAAMRAGDAATVNAHLLHVSTHHWEEAAYWF
FT                   PSLKRLVKL"
FT   CDS_pept        182343..182903
FT                   /codon_start=1
FT                   /gene_family="HOG000241199" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638461"
FT                   /orf_name="MICPUN_61739"
FT                   /product="PII protein"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of nitrogen utilization "
FT                   /protein_id="ACO69655.1"
FT                   /db_xref="GO:0006808"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="HOGENOM:HBG748089"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniParc:UPI000199C969"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI34"
FT                   /transl_table=1
FT                   /translation="MSSTTAIAAQLRPSSAFRASTRRGCARGVAPTSRRVRTIARAEQR
FT                   TTVEPISLDDNVPFYQVRAMVRPWRLSGVIDALNKYGIRGLTTYTVHGAGVQIGTVERY
FT                   AGSTFDESNANLVEKVVVEIVVVREQCQEVVDVIVDAAQTGEIGDGKIFLSPVHDIVRI
FT                   RTGEVGAAAERMAGGRSDMKAKV"
FT   CDS_pept        join(complement(183988..187047),complement(183079..183855))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638462"
FT                   /orf_name="MICPUN_113766"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69923.1"
FT                   /db_xref="UniParc:UPI000199C96A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI35"
FT                   /transl_table=1
FT                   /translation="MGGQKGKSKGGAKGRGGGKKASAAAGGNRGGDKSDPRALRAFVSS
FT                   HVELAWVASADEATRAAFLDHASTPPAASALETSFAAVRECVEQRACSERVKDVAVHAL
FT                   ALVRSGEVERLAKDAKTRSTEVRADPSTPTSAQARTSTGSSTFSSVDDDSDSDSDGEDA
FT                   AERKRDAELARCLLGSGGSDASLAVSDFAIVEAPVDSDHGATVRFAAASAGRSAEDARP
FT                   ALRAALERGLAWMARVQGEGSNSSEGSKKTRDAANPVEKSSDASPPSGAIDANKPQSED
FT                   PTLYLDHSIQSHDRARAAKADLEHFASVYRQEWHVIAGLQASCAEAGRDWDGLAQACHA
FT                   WMLLSDRRREFHFEKQLRTKFESLKMHDHWARESARIHRSFDARHGGHLGGGLNAAAQS
FT                   GFSKTPARTALGAQQTAARQAAMDDMKRGYDEADRELRERETMTPRVEADRLIYSANAA
FT                   IQAYMDYLTRLQMRLSAADPKEREEQSKEMHKEEDADVTARDGSDDDERETDDVDVHHV
FT                   EACEKTGKLKAVNTDGSFVYVDAPAITDETSANAAIAAALDAAHKAKAAGKEAAADAAA
FT                   AAFGKFGLITAGPGRNLAEKYKTSAAEKYKAEWDQEVAYAATSVQRAEWLAMTQEERDR
FT                   EMAVRQERCNTVYVHITRWNAATDALKQKQRSRHNNAGGQYWNTQDILGHVQQMERTVF
FT                   AWLKGHQREVHQAELKLQSLMEKAPDAASLGVTNPNNRAAGGFTTGGVGLAKDVAGPRL
FT                   NYDVFPSKFLNKLNAIGEEYESKIRAWRDEISAGNRAIHETAANTVARAMFSQTCARLA
FT                   CTFAEAESDRRREELDDLVLLDDAPDGAGGSKKKPKKKKKNQNAIVAIAGPEASSAEPE
FT                   TRPAAETSRLEPDSPMDDSAAEVESDRDEHEPSPPAPVRKSAPPASSSPEIEEIEEIGE
FT                   GDDLGSDVASGSEGVDAWWGIERGEKARRDEGSDWVAAGPKPRKTREQRARERHERAAA
FT                   ERADAERAMRRERELRERKARERERWEREEAPPPTVGSMPARDGGGEPEAIPAEDDEAL
FT                   RIEAIRIGELESRAAKAAKAAQAAAEAAIAAAAEAAKMQAEAEAAMREARRSRETLAKA
FT                   ATGPVQSANHAPGPERSANHASGPDRSANHASVATAPPPPPGAPPGVATHGSDSTMTKP
FT                   VAAFFAGASNRAKAPSPPRKTPTSDTPGDKPGGEGGEADSEEEIRRLSSSDFPALSPSA
FT                   AAGKAAEKRAAPLIAAHKRATETSNLPVGAKPFDPNMAKAILAGMRDGDPNKP"
FT   CDS_pept        complement(187229..189112)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638463"
FT                   /orf_name="MICPUN_106110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69924.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199C9ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI36"
FT                   /transl_table=1
FT                   /translation="MAADPNDPDRIFYVAGSTVVYGHLGKTGGQSFLRGHDDDVTCMAV
FT                   SHSGKLIATGQTGVNADVVLWDAVNGKELFRLSEHDEGVACLAFSPDDRLLVSCGIHAD
FT                   GKIFAWDTETGCIVANGALSPRETNAIAFAPKIQRNGTYYTFGTAGKEEVVIWGCDAGR
FT                   GLIGGQKCGTGNTKRYFTSCIFSPDSTELYVGSKSGDVSTFNVQGCVLRNWAPCCKGAA
FT                   QVFMQVDGGRYYLVGGGDGSVGVFNPHKPPTVLDALDYVWEFEGGVTSMSTVNDEGSRS
FT                   GNPKMVVCTAAGRKYVAYVKRRKAGVANPTPVLLEESHVDAISLVQFAPAGADFGDQGP
FT                   KAHANSCMQAVVSCGSDGALKAWNLNPRPVCTMRTKVKSTAMAPMCVCVCDQMFMTGWA
FT                   DGHVRAHDNVTGELLWTLPDAHAQGGVTSIAVAHGAHFFCTGGAEGMVRVWDMRKRQLV
FT                   STFKEHRNRVVGLTVLTDDLHVVSASRDRSIITWDLVRECRVHQQTQHVGGINACVINQ
FT                   ANPEAMQMVSVGQDRSLSFWDLMDRDPLQIVKGAHSQECTCAALSSQGVLATGSKDQTV
FT                   KLWDFDSGRLLAAQHAHCGSVSSVTFSADGRTLVSGGEDGIVMVWDVAVDR"
FT   CDS_pept        complement(189522..190307)
FT                   /codon_start=1
FT                   /gene_family="HOG000263450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638464"
FT                   /orf_name="MICPUN_108979"
FT                   /product="Putative uncharacterized protein "
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ACO69925.1"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324056"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniParc:UPI000199C9EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI37"
FT                   /transl_table=1
FT                   /translation="MSCGKCVAAVESAVAAVPGVEAVTGALETNTVRVVARLQHADDVI
FT                   DAITGAGYKARLIGSGDVEAFGEDLARRLGTDLRTLRQSLAAVAEFKGKAYGHGDVTGV
FT                   VRFVAVNEDTCVVEGALEGLVPGAAYAVTVRQFGDTTHGVATTGGVYTAVDASADADAA
FT                   ADADIDAARAAGDLGEVTADADGRATVPSRVVDSRVKVWDVIGRSLAVVRANGPGEEDG
FT                   AAAVLARSAGVGENLKRVCHCDGTVIFESTPDDFKPSSA"
FT   CDS_pept        join(190791..190849,190961..191507)
FT                   /codon_start=1
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638465"
FT                   /orf_name="MICPUN_91758"
FT                   /product="Superoxide dismutase"
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ACO69656.1"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG609879"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="UniParc:UPI000199C9EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI38"
FT                   /transl_table=1
FT                   /translation="MAAVATSVNLSAKSALVGSKKVVTARAFAPASARRALVVEAADKK
FT                   AVCVLTGTAGVEGVVTFTQSGDGPTKVVGDLKGLAAGKHGFHIHEFGDTTNGCMSTGPH
FT                   FNPHGKDHGAPTDENRHAGDLGNVVATADGCTFEIEDVQIPLSGVNSIIGRACVIHELE
FT                   DDLGKGDSSEIGTQGKTSKTTGNAGARLACGVIALTPA"
FT   CDS_pept        join(complement(192206..>192263),
FT                   complement(<191835..192055))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638466"
FT                   /orf_name="MICPUN_76735"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="ACO69926.1"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="UniParc:UPI000199C9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI39"
FT                   /transl_table=1
FT                   /translation="RFALELEFVMSLANPRYVHHLASTGAMDDPAFIAYLEYLRYWEQP
FT                   QYAKFVHYPHAFYFLEQLRRPEFRKAMANPRLAEQAHAHQFWHWQRSR"
FT   CDS_pept        join(192485..192523,192732..194093)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638467"
FT                   /orf_name="MICPUN_61745"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69657.1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="UniParc:UPI000199C9F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI40"
FT                   /transl_table=1
FT                   /translation="MDSKKMYEAVFGKSSSSSFSGQGRTLGTKAEDEEKKKARIAALEA
FT                   EAARRRAQAGGGASGGGGAPSRGGLAPSGAAAAAAARLAAGAGGSSADDMRRQILAERE
FT                   RRRAAMLKEKEEREKALAAEDEDPAMAPLNDAVARVAAHADAEASASLLLRIVGNALNN
FT                   PTEPKYRRVRLANPKIAAAVLDTDGGLVLLECSGFRLVFEDDGGEGDPRVMVLDADADP
FT                   APLSAAFRRLARLAPAAAAKFSQAAPAVTAPRPPDPAKPPAAGRNARAFTPAEVCAAAV
FT                   TDLGDEYFQRTPEEIQAEMARKRAQRERDSVLTTKSWKDKNRFGWEGGDGPAGGGFDAG
FT                   KPAVVRVRMPDGVVLQGDFGRREPAGAVREFVASALREPHRTFSLSFLGKPVTEDDEGG
FT                   AAAKAAAEREQAKARGGKGAGYAAAGTVEGAGLFPSALVTLKWTDANTDGGKAALASAL
FT                   MASAEPLE"
FT   CDS_pept        join(complement(200915..201009),complement(199680..200766),
FT                   complement(194220..199484))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638468"
FT                   /orf_name="MICPUN_61746"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69927.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR019269"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C9F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI41"
FT                   /transl_table=1
FT                   /translation="MRFAVLDCEDAVKWDGHAIALSRLLSRAGERWEHFRCWNDERPAV
FT                   VDLPAYAGLVVTGSHHGCNDAHAWIRNLRAFLKHVVEEHPRVRILATCFGHQLLAQALG
FT                   GAAGPNPGGAFVLRRESLECEDAMLERDDFRVAAAMFPPASAASEGLKRIRVIESHGDC
FT                   VTSLPPGATLLASSSTALVEAFAVGDNALAWQGHPELSAGAVERKILPFVASMSAEEKE
FT                   DAVASWNAGGRDDALLLVAMARGFLRGGSCDGDDAEIVTRHYERADEIFRDIISSPSSA
FT                   SAGTTLADAAEATFLRVADAVRADVDAVSAEFRHLAAMNQSAGARYAAIGRRVGDAHVF
FT                   ADKVRKVQETGIAPQLARLETIEASVGSLENVAQVLDARCAELERRFARVVNGEQKFGT
FT                   HGSANRRWFRMRKTRRLAHSEGARGMSGRDRGPGSAGRGRYRGGDEVDGLERPLLRATR
FT                   DDLDDDDRDEFSRGDSRGEETRVRVIVDDVDDAAADDDAAAAADDDDDAYDSDDSRRGR
FT                   SPRPDASARLGLSHREAARRLRRFGPNQPPPPDDRRPSRVAAWATWRSPAAVATWLAIA
FT                   CECARALAHYRTDASDAGASDATDPDFPDYDPGSTSSSGGGFRYGADREPVWAAILALL
FT                   AVQALHAWCAWARETRAHLASSKGGIGMGGFGLGGIVVAVRDGEPRRVSALEVVPGDVL
FT                   RIRAGDVVPADAEVLVPGDGGADSGDGGARSGDSPDSGTPRGGGKRRRRTAWSFAYSLG
FT                   GRFVKVGVRGGERLPAGATAVAGECLCVVTATGATAAENFTRRPRSGRSRSSAVAETSG
FT                   SLLLRATSAFVCVAMFAVLYARDTYEDAAGHGTDGGFFGALAIASALFAVATSAAHDHV
FT                   VDAPTRFLVSYLARRGIVVRDDGGADGGADGGAVRKLAETDAVLVDEKIARVGPNGASL
FT                   RAVHVTQTGVSPKDVLVAAALSTRWLEPPTSAVDAAVLGAVDVEPLSDSYEQIDHATEG
FT                   GDSPLAEGGDSSLGVGWIATSTLVRKSDGGQSAFRTCVGSVDAVLTRCRSGWADKDDAA
FT                   RMVEECAAAGVLCVAVAADYRGRSDDDGDDDGGDDGEGDGEGDAFSDGSEGSDGAAPRT
FT                   PRRGGWMLLGLLSFHDPPRADAAYAIRVAKELGVRVVIVSGGDAREARELCRAVGLPTH
FT                   VAGAECLDVPLDLVRRTTTTNRTAMNPQTDTTSSGTYSIPHVLEAERAGAFAAMSRLDR
FT                   GKLATLLRRRGRRVCAMGASASDADAFRAADVSVASRAASTPTATVNAADVTIASPGLA
FT                   GLLHAIVSCRSARAQVRGLTVHRVAIACQVLLFYAVAGAVSKPDDFAPGWPRTFRVPVA
FT                   AMCALCVVDAVIAAALAGGNPCRNVAPGRDPERRSRAPPPAELADAFVAGAVHAFANLA
FT                   FLGIALRGFDGGGRDGAGKAGGSSGGLFGGGFGGLSAGFVFGFGFRVGSYGEVVAGSHL
FT                   RACLGVVTTALSSRRPPSVHVLVAVLASVTSVTSLAANGAFAVDAARLDATQIFFVAMY
FT                   SCVVAMAQFGARAVTSRVLARAGWLPPTGGASPDRPDDAVVGGGATWRVRRSRELTRAE
FT                   TSRVAAFADSVYQPLEEHAESDPSRRRRGVGNVAYARGGGSFGTSGKEGEFSSPPRGER
FT                   LVDRGRMLRESVRRDLSDRSAGGWEQDVPPGTASDAESGGGGMPVPDYESEDGRMRPWA
FT                   GLDDDDDAAADVYSGFDGSASDGPGSASDDVDDPAAIAAANAGRRLAPAPTSAREIAAA
FT                   NAAGVVRATAPGQSWAPPVNSRSGSAQAAAEAAADAAVPRADRLRLHPEYVAATADDYA
FT                   HLVRSHDWRRTLGAVKEEAARRGRSEVSVLDVGCGAGAFTAALAASGALLPREPALLHD
FT                   DDDDDDDEAVPPVPCSFRVDLLDPSPRALRAAAASLVPPLALGELRCASVQDFARAALT
FT                   GLTNDDVNAVDAGSVGSSGRGTYDVVWAVHTTSHVPCGINAGYGSSLASFLKSLRDLLR
FT                   PGGFGFIAAPTNDSHYARFHALYRREFGPGSGFDAARIGDPSRPAKPGFNGGDPIGGRG
FT                   ANTTSFGGDQYTAAEHVAAALAARGVAFNRVDVSHVTRVNAGDGARLEAYLRGCAGDDA
FT                   VSLDTMLANPRIGAYLASCRSADGSHYAFPQKTAHITL"
FT   CDS_pept        join(201463..201600,201774..202415)
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638469"
FT                   /orf_name="MICPUN_85577"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69658.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI000199C9F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI42"
FT                   /transl_table=1
FT                   /translation="MGIAKPGSEPRRRRSGAIAVKCGMTAEWNEHGVRVPLTVLWIDDC
FT                   RVTQVKTQEKEGYTALQLGAGSKKAKRLNRSERGHFIAGDVPFSAELTEFRVSPDAILP
FT                   VGTAIGASHFSAGQYVDIQGRTIGKGFQGPMKRWGFSGLPASHGTTKKHRAHGSIGNSQ
FT                   DPGRVWKGKKMAGRMGNRTRTVQSVFVYKVDADRNLLYVKGQVPGKAGRFLKITDALRK
FT                   PPETPAYPGWGFGDFAKEAPGGVSVAKMDDPFVKQSE"
FT   CDS_pept        join(complement(204349..204683),complement(204171..204186),
FT                   complement(203586..203939),complement(202664..203479))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638470"
FT                   /orf_name="MICPUN_61748"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69928.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniParc:UPI000199C9F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI43"
FT                   /transl_table=1
FT                   /translation="MLHEAISVTSFEGGGGKALLVTAPIPKGTVVWWENQDEEPDWVSI
FT                   PRCRLYIDNLPAEARKIFEHYMYKVRPFPIFVFLSHPGGSYRRADSLVGHIRVAIREPR
FT                   KYIGGVSKINFSQVGEDAYESLPEFDRLPHDQWKLGVSDDPSMFMNHSCAPTCWFEPDE
FT                   LYKNDGVVVMTATRDLVPGDELTFDYATSEDVEQNWKCLCGEPTCRGRVTSDDWKDPAF
FT                   QAKYRGHCMPHVEALMANAANDAALGLFAFADLRRSGEIGGAFWSPEDVAKAGRAKLPE
FT                   AFWSAEKCREEASNVAAQVPLAIKTPPPGPDSWGRHLVYLPEQDGEEAMAAPIVAGQTV
FT                   MLMPPNLLLRDRQMKGRRGYMGTLYNAALQVRPSAQRPGALYSLSETPEDLDNYINHSC
FT                   DPNCDVEVFPTNYLIKLTANRDIFPGEPVTIDYETTEEDMVAQGDQFECECGSENCRGR
FT                   ILGWKYRAARGPIAIPLKVGAEVDSPAVTEPARPGVLQPLVEPVSATA"
FT   CDS_pept        complement(205173..206024)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638471"
FT                   /orf_name="MICPUN_61749"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69929.1"
FT                   /db_xref="UniParc:UPI000199C9F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI44"
FT                   /transl_table=1
FT                   /translation="MSTPLSIYHPVGSVASVGARFRAASPAARVPRPAVPSATARASKN
FT                   ADSAGAAAARARPGRGSSLPSLARGPEPSTSGRSHRQNTVRAAATEDAPAQTSSGIPDG
FT                   NLRKDASASEYAELKQTLLKTTALYGAGLTAYCTLGYGLANGLSAALGTTGGVAYLLML
FT                   QRYVDDLEPKEGWEDELYTRNLVYEPVTDVFGMIGGAFGKVGQVYSQALLQKRLLVPCA
FT                   VAVFASAFNALDFPFDFNYGPVLLGFVTYKAAVLSIMYGDVKGDITRAIAGSANGEGAE
FT                   ER"
FT   CDS_pept        206636..207199
FT                   /codon_start=1
FT                   /gene_family="HOG000100802" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638472"
FT                   /orf_name="MICPUN_108981"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69659.1"
FT                   /db_xref="HOGENOM:HBG557385"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniParc:UPI000199C9F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI45"
FT                   /transl_table=1
FT                   /translation="MAADVMDVNEPSIMNLKLKPRTQEVILETKAEHINEDFSHEDLVG
FT                   AIYTEGDLRGSDFSGSDLRAAIFSRAVMPGVNLEGADMSNSFLDYVVLRGSNMRGVIAR
FT                   EANFVRSDLGDCDVTDADFTEAVIDRYQAIGLCDSASGTNPFTGVDTRDSLGCERLKRY
FT                   EGFNKENSKVAVSKGSGTWGGAAN"
FT   CDS_pept        join(complement(209031..209084),complement(207339..208892))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638473"
FT                   /orf_name="MICPUN_102575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69930.1"
FT                   /db_xref="InterPro:IPR018799"
FT                   /db_xref="UniParc:UPI000199C9F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI46"
FT                   /transl_table=1
FT                   /translation="MAEYWTVTQELLQGSDPMLTENLLKKPPFRFLHDVVSEVTRNTGF
FT                   ARGLFDAVESDSGKVKDKESKVAWLTKIIACVGLALGEHVRARPLKIVAGLEPEHTNAF
FT                   LQQLARAASAGDAPDAVRRTLAGETFAGDNDNTAGAAPPSRREPPQREREPSPPRREPS
FT                   PPRARSPSPEAFAPPPPPHSDSDDELAPKTNSSRTDPVDRSEPLKDQSGASTTRDRSPP
FT                   PSSRRPPPRPQSARRAPPKLASNVVEVESGTSSRDGSRPGSVEGSRGGPAQLSTLNPNP
FT                   KPPLANVLGEGDVVDSDDDDESGEDASAPAPAIAAPSAGTAWDRASDIGGGALVRDMLA
FT                   AKREGDAAAASAVGATTDEATAKAASGGGKGIILGSRRRSRKAAGGGGGGADDHPTGGS
FT                   TGGVGGGVSAAMFRDDDDDAAGGTTEDDVEAIRERVQALVQFTNPLGKAMDALQEDVET
FT                   MRRELAFWQRERENMGRIAQEVKSAPLGETVAKQDRRLEEADDEIAAMKKKIQSVKAAI
FT                   HRNDDKIAKLLDMVVTPA"
FT   CDS_pept        209389..211092
FT                   /codon_start=1
FT                   /gene_family="HOG000265576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638474"
FT                   /orf_name="MICPUN_61752"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69660.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG607920"
FT                   /db_xref="InterPro:IPR012617"
FT                   /db_xref="UniParc:UPI000199C9F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI47"
FT                   /transl_table=1
FT                   /translation="MPPTRSSTRAGGGLNLAALTNPAPASTELPDDDFDPTGGALTRDD
FT                   DGDASDGDGFSDDDDDDALDRDDGVFRPTEDDEKASGKGGRLRMRGGLSLDELGAEYQG
FT                   KRTSRKAMEDAWAGEGDDDDVDDDSMEGLDADDLARMEREAADDDEDEDDDDDDDDDDD
FT                   DDDDGSEDGDDMETGDSGDDDEIMDDDEEDASEDDDDDGGDDDGDLAAELAAFRREEAE
FT                   ANRLAAAKSQNAVKGAAVRRQNEMWEKALQTRIVLQRALNASAKMPTPPYAVALCSADA
FT                   NVTRAMATCAAAARGALDALCSLQAALIDGNPAIAEAAAAGSNPAAGGEGEGATTPAGG
FT                   GKKRKASSAMAAVSKFGLLAAPASEVWKSVDSVYERYAAFRDVSIDRWHRKAQVQVGKM
FT                   SGGGGGGGGGGEMRAFNQSVSSQVASAMRIPDRLIRKSQPPAHLAPRRLGEPAAASKAA
FT                   PTGDRTEDLDEDDLEARAHAEARVEELYDDADFYEQVLKEFLESAGAGAGLAAASKPAK
FT                   RRKIVDRRASKGRKLRYHVQQKLVNFCAPVELEVPPWAEKIFGQLFASSG"
FT   CDS_pept        join(complement(211840..212311),complement(211534..211661))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638475"
FT                   /orf_name="MICPUN_61753"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69931.1"
FT                   /db_xref="UniParc:UPI000199CA7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI48"
FT                   /transl_table=1
FT                   /translation="MRSPILLLLLGVLLALTPGAEAGKLGKLLWWKHWGKHGHGHRSGS
FT                   GWWAASATKSDEKGMDHGDMTKMHGDMDMSHMDDDADDDDSQDWWRSKSWRTESWWGKH
FT                   MSRHGGWKMRSSGRAFGSGQGIRAAKCMVRECGMELQKCRMDMTCRQGVKCAVGCGMGS
FT                   DDDSRQCSLDCALDNRNDVSTALFGCIVKEGCLPEM"
FT   CDS_pept        212764..213771
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638476"
FT                   /orf_name="MICPUN_102577"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69661.1"
FT                   /db_xref="InterPro:IPR013326"
FT                   /db_xref="UniParc:UPI000199CA7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI49"
FT                   /transl_table=1
FT                   /translation="MRARTSALLLVALAALASTARAADATPAADASAQRRRLQTIGHHN
FT                   THISSGTGTHVGDMVHRLRDAHEDNVQKIEDAARAAQASVQAAHDANMKEIADTTAKLT
FT                   NAHDETRDRTLALMNSAEERFSAAMTAAIAALANAAEAWRDHLRESSARYKARVEAFQD
FT                   KQVERVGKLAGVAAGVNAYGKQKVDEAYDAHRQRVADMVSEIGDHLGDTADKLTGGKGV
FT                   SGRRLLEDHDDDDDEEMDRRDRDWPNFRMNQDGPFERVRKGWSEFGKHRRDRWKKHHQP
FT                   VSSGTGTLVGDAIHNARNKNRHRHHQPVSSGTGTFIGDAIHNARKNARSKEDDE"
FT   CDS_pept        complement(214053..215927)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638477"
FT                   /orf_name="MICPUN_102578"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69932.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199CA7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI50"
FT                   /transl_table=1
FT                   /translation="MRPPRDSNSTAPPQSPSRAEAARFELAENARLALEAKSAQVEGLK
FT                   VKLAAAEAALRERDEREREEQAARASSEHAGVMHEADRLGDEMKGALGNVKAFMRRAWT
FT                   GAGQTASSETDDVTAGNRTPERRATNARDGPHTPSSAMRSKAKTSIVEKPAARGAYLRA
FT                   GGDSPGGDSSLVGRQRPKTVAFVGDREQRRLEREGEVVADNARLRRTVGELEQRLKRLA
FT                   RVARRATDAAESKFADERAARLDAEAACERLRAALEEVGGAGRSSGVGDEVGKVGAFGR
FT                   SLVEELETSRSACRDVLLVARCAARVNASDPAAIVAALPALAALAGERQGDTAHALADN
FT                   GVVASAAAAMEAHGRDSSVAKAGCELIATLARGGGPSVLRGLAGSARKAAAAVARDFTT
FT                   PASGGGGGGGGRAGSQKFSPRSPAAHNPSVAVVDALRRHANDAATCAAAADAAWAASHH
FT                   GGVAVASRLLADGVVAALADAMALHPTDHDVVSKGSHAVCCVAATSAANAAEAASQGGA
FT                   AAVAAAMSDGAADAIAAYPSTERWVAEHGAAVTHRAVTHSSRSRSRAVYAAGGGAGDDV
FT                   DDESWLVEYERGVMERTAGRAPRKVEVEEEDGEDGDGDSGSFDFDSNL"
FT   CDS_pept        complement(216678..217811)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638478"
FT                   /orf_name="MICPUN_113772"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO69933.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199CA7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI51"
FT                   /transl_table=1
FT                   /translation="MAALGVRPPEWNDNYKAKIKKIFDQCDDDKSGTVSLDELGRALAA
FT                   EKDLCRILGIDPIAAEPGNKAKLREVFNTVDIDGSDELDFDEFGLFFQSRVEILRYLPG
FT                   TDDEDKFCIIQESIEQIREHANEIHPMAIPGLFNDRIENIKPIVDGLADAILDDIGDAV
FT                   DCFLEPDKIMKAKREVGYVLATRGATKANFDAYGDAMLSAFEAGYGEGWTAAHHEAWGK
FT                   CLGNLMDMYRLGVEDFQKEERDKKQAAIEAAKAAEAEAKAAADKAAIKAAEDAKKAAEK
FT                   EAAEAQKAVEAAEKKRKEEDEKRAREREEKAKKLAAAEAKKTEEELAEERKLKEQRMAL
FT                   VRANQAARMKREQEALKDQEPFCFCLKKGMVKGTPLY"
FT   CDS_pept        join(218324..218332,218520..219683)
FT                   /codon_start=1
FT                   /gene_family="HOG000024037" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638479"
FT                   /orf_name="MICPUN_95208"
FT                   /product="Homoserine dehydrogenase "
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO69662.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG477935"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniParc:UPI000199CA7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI52"
FT                   /transl_table=1
FT                   /translation="MKTVPLHVGFVGTGLIGKATLKQVGAHAPSLLATGGLDLRIAACA
FT                   DSKHMILASSADGMNPDAVDAAVGDRAVAEWDAGALAAETPVAADLDALVEKIVAHARA
FT                   TPDGAAVIVDNTSSDAVADRYGEWLAQGVHVVTPNKKANSGDLQRFRRFRAVADESGAR
FT                   WLYEGTIGAGLPVVSTLRTLRASGDRVRSVQGIFSGTMSFLFNTWDVGAGQPFSEVVLA
FT                   AKKAGYTEPDPRDDLNGLDVARKVVIAARESGVDLALDDVDVQSLVPAELEDCDVAEYE
FT                   RRLPEFDGVIAEQAAAAAAEGKVLRFVGKVDAEKGTGSVELAKFDASHPFAGLQGADNI
FT                   LEISTARYSDEMSSTPLIIRGPGAGAQVTAGGVFGDLCKLGAVLGARVPV"
FT   CDS_pept        join(219954..220407,220582..221300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638480"
FT                   /orf_name="MICPUN_113775"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69663.1"
FT                   /db_xref="UniParc:UPI000199CA7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI53"
FT                   /transl_table=1
FT                   /translation="MCPLRPCSNPSAVGVFVRDTASWIAYSPQATEKILAGYSETLGLS
FT                   VSDLLAGELGAKDGEPGSPRSVLPGAPRASPSSEPGRVDLGSLGLGGGAYVVDIVAGTQ
FT                   VSPRGFARPVLFVFPDARSRERFARALEAGDAKCECAVAAGDAERSKEEQNAERLAPTA
FT                   WAQIAANTKKEDAIKASAKLAATKAGLKKAWAVRQRQQGRERRLAAAAAELRAKEEEEN
FT                   KAKEVLGKVRKVLDANRHAVHAVATKYARAKVSEVTLDTESPHVKRFVELASSDISGDP
FT                   DIVLGYHGTSVDRAEAIVTGGFCPTKRVAALGAYFSGVPEESYQHAGKHDSRGSILLVA
FT                   LIRDGYKGANSSERTPDSLRRLAGGDVVSERVAAFEEYACLPLVHVRGVC"
FT   CDS_pept        complement(221746..221913)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638481"
FT                   /orf_name="MICPUN_61758"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69934.1"
FT                   /db_xref="UniParc:UPI000199CA80"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI54"
FT                   /transl_table=1
FT                   /translation="MPAPANVAAPAPAPKPTMSISEDAKKVAIKLQREALERIEKGSAE
FT                   LDELFVKSWK"
FT   CDS_pept        join(complement(223085..223141),complement(222097..222924))
FT                   /codon_start=1
FT                   /gene_family="HOG000165015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638482"
FT                   /orf_name="MICPUN_95210"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO69935.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG397841"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199CA81"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI55"
FT                   /transl_table=1
FT                   /translation="MDYAGKANELMDKARKKLATSSFMSMFSSTSKYEEAAELLEKACN
FT                   NYKLAKMWREAADGFALLADCHDKSDSKHDAAVAHVEAANALKKIDVDAAVASLRVAVG
FT                   MFQDMGRLSISAKHLKDIGETYEKAENFEAALEAYAQAADIYAGEESSATANTCKLKVA
FT                   EIAALVERYPLAVERYEEVAKASMDNNLLRFSVKGYLLCAGIVRLCYQEPHGVKNAMER
FT                   YEDVDPSFAGSREHKLLGDLSDAAEAGDADAFTAALAEYDSMSRLDPWKTKMLLRAKKN
FT                   LAKAVEEEEDDLT"
FT   CDS_pept        complement(223934..224422)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638483"
FT                   /orf_name="MICPUN_102582"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO69936.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199CA82"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI56"
FT                   /transl_table=1
FT                   /translation="MATPGPTFWQQIEANERARHAEDRRAAEAFIAKRFVPLLARVNVK
FT                   HVVDVTRGDTNNWSVGEIVCNHAKMLRASCVVMAPHGRGRVKEFFVGSVCNHCLHRCEA
FT                   PLVLVRPERVDADGKAKETSAVKSTAEEATQTVGDARGAEAKGERDEGDGGKAAGVSA"
FT   CDS_pept        join(225069..225104,225257..225372,225519..225930)
FT                   /codon_start=1
FT                   /gene_family="HOG000065978" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638484"
FT                   /orf_name="MICPUN_106116"
FT                   /product="Peptidyl-prolyl cis-trans isomerase "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69664.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199CA83"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI57"
FT                   /transl_table=1
FT                   /translation="MPNPTATFNTSEGAFTAEIFMDRMPITASNFIDLANTGFYNGVHF
FT                   HRVIDGFMLQFGCPHAKDPKSRNAGTGNPPGGSSFTCNGKTITRDAGGNIPDELIDKTS
FT                   NEPGTLSMANTGQPNSGGSQFFVNTVHNDFLDWWRSDLSPSQHPVFGKVTSGMDVVNKI
FT                   GKMPTDPGDAPIKPVMMNSVVIKS"
FT   CDS_pept        226339..229404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638485"
FT                   /orf_name="MICPUN_61762"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69665.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199CA84"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI58"
FT                   /transl_table=1
FT                   /translation="MSTSSMAIGARLAPPVAGAARANARGRSSSASLARITASSSKRRA
FT                   RRAFPVVAAAADSPTGASDKERVDKTTNADGSVVYSFGDDVIAEVDTKTSFDLPPLAKN
FT                   SERDDGDDEDDRATTGEAPASNAVWKRRDEPAPPAPSRDATQNAPPVNTSGPSAPKFNL
FT                   TPKKPPAEEKENEKPQAADAAAAAASPEYDLEDAENARKVAKGAAILTAGTASVVALTL
FT                   GVGGAAVVESLDKIPLLSGFEEALGVAVSAYYANKFKGSFLTAAGRESLRLGLVEKFTQ
FT                   ATGLASLAGKLARTDPELDAQIKGVIGDLSQLPENGEELPVAVREAIASFIRNRDGALA
FT                   EETAALRASNDALQREVDKIELLQTDLERARRETTYARANIRVMNLGEKERQSLRDAAD
FT                   EAKKAGDARVDALREQMEKMAADAAEAAKEAEKALEAARAEASRLASEADSAAALAEDE
FT                   RRREVAAALAEAERAAAERLAAFESSAAARAAEAERAARNAAAEAEAEFAEELAAKVAE
FT                   ALEAAEARSVGDVSAANERADAAARELDELRASYAEMERSVEAKSAAAADAARVESEAA
FT                   AAAALKKAAQEAEAKLVAAEERAAWAIEEERARAEAAIAAANADAAELADAMKKSEEAT
FT                   RAAERASEEAEAAKKDAEAAKKDADAAKKDAEVAKKDAEVAKASLVESEAKSAELEKKL
FT                   EDVDAILAEAREEVAASKAEFDAALTEARATADATVVKVKSELADTRAELDTVKGAYQK
FT                   LENDVDVKIAFAVEELEQKYDAATTRAEASEARAAQAEAQLADMNERVEELEFLLARAD
FT                   DEAAALAERATAAKQNMESDAEVHNLKTRLDDVTARLAAAEAAAKAAEAEATAATAGLA
FT                   AAEAKAGAVLEAADAAEEVEEAARRMTKRVAELESEVRRADAAAKKAEARAERLAKKLN
FT                   ETIDKKEKTTKRKKAEKKAKANAADGASAEGSENDFADEFLDTSVDIVALPALSKMRKQ
FT                   ELVDELAARGLDVSGTVPVLRARLREARAAAE"
FT   CDS_pept        complement(229639..231438)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638486"
FT                   /orf_name="MICPUN_61763"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69937.1"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="UniParc:UPI000199CA85"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI59"
FT                   /transl_table=1
FT                   /translation="MRRGVASAVASLVARGAEALPSWSAPGARGVALGVRSVDPALPRC
FT                   ARVRPARCLATDADAGSGADAEGSSMRFGSGLSNNETLSVAVAEAVAEVKATLGHDRVP
FT                   SWVQLAVSADYPDPTRAAAFVAECFTPAGGANLASPQPPPPAIFGGVVTGCIGGRGQTM
FT                   DGPSVSIVAAAMGPDVEVIPFTADDASLPKQVTPAQWARLMASGDSSSASSPASTSSPA
FT                   VSTSSPASTSSPMGHESVAVLALCRPDFIEVDDFTRRVHGVAPGSVCVGGAVRPGGALF
FT                   ADGAQCDESIAVSGVFVRGRSFRVTAHSLHSCRPVGRAMTLTRAVDGHVLDLDGRSAGD
FT                   VLSRMLQELPDHVSGLPVMLGVGEGGLSEGVGEGGMGVTNKGVNKGGPRPSRDVRGRVV
FT                   DDGSVAAGIADVARMAKKSSLGEKASEKRAKAGKIVEDVTGKPGTNRGLKGTHERTHAD
FT                   VEADAQLAARDGYASGGAGYVYRDIVMADRETGGIFIGRHSLENGAPVRLHVRDNEWGR
FT                   ARSRELMRLVHEEREARGGGLRGAVMYTCVSGDRLHAANFRDRVPGVELGGGYTSGELG
FT                   PSAVGRQSHMHSHTSVLGLFWDA"
FT   CDS_pept        join(complement(231984..232325),complement(231694..231807))
FT                   /codon_start=1
FT                   /gene_family="HOG000265846" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638487"
FT                   /orf_name="MICPUN_108987"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69938.1"
FT                   /db_xref="HOGENOM:HBG608334"
FT                   /db_xref="UniParc:UPI000199CA86"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI60"
FT                   /transl_table=1
FT                   /translation="MPAFGPRSSPSTALSRRASLRPLAAKPKEKDVDWDAKTKQMTAER
FT                   IMDACLEAMADGDEGRLEACLLELEDEGERAGVIDSLQQTPQVKDDKFWQGKLQEIAAE
FT                   RVLDNCMAAVMSGDVDEIEACMLDANNDTLLGVDVTTAEDGTKTFRF"
FT   CDS_pept        232902..234020
FT                   /codon_start=1
FT                   /gene_family="HOG000145430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638488"
FT                   /orf_name="MICPUN_108988"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69666.1"
FT                   /db_xref="HOGENOM:HBG638359"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199CA87"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI61"
FT                   /transl_table=1
FT                   /translation="MRAASRVAPACTTAALASVSSTATTATRGSVAMAASADDLEMIPG
FT                   VRRLAETKRVWLLDQFGVLHDGVTAYPGAVDAARRLHESGAKLYVISNSSRRSTNTLQK
FT                   LAPMGFDPSWFSGVVTSGEVTHQMLASRGKGSTSDGEESDSDDEFWASLGKKCVHFTWS
FT                   TRGAIPLDGLDLETVTDPEEADFLLAHGTEAINGAGTNDEQRAAGCVDTPLEDMRKVLE
FT                   RAAARNLPLIVANPDVVTVGGDAGLLPMPGTLARWYAEMTNHGAVRLMGKPDRIIYDRV
FT                   LEMTGLEASPEEAIAVGDSLEHDVAGANDAGVESVFVCGGIHAKELGMRRVASAAEVGD
FT                   GSGVAPPDREKVLEAAEEHDCEPDYAVPVFVW"
FT   CDS_pept        complement(<234258..>234657)
FT                   /codon_start=1
FT                   /gene_family="HOG000200885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638489"
FT                   /orf_name="MICPUN_74046"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69939.1"
FT                   /db_xref="HOGENOM:HBG710518"
FT                   /db_xref="UniParc:UPI000199CA88"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI62"
FT                   /transl_table=1
FT                   /translation="RAMLSVAVGAAVALHLSALTPHALAKTVNIAIDQASLAQESCGRA
FT                   GGVPGTGTYKATCMKIKGKATNPTSEPVFNADVYGLVKDQANDDVLNSGRVGSIDKLEP
FT                   GVNDFVLQITVADSQPLPLKLKNFKAQGV"
FT   CDS_pept        235122..236756
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638490"
FT                   /orf_name="MICPUN_61767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69667.1"
FT                   /db_xref="UniParc:UPI000199CA89"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI63"
FT                   /transl_table=1
FT                   /translation="MAPAILASARAWAQPLALTRRVSPDAPRAAPRRPARRPARRPVEP
FT                   ILAVRGAPSVRVDGVRGVRRRGSRVVSRAASAGGVWRLWPFAHAWAVDDPTIEADAAGD
FT                   SPGADQHQQQQQQQQQRGDETNPWRTVALVLGAMLVAALVHPPLASASSTLIAAVAANV
FT                   VAPVGVLYPVATYVAAGAQAWANNAVGVVGTLVSSAASAGAGYAAASARARAEMEELRA
FT                   EIAVIREAAAAVGISATSAVGNPAVGISASEPRPAIAEETRGAVVPTEDPVVTAERASA
FT                   EAELADLRRQLARLRAVWTPNDDEGDEGDDERGVGGGAASAGDAEGVSKRDGGDGGTRA
FT                   SSAAAAAGSVDARAAGGDVDWRAAAKSRAVWSPSVDDDDDDDDDAEVASSPASVASSSS
FT                   SFYSSTAIDEEEAARISAEIVALRAELAGVRGVGGINSRMTVPVPGAPGSPGDLGGVGS
FT                   GAREASGPVDWAALAKSRALWSPSDDDDGDGDDDVDAEAARGESRASAVDGFGETGERA
FT                   RLLEEDAAWRRRLGMTENAQDDQPLGH"
FT   CDS_pept        join(237467..237721,237878..239527)
FT                   /codon_start=1
FT                   /gene_family="HOG000017735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638491"
FT                   /orf_name="MICPUN_61768"
FT                   /product="Ammonium transporter channel family "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69668.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000199CB07"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI64"
FT                   /transl_table=1
FT                   /translation="MKGHATLDIDVRTIPTGLVHVPKVCVLIWYHDQMKKKRSRPAPFH
FT                   NDQRRKTHVFNRVSGTSNVTFRSARTPSRDTDKYFHHVFLIRVRALESTALRRVCGENI
FT                   DRPSVDARILGVRALDLPGEPAHSRPFRPEFEGPDPKPENPKNSRASFPLPLLLAVDVL
FT                   CKVGPERRGLAATTVAELSAEVATAVGLIHGSQDISYMLISGFFVFFMQAGFAMLCAGS
FT                   VRSKNVMNILIKNVLDACIGCLAYFCFGYAISYGTKNSNSFSGEFAGEGWFFLAKGDHD
FT                   AAFDTWHVFFFQWAFTAAAATITSGAMAERTAFQAYIAYSIVLSGFVYPVVVHWIWDTA
FT                   GWLCNWKTDKDGNSDLLNDVGMHDFAGSGVVHMTGGIAGLMGAAIVGPRTGRFDASGRP
FT                   MAMPGHNAALVVLGTFILWVGWYGFNPGSVLMIHATNAVTVARVCVTTTLAAASGGIGA
FT                   MILNYSLYKVWDLVAVCNGCLAGLVSITAGACVLQPWSAILAGFVGSVVLWASSKLLLK
FT                   LRIDDPLEAFPVHGACGAWGVIAVGLFADQQLLGDYMGNAKADQKIYGAFLGGGGKLLG
FT                   NQILGIVVITLWVGTTIGGLFFALKTVGMLRASAEEEAAGLDESKHGGSAYNMEPSKV"
FT   CDS_pept        join(239998..240559,240618..241291)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638492"
FT                   /orf_name="MICPUN_102590"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69669.1"
FT                   /db_xref="UniParc:UPI000199CB08"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI65"
FT                   /transl_table=1
FT                   /translation="MAHRSDRHGGAVKRRAGVPAATPASTETPRDAATDERAHPLAKWW
FT                   AYAAVMRALKVWDAMATWKRYAWITLVVVGPYVAWVCYLWFHLQSGLLRPRVPVDHPRP
FT                   VLIVGTQSSGTTQMSHQLARIGLEVGHETSDATWDFARDGTISWLHGMRFMPGRAPPAT
FT                   IAQLCRRFRRNMGLHPAQFRSPALGCSYRSTWDKCWSAECAGIVTREWGCAARGTCETP
FT                   FDVALLQLRHPLRTMESLAAKFCPPDDDLAGAFKPPHVDFLETAAALWPERTDWNTSGC
FT                   VDAVGWSVALYTRDMLAARDAGFIAEAYRVEDTYPCEVASRAGLLLTNARARGRCETVM
FT                   RKRKEGVNGGVDGQAGRATVTTVTTAKGKNVRNENGRVRFEARDVVSGELRALIADVAA
FT                   RGGYRYDDDEEP"
FT   CDS_pept        complement(241432..242331)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638493"
FT                   /orf_name="MICPUN_61770"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69940.1"
FT                   /db_xref="UniParc:UPI000199CB09"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI66"
FT                   /transl_table=1
FT                   /translation="MARGGIFAACMSASVARAAGVGTSYGAAGVGGDGASRARPAAFDE
FT                   LREETAREAALNEVFRKEFAREQRRLQRSVDDIVDAAKRGGIDGGRTGGGGGGGGRAGR
FT                   AGNARWSGCAAVSATLVLACVAALAALAYFGGIDDVVAMTIAPIAQSNARGGAPSARAR
FT                   DAPRGAHPFAARMRRDFEQSRREVRDLHRKLDETTAREERLEGSLSPWALTASLSPDPP
FT                   RYLRDEDEATWKAREKAEADAKAKEAEKANEKAAKRDEDADFVAEKKDEPSARSSRASR
FT                   KATAPRRAGGGKASSSRA"
FT   CDS_pept        complement(242596..250677)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638494"
FT                   /orf_name="MICPUN_61771"
FT                   /product="Predicted protein"
FT                   /function="3',5'-cyclic-nucleotide phosphodiesterase
FT                   activity"
FT                   /function="metal ion binding"
FT                   /function="phosphorus-oxygen lyase activity"
FT                   /biological_process="cyclic nucleotide biosynthetic process"
FT                   /biological_process="signal transduction"
FT                   /protein_id="ACO69941.1"
FT                   /db_xref="GO:0004114"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0009190"
FT                   /db_xref="GO:0016849"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="UniParc:UPI000199CB0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI67"
FT                   /transl_table=1
FT                   /translation="MSAAIIGVDAGVTAPALVTNTNTFDFTITPDWTDGNVVTAMRWGL
FT                   GTSAGAVDAQGLREIADLDAAKTGRTVNGTVEYKATFNSSVTRLALVPGTGYYVVVEAD
FT                   YTPAGGAATRKNASSVKIIADDTPPALVTLIPNFACDVNGVMTVDEATPKPEQVSLLHA
FT                   RLPNSQASRTNNAEAAALINNAIANGEDLSAKWGLELCWKFDEGESWVTDYSFAIFTSP
FT                   LSYYDPSVAVSNATGGVSRGRRLLAATTANVYRTFGQTASTQASVRTTSQLSPWKSLGS
FT                   NATRLKTSQRDMIDAMRTNPVDADAGVEINGYVALHIRATNAAGLITEVSGPEILVPPE
FT                   PPSGTAEGDSLIYGIIAGVVVVFAGVLFAFYREMRRQDKTAKEKERQQLLEDGSRQMNL
FT                   VLRALASDRDDDSLLKRLDSSSGGDSGVASGRRSRRGSVGSEDLDLGSVEEHRSGAEDW
FT                   RGRDGGGIHRRRNVVFVCTDMEGSTAMAAENAELYQEVQDKHDEVLSSAALAHNGYIFA
FT                   TQGDAFELVFPTIGDAVRFCLEGQEALLRTQWSSVALDLPKCGAHESKPGERAPFEFAG
FT                   PRVRMGIHAASLASRGDGVDEEDPHDLGAWDLQEFTRTFDKDHGRVKYDGPAVVMTRVI
FT                   GDSAAGGQIVLSETAVAEFERQRASCDFAVLSDLGKFQFTELTAGTLGSRTGAAGKGRK
FT                   QQPLDDDDGTAGDARSRHRGRGKDKHVVSRLHELQPPTFSYMPLREFPPMLRGTVKLDV
FT                   GHGLDFPKKPSIRAASRRGDTVVMARVHGIRPSKWAEIWLTSNFQQVMDRHVCALLQLF
FT                   GGVPLREDADIPSHTYALCFPAASAAVRFSMALQVSLLYGTWDNDVLENSVRPHYSRSG
FT                   QLLARGPTVACMVITLDENDGDDIGDMCRQMDYYDERGVPEKGNLGLRMTDPPAPPPFA
FT                   PPSVPNALRGSLNAKGHHAGDSEANHSGKGFGTGVANESSAASDDSSTIGGGNIDSSAG
FT                   GVARSGSSVTGGGLGNRFLAALGVSFGTQKSSWSSSSDDQTKTLRHVFAPGDPVRYSNF
FT                   SDAAKLPRFETLMRTIYPGQVSVTADTWLSVQHALPEGVSPVDLGAHKLRCKTVMVEPC
FT                   NGVRFDSNNGGGIMDSLGGGSDDEGGTGAARRTASMSLASSHEIRVDFADDLSDGAGDS
FT                   IRNAEYDVSLYNVSHRILHERAYPPLRSVRCSSPGYYDSPRPADGVAIVFCKPRLPKNL
FT                   NSGAAEEAKQRWASIARALLPVYSGYECKSPETGQFTLAFSRLENAIGFCTNAQAMMSQ
FT                   FAARDDSGGWPKELLDAEAKEAADAEAAVRKEREEARAQGLKKVNFVTDTAQLAAHRAG
FT                   QRGLRVAMGIAYGVNCFRKPLLETGRADYFGPLANLAARVMSCAHGGQVLVEGVPLLWK
FT                   DKERFRGSVHWFPNDPTDADSLKEREQWCERSKTAVNTMMGTFNVPWFLVVNAGKAATQ
FT                   MLLKELDAARRSRDAEEERGGTLAGSPNRPSIERSAGSASAGEPALHLLHNLRATLEQK
FT                   SERDIGAWIRQGGVGGLDMETGTSESALALCARGFCELRGFPQITPLVEARSPSLKPAK
FT                   FPAIRTQRDPVSYEKLAGPRPPRAWEATANATSTMDRSSKYYGGGAGSKLASIVLGMTS
FT                   SGPSRSGRGGRKGGSKWNVVRDAVEGSDKSGRGGSKFTRRLLAGDDKGASGDASIGARD
FT                   SPMHTSKDSNQSDDDDADSRNDGSATPSGASEEGSFRSGNRFGQRASYYGRGGGRGGAG
FT                   ESGRRDGSGAGERAAGAAGGSREQKLHAPTPLSSAAAAAREMFAAQYDDDDDDGDDDGD
FT                   GYVRARSPAIRHEPRVDAKPVASALRRVGSKADLATGTNAGGGGGGGGGGDSASEPSTS
FT                   RGNSVRGATSAADLVQGARQTSFGSLPVYKPGVQVERMPRLDRIDSTASAETTDTSPRS
FT                   TSEEGSRRASRDGGAVRKRGGRSRSSSSSAMQHSDDVVTEDAYQYKSRRGEVFKRLLDV
FT                   IGTAQCSPAARSRLWDAVKVLSRIVEDVKTLDADATDDDMRHHLDRLQRAINREYNSGQ
FT                   VPVVFCLVLMCFEHCSAARQVKMHTARAQYLMESMRRKGSTTSQGSSLSSESGRPRSSR
FT                   HSSGARSGSGRSSNASSERAKSNRTNRGPNEIAVDRAQLSAAELAEEIARERDAARAPS
FT                   SGAEGAVRDPDADPDSLSAHSGSTLSERPPSATGIVVDDEDGGQPGPFDIEDPSSPAAD
FT                   GSVVVEDESADESGESPDEDELERAAIVAGAPAECDITSVVAIAASVGHQHEPLDYGPK
FT                   ASETLRLRAHTWRDFDLFAFADDIGPERCGERGGGPLMALGVAILDRHGVFERLGVERD
FT                   SCAAFLAGLHCLYMRRGGIYHGPMHAADVLQAAGVLLDELHPHSLPEGATPETREAEPG
FT                   AGPAGGDGDGGTGTGAGTGRRRARLDDLQAFALVIGAAIHDVYHPGVTNAFRAAQDDDQ
FT                   ARRFGGVSVNENEHLSIALALLANPATDAAAGLGDAQRARLTRMLRHGVLHTDMANHAA
FT                   LMRDFRECAAAAREDPNHPWWSDEDATRAMGADGYPHKTQDSLVSAVLHLADISNTARP
FT                   APLFHAWAKMLQHEFQAQGKREELLGMPVTPMCASPPSNLGERAGLLHAAKSLATAQIG
FT                   FVNMFVVPMVTELVDASVAPDTLREWRCSIARNVAWWEKRKAMKSLPKGEVG"
FT   CDS_pept        <252678..>253118
FT                   /codon_start=1
FT                   /gene_family="HOG000037187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638495"
FT                   /orf_name="MICPUN_72714"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69670.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199CB0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI68"
FT                   /transl_table=1
FT                   /translation="HPNVVTLLAAFLSEERNESYLLLGDAGDNLHAARERGEVSPRDVR
FT                   RHARSVLRALEHVHAHGVVHRDVKGGNILVGKDGVATLIDFGVARHVSVPDQFPAARYG
FT                   TPGYQAPELLMTDMRAAERDVRLYQKVDAFAMGCTLFFLCTGR"
FT   CDS_pept        complement(253865..255004)
FT                   /codon_start=1
FT                   /gene_family="HOG000264465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638496"
FT                   /orf_name="MICPUN_61773"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69942.1"
FT                   /db_xref="HOGENOM:HBG557073"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199CB0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI69"
FT                   /transl_table=1
FT                   /translation="MFRTVAAALARRSARHVVDATERRFSRFDALRRCRASDAFAASTR
FT                   AGMCHDARALGPLPGDAEHAVSDVDKFLFDTNGFVVVKDVFSKDDLHAFHDAIDAHAHL
FT                   IHERKGQLRLTAAKTPLSGDGKTGRKDLAGFLGWQKPHCDPFRSVLAHPKLVPYLHELV
FT                   GPGYRLDHNPLLIMQDPGAEGFEFHGGSTLDSGDWNHPLGYDFRHGKMRCNLLAFAVHL
FT                   TDVKEGDGGFCIVRGSHKSNYVCPPSIKRYEEATEHSYQPAVNAGDVVVFTEATTHGTL
FT                   PWRGDAQRRNLIYRFSPANISYGRGAMDDGSYLAPAPNWPRSYLEGMSEAQRCVMAPPY
FT                   HPRLNRVAVKPDASGVVKPAPREAHKVDFDRAVFKADYF"
FT   CDS_pept        complement(255344..256066)
FT                   /codon_start=1
FT                   /gene_family="HOG000265845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638497"
FT                   /orf_name="MICPUN_61774"
FT                   /product="Predicted protein"
FT                   /biological_process="peroxisome fission"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="ACO69943.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016559"
FT                   /db_xref="HOGENOM:HBG557074"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniParc:UPI000199CB0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI70"
FT                   /transl_table=1
FT                   /translation="MSVDLLIQLHEQCKGLLAKSDGKDKTIALLQYAAMFASGGEPGTA
FT                   LAVQKSLAAARKPFRLYKPVEILVPFLRSPPDFAANAANAAVEYAKNIGMAIYFGCDHV
FT                   VWAHAAGVVKDASLAKNMQKLSLWGWFIASCAGLYAQTGDLTDALDDMTDANREESEAV
FT                   AAGDGVAVASASARKRDAARVARGVMAGVVTNGAQALLALALLEKVSMSKKQTGALGVF
FT                   LSAMNVYKLTPPMKRKTA"
FT   CDS_pept        join(256508..256675,257059..258285)
FT                   /codon_start=1
FT                   /gene_family="HOG000237599" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638498"
FT                   /orf_name="MICPUN_91773"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69671.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG320208"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000199CB0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI71"
FT                   /transl_table=1
FT                   /translation="MMSAIFGGSAGPAMPPMDQPVPGLAIPDPPAAPAAAPVTNITTLS
FT                   NGAKIASEDTPGASIAVGMYVSSGSKWENPHVSGASHLLERMAWRATANRTAFRVTREA
FT                   EVIGANLLASASREQMAYTVDCLRTNLPEAVELLTDAVMNQKLTDHEVAAAAAALKKEM
FT                   TELAENPAHLIMEAAHSVAFTGGLGAPLVATPAALTRLDGDALAHFVQATYTAPRVVLA
FT                   AAGVDHAELVSVAEPLLSTLAPGPGVGAAPTTYVGGDYRVSTDSPLTNIILAFEFKGGW
FT                   RDQKGSTAMTVLNTLMGGGGSFSAGGPGKGMYSRLYNRVLNRHAWAQNCTSFHSVFDDT
FT                   GVIGISGVADGPHAGDMVAVMARELAAVANGKIEAKELDRAKAATVSSILMNLESRAVV
FT                   AEDIGRQILTYGERKSPAEFIAAINALTAAEISAVAAEALKSNPTLCMVGDLTAAPRFE
FT                   QVKTLF"
FT   CDS_pept        complement(258405..258917)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638499"
FT                   /orf_name="MICPUN_61776"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69944.1"
FT                   /db_xref="UniParc:UPI000199CB0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI72"
FT                   /transl_table=1
FT                   /translation="MDETVPHGEIIHLPELVKAAGDMHDRSVRTIGRCDGHASIRPPRS
FT                   WDENVGTPAPSPLTRPLTVRPLLFVPAHPRRLVSYDAAAARATIALDGASILVDVANVP
FT                   SPDPHRIDSLYQYIGEIDAAGGGGDRDGGGGAPCLRARVARCVDGLDLKLYARALRERN
FT                   RFLGNNA"
FT   CDS_pept        259043..260038
FT                   /codon_start=1
FT                   /gene_family="HOG000079432" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638500"
FT                   /orf_name="MICPUN_108991"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69672.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CB10"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI73"
FT                   /transl_table=1
FT                   /translation="MATTASLSFAASLGAPATSRRAVRSRARSRVVRASVEIEPGSDPA
FT                   PDASPAPAQIVVFGSNGKTGARCVQYAARAGIPVTACTRSGSWSPQNINLTSDERSLVT
FT                   AAAGDVAKASAAELTSTLQGAGACIFAASASPSGGSPQDVDKAGLVAVARACIAANVPR
FT                   LVIVSSGSVSKPLSPVYVFLNLFGGIMRAKIEGEDAVRSLYFKRDGADYVVVRPGGLTE
FT                   DEPRGVGAIELNQGDDKSGRISRSDVAAICVEAAVGANGCVGNSTFECYWADSAKGLDA
FT                   VGFSNMMGGTNTDGDYVSGMERRGNTWNEIFAGLKADAPGIAQQGVGPSL"
FT   CDS_pept        join(complement(262471..262512),complement(260091..262310))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638501"
FT                   /orf_name="MICPUN_113353"
FT                   /product="Cyclin-like protein"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO69945.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI000199CB8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI74"
FT                   /transl_table=1
FT                   /translation="MADDMKCPACGKREIKHEEDLGCDICAACGHVINERGLTSQVQWT
FT                   EDAGAMGTYVHEDRGGQLAAARGALAIGPGGVGAHIAKQFFRDEEATHMENITKSVNFA
FT                   CGQLRLGKDASADAKALVVKACDGRWGEGEWTTMLTGACVYAASRQNALPITVRDVAEA
FT                   CQLDVFALGRVYNRLKFLHELKVPPLDPATFVARAAAAIPQLRDAMGGGDENDARGGDG
FT                   ASRASASAAKAKSSQAKSGQQGDKPVDRGAKLAPVVEDAKRLLAFAERRGLMTGRGPFP
FT                   MVAAALGVAAAARGIALPPEALAAGARAAVTSTKKSLAALKRELGTFAASCAWFGSPDG
FT                   SPLDDPNPFQIRSIASSSSRHRAADVDKVLPLALASLADAIDADDGARLDAMPVAFRVA
FT                   DGVRAARLAKIERCKVTGSLDDEDGYGDEEYGDATGAEAEAAADAAPPEEAAPPEAAPP
FT                   EAAADAGGAPSTSVVVAGPARRRAPKRLGPNRGGLKPRRRRKHAGGFAGIENDEGSRLA
FT                   IGDAAVGTNASTPPPAAARLLEGTNGASAGGAPLGWTDVLIQQLLLAGVPERLVVEEDG
FT                   LFPDVSVDQSTGAVKPVRPVRARSSAVKPPPDAGDEMEAAETAAHRVLERWRAESSRDP
FT                   LLDAEAAAAAAGGDDDGDDDDERATAARILAAREAVEKADADAIAAIPDEDVAGLIRTE
FT                   EEAAVVKAMAARRLVQFDADDYYKIIGDDDDEDDDGDEDGLVPVVKGERAEAETEDGAR
FT                   "
FT   CDS_pept        262911..263462
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638502"
FT                   /orf_name="MICPUN_108992"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69673.1"
FT                   /db_xref="UniParc:UPI000199CB90"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI75"
FT                   /transl_table=1
FT                   /translation="MAVVPNRNDSERSMNVSFAEGEGSAATNKERFEKLKASRQKYKDQ
FT                   ATEAKLRCVNLERQLSMLVQQLESSAAAGVGVGNGNDDEGKARMEAEIRELKARLASAS
FT                   ATVDKLDDQLADCARRLSIANASLAKAHSDAKEWRAKAERATSTMVGGGGAYEYMCGAV
FT                   LGAGTVAAAGYVALTYMMKR"
FT   CDS_pept        join(complement(264604..265511),complement(263901..264549))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638503"
FT                   /orf_name="MICPUN_85925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69946.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199CB91"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI76"
FT                   /transl_table=1
FT                   /translation="MNLICNQLTSLPAEIGQLTSLKELRLHGNGLTSLPAEIGQLTSLT
FT                   LLILDHDELTSLPAEIGQLASLVELDLSYNQLTSLPAEIGQLTSLVKLDLTTWLEEPPS
FT                   LLEELDSWELNLGNNRLTSLPAEIGQLTSLVELNLEHNKLTELPAEIGQLASLVELNLG
FT                   NNRLTSLPAEIGQLTSLVELNLDDNTPLTELPAEIGQLTSLRELNLCNNRLTSLPAEIG
FT                   QLTSLKRLFLHRNQLTSLPAEIGQLASLVELNLHRNQLTSVPAEIGQLTSLKRLFLHRN
FT                   QLTSLPAEIGQLTSLVKLDLTTNKLTSLPAEIGQLESLRELRLSGNQLRSVPAEIGQLT
FT                   SLTLLDLGNNQLTSMPAEIGQLTSLVELNLGGNHLTSMPAEIGQLASLKRLFLHRNQLT
FT                   SMPAEIGQLTSLEMLHLGGNQLMSVPAEAGQLTSLKRLLLDRNQLTSVPAEIGQLTSLE
FT                   MLHLGGNQLTSVPAEIGQLTSLWTLHLGGNQLTSLPAAIRDLGAADCSVHLDDGVTVDE
FT                   L"
FT   CDS_pept        266963..269074
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638504"
FT                   /orf_name="MICPUN_61781"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69674.1"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199CB92"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI77"
FT                   /transl_table=1
FT                   /translation="MGDDVTATGNIVEGSTSVGAAAGAPPGVPGSGGGGFKIPKVASSQ
FT                   PPGAPPAGGGSAASPEAGAPAPPPRPPSDDPSHPPREDPPRDDRYDRGPSGATATAAAA
FT                   DDEDRKRRTHKGTRRHRHMLVLDLNGLLVDRRMSPFENPVDGTKVAPDAKFGKFYIYNR
FT                   PHMQSFVEWASEHFTVGVWSSAQHHNARTLVNHIWGKQRDRLAFVWGQDRCTHVGAMDP
FT                   AATGPNHRSKPILLKDLNALWAVSSYARFGPNNTLLLDDSPYKAVMNPAHTAIHPAEYK
FT                   LSWGADGLTGRGDESDLTNRQKIADELLGPGGALREYLAKLSECETVTEYVASNPWHSF
FT                   GPAAPDSDPGLMAKAREGGEAVAAAAAAAATAGIDANEIDLGEFSDLSEGREEAKGKDR
FT                   IDPEGWGGSGDEAEGDARSNGGVGAKREAPEAAGTNTDSQLFQKPAKKPKRVFTGSGAS
FT                   LFIRRWAWKREAKTDEERFVLPYEHDWLGTKMSFAQRRFDDGGASGGFASTVWDSSIVL
FT                   AKYVEKHRGSFANKRVCELGAGCGVVSAALVKAGCARVVATDLPENLPLLRENMERNCG
FT                   ENGENGEGARWEVKALTWGPDAAVALGETFDVVVAADCMYIAEAASDLVDTLAALVPAG
FT                   GEAAGPGSLPPALMSYGRNRQAEGEFLAACDGAKSGKARTLTIEDVAESELDELYQCSD
FT                   VRVVNVAMR"
FT   CDS_pept        complement(269397..270503)
FT                   /codon_start=1
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638505"
FT                   /orf_name="MICPUN_86044"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO69947.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG687898"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="UniParc:UPI000199CB93"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI78"
FT                   /transl_table=1
FT                   /translation="MASKLTIKPALDIASKPTDASANSSSSSSVKPPAASSAGGVEPKP
FT                   SAEYAPPSANDGDDDSPVAFLFPGQGSQAVGMLRSVADVPAVKEMCDKAKEILGYDLLD
FT                   VCVNGPKEKLDATEFAQPALFVAGLAAVEKLRIDSPAVVDSCASCAGLSLGEYTALVFA
FT                   GAMTFEEGLRVVKVRAESMAAAAKVGDHGMLSVVGLKDDALEECVVAAKKACGDGVVCE
FT                   IANKLFPTGRVVSGDKRALDEVTKLATAKGAMKCAMLAVSGAFHTERMESARAALVQAL
FT                   NDVNFQPTRMPVYSNVSGAPFYSHNIIPSLLAEQLVQPVLWEDTVRAMIAAGKTEMYEL
FT                   GPKAQIKSMAKRIDAEVWKKFKNVDVSV"
FT   CDS_pept        complement(271887..273152)
FT                   /codon_start=1
FT                   /gene_family="HOG000265104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638506"
FT                   /orf_name="MICPUN_61783"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69948.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG610285"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199CB94"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI79"
FT                   /transl_table=1
FT                   /translation="MRRSGASAASVEDGDGKGTKRVRSEADVRWMYYAKALTYLLAWSL
FT                   VSGLIIILNNWILHYDHFPFPITLSASGPLFSWLVAATLVATGHTKLERRMTFGLWLRN
FT                   IFPIGFFTAITYATGNELYMFLSVSFIQMMKSLSPIVVLFLLVLFRLDVLTREKLAGVL
FT                   IMSVGMIIACFDEPTFSMWGIALMVVGEAAEAMRMVFFQHLLGQQQFGLIEGLFYTCPA
FT                   NFFFLCIGIAVFEEKSLTEPENYGRVVNNPLPYVVVSCMGFGVILTTLGVIQTCGSLTF
FT                   KAAGQVRNVGIVFVSIVMFGDVVTAQQACGYAINLIGFFMYQYVKSREDLAALEAKRVE
FT                   AMGGGEPGGGESGGASAGEGGGGGGGGGDDDDTRPLLRGGAGDDDYGSGGGAGGGAGRS
FT                   DADSTPLRRMPSTPVFSNVAHR"
FT   CDS_pept        join(273788..273841,274043..274088,274234..275264)
FT                   /codon_start=1
FT                   /gene_family="HOG000168207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638507"
FT                   /orf_name="MICPUN_91774"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO69675.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG629020"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR004545"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199CB95"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI80"
FT                   /transl_table=1
FT                   /translation="MSDYGSDAEDETETTCANPAVVDKYKVAAEIANKALAVALAACKP
FT                   GAKIVDICNLGDKTVEEEAAKFYNKKDKDGNKIEKGIAFPTCISVNHQVCHNSPPSDDA
FT                   TSLEEGQAVKIDLGAHVDGYVATVAHTVVLMGDMNAPVVGAQADVMKAVVTAGEAAIRK
FT                   LRPGVNNSEVAKAIGRVAEDFGVRVVEGVLSHNMKRYVIDGNKVILNKPSAELKADEAE
FT                   IKLNEVYALDIVMSSGEGTPKMLDEKETAVYKRAVENNYKLKMQASRAVFSEIQKRFPT
FT                   MPFSMRAMEGIKGAKLGLVECCTHELLHKYPVLYEKPGDAVAHFKATVLVMQNGNDRIT
FT                   TWTCQPVESALELTDEELKELITQPLKSKKKKKPKA"
FT   CDS_pept        complement(275454..277040)
FT                   /codon_start=1
FT                   /gene_family="HOG000265844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638508"
FT                   /orf_name="MICPUN_102602"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69949.1"
FT                   /db_xref="HOGENOM:HBG608331"
FT                   /db_xref="UniParc:UPI000199CB96"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI81"
FT                   /transl_table=1
FT                   /translation="MTSVARSLAARVAVASAPSRGSERKPPTAASRGRIRAVRAMGYES
FT                   NIPPTRGQPGRFGDGGGGLILPGDDRYDPGMVKGIPSPSNPGGKSGFDPRTGTGGPGQL
FT                   PGGYEAPPKPGSEKDPNAAFAPFRPPSEYLDTDPQGFLKEDDQMSFLRLRNRAGMWYQL
FT                   APILPKLMRSGFLPDDIFDETGIEPREQSLWQTWTSTRGSLLNDPRFPDEKLEYFDDEY
FT                   NGAPCLSHLQYLTNDERPPAAEFVVDQQFSPDQTKELIKAFEIRRAHASQAKGFGTTPG
FT                   EIMAFKMWRDVQEVQRYEGMGRVEELVEKGKRYAESDSAVQRLEALRDAWSMDLSEGSD
FT                   LMEGGLFAKAQADAKANISTVRLDPEELAFRPVPYLGPMESLSVEKVIAVQPVARTGVF
FT                   NTFVPQGAKEWIAMPAWAALASAQIPFAILVSNTGKLSGAGDLSQREEPATLVVDKAAN
FT                   TPGPGNYYLVARESSIQLAGGKGAVVIDVYPGRECMDIERNGQGTVIGRVVLAVRAPGG
FT                   TGDGMTTEFVA"
FT   CDS_pept        join(277277..277402,277594..277677,277836..279818)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638509"
FT                   /gene_name="EIF4G"
FT                   /orf_name="MICPUN_61786"
FT                   /product="Eukaryotic initiation factor "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ACO69676.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CB97"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI82"
FT                   /transl_table=1
FT                   /translation="MSGGASAISLRPGGAGISLRPGGAGAGGPGVFAAFAMGSRPQAPT
FT                   ESSAKKLNAEDVIKYDADFLRQFQERYKEIPVELATSPVEVVINEVNSEALASMGAEAD
FT                   AQWGKKPAEPATAAAPEKGDKDWNEKKAADAAKAAAKAGKKGGKVDLTPLPEGTEGATI
FT                   VKAANAWSRGGADDDTTKVTRAVKSILNKITPEKFDRLMEQLLEAGINTAATLSETISI
FT                   VFDKAIWEPGFCGMYADVCLRLSKELPEFPGESADGKPMTFRRILLNTCQEEFEGAGKA
FT                   REELATITDQSERAAATKRVKMRTMGNIRLIGELFKKKMIAEKILHACVTDLLGAPGST
FT                   PPEENIEALTGLLTTVGKELDNSPKLPKEMMEGYFTRLQALADNAALDSRVRFLCRDVI
FT                   ELRRSGWIPRVKKLEAMTLGEIHAEAAAAGLMSPAATEEILFPEGPGGSDGIGGDWEMV
FT                   GKDGSVGDGSSALSGPYVAPKHKAAMPTEKEKAKRDAELRKLAKERAMAAVTGTSTASG
FT                   ASTSSSSAPGAGTWDEEKVEEKCKSAVNEFVQVADVKEAVLSVREILEKAKNAAFALDA
FT                   VLSAFVTHVVDSSNEKHRDLCAKLFVQLRKESDLAVSESALADAVGEPVAGLDDIAIDT
FT                   PMAPKLLGGLVAALIIDDALAATFIADSAVGVEDTMYRREYVAAIFKELKARGKKGAAA
FT                   YAADGGVDVAGLLAGDPEFDSPLAEFLEKSGLKELA"
FT   CDS_pept        join(complement(280732..280771),complement(280176..280435))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638510"
FT                   /orf_name="MICPUN_108994"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69950.1"
FT                   /db_xref="UniParc:UPI000199CB98"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI83"
FT                   /transl_table=1
FT                   /translation="MGFEDQVQKVGDWGLEHIAHAPKDRPHADNHPGWGISGDAHHPAP
FT                   ASKKNSKESSRKSMDLYPTGRRSFDMSNNIVGKALDADVKTQQNLDKEGLSAFI"
FT   CDS_pept        281337..282161
FT                   /codon_start=1
FT                   /gene_family="HOG000258140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638511"
FT                   /orf_name="MICPUN_113354"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO69677.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG756383"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199CB99"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI84"
FT                   /transl_table=1
FT                   /translation="MRRDLARAALAVARSSMSADAAATRALPAGARVSTGGHPRSAEWR
FT                   RRLGAPGATARSFASSAHGSSGPVGWKSLAAMCATGGGLLWWYDAERRRRLESIRAGPS
FT                   SGKASIGGAFGNMKLANENGRAWRTDELKGKFALLYFGFTMCPDICPDELEKMAECVDL
FT                   VEKAGKSIVPVFVSIDPERDSVRRVKEYVKEFHPKLLGVTGSVEACKAAAKQYRVYYHK
FT                   TGDEDGDDYLVDHSIIMYLVDPAGEFVTFYGKNYEAAPMAEAILEQMKRVGH"
FT   CDS_pept        complement(282314..283063)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638512"
FT                   /orf_name="MICPUN_61789"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69951.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199CB9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI85"
FT                   /transl_table=1
FT                   /translation="MPDAAYAVPTQNITENGFKGFLPSTWSEDSLEVFPDEILGKYDVE
FT                   IEWNGTRTLTIEKDNLRWNGARLTPTAVWCQRSHGISNFATRFTAFCPEQRTVWVKRGT
FT                   QRGVVESLDISFELNDAGNATGLVGTFRRQGEGTLGVRGAKAFDANQLPTLVRTKSNDP
FT                   ESQCPVCYSEWDDPGVTQVVVTTCEHCFCLECVVGVCSLTPPAESGSCPICRRPMVLHD
FT                   LRTVRRERGGTPENPAGKPPPGCLPCA"
FT   CDS_pept        283182..287327
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638513"
FT                   /orf_name="MICPUN_61790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69678.1"
FT                   /db_xref="UniParc:UPI000199CC0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI86"
FT                   /transl_table=1
FT                   /translation="MSDAAKLAGEAALSRAFGRVTLRTPPQPSDARQGEGSGSRADDEG
FT                   SGDACRSPRLPELPDEVIERIIRHALGDDADRWSIGERFRTPPARGQPRPFRQPRGPLR
FT                   LVCKRWRDTVDAMCEHVEVDRAVMVGDEALCGVIKAMHLKSQLDFMPAESNIETLTLVG
FT                   SHTEGGELKLGTDGLREALRLLKDSLKSLTIRDTGMALGRILDFVEQTIRDHDAVLKSL
FT                   TIDGYSRQSRDGTAPFETSMCFPVENRASDMRHLNALLKIGRGLEELHLTNLPCLFLYP
FT                   HQPTHDLRGQLFLNHAIFIGALQGSSLKSLTLDRVGLHDQAAERIVTALPPTIEAIKLT
FT                   CQASLRPNPEIPESRWESEYQSQHNRALRNGEPDDYIDNCFTPRRGFQRTWPRLLCERL
FT                   MKGDYPNLNDVTLPGEYIGASTALHLEEMLKSCAGASPPREFKVTFTTFDAEGIPTIPE
FT                   AILGRWRIHKSKYVDASLESKELGSITISSMAPDIPGDSENDREPHPTSWSEKRLAVEL
FT                   AHHMAQREAFADGPLYRSNYDLPPKLLFFPVEGDTLEAETLWKPCPKTSVYNEGTMECT
FT                   YDDEGEPKFIYKPPDGQYLEWSAMRMWTALGHGAPRHAYAAAMRWLLTRPEDASLRKLA
FT                   ARAYLKDWVLIGAFGLVRQIKPDHCMPCGLWEAATAMCSDPDFEDKKIMQLPQFPVIQE
FT                   LLNTAYDLARMLEKRAAANVPNSDFVPDGVYITQAGLRKCSSDPELGRALKWRGYFWPG
FT                   QDEHAFHRAVMCVLLKHWVTMVFEDEALHPGIIADQVIAEVEDALFTQLIAYDVVSDAI
FT                   NEHFSFHGMFSRKDEGSKSHYKFIDEQGMAISEWEWVKAHYGPGRRWAHSTEGGILCHP
FT                   IELFFDYLHSGCAWAMYDAIYRSLDYQRMRFEGTNTTLNYASFDRWTETLLHNLHGAPN
FT                   WIYSALDRPWPEMEAALRIATRVIAGVRNENDLRKPEIDSIALILTGAAQCYPQHPWRL
FT                   DTFSHDGSSVSSSSEAIKELNDAVEAFFRRRKFAPLPRGTGAHDHRPLIRSWAEWLHAI
FT                   GSPPPLTIDDARAKHDELAAGNSEYERLEAELASVHARMDKLGGKLRNVRSELRTSAAF
FT                   HRVPAARYLSEAAEGWVRFKQPLLNSPPRPRLRQAKLDPRRPWTLDSARRDSAGGGVAG
FT                   RARAAHALRRVPSPLTDVPEEMEELAELDEAAADALRRLFEHCDAAAAYVDDDLDVNGG
FT                   AGWSRVDDGHGYAERGVLGRGPDTATLATYVHEREVAERCDDGERGGGGVGSIPVESTA
FT                   RRSLGNVLRVLGANEASRRLVDGWLGLLDRAQLARAARRRGEDVDFDVDDALAASVPQL
FT                   YTGKDVREVSYRDVEGALVRRGGESDRSDDATETRVES"
FT   CDS_pept        join(287480..287515,287671..293775)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638514"
FT                   /gene_name="PF6"
FT                   /orf_name="MICPUN_61791"
FT                   /product="Central pair protein"
FT                   /protein_id="ACO69679.1"
FT                   /db_xref="UniParc:UPI000199CC0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI87"
FT                   /transl_table=1
FT                   /translation="MAEEEAEDVPAEPEEPFPEFNLEWRTLAVVLDAGTVGGVDAAAVE
FT                   AALIDPEQVPWPTVDGRLNCFARLTLAEMTEAAEAAVAPPPETEGDADADEAAPPAPPA
FT                   DDAEDEPPNPWKEVQLRMIASREAHEASEDPNKGTWTLDARWKHELFKTKSEVDREAFR
FT                   IDLARRRRRALKESTEKLAAAEEEMRERAPKLEAAQKAHEAALEAGEEPPPPEEPNPPP
FT                   EEEGGEPPPAPESALQEAQWAYDKVSAQLTEWRAKNIAAKNDVQAPCRATRAYVLQSDL
FT                   GGTGADNVDALSELAAGGFPIRACVQVARAKWAPPTPDFFEKPADAGDDWTAPEAPTPE
FT                   PDDAPGKLTAKFIEARAAAIAARDWDHGCRKIACLHAQFPRDAESLDPASMAAFAAEYC
FT                   GYLAVADIEYQRWLTDDASLSHVPGITPAEIDATDVRVYGQLLAGVPHERATCAVVLDA
FT                   MIGQVCASATVEAIGEDDLRKARDDAAAVEAAAAIAEALGGVKLASLHDAGSLSVTTTT
FT                   IGAATATTHVGFDSMGGTTTMGGTTTMGSTMGGTAGGGAATAGGVLLMQNGDSATTLRA
FT                   TYGPGLFARALRGDTVAPLASVVRLDPDEVEARMSRLLARACAGADRTWMPATPELDDD
FT                   GYGARKTALRTFLPTPETPLQVLERHEMLTEAANTLPPGLFEEHGAEVRERRHWEPLTR
FT                   EAYANLYSNAKRDLRGERRLYHAPEDALVTLLHAPAAEEDVDATLQRAIDFREFMERYQ
FT                   NAVASRKADEAEARRLEAKAEAARIAAEEEAARLLAESSMLTDEEEEEEEEEGGEAAEP
FT                   APAPEPEPEELEEEDEGIGYDDGEDPPPEPLAHPASPLVTLHPVGYKGIETDIERLVGR
FT                   RTCGYPRFGSLVSTDVDGTTSVVAGGVTLGFRRDGLVATLAGEIGTSISITRGPEPPAP
FT                   EPEAADGADGDGAADGAEEETCEPLLDENGVPVVDAEGNPVYAEPTPPPPPPPPPISLQ
FT                   YLTPSGLCVQVSTERTVTQKKPEVDASPAGAGGKAATARAGDAVKFDAHETSRAVLADG
FT                   SVVRYMSDDSTVVMLPDGGLCERPGAVDEVTGRGEWIGTNLAGTRWRQPDSYMGQPRVG
FT                   HELPEIEPLKDEEGNVVTDEETGEPKFPPKEGEEGYVPPTALRDEETGEPLLDDDGNFK
FT                   LPPDILIVPDPTWVDPVAAAHVTDPDTGAVVTSRGDLTMVVNHPPPSLRRLVVHSDGTR
FT                   VVRDPDGGCAWRVEREGFAAVHAPSDDNEPITVDLGAALAAVDRDGGVAITLQDGSAVA
FT                   ADANATTGHVAYAPAASSTDPARAALDALRGTRGAPEPGVFVFDLVRKRILVHGDETTA
FT                   GFSVKADGTFAPTEAFDADSDAEGADGADGAEGADGGDGADGADGGDAKGGEDETGSSP
FT                   GSSPAPPRPIGFVSAPEVKPRCFVVYPDQECYFEVHSEPAFAQYADAMARDGSCTVTSG
FT                   PVAGSEPGVVNHTYLAPLKPPPRPSVLIDADRVPVAPPKPSRPSSAGLTLPSLRLPSKP
FT                   TFPAPPRAMIVPRIAAFEAPKPRVDPPPSAFVFRQVVEYPRMTAQLAGWLDASLARFKA
FT                   HQAENAAVTPDAYVLDDARGSSFVDAERTLADRILAARVAKEKAYADRVTAEDEARLER
FT                   ERLEHEAAMEAAAEAARNLKIAPRAKTPPPRPKPLYPPCGYFESAEGLTSLETMKDAFE
FT                   NAFENPSLRRLPSPRLPRAVKVADPEPADPRSWDGAFGDHEAYIDEVYDGGEAYAHTQN
FT                   TYDDRYDRYGRHVADSRHPPYAFGASTGAKPDRVRAETEYLARPEGYLYRRRETQRAHE
FT                   AHAHALATDSRTSARAGKARVDYTGRRRARPAAPASLYRRDTAVSARNRRYDDVDGNSR
FT                   PPVRTTSTVLASHRGGGRDRRDGTVQTFELSPAHVHFGRVSVSSGAVERRATLTNVGVD
FT                   AQRFSIRQPEAHGPFRVEFRPGMVSPGLAARLRVVCDARGVPPGDYVGEAVVTTERQVF
FT                   ALSLSARVAAPGGGSSVDVSGRSVVDVHGGSGVHPGGEMRLDETVSLRDMRGGR"
FT   CDS_pept        294349..299958
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638515"
FT                   /orf_name="MICPUN_102606"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69680.1"
FT                   /db_xref="UniParc:UPI000199CC10"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI88"
FT                   /transl_table=1
FT                   /translation="MMGSAETRPLLDEFSPLVERKRANSAWGTRAKYALATLALVGVAA
FT                   FAGVAMFPGAANNIGLSTLGDKSDFVAAEAPSMHHRSSVKPHSKLYVPRGSARLGEEGE
FT                   AAPAAPTKAIPHTAEDPIESSGLDAKIAQLEADKAALEQSNADLAAQIATLTADTSAQD
FT                   QLKKCQEDTHSVIAEKKTVEDELQRLEQEISDEREAHMKVGGFNCGRIIPGENRDEKLA
FT                   ECDAEMRLQLYERKKANQRKYQMRLQNDALHAEIEGLENKLLELDGEVRQCIADSAAAA
FT                   QTAAEQLADANAKTEEVQTAMGKVEYELELCMNGKKACDTKVHDMEGELKDMEAREDKC
FT                   EADFAQARKMYQDSHATKDEATKQLESDISRLELDITNVKDKRDSLEKELNEKFVEIKT
FT                   LEKTVADNQAAAEEANNAKSACEAENGMISASIEHLKNDAKRMEQTLNMTRDSKLAMVD
FT                   EVMRLNQKMEGLEGEILEADNKLKTAINASAAEKAELVGKAMEKDEQIAAIKTEVASLK
FT                   AQVNVSAAAELALQARLADAQDKAAAAQLDLEAQISTCQTDFAAARDAFQAKHMSNDEA
FT                   SKQLKEQITQLETTLATTTESCKQGKETCKAEIDQLHADINAKSQEIQNALATVDAKSA
FT                   EIDVCYAATDKLHTENAALIGSVDTCTSDLATSKEEKDLCEGSKNGLLDMNKKCEASVE
FT                   KCEADGAAEREVLLKKHADKDEVTQQLNTDLTRVQGEVAKCQDAKATLTTQVDTCDADI
FT                   NAAKDETKAAKADFTELKMQPWCQPPNPPAPDAPAPPPPQNPPGAKKFAEKLPISEKKL
FT                   IAEGVASAKAVKIIDAIMLGSDITSDKVRPFVNLDKKYSDASVSYIFAHCYADEINMIA
FT                   AEVTVEGGKAYLTAQGEGIRSSANCRDEDLDAREVTAAWANQLSEDEAWTEYGYMPGAS
FT                   LGGVKLVNADRRIADEVKALMPVDAPAEFDASAELDEEEKTNTFRQLLGGCSRVNCGYH
FT                   WQGWSSCSPSNGVCGWGSQSRCPSVYRRNSCGGSGCPGCQSQSCFSRTCPPPPSPSPPP
FT                   PSPSPPPPSPPPPSPPPPKAKLGLGTIEYVIVNNVGGLEMGGKGKPMYTPSDAFLSIPE
FT                   VATMKVGDAVMMAKAYKNGQPTEEEAPVIFAACDGDSLKLVSATVTAAHGSSFIALGEA
FT                   KSSPKSGCDNAALTAGAVMDAFKAGDAAGSVSIGHVYFTQADDGDEVPTANTAVVLGEA
FT                   SAPVAIELKSACFIGSSIGVDESGCRIAKAFPTDKVGEFIFATCKDEHMTMVVAQVGMG
FT                   DVPAEEPEEETAVAEEPEEETAVAEEPEEETAVAEEEEAQEPLTPSQSAPAPSTKKSKK
FT                   KKRRKRRKRRKKKKSKKKKGWWPFGAEAEAQGQAGRSLLFAPGILPDISSALENANLPV
FT                   WVTDKAQAATITVTKAMTATCTDGAMTAASVKAAASQASGKPYGPALSIGRVAWTDHDT
FT                   TQTDVIDAVKTTLTAPPPKPCTGRTVTVKRMDPAGLDGHGWGMNLEFMCGDSKVSIGSS
FT                   RGSQTQSTVVNSEMTQGDCAARIDKSNWLGGYGYGDFFDVTVGECPPPPPPPAPAPVGE
FT                   ECTGRTVTVKRMDAGGLDGHGWGMNLEFMCGDSKVSIGNSRGSQTQSTVVNTPMFASDC
FT                   AARIDKSNWLGGYGYGDFFDVTVGECPKKCKRTISATRRDANHGWGMNLKFKCGDAEVV
FT                   IGNSDQAEKTVFYDNVATGTCPSRVDKSNWLGGDTYGDYFDVVMGECIDSEAQAQCRRE
FT                   VTATRGDAAHGWGMPLEFECGGKVVHIGSSGGQTKSATTTFKLDGDDCPSRVDKSNWRG
FT                   GHTYGDWFSVNVGPCVGAALGDAVEYDHEDKPKLGSKTKLGKKTEASANTWKVW"
FT   CDS_pept        complement(300212..301288)
FT                   /codon_start=1
FT                   /gene_family="HOG000212435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638516"
FT                   /orf_name="MICPUN_108996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69952.1"
FT                   /db_xref="HOGENOM:HBG736614"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000199CC11"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI89"
FT                   /transl_table=1
FT                   /translation="MMPPPPPRPRAPSADDEEVHRRFDRAALFQPADISAYFDECADVR
FT                   VGGGDVFRVRTARGATRGATRGRGRASIAALCLHGCALSGASFALFARRLADRGGENFR
FT                   VDALDLRGHGSTRTADDRDLSLDTMARDVADVCARLYRDDDATTNEDGNTNVQVVLVGH
FT                   SMGGAVAARVAQLDLVRNLRGVVVIDVVEGTALASVRGEAMRAAVASRAGKTFATIADA
FT                   VEWCVRVARTTSNVESARASTAHALVPSRRDDAGDGGSEGGDGARGWTWRVDVAKMSAY
FT                   WEGWYEGMGERFLRARCAKLLVLAGTDRLDDALTVAQMQGKFQTVVFPNAGHAVHEDEP
FT                   ERCAEAVLGFAARYASSS"
FT   CDS_pept        join(301738..301829,302201..303419)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638517"
FT                   /orf_name="MICPUN_108997"
FT                   /product="Heat shock transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69681.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199CC12"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI90"
FT                   /transl_table=1
FT                   /translation="MTSAKGASAQPGSATGASTPFATVNVSPFLWKTWNLVSDPSSDHI
FT                   ISWSAQGRTFTVWQPDLLESTQLPATFKHSNFASFVRQLNNYGFRKCHSDRFEFGVEGF
FT                   EQGKPELLTTLRRHDAPRNKKKEADGGKSASAASSGKKGAGVKSGGLKTAPHVPGSGYD
FT                   GLELGAYGGITSEVEQLKRDRLLLLKEVMRLREVQSHTQDQVRELSARLASTEQFQSRM
FT                   MSFVDAVQSGTGLSFDAQGMQKFKEVAATRKRRQMFLPSSAAAPDQSAPGQNLNLQGSL
FT                   GSGSYNATQGFSLQEMDDDDILPADPLAPDPDDALTSQMFGPLSPNPTAPIQLPEHEWL
FT                   DMLGGGGVDPTVGKLEPRVGGPLIRSASQDDDVGAEGSADPFVSSILDRGPSLEKQMSL
FT                   GFLERMSSAEIGDMVKDMNINQPFDDEFARRVREIKS"
FT   CDS_pept        complement(303858..305300)
FT                   /codon_start=1
FT                   /gene_family="HOG000193296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638518"
FT                   /orf_name="MICPUN_108998"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69953.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG592488"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI000199CC13"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI91"
FT                   /transl_table=1
FT                   /translation="MPAQTRGARRKSLGLPPKEKQERFDPSSPSKAKTGKKAEGWGAPE
FT                   RTGFWANVYGTCGVLAIIGTTPFIAVIVWHMFVNLDGSLASIVAAFQKDGLSLIAKIWP
FT                   WTSKRAWQLLGSYAAFEALLQVYMPGKRFEANPTAAGNVPVYKANGVQSLVATVIAFFL
FT                   CWHLGLTTPLEVYSLFGEMLAGMSLLAIVFCVFLLVKGHVAPTDEDSGSCGNVVYDFWW
FT                   GMELYPKIGPLNLKQFTNCRFGMMAWAILPIIFACHQYQRDGFLADSVAVCVALMCVYN
FT                   FKFFVWETGYFNSMDIQHDRAGYYICWGCLVWVPAVYASPALYIASVQPPVNLGPRLAA
FT                   AIFALGCLSIWINYDSDRQRQEFRASGGKKKVWGKKPVIVEAEYKVAKDGRTVTKKSIL
FT                   LASGWWAIARHFHYLPEISASFFWTAPALFGKLPPYLYVIFLTVLLIDRSMRDDTRCSL
FT                   KYGKYWKKYCELVPYKIVPGIF"
FT   CDS_pept        join(306043..306066,306257..306289,306453..306557,
FT                   306807..306837,306990..307630)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638519"
FT                   /orf_name="MICPUN_108999"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69682.1"
FT                   /db_xref="UniParc:UPI000199CC8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI92"
FT                   /transl_table=1
FT                   /translation="MGADTSYEMLTALNPAHLKALLGQEVVVTLGDASTRTGIVYNVDP
FT                   VNFSVALLKPRRPLIKGTQASPKGHNGEDHLCVVPGHAVKGVEVVGGQRAAMECLTSVG
FT                   AVGWNARSASATQPGGLDRFGAAGAAGSSSGRRMSLEFLRSYSNASPAPPPAHARRERF
FT                   SDPGYGEEERGNAGDRSMGSIAEGSADGAADDGVARARRDAGWEERRERVRAMLERARV
FT                   PVHVSAATGAERVPGATPLVVMGCARVAYPFTADAVECANEIVLARVRELVSTVQ"
FT   CDS_pept        join(complement(309424..309552),complement(307782..309230))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638520"
FT                   /orf_name="MICPUN_61797"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69954.1"
FT                   /db_xref="UniParc:UPI000199CC8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI93"
FT                   /transl_table=1
FT                   /translation="MATRMTERQQLAIAMRESMASAPVVPVVSVALMDDKENSPPPTDD
FT                   EPKRRKMSRVEKELASLAPWAWDPLVARHAPGSAMMRDFSEVVADKTVMTGGNARAYRF
FT                   KSPDPASTPARPTDRPSGSTAATPTPATDAGKAAGALGTSSSREDLAPPLAGANDGAIR
FT                   VGKRTRSSPASRAGLNDATPAPATAARGTPLPRARAAAASSARATPFGTGRAASRLASA
FT                   AQPTRSLPQHGGNDAAPVTNLVKALDEAGDEEPRRVRRRGDAKTPAKTREKEEREAKEA
FT                   KEAKDAREAKDAREAKDAAAEAKRAAAAAKRKAQREERERERAAERADKASNRRPEEAK
FT                   DAAVANGRKDPHVVRSRELAGLDPMSGPDARRQREAALLAVAAVEAAAEAEAAKPKASN
FT                   AQTLLAAFYDLTGREPPPGVVLPDASVAARDAAERAKRAADARDVAVYGAVYKPPPIDG
FT                   WRPVCIGPFGGASGRDDFARAYHGAPARVVSAGAQLARACEYLGRVDAVDAERRAAKGV
FT                   PRARSDGA"
FT   CDS_pept        join(complement(312029..312527),complement(309934..311711))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638521"
FT                   /orf_name="MICPUN_61798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69955.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199CC8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI94"
FT                   /transl_table=1
FT                   /translation="MRRKRGDCASLWHEKGRGTKSGDTPAEGGAGSPIESIARPFAPRG
FT                   LPWMWWKPPVRENPLRSRGIHPSRGGSPEPSSPANQRLFRGLNGIEVGSNGRAVLTCVV
FT                   ILGLRHDRRSRRCHESALRLFHIDLRAFGPHMAPDGRPGRGHFFLRHLVPQTEPLSLSS
FT                   LFALNGCRIFWRNGPPSRKSGELRKRPKAATEFVGRIPRSSTFAAVTPWRASGRIAAFT
FT                   GWWAPTRHRRTPRMAKGKSKRKNKDGPSGAEGGAGPSADYEGPGESWGGEHMNQAPAPL
FT                   MAMHPSGEHIAVAYGKGVAVFDASTGAQIPLRAAAKVPSIGEGVAHTPASPEMRAPLEP
FT                   DGLWHADAIRAIAFDPTGRFLATAADDKAVRLFAKNADAYECVRRWHDRKKPTALAYDD
FT                   EGKHLMISNKYGDVHVVLTDRKPNDPVGTDHEYGALREVDDPAFLLGHCCAVVTDLTCP
FT                   RGSNLLVTADRDHKLRASNLPTTVPLIHGSWDIQSFLFGHLAFVSCATAVPEPDDDDDE
FT                   GEGEGAARDNQKPKKIERLASGGGDGAVRLFRLDDGEELASAQLSAPVDPPSPEELEAI
FT                   VTGQAPRIPVNAPAVTSIDAHPSGAAVVAAVEGAPEAVLMRGDDLRVVAKIPVPVCGDD
FT                   VEVTCVRFDRPSGQRLWVAGTVGSDAAPFFRCARVGVNGSVDGKASDDGDGVDGGTIAD
FT                   PADDVLASKMREAMAPHAPGGNSSRMVSKGTALRKKQYDNVAEIAERKKLRRDVTKGKR
FT                   KADGA"
FT   CDS_pept        join(<313690..314103,314704..>315072)
FT                   /codon_start=1
FT                   /gene_family="HOG000240817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638522"
FT                   /orf_name="MICPUN_69279"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69683.1"
FT                   /db_xref="HOGENOM:HBG317255"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199CC8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI95"
FT                   /transl_table=1
FT                   /translation="VSCGASHCAALDPDGALMTWGLASSGELGHGGWTPIEVDIPRRVN
FT                   SMSGVKVTQIATGANHTVVVSEGGGLWTCGRGRHGQLGHGHFNDAGPLQRLEALRGMNV
FT                   TRAVAGGSHTVCLTDCGSVWSWGACRYGQLGLGDDWEGRTPKNGVWIKVPCACGDRCKI
FT                   VRAAAGGNHSAVLTACGAVMTTGSNSYGQLGHGDIKKRYAFTRVESLRGSRLATVDCGE
FT                   DHTGAVGDSGRLYLWGRGDWGQLGSGDGRSHWSPAPVNG"
FT   CDS_pept        complement(315610..316998)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638523"
FT                   /orf_name="MICPUN_61800"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69956.1"
FT                   /db_xref="InterPro:IPR002861"
FT                   /db_xref="InterPro:IPR004877"
FT                   /db_xref="UniParc:UPI000199CC90"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI96"
FT                   /transl_table=1
FT                   /translation="MPIVILAIVALGLIAPVDAYSSVAGSCEHAGVVHGIDAAPPQKGD
FT                   GGYKLRIGHPGVNVPGATVPVVLTGAEPHKGFLVYAVDDDETKPLGGWDNAAMPDGCQA
FT                   HPQCSHAATHDAFHNTGIVTDVLPWIAPAEPSDLAKDSVIKFKVTVVRDYETWFAFEQT
FT                   FVVGTEEGAGEKGLTLAEPGRAPRANGGGGGGGGVRAPSKGAAVLGGWDGKPTGGDEPA
FT                   PVTQPVTQPVIRPHERAIQDPLAANAIAKKPKTNSANDGEAPGAARRKSAGGGRKDLTD
FT                   PAGPLSERERRRAARLAHGLAMGAAWLVASPSAAFAARHGRKKKWWFKYHRNANAGVAA
FT                   ATLVGAALVLDARGWSTPWGFHGKIGATVCALVAVQTLAGFWRKSFARPTWAKWHRIVG
FT                   VGTWALGAYNCTTGAAMLAWMETDQAWERPTAWALLLAWIAVGAWAESRRRRRVLTLKL
FT                   HRTA"
FT   CDS_pept        join(complement(317931..318047),complement(317155..317799))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638524"
FT                   /orf_name="MICPUN_109000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69957.1"
FT                   /db_xref="UniParc:UPI000199CC91"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI97"
FT                   /transl_table=1
FT                   /translation="MSDTLDARCRAWEDEQRRLDASWISGPCPCAKDAKAPGQPTSCYV
FT                   GGKAPSPSTTSGGVDVQLANIVGATFFAVMMIFGFYAVYRGFRSRERAKRRIATEIIRV
FT                   LKEDEERAIKYKVLQLTQPCGTVAAATRCPDEEQGPDAPAGPLADGAGDVIEEGLMASL
FT                   RIQVEMHEARAARRRRRIMCGLAAVLASASERIRGRTREADLSERFSSLSLDELMMVQL
FT                   RLSRRNEQQERLDTLRFQRSQAPVSVVVENP"
FT   CDS_pept        318668..319315
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638525"
FT                   /orf_name="MICPUN_113319"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69684.1"
FT                   /db_xref="UniParc:UPI000199CC92"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI98"
FT                   /transl_table=1
FT                   /translation="MLFKKNSILDRPIKPPSMRNYESGPDEFEAKLRRDALVKERINTH
FT                   KDLDGYASRHGWTDPGHLSTTMYDNTHRLHTVITERGVEKVYNADVDTPSGVAKVPAPW
FT                   DRAENYNPDAPLLEIVPPMSPGAAPNSSPVGSFSPASGTPKRLLHGKQYSVPENDPTDD
FT                   STQLRRVPPPSALDGSYNPILHHWNVEPSDPSRLDREAMPAGLRSKHNMYHP"
FT   CDS_pept        complement(319415..320446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638526"
FT                   /orf_name="MICPUN_61803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69958.1"
FT                   /db_xref="HOGENOM:HBG557092"
FT                   /db_xref="UniParc:UPI000199CC93"
FT                   /db_xref="UniProtKB/TrEMBL:C1FI99"
FT                   /transl_table=1
FT                   /translation="MDHARSILSAADWWASKVFQADRAPLRTGTMNPRSIRSLFTFLLI
FT                   SVILLVGLPTGADAAGKKKKKKDPLELRAVKSDVKYIRCQVCQEVAKVLSREASTLRDT
FT                   KGAKLKESDVLEKVEKVCDPEAVEGEWLITHDLQEKGSELKMVLMKDQYGACGSECKTM
FT                   QRACEKIVADRDTDVAEILFTGSPQRAALVQHMCHNDDEDGFGACVKKAPPLPKSRPKG
FT                   PAFDPVDKKDLDMQRMMKNMKDMGMGGMSMYNRDDMEDMMDDEDMEDPSLTDNPYKNYD
FT                   QSIYDPPEPPAPGVAEKVADAVRGAGSAIRGGIEAAMSWGKGLFAPSKESAAKAETESL
FT                   GEL"
FT   CDS_pept        complement(320575..321840)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638527"
FT                   /orf_name="MICPUN_61804"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69959.1"
FT                   /db_xref="UniParc:UPI000199CC94"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA0"
FT                   /transl_table=1
FT                   /translation="MRRRGVLDPTRIDRSVRSVAILDTNSGENVDAILFVYPSDDASVV
FT                   ARTRAMKGLILALRGATRSLSGRDATCATLGADDEEGSLVRVGLVDLARTGALLAVETT
FT                   FAEDARAARLAATTAEHIRFLHGDSWVDRLREERDARRDGAADTNEAFDASDADGNQTP
FT                   HSLLLGETIASFLLTRAAWEPARVVARVDPGIRAALCAAETATRPLAERLGGAAPFADL
FT                   KPGAMFILADDDDEEEEEEIPGSRGAACTVLASHLPHDVTARLAAYVSRAPIGSSGRHA
FT                   RWVWTTTRGDDDGRLERRGLVVAREASVAACLMLRPLRDEAAAVGDEEAIARLGDFEMR
FT                   AAAAAAAAAAAARGVIDGCAGFDASFEAASEADRRRPRRRSNGGDVEDGVGDAVGTLAE
FT                   VFDAQRRDRELAGAAGDGPSFG"
FT   CDS_pept        join(complement(323494..>323733),
FT                   complement(<323224..323442))
FT                   /codon_start=1
FT                   /gene_family="HOG000067973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638528"
FT                   /orf_name="MICPUN_85746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69960.1"
FT                   /db_xref="HOGENOM:HBG262143"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="UniParc:UPI000199CC95"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA1"
FT                   /transl_table=1
FT                   /translation="YRGCQTKTRSGRTCQNWDSQTPHHHTRRNEAKGSAGNNYCRNPDG
FT                   EPTIWCYTTDPNKRWEFCDPLPESSAEEAPSPPAPTLRGVGDEGYRGCQTKTRSGRTCQ
FT                   NWDSQTPHHHTRRNEAKGSAGNNYCRNPDGEPTIWCYTTDPNKRWEYCD"
FT   CDS_pept        complement(<324870..326904)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638529"
FT                   /orf_name="MICPUN_53700"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69961.1"
FT                   /db_xref="UniParc:UPI000199CC96"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA2"
FT                   /transl_table=1
FT                   /translation="MVYGAAPHEMASPLLADESAPLVDREERKRSTWSRAVRYGGAMAV
FT                   GALLVGAGVVTTSPSHPVSVTVRGGLASLGASNAAKPGRVGPLKYGGKHANKVAHAGKS
FT                   HRHAAPSPVPHAERVAAASSVYHRLGEGEDDQDVGGDDITDDPLAQLDDLNKQVERLVE
FT                   DNKALTEDNIALEKQVQDLEQSIVDTREEFLKVGHGGRNKHLAGSHDNEIIADLENQLK
FT                   DKHYELEKTRQQKYKLYVKNTENLDKLAKLDKDLATCAQDKAELAIRAEQVSELEECKA
FT                   SFDALSVKMTSAQDDVEICKADLAAARGDDHDDNARIASLEDKLSHCKSEKGDLADELV
FT                   GIKVELKNSKTDKLQTDALVEELNAKAAASDALADRLRGEVDILVEDVKACELDGRSFN
FT                   FFCSGEGETCECPDGDVVFGPRYHASDDSWENTFADVVALQKFTVTPGTSGFPCDIDHT
FT                   GKDVAPGSGKACFCVPKGIVTTPVVDAKGEPEPVDMPAIEPEEETHSLFDIKAAPGMVA
FT                   CDSEKSCQAAAEAAGLQIGGGGYDFAGEYGTKGCYTYNSGKYEGMAFFGTGGDTIAMSE
FT                   PVDEPKVRVMCPAPTEADDVQTEPVILPIDQESYEDSLEEAPAEPQPEVESVDVTELLE
FT                   DHFEDTVGEDTIAKIEYADADKSPDTEPEPETDENPPPVDPAV"
FT   CDS_pept        327277..327810
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638530"
FT                   /orf_name="MICPUN_61806"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69685.1"
FT                   /db_xref="UniParc:UPI000199CC97"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA3"
FT                   /transl_table=1
FT                   /translation="MDEPARIFGHFCRWARIPFVKPCRHWAMEREGAPVDPIGGSANAT
FT                   RSEIALPDGAVIELERTEFTARQDTVEAKVQDGARYQGLLSREDYDKRKQRLGESLRAE
FT                   TDPEAYRREKLREAIEREDKARREADDARRRREEARKEKLRAELADVKDGGVAKKGKKK
FT                   KKTSAILSFEEVDE"
FT   CDS_pept        complement(327893..329068)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638531"
FT                   /orf_name="MICPUN_102615"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69962.1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniParc:UPI000199CC98"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA4"
FT                   /transl_table=1
FT                   /translation="MSAIARRGFAAPATALAPGPAATRARRVKAMITSAKNAGSPMSRR
FT                   SRLALPRGGLVLGVPRERPPPLAAQRRRIRVAPNAASADALHAPPAEPERREEDDRRER
FT                   TAAARLDGERRVANEHDDPASRRVRYAYLAAMVLATATAVAVSWLVAPELPAAIVPLMP
FT                   RGLDCLDWTAAPGAFVRFVDYYGTAVFAQAGVVTAGAAGMNFLGCLVVGCITAMGGGSF
FT                   RGFVLGEQVFWAQEPEYVYISLAASVLTFFFWPALERLFAKAGKSNVLESSLNWLDALA
FT                   IGGFCVIGANNGLRAAAGDPVVAVACGMFTASFGGIMRDTLCAMPARILHSHQEAYASC
FT                   TSIGAATFVTLSALNVNPWVRCLAPMAVVVALRWLAWSKGLRLPTYGTRAE"
FT   CDS_pept        join(330183..330326,330435..331814)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638532"
FT                   /orf_name="MICPUN_61809"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69686.1"
FT                   /db_xref="UniParc:UPI000199CC99"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA5"
FT                   /transl_table=1
FT                   /translation="MRRSRRHSFGNRERTYVGVGRALAEKRPRSFKLTRKGGSRDAAAR
FT                   NSEMQRKDGLPPFERRGMNPFQRFASRLKHGLDAKRREIGAKLDAKRAELDAKREDLVA
FT                   TFMAKHDLGAGVYAPNRAERRTEKKNRKQESARETARGAKVHLVLNSIKIADPAPGVQP
FT                   ATNGGAAAKESENSTPAGAEKKEKKAPNSATAVFGPKLKPQKVTVDDLSANDRAAVLGV
FT                   PLTARNLAGAAMFAFAVYAVSKAARGGKNREDEDDAGKGASKSSRFGLLDLDSAFTTTP
FT                   AKGNTPRRSGTKGASPAVDVECDSTSKQLMDQLERVAVDVPKAAAEMLRNGLTPAKKSP
FT                   AANGKRAVKRVNPAHVRAKQRRMESSRLVSPGRLVAKVLGVSLAAAADSCKGAAAGVDA
FT                   PAVEYSVRIECRRGDKLMGGVTSKRGVNKDGKTVDVKQKMRFNLPAAKDEGEITLRLCD
FT                   AKGKTVARSGLTLVDVLRVSPVTKDFQLFGRDMRTFANAKIAFTWEPNA"
FT   CDS_pept        complement(332066..334114)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638533"
FT                   /orf_name="MICPUN_102617"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69963.1"
FT                   /db_xref="UniParc:UPI000199C465"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA6"
FT                   /transl_table=1
FT                   /translation="MSSRTPLNPLGLSGGGGTAGAMSGVDARSDPLAAAEGLLGKYSTA
FT                   RPATAMRPGTAMGARPGTAARARPGSARGGRPPVSPRAEVMTLDTSSVAEDSHNLDESA
FT                   EISYGDGFDIDRSDADASRSVEAAMDDSDDAAFYDNDDGGGAEVTTFSDGAEGIVLDDD
FT                   SLGDSVSIDFDASARSPSTPATRPKSAPRRDVDLSMSVDDDALGDASISVDADDFANRR
FT                   PAPNRPASAKGRPRGAPPPPAVSLPPPAVSPWAGALSDGEDDGVDDDVDDDVEMVEESG
FT                   FSFSPSPRSPAAAEAEDETEALHRQLAGNDPMTQLRAFERDEGLSPSANGGPSPRSPEA
FT                   TEAADETEALHRMLAGNDPVSSLRAQFSPPEETRRPTSPPRVMRRATDPEESAEEVADE
FT                   SAAALEVLDESAEEIATEPRTSVSRYSEHLADYSETFESPDASRVIEGADDASAPRDAD
FT                   GSKQDGSRRPELVRSGDLGDKARALLEDIRALRSGDLGAGGPASAKDAAELARLLREVQ
FT                   RATRRRMIGVSRRAAAASPPVNYFEPAKKDYLGAFANLRRQTTSISQTAEDGPPQPQRS
FT                   YATTREEWSAYLAGEGGYPAEAPRPLGLDHDEKSFQEIWNASRLRTKSAASGAANDTST
FT                   EDTSTSRAIAAAIRAHGACGHLRARVASIQMRLRDRKRELERARPFG"
FT   CDS_pept        335252..335626
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638534"
FT                   /orf_name="MICPUN_85736"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69687.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199C466"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA7"
FT                   /transl_table=1
FT                   /translation="MKTGDEADVTPKRDGGVVKKVTKDGEGTERPGKGAEVAVHYVGTL
FT                   EDGTKFDSSVDRGEPIRFTLGVGQVIKGWDLGVASMRKGEKATLTIKPEYGYGDAGAGG
FT                   VIPGGATLLFDVELVEWKSS"
FT   CDS_pept        complement(335637..336665)
FT                   /codon_start=1
FT                   /gene_family="HOG000100786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638535"
FT                   /orf_name="MICPUN_109001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69964.1"
FT                   /db_xref="HOGENOM:HBG557098"
FT                   /db_xref="UniParc:UPI000199C467"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA8"
FT                   /transl_table=1
FT                   /translation="MTLGEWCDENGDYGDKLLEEWYDPDRTVEEVTRGAKYKALWRCSA
FT                   GCTKDGKAFTWEARVSNRTSSNRAGCPGCAGRNGSPTDQNNLQQWCQDNSEYGRKLIEE
FT                   WAEPDLAIKDVTPASHKKLMWRCSAGCTKDGKAFTWEAAVGNRTSSRRVGCPGCAGQSP
FT                   TDQNNLLQWCQDNGEYGRKLIEEWAEPDLAMKDVTPSSGSTGMKMSWRCSAGCTEDGEP
FT                   FTWEAMVHNRTSSKHPGCPGCSGRSPTDQNNLLQWCQDNGEYGRKLIEEWAEPDLAMKD
FT                   VMPATNKKLSWRCTVGCTEDGETFSWEATVNNRTRPEREGCPGCSPYAPISLQKRLGKV
FT                   PR"
FT   CDS_pept        337075..338433
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638536"
FT                   /orf_name="MICPUN_53704"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69688.1"
FT                   /db_xref="UniParc:UPI000199C468"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIA9"
FT                   /transl_table=1
FT                   /translation="MRSTPLLPLVLLLLLNLGRAISNHAVPSSLGGIDMSELEVEMSAG
FT                   CDPSVAGCEVVEPLVSIELRALDPTTHAPPRPMGGTKATEADALADSFHVWLALPQDSF
FT                   WVNLAPTESHRVIDSELGRTEVGKVMLDADLALKRTAATLLHPDHDVGAAFWDELYGWV
FT                   GARPARLCHSFRQWIVPGVATMQITPRTVSGAGCDDGEDGSCCDGSCRDGSCRPGALHV
FT                   LRAPLKVMQEASYASDGAFGFLAADASGAASAMCAGADEGARAKADELFERLVLPALEA
FT                   EVNESPEYERLRSAYLWRVVGEAYLSGAVSDADVEGDADADAEERKRRVNAEVLADFAR
FT                   RVDRSAFARSASDGWSPSKVFELYVQSASRGEFHVTREVENATSGDVLRRTYFHGGIDW
FT                   RAVPSCVRRWAGTGGLEERCVAGGVAGGVAGGGFASVSFVTGSSEVVLMRGRR"
FT   CDS_pept        338600..339364
FT                   /codon_start=1
FT                   /gene_family="HOG000264387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638537"
FT                   /orf_name="MICPUN_53705"
FT                   /product="Predicted protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69689.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199C469"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB0"
FT                   /transl_table=1
FT                   /translation="MASLTTVARTAAPIRVASRASSEEKSARAAAIRSKGPVATPPAVV
FT                   RMPPAARRGERLVANGRKGMLGQTLDGEEGGGKKRREAKKAEKFAQQQSMAASIDPAAA
FT                   KRKDGWLAVGNVNTDFKEKNIKLLELANGQFLAVRWEETGQVFVVPCASTAYQYPMIDG
FT                   ELFFGPMGPAIRVPLDGTEYDLTTGAVIAWCPGGGNPVKAMLGALKKAADPVPLKSYPT
FT                   VVESDGTIACTFTQTNAAGEGFANRTVTPDAQ"
FT   CDS_pept        join(339633..339921,340061..340977)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638538"
FT                   /orf_name="MICPUN_61815"
FT                   /product="PAF1 complex protein"
FT                   /protein_id="ACO69690.1"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI000199C46A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB1"
FT                   /transl_table=1
FT                   /translation="MGDDALIKNVFGSDSDSDDDAAAAAPPAAAPTEDAGAAKGDDAEG
FT                   EVHADADPIPDADDAERDGADPDRPPGFKSSLEENLSDEEQEDDDKEEEKFGPPLEINV
FT                   NLYDPLPPTTTAKLVRLTNVVGVETEPFDPETYQPQEDTFVDNEGKTRISTPFTNIIRW
FT                   RKVIDPETGEEKVQSNARMVKWSDGSWQLLIGDEAFNVTETDLGDRNEYLFARHPGAGL
FT                   IQGQKRISSKLAFTPANLDSATHRRLTRAIDTRHVKTKQTQKFIAVTDPEREKAAADAE
FT                   AERVMKEQDAAKKRQTLAMGGGGRRGTGAGVGRGYTEDYYAKYADEEDALDGDFLEASD
FT                   ADESDGGEAEAVAERVAEKRKAGEPGGFEDEAGMSSDDGVGEKAAAVKRKRGRVTIESD
FT                   SD"
FT   CDS_pept        341112..342269
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638539"
FT                   /orf_name="MICPUN_61816"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69691.1"
FT                   /db_xref="UniParc:UPI000199C46B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB2"
FT                   /transl_table=1
FT                   /translation="MFAPCVLPVVARGAYVAPLRAGSSRRRPRPARSVRSRATVPVRSA
FT                   SSSAESDFDDLSDVTRDVLAFHAAERNGNGDRGRGGERTVPLESWAARYGWTVDAAERV
FT                   LWQADVPLKSSIGAGDANPIGKNVRIVDAKSAYVGVWLAFVEADHVVSALLARERGDPN
FT                   STAVKGGGSMTKKQALDAASAQLATRHAASQPEGGGCIQRRSTVAAWGDVIRALRRRYR
FT                   KGGDDACPYALLTKKVKTRRVYRAVRAGGAGSSSADLAGWEIVLGALEPDVHTHASHPF
FT                   AVEDARERERGGFGVRAGIGASSVYTNDGGTAGAGSTDVANNIAARRAARAASWKRRVN
FT                   ATYELDRCDNPWADDDEGGACGRADEARRLAEAAEKRRRSRLGSW"
FT   CDS_pept        join(complement(342921..>343192),
FT                   complement(342609..342674),complement(<342440..342545))
FT                   /codon_start=1
FT                   /gene_family="HOG000200886" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638540"
FT                   /orf_name="MICPUN_73377"
FT                   /product="Predicted protein"
FT                   /function="peptide-aspartate beta-dioxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="peptidyl-amino acid modification "
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO69965.1"
FT                   /db_xref="GO:0004597"
FT                   /db_xref="GO:0018193"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG286995"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="UniParc:UPI000199C46C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB3"
FT                   /transl_table=1
FT                   /translation="TGEWSAVYLWRNGIRDKVNCAAFPATMNALCSLDNAAFRNVSYEG
FT                   LEEPGCAFASAYLSKLTPGTLVTPHCGPCNARLRVHLALRIPKDDSRVVRWEEGRCVLF
FT                   DDSFVHSADKKRRDADRIVLVLDLWHPALGPGDRNAVRALYPGG"
FT   CDS_pept        <344544..>345326
FT                   /codon_start=1
FT                   /gene_family="HOG000219622" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638541"
FT                   /orf_name="MICPUN_71152"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69692.1"
FT                   /db_xref="HOGENOM:HBG560878"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199C46D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB4"
FT                   /transl_table=1
FT                   /translation="EGLPGLTRSRNEADHAVITPESRVWCGLPGWDPTCSGAYLASPQM
FT                   NGALFTMCLVKMPDGARAGPALPGVERFVMVVEGGIATTLGEHIRLSAVKSGDDVHGEY
FT                   LYMPPDMASVVSIKAEGATTILMFEQVYRPSPYKKDEKPDREFGFIDDKPTLDPGAPEV
FT                   FTLRKLLPLEERFDFNIHVMDFEPGQFLHCNEMHYNQHGMLMLEGRGIYRLGQGDGRWY
FT                   HLRAGDAVYMAPYCPQWYAALEPGRTRYILYKDTYRDPL"
FT   CDS_pept        complement(345555..346649)
FT                   /codon_start=1
FT                   /gene_family="HOG000265222" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638542"
FT                   /orf_name="MICPUN_61819"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="ACO69966.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG557104"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000199C46E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB5"
FT                   /transl_table=1
FT                   /translation="MFGLGQLRSPTWHVPIPFLTGEDRPDAALWREHLANRHRMGRELR
FT                   ARGVRDVPWSSFDRALGVAMTCFTFGLWIVSGAGTIAMFALGGAWTRAIVAAYAIASLF
FT                   SARQFSQRVYDYCAALEVGERNGWGLIVKGDVDCARTAHIFCSHPHGLFCAGVSLNLIL
FT                   SRRGLDAVRARSIRLFVHSLLASVFPVVKDWLRTLGFQPCTAAHMRRALDAGLNAAIVP
FT                   GGVKEVVWTGRVDRERLYLKNVFGFCKLALQTGAPLVPVYTFGESLSVGPDWLPFFESR
FT                   RRLSYLIDAPIRYMSLTQRWLLPFPNGRLVTVVGAPLAVGERTENPTRKQVGELHARYC
FT                   AALLELIESTKEEAGYGSQVTELV"
FT   CDS_pept        347105..348181
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638543"
FT                   /orf_name="MICPUN_61820"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69693.1"
FT                   /db_xref="UniParc:UPI000199C46F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB6"
FT                   /transl_table=1
FT                   /translation="MRAGRANESTSSQPLACIVGAAALLLWRARAKDVARGERKDDDSD
FT                   AADPWKEVEADSLVSGLARKLSNVTAPQLAPPARDAPRPARRMFGAALAAATVAAAAAP
FT                   NALGGGGGGGGRGNPAGVGAPHREVGQSKRDRLARFDDRVQVSVRRAGKGVVVLDARVA
FT                   VPEATRAQTWRAVRAMALGQVPAGGDGLRDVLTQTTVPGVPLPGTFTGTFKRGLGAALL
FT                   DDDAFDEEATVTRTARYKWGVIKGTSTVATRARVRDADMTAVIDNVEPERKGPNSSASS
FT                   PSLERVNSEYAVVGDGVAFRSEFKVADVRVMGISQIEVATRATASILRGAAVKNLGDIA
FT                   RVAADATASENGPRDVRA"
FT   CDS_pept        complement(348857..349681)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638544"
FT                   /orf_name="MICPUN_109003"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69967.1"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="UniParc:UPI000199C470"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB7"
FT                   /transl_table=1
FT                   /translation="MLLSIKGFSHCQPTCNEGYTLSGSQSCYLGTLTDTAECQADPCVA
FT                   SDDPAKDGSDGIFYCINGGTVGGTTTACTCDCNPGYEDASCQTASACTASSDPAKDGSD
FT                   GIFYCINGGTVGGTTTACTCTDCNPGYEDASCQTASACTASSDPAKDGSDGIFYCINGG
FT                   TVGGTTTACTCDCNPGYEDASCQTASACTASSDPAKDGSDGIFYCINGGTVGGTTTACT
FT                   CTSCATRYGGKNCHIGPCDMEKSCFDFNLRNGMTTPASCAFLGDEDVTECKS"
FT   CDS_pept        complement(<351269..352387)
FT                   /codon_start=1
FT                   /gene_family="HOG000200887" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638545"
FT                   /orf_name="MICPUN_86032"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69968.1"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C471"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB8"
FT                   /transl_table=1
FT                   /translation="MVDLGEEIAIGGIFLYQTADLGGFSRAVGLYAEILDASQNTVLTT
FT                   AAVQDSRAGYLLDFSSTRPNYQRGRVTIGQDHLCAFMNDGSVQCWGRNAKGQLGDGTTA
FT                   DSLNPVVVQGITNALSVDTGAGRTHQCALLMDGSVKCWGGNYYGTIGDGTYDWYFGKLQ
FT                   PTAVVEKTSGDLITDAVAISVADYHSCVVRRQGNLSVWCWGWNGSGQHGDGSRSHNYAA
FT                   VKMLGISNARSVAVGYAHTCVLLQDGFVKCLGYNAKGQLGDGSYVEDSTTASQVVGVTN
FT                   ATNIASGYWHACALLGDGNVTCWGNNANGQLGNGATGDRSAAVQVLGITSAMSIALGHH
FT                   HSCALLRSGVIKCWGKNANGQLGDGTMDDRSSP"
FT   CDS_pept        complement(353511..355319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638546"
FT                   /orf_name="MICPUN_102624"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69969.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="UniParc:UPI000199C472"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIB9"
FT                   /transl_table=1
FT                   /translation="MTKPRAMLAGDDPSADPLLSCLAAIRAPPRELETAPRTADGSRLL
FT                   CKRFCRADGGSCARPDCPDAHVPIAQRQTCWTLDRYGVCAREEARRADPKAPRCWFPHP
FT                   VPPPADHHIALQVEVGMSDRVVSRCRELLGADAVVGAARADLSRNGDVLVLVTAGHRGV
FT                   ANAARILADDEHLAARIKRAYATGANHAADRKGDERNERGGDEGVLFADASVVGDDADA
FT                   LDATLREKLASLVDAALGGEKDSSFAARIRVRCFPPRLRDVVLEALEARPVLGGSHGWE
FT                   TCARVDDATHALDVVAVRGRAHVTVWSLDRTGPDSLRAWLMDAGEAARKRRTDAGAMCR
FT                   AFHKIEEATARAGVAIERTWRCVDVGAAPGGWTQWLCARLDAACGGEVFAVDPAELGDF
FT                   KNGRLPPNVTHLKMRGEDAVETVRRAGDVDLLVCDANVSPETATGIVSAFVPALRRGAT
FT                   LVLTFKDATKGYAEWRRQMESATDTLTAIGFESPRIFHLFSNCSREKTLVAKFAGGRDE
FT                   KRTGAGVPARAEASSRKASRDADRSRLLLARSLAVFATMPGEFAEAHIKARGFAPPPNG
FT                   SVRLMRGRLLKILSDEVIAESSWHAS"
FT   CDS_pept        <355711..356460
FT                   /codon_start=1
FT                   /gene_family="HOG000257748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638547"
FT                   /orf_name="MICPUN_85881"
FT                   /product="Predicted protein"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69694.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG616790"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C473"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC0"
FT                   /transl_table=1
FT                   /translation="RNQRRQHRDTPDNNDSLSWDFPEAAMPTVHKILERYPPNYKRSAM
FT                   IPLLDVAQQANQGYLSVQAMNRVAEMLEVAPIRVYEVATFYSMFNRTKVGKYHVMVCGT
FT                   TPCMLRGSRDIEKALSDYMGVKKFESTPDGVFTLGEMECMGCCVNAPMIAVADYSNGVE
FT                   GYSYNYYEDLTPADAVAVVKALKAGQKPRVGSQHRDKAEPMGGQTTLTGEPRGPYCRDL
FT                   AKVKADLEAAAAAAAAEAAKAAAEAKK"
FT   CDS_pept        complement(356586..357632)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638548"
FT                   /orf_name="MICPUN_109004"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69970.1"
FT                   /db_xref="UniParc:UPI000199C474"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC1"
FT                   /transl_table=1
FT                   /translation="MAPEAAPPADTAKPIPVVDEDAPAGPDKYGSFSNPGSLNVGVPYT
FT                   GKDPLAQGNSRLRGVNMKAPSAKMGKGNDASFDRFKPLYQKEPFQVSAAEKREARAKAE
FT                   DGRIQGPLVPAGMPKKSSGLGGYGGTLGEPFENEDGEPYFGWGTADGEPPKGLMKGDPS
FT                   TQPKPRNIVTGPGKKGGYGMRGYTLGEKKSAGGSAGEYKYVATDYDAERKADAARAAHG
FT                   KKLMAGKPDWKPTAPGKRGGPGVTGKTLAGPKNLGGVCGEYRYKPEGPDPKFVPEPPAD
FT                   YPWAPPKPNKGPMNPFPEHMADPEELQKWKERRREKEGRAKITKAWRPGGGGKSGATKS
FT                   VLRMNTRL"
FT   CDS_pept        join(358130..358199,358383..358440,358620..363012)
FT                   /codon_start=1
FT                   /gene_family="HOG000265853" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638549"
FT                   /orf_name="MICPUN_61824"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69695.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG557110"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniParc:UPI000199C4EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC2"
FT                   /transl_table=1
FT                   /translation="MKVMQRRILLGLVAVLCAAIGVQAGCEYHTNCAACVADTTCGWCG
FT                   NDPYSAGGYGFTQQGDHTEGNPFSADAYMVGGIGKVKLLGTSSTASPGQPPPNRVIIGQ
FT                   NTRFTKQFRGYSSFDQDGYQMGENPFKIVVVVSTEYTLEVVRVYNDTYMEVKDHQVNIP
FT                   DYIPFTLGTPRGRGELWYGPSSKEVILPNSQSREQLTIVCGKSFSASTVNDTDACKFTK
FT                   ELKVGYWLVLDKAYPVQHRVITSIKSDYELTVDADFSVGSAVATDTLAHSGTKLAGESE
FT                   WTWVSCPPRIGKRATGMGVIETHADQTTDFKDSGAIKAGRSVTSGWLGRASGAATMKRH
FT                   RIVGRGTRFETQFGAETHWDKLEPGSYYKEGPWMSVQINGDWETVKIDKLGSTGTYAEY
FT                   ISVLENSFSEPLLKATHFHWYTMLSKGTGRIRSYGKRVVSNAWSNVEFSTMAGEGTTEG
FT                   YYGNTRFLTQLRTGFTITACGQTRMVNSIQSDVELTIDRPFTLGNREWLPATGSMARAD
FT                   DMYVRGLTRLMPLWPRGVTVQLIVTYVGGSGNVRFKYHVWWKTFKHTDDGDGNSQDDLC
FT                   PTATIDALTECGITMPVDSWYQLKDTELQKEFGVYVKFNKCAVGKGGSGTPKNSDDTQA
FT                   CNQATFKPHDQWKIHVADIENCEYYISTEGERFITDDNANPPVCYNYGKCMPITTDATT
FT                   VSEAQKRPQLTAPGLVKYDKSTYTLTSEIDPNDGNRNAKFNSDVEPGDIIRIMKTGGSV
FT                   DIRVTGITSDTELLSDYLDDVDTSTAYNYKILKCAAGRIGGDKHDAIDNTGGAMHIPDE
FT                   SPLAYLPHPEHSYYQTWSYKYCEIDPGCCGFRVSSIVQPQQFGYYHVKPDHSNYNLRIA
FT                   VHTVNDNLDLYTRRDDDGGGRPDTTNYHLTSVRESVPWAIDEDEYDFACVAQTLKKSVL
FT                   AGEYIGGDAPTYDSALAQYTMHDNKPNCEKWVVGVMGDNRYPQTVGASEYSARFYIEFN
FT                   FPDFACEDSGEPADDIGGFLSASHKKKCIQNNLRFVRDADVVLNSADSPKWVVRLTETK
FT                   KRQNGQYVKWRDAGGASYPNAQRSGAVWWHRKVHVWDGFETNFVFQITDPSQCGGEDKI
FT                   CDGGDGFAFVITNDARQEKVDYNSNEGWDCTDPNSCSITDGLIGCPADGLGYANSKKSN
FT                   TVNYFGEWQECTFGLRKALAVEFDTFYNVERRDPKQGKQHWWINATEYVSYNDNHIGVF
FT                   MTTEPKYAHQPWGASQPELKALHSDDENGAHFGSTPSVPTMADFQEHTVKIRYTRGFTT
FT                   EKQGSGKLSTTDIVTADADRRRLKGNQLTKFKTELRTGFEFGYASRVKANVKVKLNRDI
FT                   TCQDPETDPPTFAACRQSPPVATTGFGDDGEATRVIKIIDDDEANLEDTDTSGATAEEA
FT                   EVRITYMHAFNPKQDTDADYNIIKEFPGEIQVFIDDMDRYVFQVAVEDRDMSKILDTDG
FT                   NAYIGFTASTGSKGFAKVGYDPEEVHETHDILAWNYCNNPGCVPY"
FT   CDS_pept        complement(363255..>363704)
FT                   /codon_start=1
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638550"
FT                   /orf_name="MICPUN_85490"
FT                   /product="Predicted protein"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO69971.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG753323"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199C4F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC3"
FT                   /transl_table=1
FT                   /translation="VLIVEDNLMNQKVAKVVVKHCGMTADVANNGAEAVEIMKGGGLYD
FT                   VILMDIQMPVMDGLEATQRIREMEATGTIAKGNYIVATSANATAENHREGYEAGMDEYI
FT                   TKPIYPSKLKELLAKPKRMQTVLEFDDGADGDAEVTSLIGRNGSG"
FT   CDS_pept        join(complement(365295..>365621),
FT                   complement(<364848..365114))
FT                   /codon_start=1
FT                   /gene_family="HOG000217841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638551"
FT                   /orf_name="MICPUN_71636"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /protein_id="ACO69972.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG584997"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniParc:UPI000199C4F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC4"
FT                   /transl_table=1
FT                   /translation="EPQREFVSSAIVSAEALLGIIGQILDFAKLESTSGMHQELVIESF
FT                   DINEMVNELVDIVGHQANKNQVELVLDVAPELDGLNVRGDKFRLRQALINVINNSIKFT
FT                   REGGEVIENDFLAPHAPRVVVAFEVCDNGIGIARDKLKLIFMPFGQASVSSTREYGGTG
FT                   LGLAITNNIVQSVGGTITCSSELEKGTTMVLSVPL"
FT   CDS_pept        join(367573..367863,367922..369481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638552"
FT                   /orf_name="MICPUN_61826"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69696.1"
FT                   /db_xref="UniParc:UPI000199C4F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC5"
FT                   /transl_table=1
FT                   /translation="MAGPLVPHVGFEVSELSLGDEPSMYTGRMTSPSTEAREAEVSRSS
FT                   AQLQAVKNEASAEHFGSFLAPPLGASRFTPGSRPRDASIVAIIHTDHTTRPAKLKAQKT
FT                   LQSKERENNFLRREVERVTAERNSLEAALQSEKAYVRRLEHKMTAGGPDTAARCAQLRS
FT                   KLKTARDELQVETAKTRGLQKELEEALRDKASVLHALELRAQDLSAEGGADVPSRLLYA
FT                   VAKGREEAVSLAVQIAEKNDELRAERELTEHLRERCDELEKARKAEFDDATRARAGRAD
FT                   ADARAERARTAAEKAVAVAHAEAAKAGALAEEAASRCVQLGTELAKERERCDALHRALD
FT                   ERDAFHSKDLDVLRREMELAIEATEREAGDDVRRARTELEDVSARLAVAEAELAAARTN
FT                   ASATAADASKSVETANVRAVQAEAESHRLRDHVTQLEEEGGNLTAQIEAFAAVNARLQD
FT                   AATSAQTRADAECAKVANLKRQVETLEKASKAARGERAQGESELKHKLKSALEELATVI
FT                   AQRDEQKLLLQEALAKCASAMARAERMEVNERTLKQSVENLNRSKALLQETMVEQLASV
FT                   RAQLERAQTQNRDLEAMMRRQAANTEKLQGLVEASTPGLS"
FT   CDS_pept        372188..376738
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638553"
FT                   /orf_name="MICPUN_61828"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69697.1"
FT                   /db_xref="UniParc:UPI000199C4F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC6"
FT                   /transl_table=1
FT                   /translation="MARGEDAFTAADSLCRLQRLQATCGALRESEGVDALLFIGGIDGR
FT                   DNLGSVRCLNFLLGGVGGVELLEREQCVGKWGEDVVLLVRPDGCEIHVGHAHYEALRPF
FT                   VAAWGNVEVHTLPPRHIPNEDDEAPKRPDREDEARDDDEASSDESLGGRGDGSDDSEEE
FT                   EEEDVLQDFKLTALVSMLTGVTTVGVACTPNGPGEMETERWPLLQAYGIEGVGRSGFFT
FT                   MSTKVVDTWDVIHRACFTQLDGAQLRRELAESTPPFRQHWEASLATMDARRAPGRMTLT
FT                   PALAFDPLAEFFAYGTLRRPVGFGAFDETDAPRVGFGLGTDDDLRGGDDVRLENVRASA
FT                   SGHARSPALHCTVEARHPKSPGLRCARTYVFGQGCVTATTINGFTKRVDDDSENQSQLR
FT                   EPPRATDEADVAALVGLYAAAVAAGRDAMSAACDAWAAGAGPETWTRGDAVDVSIVGAA
FT                   RRAFAVTADVLGVPSHVGSDRASVLDVHVDATDPSNARPSPVAGDGAMGERRGNGGDDD
FT                   AGSDVGFSFGFGRGVARCVAYVRVALRGVVGVESGEPLGAIVYGDSFVPGGFRTGDGGE
FT                   EESSASLAPLVLTSGVPLVRAWPAAGAETDACEGCGEATRKMVKDARLNFRARRKARAA
FT                   KKAKAEKSRAAKEERGVSEDAPAEEAAKASAADDEVFLDDELEFESDDEEDENAAPGNS
FT                   DAEGPEEGPEDDDGDDFFAPSDDDDDDGPHFAPLASTYRVDESLALGPSLLVPKPEPVL
FT                   AFVPAFDVRSGSSSNPNPNPKPSMDPRVLDVVSGDDGARAGEWHVFDNGVAFVPDHGVP
FT                   LHLVLGVNVAAIDVHDALVDADGVADAAAGPVVVFRLSRPCALAPSHLFLHNDDDAGTS
FT                   RLNGTTSVAFSLAPLGDKSKRHFARVVVPRWRRVCASGHRQGVVGHGGSGAFFGCEVRT
FT                   GLGAYAAATPSQAWACGRARSTRERAGGIALASASASSEASVAHKRFQTREPDSAVLAA
FT                   ASALDAELYTGTGKHVHSRGFEQPKETGDEGDSMDDDAVDVTLLVGPPDGCQDEVFDAL
FT                   RRYASGSATWISTEAVAPCAAAESVRELAHALASVRSTAARSDGGGARKPYRVCVIART
FT                   YESAAEVAASVTEATTLAAELLLVQTSPPPTDRVRMRLGAVTACVAADGFFADAERRPA
FT                   FGALAQVTPPACDNVVLLPTGAAAAAAAASFSSAPGAVPAPTSRELLEDAAAWIRGAIR
FT                   ARGGDVNVTVGARRLLSSPLAAATTTKKSPATHHPVTHRPNSGSRRNLARRRVVAEGDV
FT                   DLRAVVACVRGMFSLGRRARPKTPEELRRMSPDERLAYDLTRFAEVDPASPVIGHAEIS
FT                   ATIGVGEGDATTTTFRRVYNFTAAARGEDVDDAEGWTDTAGAVAKRVEITVSGVNVAGD
FT                   GLNLAERVRACAHRGPPSRPLRTAASLREEELAAIARRCKEEADLPTGWYYDGAVYVSY
FT                   DGLRRTSAHPRMDEHVGARLEEMNAVIEEWNVRAEEARNALRGVTITAEEVRAYA"
FT   CDS_pept        complement(376800..377561)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638554"
FT                   /orf_name="MICPUN_97949"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69973.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C4F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC7"
FT                   /transl_table=1
FT                   /translation="MVRQLLENEDASLPGRPAAAGGHVVATCRDPDNATALHALKAAYP
FT                   NRLTVVRLDVEDSASIASAAETIGAAHGRVDVVVQTAAVLHVKGEMTPETSIARVDEAA
FT                   MMRSFRVNAMGPTLVAKAFSPLLMEATARSAADGSGPPAIVANLSARVSSIGDNGLGGW
FT                   YSYRASKTALNQLTKNCAIEFGRKKHQVSFILLHPGTVDTDLSAPFKKNVPPEKLFTTE
FT                   FSASALLKIVGEKNQSDTGKFFAWDGSEIQW"
FT   CDS_pept        join(complement(379734..379916),complement(379266..379565))
FT                   /codon_start=1
FT                   /gene_family="HOG000264466" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638555"
FT                   /orf_name="MICPUN_106134"
FT                   /product="Predicted protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69974.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG557113"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="UniParc:UPI000199C4F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC8"
FT                   /transl_table=1
FT                   /translation="MVLYELMVMVKSATPRAQLADILRRAGTRVLDAGGVITDITSFGT
FT                   RPLAYEFKSPGERHFEAHMVQISFNSAPTLIEDMKHDMRTDERVLRWIAVKKKALRPLS
FT                   DYKARDPRNLNLPAATTTKESAAPKPPTQPVSKYPLFSEERKERRNARRKAAARGD"
FT   CDS_pept        join(380186..380222,380440..381026)
FT                   /codon_start=1
FT                   /gene_family="HOG000090523" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638556"
FT                   /orf_name="MICPUN_91802"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO69698.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG314667"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI000199C4F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIC9"
FT                   /transl_table=1
FT                   /translation="MSIMSYNGAAIIAMCGKECVAIASDLRFGINQQQTTAVDMKKIYK
FT                   IHDHLYVGLSGLATDQATLAQRFKFRHNMYELRESRKMRPETFANLVSTMLYEKRFGPY
FT                   YAEPIVAGLDATNGYKPFITGMDLIGAMAPTDNFVVCGNNEESLFGVCESMYKPDLEPE
FT                   ELFEVIAQCILAGVNRDCLSGWGGVVHVISKDKVITRTLKGRMD"
FT   CDS_pept        join(381403..382435,383545..383687)
FT                   /codon_start=1
FT                   /gene_family="HOG000100131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638557"
FT                   /orf_name="MICPUN_102633"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69699.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199C4F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID0"
FT                   /transl_table=1
FT                   /translation="MASAWLIMTVIAVHVASVSAVFRPTTKDELNYAISSCLTNNASGV
FT                   QCCAASPYCNAGPGTASFTDDIGDWDTSLITDMNLLFDGRAMFNADISRWNTSQVTDMA
FT                   EMFSGADVFNQPIGSWDTSQVTRMEYMFRNTAAFNQPIGSWDTSQVTRMEYMFRFADAF
FT                   NQPIGSWDTSQVTRMEYMFRNAAAFNQPIGSWDTSQVTRMEYMFRNAAAFNQPIGSWDT
FT                   SQVTRMEHMFRNAAAFNQPIGSWDTSQVTRMEYMFRNAAAFNQPIGSWDTSQVTRMEDM
FT                   FRDADAFNQDITRWYTLSSITSSGMFLGATAWQARYTNCGYHNTAYSACSEFTSYTSSA
FT                   DIYNGYHQARGRHRPGWRRDDVLVWIVGIAFVAIIVDAIVAQLRPRQEGGG"
FT   CDS_pept        complement(<384398..>385333)
FT                   /codon_start=1
FT                   /gene_family="HOG000007813" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638558"
FT                   /orf_name="MICPUN_69685"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69975.1"
FT                   /db_xref="HOGENOM:HBG412519"
FT                   /db_xref="UniParc:UPI000199C4F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID1"
FT                   /transl_table=1
FT                   /translation="ESLRDEIDLFEVHLARIAPPGTEQAPEEDAEDAGAKRSKGSKKSK
FT                   AKTDAPVVRDRLTDAERLDAVTAESELLERVQREAEAANERGLMDLRAACDEVDACLQE
FT                   LKKAAHDFKREVAVGAVNERTGLVDPTRWLRHSEQYVRARESTAEKLTLTNKTLRNQIA
FT                   HAEATLRQKEEMSEVLHAVDFEKLKIENQQYAERIEERSAELAKQKDSLAAASTTVTRL
FT                   KRQLDEAGARMRQLQADMDQKRYYMGTFDANLAVAEKEHAAAYKLNKNLLTASNSTENP
FT                   GVMEYVHLKNEVQLLELKAADWARKLEVAQM"
FT   CDS_pept        385655..387295
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638559"
FT                   /orf_name="MICPUN_102635"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO69700.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniParc:UPI000199C4F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID2"
FT                   /transl_table=1
FT                   /translation="MSGDSTFILNSSASPARSFALSLDPCAYDTLLDTFGLGLTTSTPE
FT                   ARASPNGEEEERESDPPAAVDDAREDDGLAPIERDRLERMRRNGDEMRRMGIVDSVYRL
FT                   AGGAVGKPKAPEQKTEPGDDVIIIDDEDEEEDDDVNVEEATRDETGLGYGCKRCRFSKR
FT                   GCYDSADGKGKGCRGDATLGPLSLQRESGAPKKRKGIAREHNANPIMSPRSKRRRSAPA
FT                   KYESGAATEAERRSPTVIPARKHAPRPDDEKKKDKKNKKKLSSVPGYPGISVSNYTGRF
FT                   CATIGSGSKPNRLYLGTVDTLKEAKELYNEEARKRGKPVYRLLEAPKINKISTAVPGLP
FT                   NINLFTADGKFVMQFTHSAGSVHLRADTLDEAVKAYNEERVEHRLSTHKITAEHRAVVE
FT                   EMQRRRKLFVAERSKHRESTPPMPAPAAAPVTRACSKVPAPPPKPGKTRPARATAPPTP
FT                   KPGRDARESAPTPNPEPVERGAAAAGAAAEAAGAAAAPAPVTPAPPADSADVRRLREQI
FT                   IELQDMNRSLLGIAQRAMSMAAKNAEMMS"
FT   CDS_pept        387612..388553
FT                   /codon_start=1
FT                   /gene_family="HOG000264465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638560"
FT                   /orf_name="MICPUN_102636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69701.1"
FT                   /db_xref="HOGENOM:HBG557073"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199C4FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID3"
FT                   /transl_table=1
FT                   /translation="MSSAHDNSGMSDMERYLFDLNGFIIVRNVFTADEIARANAAIDAR
FT                   SERIVERKGDLRLGGNKGDPLAGDGVTGRADLGGMLEWPAPDRDLFRSVLTHPKLVPYY
FT                   HALVGEAYRMDHLPLLIQQAPGADGFVFHGGKMNDDGTWCDELAYHWNQGRMYNRLLAV
FT                   SVALTRTEPGDGGFCVVRGSHKSNLPCPPSIQRYEEHRDLVDNPGLEPGDVLFFTEAST
FT                   HGTLPWSAEHTRRAALYRFAPATSAYGRAYLTPQHWGGMDNLTDAERAVLEPPYHQRLD
FT                   RPALTMGGTVAGQRRAEFKKEHDAKVFGSKYF"
FT   CDS_pept        complement(388665..389585)
FT                   /codon_start=1
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638561"
FT                   /orf_name="MICPUN_109007"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO69976.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG737737"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI000199C56F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID4"
FT                   /transl_table=1
FT                   /translation="MASVSASLVAPAQRIAARRQARPTAARGARTPLRVAAAASIAEIK
FT                   GTGDLPAVKLTSADGCTATAYLFGGVVTSFTKPDGREVLYVRPDAVFDKSKPISGGLPH
FT                   CWPQFGPGDIQVHGFARNVDWELTKKTEGSNPSIEMTLLPSDYSKKMWDKDFKVTQTIT
FT                   LGDGKLKATLKVWNTGEEAFTFTGSFHTYFAADIDEVAVTGLKGCKSLDRLKDEAGTVA
FT                   GALTMSGPVDSCYYDVPSVVNLAVGGGNSVAIESQGGWTDAVVWTPWTDMEACYKEFVC
FT                   VENAACKEPVSVAAGGEWEASTILA"
FT   CDS_pept        389876..390181
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638562"
FT                   /orf_name="MICPUN_109008"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69702.1"
FT                   /db_xref="UniParc:UPI000199C570"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID5"
FT                   /transl_table=1
FT                   /translation="MFAVANTSALRVAAKAPVKARRTVAPKAALVADLKKAAKKVAPAI
FT                   LTATTTMLPAAAALAEEEVTPVDLKLAIGFTVAIGIAAFSTLPEPESSKHGHGGDH"
FT   CDS_pept        join(complement(392070..>392129),
FT                   complement(<390866..391897))
FT                   /codon_start=1
FT                   /gene_family="HOG000197992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638563"
FT                   /orf_name="MICPUN_66469"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69977.1"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C571"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID6"
FT                   /transl_table=1
FT                   /translation="RRPVQRRTVDYTATTVRHLENRVYQKHPWDNEMLQATSGAMLDFL
FT                   PPVAYPHVPATSFATKFVHVSTNKIRTPVRVVTFMPDGRRLLSCSQNGEFTLWNGMSFN
FT                   FETILQAHDCAIQAACWSKNENWLLTGDDAGRIKYWQTNLNNLKSVNAHTEPVRGVSFA
FT                   PTDLKFCSCSDDTTVRVFDFARAAPVHTLSGHGGDVKCVDWHPHKGLLASGGKDSLTIL
FT                   WDAREGKKAVDIHAHKNQVTCLKWNANGNWLATGCKDQTIKVFDIRTMKELENFRGHTR
FT                   DVTAVVWHPQHETLLTSGGYDGTIMYWIVGRGQEECAAQVKGGHEAAIWSMTWHPAGHI
FT                   LCSGSNDNTTKFWCRNRPGEVPRD"
FT   CDS_pept        join(complement(394336..394609),complement(392487..394132))
FT                   /codon_start=1
FT                   /gene_family="HOG000046859" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638564"
FT                   /orf_name="MICPUN_96632"
FT                   /product="2-isopropylmalate synthase "
FT                   /function="2-isopropylmalate synthase activity "
FT                   /biological_process="leucine biosynthetic process "
FT                   /protein_id="ACO69978.1"
FT                   /db_xref="GO:0003852"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="HOGENOM:HBG701974"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C572"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID7"
FT                   /transl_table=1
FT                   /translation="MAAQCAASAVVSRVAAPRPAKALKAAGAAPVRSATHRARRVGGRG
FT                   VIRATGAPKDEDVVRAPRPEYIPNKIDDLNYVRVFDTTLRDGEQSPGATLTSKEKLDIA
FT                   RNLAKLGVDIIEAGFPIASPDDLEAVRNIAKNVGNEVYPDGYVPVICGLSRANKKDIDA
FT                   AWEGVRHAKRPRIHTFIATSKIHMESKLRKTPDEVVQIAVDGVTYARSLGCEDVEFSPE
FT                   DAGRSDPEFLYRILAAVVEAGATTLNIPDTVGICLPEEFGALIAGIKANVPGQYIISTH
FT                   CQNDLGLSTANSLAGVANGARQVECTINGIGERAGNASLEEVAMSIWMRGQEKIFGART
FT                   GINPVYIYPCSKMVREYSGMAVQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPET
FT                   IGYFRGEGDVGVVMGKHSGRHALKSKLKQLGFPLEGDELNEMFDRFKLVAEQKTGGVGD
FT                   DEIIALVTSGAGQGDDTAVTWKLDEVQVVCGTMGLPTATVKMTGPDAVTRINSAVGTGP
FT                   VDAAYKAIDGLCRVKVDLVEYTVNAVVEGIESLAQTRVSIRAKSDQTMPGAMMKANVQT
FT                   GNVEARTFMATGADSDIVVSSARAYVAALNRMISFMRSNAETVAAEAVIDIVAEEEEKK
FT                   AAAA"
FT   CDS_pept        join(395682..395854,396118..397282)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638565"
FT                   /orf_name="MICPUN_109010"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO69703.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199C573"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID8"
FT                   /transl_table=1
FT                   /translation="MHDAKPDAAGFYKDEIIAAVKARHGYTDKPEIYQIVLGDNKVFSR
FT                   EVGTRKQGVKQGRPRTLYSLVSLKGPPRPSSPSPTRQNIKEASPESTAVEAGAGPAAGA
FT                   EKEKENAPAPAAPAVDADADADADAEGRTNRPRRAAANREQQLKKREEEEARIEEALKD
FT                   EEKRRRGEKKARGRPPKAVPATTPAPKRAKTTHAHPPKHGTPGLADAADILLDLASNEN
FT                   SPAASGEHEGGMVPASPLGSPIRRRRTSATDSDNEAQQQQQHTNRLYQPTATRVRFLDE
FT                   PERPDVHAEMNLNTPRGRHFDFAAAAAAARSVADASAGSVDGVDTVAKDAAVALIMAND
FT                   AKGEKQLRKALEAQNRAITALLADREVRSATVNSLCLAVENIAEIAAARQQEASVETRR
FT                   AAAAIAAPTFHGQEHIRDARRELDQMRTRMTLELEKISARLDQGLR"
FT   CDS_pept        join(complement(398798..398941),complement(397448..398728))
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638566"
FT                   /orf_name="MICPUN_95257"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO69979.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199C574"
FT                   /db_xref="UniProtKB/TrEMBL:C1FID9"
FT                   /transl_table=1
FT                   /translation="MRKAAIKPRAAPTVLYSHFVKDLTAKKVVAVRFEEGTGRILYELK
FT                   EGAQQQQQGGAIADKENAAPQQKRTILQTKRIPDEKLMTRLEAAGVEFGSIAAPATSVL
FT                   SKGALTAMALWIPLVPLYFMFRNMANKQGGGGNAKKARAPSNEKPVTFDDVAGVDAAKA
FT                   ELVELVEMLKSADKYKGVKNRLPTGCLLVGPPGTGKTLLAKAVAGEAGVPFFAVAASEF
FT                   VELFVGRGAARVRELFAEARKASPAVVFIDELDAIGARRGAGLNEERDQTLNQMLVEMD
FT                   GFNKPRGVLVLAATNRAEALDPALLRPGRLTRRVFVGPPDFAGRAQILAVHLRGVRTAE
FT                   SLAATCDAVARVTGGFTGAELANVVNEGVLLAARDDREVVTVDDLFSGAERTRNGVGVG
FT                   QGAATVLSGLRKLMQGGDPREVLKEVRDGSDRNGGGPPSGGGGFGGGGGRNDPNDPSNI
FT                   SEANRRQGVGMSMPPT"
FT   CDS_pept        join(400431..400901,401031..403079)
FT                   /codon_start=1
FT                   /gene_family="HOG000075064" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638567"
FT                   /orf_name="MICPUN_85922"
FT                   /product="Urease"
FT                   /EC_number="3.5.1.5"
FT                   /function="nickel ion binding"
FT                   /function="urease activity"
FT                   /biological_process="urea metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69704.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009039"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="GO:0019627"
FT                   /db_xref="HOGENOM:HBG357507"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008221"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="UniParc:UPI000199C575"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE0"
FT                   /transl_table=1
FT                   /translation="MRLSPREIDKLALHAAGSLAQKRLARGLRLNHPEACALVASVLLE
FT                   LIRDGRDGENLGVAALMDAGRRMLGKRHVLPGVADVLHEVQVEGTFVDGTKLVTVHDPI
FT                   ATDDGDLSLALYGSFLPTPKKDAFPPLPGEDKTAAGKKGGKKRKAGDKADPEPDRPGIL
FT                   LKVTNTGDRPIQVGSHFHFIETNGLLSFDRAASLGRRLNVPAGTAVRFEPGESKEVPLV
FT                   PIAGNRIVRGGNNIVDGPADAPDALEKAMARVASGGFLHVAGGPEYPPAPPLTIPRAKY
FT                   AAMYGPTIGDQVRLGDTNLWLTVEKDMTVYGDECKFGGGKTLREGMGQQCGVDASAVLD
FT                   TVITNALIVDYTGIYKADVGIKDGMIVGIGKAGNPDVMDGVTPGMVVGVNTEAIAGEGS
FT                   ILTAGGLDTHIHFICPQIATEAIAAGLTTLLGGGTGPASGTCATTCTPSPNHLKMMLQT
FT                   SDTLPLNFAFTGKGNTAKPEGLQDIIDAGAVGMKLHEDWGTTPAAIDNCLSVAEANDVA
FT                   VTIHTDTLNESCCVEKSVEAFKGRTIHTYHSEGAGGGHAPDIIKICGEKEVLPSSTNPT
FT                   RPYTKNTVDEHLDMLMVCHHLDKSIAEDVAFAESRIRAETIAAEDILHDMGAISIMSSD
FT                   SQAMGRVGEVITRTWQTAAKMKSQRGILKEDGVTDNFRIKRYIAKYTINPAVAHGMSHV
FT                   VGSVEVGKLADLCLWKPAFFGSKPEIVIKGGQIAWAQMGDPNASIPTPEPVIMRPMWAA
FT                   HKPGTTCVAFVSKSCVDKGIAQSYGLSKRVMPVQKCRGLTKLDMRHNDALPVITVDPET
FT                   YQVTADGEKLECDPATSLPLTQVYQLF"
FT   CDS_pept        403207..404025
FT                   /codon_start=1
FT                   /gene_family="HOG000049666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638568"
FT                   /orf_name="MICPUN_61844"
FT                   /product="Predicted protein"
FT                   /function="nickel ion binding"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO69705.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="HOGENOM:HBG709295"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="UniParc:UPI000199C576"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE1"
FT                   /transl_table=1
FT                   /translation="MTDNDVNGDVDDWAVWQLVDPLLPTGGFAHSQGLESAAHSRLVAG
FT                   LDERVRDQTGWDVDTFCFEAVRNASTLMIPFVEAARGLHHPAAGAGGKKASTDWEWLDR
FT                   RLGAHLAGNHVANRASVAMGAALIRAAIAAYGEDEKIGQKLKEVKRISRAEKSGGHLAT
FT                   TFGAVAGCLGLSTRRAARLFAYLTLRDVLSAATRLNLIGPLEAAASMRRCSNRCNEMAT
FT                   TAASSAAALHANAPKDFAVAAAVSRAANTSPLTDLIQGGHDALYSRLFSS"
FT   CDS_pept        404174..>404761
FT                   /codon_start=1
FT                   /gene_family="HOG000200888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638569"
FT                   /orf_name="MICPUN_85688"
FT                   /product="Predicted protein"
FT                   /function="nickel ion binding"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO69706.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="HOGENOM:HBG319324"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniParc:UPI000199C577"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE2"
FT                   /transl_table=1
FT                   /translation="MAPPAWLDGHWGAVPDPEADAACRCGVLEVSRSAGESAATRLYHQ
FT                   YPLRLIVPRRVKTAFPDADCVWCYSVTFGGGLVAGDRSGMSVDVADGCAAVLATQGTTK
FT                   IYKHARGGGPAGKPPASTETITDEASRYSASHAKTSRDTVQALAARVGNGALLAVLPDP
FT                   AQAFRDSRFRNRQRFALAQTGSLALVDWVTAGR"
FT   CDS_pept        405583..406734
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638570"
FT                   /orf_name="MICPUN_61846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69707.1"
FT                   /db_xref="UniParc:UPI000199C578"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE3"
FT                   /transl_table=1
FT                   /translation="MSFVSSTRTCNEPIDWAMSNNQRIHGDGYGRYEYPAEEEPEKTIP
FT                   PHLVRSQQKEFEADFGQRRRKVEGEGGYLGGMRMPPKGMNNLEGRKDLFGIMKQQRPKS
FT                   GEVANPDSWIGRPGNNPQAGKAMCANSPKLRADRVNDCLKDISFIKKHGDPNRPQYYDG
FT                   EWIGNPGHRTQPAPPIDTNVGGYRHTQFRSTAESRKDFFARMYGDPDHRGGDLDGWLGN
FT                   RKIDPSKGLFRPDRVEDELGPGLIKKKDTPDAGAPGYLRPIKDQTEEFLECFKPELYKE
FT                   QEPTSPMSRAARPEDMKPTMNRGPKKVPEPVGRSQRRGMYGIMSHGTRPDGAVGDDFLP
FT                   TGRHGVKVPGADTEVGKGQLLLYTNEYCSSMGRRGIDELEDEL"
FT   CDS_pept        complement(406865..407785)
FT                   /codon_start=1
FT                   /gene_family="HOG000236979" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638571"
FT                   /orf_name="MICPUN_53722"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nickel ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69980.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="HOGENOM:HBG364734"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="UniParc:UPI000199C579"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE4"
FT                   /transl_table=1
FT                   /translation="MGCGEKDCDGTDGHGHGHSHGGDAQAHGHSHGDAGGDATPLIQDG
FT                   EGKDGIVYYRAPDGRVLHSHDGLKPHSHDPIPSPGHFERRRPRKERGDYDERAFTVGIG
FT                   GPVGTGKTALMLQLCRHFTKESRDICAVTNDIFTREDGEFLTRHEALEAGRIRAVETGG
FT                   CPHAAIREDISCNLTEVENLTREYSPEFVLLESGGDNLAANFSRELADYIIYVIDVCGG
FT                   DKIPRKGGPGVTQADLLVINKTELADAVGASLEVMARDSKKQRDTGPFVMAQVKRGVGV
FT                   GEIAEHILAAWTEATGGERNKRAKT"
FT   CDS_pept        408734..409678
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638572"
FT                   /orf_name="MICPUN_109011"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69708.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="UniParc:UPI000199C57A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE5"
FT                   /transl_table=1
FT                   /translation="MLAPPDPAGTLSGVIILPGGAHAGAHGGAHRGAHRGTWTWDAVAD
FT                   EDDVRALFEDKFPDAFNGAPVPPEAVAQILAQTPRRGGVTTHCSRLANADGSVALVGDA
FT                   AHSCWPSLGQGANCALETAQYLAYSIESMPDDLRGAVRRFDEVRTPQVHACGRLSEAGF
FT                   GGVARRAGNFLFFAKIGLLALLNKAMPFFFDKPALANINDPAWAYDDVEDAVAQETQAL
FT                   AAFGGVLLAASIGVAVFGWERFIGASVGAVKAIALGEGTRADEGAALVALGSAAAMTGL
FT                   FRWLAKRRRERRKGNTSPAVFASPSGGGAAAAA"
FT   CDS_pept        complement(409993..410451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638573"
FT                   /orf_name="MICPUN_106141"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69981.1"
FT                   /db_xref="UniParc:UPI000199C57B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE6"
FT                   /transl_table=1
FT                   /translation="MFTALTSIVPTRVALKTRTKPTHKVRSGVVAYTNWMLDGVGCSGA
FT                   RSDDSTLVKSKKLKNNVVHCPVKPIDLTSLCMSHDGRFEMLDALFEQYGDDIFVSNLAP
FT                   MDSQHGSITMTVDGEVLPPFAKTVLKPGSKVQIGDEIYEVNRNVHAHA"
FT   CDS_pept        complement(411004..413985)
FT                   /codon_start=1
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638574"
FT                   /orf_name="MICPUN_97954"
FT                   /product="Predicted protein"
FT                   /function="importin-alpha export receptor activity "
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69982.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008262"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG327833"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C57C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE7"
FT                   /transl_table=1
FT                   /translation="MGDDAQLAQLSSCLQQSLSPDPSVRTQAEQFLKDGSVQPGFSMLL
FT                   MRLLASEGSDATVRQGAAVTFKNLVKNNWVEKEADVVGAPAPYSVAAGEKDQVRAMLVG
FT                   LMLGAPRLVQAQLSEALSIISAADFPERWPGLLPELIQRMGTPGARDFNAVVGVLTTAS
FT                   TIFKRYRQAYKSDELYKELKYVLDTFAGPLLELLKEVSAAIDANAANLELLVNLFKCLR
FT                   LICRIFFSLNSQELPEVFEDNMDAWMGEFHKFLCYDNPALAAVDNKDREKAGAVDQVKA
FT                   AICDNVNLYIEKNEEEFQRFLQTFVQDVWTLLTKTGLEPNKDHLVTSGVRFLTTVANSV
FT                   HHQLFAGGDTLRQVCESIVIPNLQFREDDEELFESNHVEYIRRDIEGSDSDTRRRGACE
FT                   LVKGLTAKFPEVMTQSVSGYVAALLGQYAADPSNSWKAKDAAVYLVISLVVKSKSVVKG
FT                   ATETNDLVSITDFFTQQIAPELARAASGDAAGGTGRHVLYADALKFLTIFRSQIPKSMA
FT                   IQALPAVVSLLASRENVVHTYAANALERLLTVRDLPPAGSPPGARSQPRYAPADIQPVA
FT                   QQMLQNLFGVFAMPDSSENEYAMKATMRLISFMGDGIKPIAGVCLERLSGMVMETCKNP
FT                   RNPTFSHYLFESVAALVKAGAGDPGLIATFEQLLFPPFQHVLQQDVVEFAPYVFQLLSQ
FT                   MIESHPSALPASYMGIFPALLVPMLWDRSANVTPLVRLLEAYLRKAPNEVHGAGHIQGI
FT                   LGVFQKLVSSRAQDHHGFFILNAFVEALPLAAWADKLPAVWGILFQRLQSSKTTKFSKC
FT                   FVVFLSLLAAKHGVPSVTESMSKVQPGIFEMVLTGVVADAIANISGAVEEKVVAVAGAK
FT                   FLTECPAVMAQDAAWAKLLTAVVTMMERPAEHKGEEDLDAEAEEAEARAGYSAAYNALR
FT                   QAQRKETDPVPDVTDPKVNLARALAGASAQQPGRIGSIVSGQCAPEVQQAIAGYCAQGG
FT                   VAIQ"
FT   CDS_pept        414340..416733
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638575"
FT                   /orf_name="MICPUN_102649"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69709.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C611"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE8"
FT                   /transl_table=1
FT                   /translation="MDAPCRPRPPRQPKTAAENCAISVKGVGDKCAKEGKWPDARDEYA
FT                   KAISLVLDGSAPTEGWAWDLLPRLLCNRAIALYKCGVQFDMACVDAMRAADALKVHLHS
FT                   DAQPGGAGSKRAEQLKLLTKARFWEARALTRLDPPRLTDACDALRKALATCHKRGDDGK
FT                   SDARAAQIELRDVASKLPLGFVCEHWADAVAQAESPSPFATSQREGRLLKPVRPDACRM
FT                   SKVELTAVLEECAVGQENEWRDEMVAAWVSASAAAGVDGDRLGGSQSSAIGGLGGRRAK
FT                   FFLHSVRARAYMRRGRHEQALRDSRAALSYVPSSSEWELFDADAATPLRSLDPADAHVP
FT                   VPITETARRAAGARAMHAAALEAAGAVVNAGELDVYHPEFNPCALDGDVDPDAPVEPGT
FT                   DPNALPKKSYDDVTKSAWKNSTTTMGEGGVDVDARKTNADRLHAKRTHLTTRGVGRVVL
FT                   CAAGEGGRTEDLVVDSGVAAAVEWRRACALDPNRRDYSARCVAAAERHLPTKPRSVLLD
FT                   EGAGAAVEWLEKEKWANAPEYVRPRSKYYYFYEWMRERITDHFPALPEPIMDKLLAMDA
FT                   GELDLLLRYPKAIRGQVEEYLDVYRREGGKYLETYRTPQLSWEEVKALKGRDTIGLGPQ
FT                   NESGLMGMGVGGGGFDSCGNRIGPKKPMLLEDAEDVSDDEHTTDRAMLGAAGDEGLTEE
FT                   EAAGLVMNNSATSKRRDRRLAKYPNLPPDAQRDAVHRREARAAGDSKFLVGNDRATKGL
FT                   PQREIDPDTSRRVAAILGKDASPSTPAIGNAPKKIEVRDMDEMD"
FT   CDS_pept        complement(417075..419225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638576"
FT                   /orf_name="MICPUN_102650"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69983.1"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniParc:UPI000199C612"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIE9"
FT                   /transl_table=1
FT                   /translation="MGDEEAGETVADLPRFEADAEAIREADLRAAAAATSARGDPTGAG
FT                   APRLGNGKPRITTTAPWAMGARPAPPARQRRTAAPWAPPAPGKPGTSPEKRSGVGLGSM
FT                   SELGKSLPPHQSTTTAPLPPPPPPPQAFLDNCPGLSDRRSSLRVEAMTYGALFGGDGAD
FT                   DDGCPVVVPVFQRTYCWTDEQVAGWWRDAFQGGGRAAKPAADRLAHGTGRCLFRRVSDA
FT                   DDDGSEPRESLLCLDGQQRSTTTQLALAAVRDAALALVNAETVPRGADAGVPRGADADA
FT                   DADALIRRIEAALWVPGADADGWIRSAAAASFSSADLGASETPPFVEGAVPSELRFRLL
FT                   PSWVDRASFFECITAGAVHHRARGMDPGGDAHGESPGGESPGPKVRYSAGTSSTPMGRA
FT                   KALLDAKAADLVRAGDRVASIAALRDAVDAALVGTKLIYVEVKGDDVDLAQAFQWLQEK
FT                   SLFAGSILWNRAPGVDFSACDLVRNALVATTLRLPLREQEAWYRAMWLDPLQRRLRDGG
FT                   SPRAFDALLNAFLVAEDSRRERDGARIAVPRGAVAGLPRGAVATALAAADGTPVGPRYV
FT                   SATERDFGAMMESDAVPEKFKKGAGPGSPMWVYCRFRSYVEEVALGAAGVDPTSRRAKK
FT                   PAKPRNFDITTSAPPPEEDEEDEDEEKNSGTGDGDGMWGGVEGARDGGEDGNDAVLITE
FT                   EVTRVVLARVVEYAERNGHFAE"
FT   CDS_pept        419617..423096
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638577"
FT                   /orf_name="MICPUN_86086"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="ACO69710.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG317648"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000199C613"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF0"
FT                   /transl_table=1
FT                   /translation="MRAFDKGEIKPGVHHPDWVPDCLQVDPATLNAPIKTLKDKFELLP
FT                   AFLKVRGLVRQHIDSFNYLINEEIKKIIAAKANEKVTCDTDPNFYLKYTNIQVGKPSVE
FT                   EDFIVEEITPQQCRLRDMTYAAPVTVDVEYTRGKEIVTNTSKNGVGGVTIGRIPLMLRS
FT                   SRCILTGKSEEELARLGECPLDPGGYFVVKGTEKVILIQEQLSKNRIIIDIDNKGEVGA
FT                   SVTSSTHERKSKTNIVVKHGKLYLRHNTFTDEIPIMVALKAMGCESDQEVVQMVGPDTA
FT                   YASLLLPSLLECSALAIFTQQQALEYCGGKVRMATRMMYSRNKRSKVDEARDILAGVVL
FT                   AHVPVPAYDFRQKCVYVAIMIRRILHAMVDPTQVDDKDYYGNKRLELAGQLLALLFEDC
FT                   FKRLNADLKRQADAVLSKSNRATQFDIIKCIRQDTLSNGLEHAISSGNWTVKRFRMERK
FT                   GVTQVLSRLSFISALGMMTRITSQFEKTRKVSGPRALQPSQWGMLCPSDTPEGESCGLV
FT                   KNLALMTHVTTDDEEEPLRSLAHVLGVEPLLLLVGQELHSPGSALVFLNGHILGVHQDP
FT                   ARFASDFRLLRRRGRVGEFVSVHTTTGNVYIASDGGRVCRPLLIVENGELLVKQVHLDA
FT                   LKAGRWTFNDFLTQGFVEYLDVNEENNSYIALYESEITPETTHLEIEPFTLLGVCAGII
FT                   PYPHHNQSPRNTYQCAMGKQAMGNIAFNQLNRMDTLMYLLVYPQKPIVKTKTIELIGYD
FT                   RLGAGQNATVAVMSYSGYDIEDAIVMNRASLDRGFGRCIVLRKYGCTIKKYSNRTQDRI
FT                   VPPTPAQTGPNGRHRLLDKDGIAAVGEKISPGDVYINKQSPGNTRDPLPNPQAMPDSFY
FT                   RPTAQSYKGPQGESCVVDKVMLTTSDEGQFNVKCLVRHTRRPEVGDKFSSRHGQKGVCG
FT                   TIVEQSDLPFSERGICPDLIMNPHGFPSRMTVGKMIELLGGKAGLQDGKFKYGTAFGGD
FT                   TVTSLSEVLVEHGFSYNGKDLMHCGITGEPLVAYIFMGPVYYQKLKHMVLDKMHARARG
FT                   PRVVLTRQPTEGRARDGGLRLGEMERDCLIGYGAAMLILERLMISSDQFEAQVCTNCGL
FT                   LGYKHHGTGRNLCQQCADGGTVSALKLPYACKLLFQELQSMNICPRLTLSDA"
FT   CDS_pept        join(complement(425918..426148),complement(423187..425757))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638578"
FT                   /orf_name="MICPUN_106142"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69984.1"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI000199C614"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF1"
FT                   /transl_table=1
FT                   /translation="MPKPPEPRHHTATHYGAVPGFISSGHASDAGSHRASDAGSGNEGK
FT                   MPFGRGGATVHGDAVLANRKKPYKSLGWSLIAAAASGILIACMVAAAVIPYATVGPDHD
FT                   VSTDTENLMHEHMAFSFDSRASKGNRAVPNDEVAALAESDEPRVITVSLEDALKTDVEV
FT                   DSYKVTAPIDDARAASLDDQYRRESSRDPNAVVATVKPRVAPTLGSERHHSHRKASSSK
FT                   RSHHRKTEAGESAPEEKVEQPPRSSYKMPMLDWPREVNFNGEAMLAAEAERTGTIPDGW
FT                   PSKLVVVPAVYNEWDMPEGAAVVDVVPEWARPTYGKNKYTIGPLYQRRFESKPNFVPNH
FT                   SYETGVFLKFIIDNYDQLPDVTAFVQADFGSAVDDAMERLDAIEANAEKVTYQPLGVDL
FT                   AKDSKLGDEGAEGPVANPKPQMNYVERSPAELVQRWKALQWGWDELIHDEKMGGSVGHL
FT                   SRCWRHIAQQFVPTKTADSGDSVTEEEELKKTPVTVATYPGLNFAMSREQIKSVPREKW
FT                   RMVYDSLVIKGECVPRPAGEPRDDIRDKFDLAVTLEHFPHVVFGGKQLDDKDAGRCCGE
FT                   ECVLRDAACDAIAAAKESEKKHSKHSKHSKHSSRKGDDAELGHKSHKSHKNAVTSEHAK
FT                   ATADFIQQQFDADAMRFKAHMAEVASKLARYNGWDVELLTAVKQPPAEAEKAKAAALGA
FT                   APVSRDPIPELNSRKVTVAKAAAKTTTAEPTKAATAEPVQTLKPVTAVKEPVQTPKPMA
FT                   AVKESVKTAKKPKSAKAAKEDPEKPVDWDAVTDQAHKYEETERANRIREAAANQELIDK
FT                   SMFNAAFAAADKEVETAEKELKKDADRIKELEKKLAEAEAKAAQAEKAEKKYMKKYNKA
FT                   EKEAKAAAEFEEKFSARAAFPAAELAKAEGNEGAAAAREARIEARRQERIAERQVARAA
FT                   SRV"
FT   CDS_pept        join(426682..426708,426872..>427824)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638579"
FT                   /orf_name="MICPUN_61854"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69711.1"
FT                   /db_xref="UniParc:UPI000199C615"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF2"
FT                   /transl_table=1
FT                   /translation="MFGGGGAASPFGGGGTPAFGAQPQSSVSPLPATSPCRDLPTPRTV
FT                   NHATSASLRSAPDLSGVLPSIASQPFGAQPAAGGFGAQPAAGGFGAPAGGGAFGAPAAT
FT                   SPGGGFGAPASGGFGAPSSGGFGAPAATPTSGGFGAPSSGGFGAPASGGFGQPSPSQGA
FT                   FGQPSPSAGGGAFGQQAGGGGGFARSPTTSAFGAPSTPTAGGAFGAPTAGGAFGAPTAG
FT                   GAFGAPSSGGSGAFGAPAGGGGAFGQPAAGTGASPFGAPSQSGGFGAPAAGTGAFGAAS
FT                   PGGGGAFGGPASGGSGAFGAPAGGGGAFGQPAAGGAFGAPAQSSPG"
FT   CDS_pept        <428687..430444
FT                   /codon_start=1
FT                   /gene_family="HOG000200889" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638580"
FT                   /orf_name="MICPUN_61855"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69712.1"
FT                   /db_xref="UniParc:UPI000199C616"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF3"
FT                   /transl_table=1
FT                   /translation="APAASGGALALGASTGASGGLFGSAASAATTASSGLFGAAPSSSG
FT                   AAAASSGGFSFGAAAPASSAGAAATGAATAPASTTAGGLFGSAPASSAPAGGLFGSAAA
FT                   ASSTPAAASSGGFSFGAASAPATGAAAGDATKPAGASTPASVGGLFGGAGTAAGTTAGT
FT                   AAGSAPASSSAAGGLFGSAAATTTAAAGASAGTSLAQGTSLAQGTSLAGTSLADSKDAN
FT                   ADLAADKPSQLTTKVGLSAHLQALARMPSTLVPERELMAIAKAYNADPNNPDFRFRHFF
FT                   HNVTEPHHRVRPPGVDELKWRNLLEDVGGEHNAAGLWPVPGDGFKCLAERAAVQDAELA
FT                   NQREYLKAVQDRARDIERFRGAQLAERVQRVAKTHAELSHRLLRVMRKLEGAEGEYHAQ
FT                   QGGGGSELASGKGGSYPYPRSAPAQEGLNEHERELAARLRKLQGALGKSANSLPRRVDA
FT                   IAAAQRAEKAADAADGARRRPAVGSAFSDENGGLQVANRSPGEAIVGTPKDSLGIRGDG
FT                   IDDGTHAAPVDEAAAQAFDKIIAEQQEATRHLAEILRNDMRDIAVLQRERGEEVAKAAK
FT                   GRKFYQSYW"
FT   CDS_pept        complement(430541..431890)
FT                   /codon_start=1
FT                   /gene_family="HOG000244106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638581"
FT                   /orf_name="MICPUN_109013"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69985.1"
FT                   /db_xref="HOGENOM:HBG316370"
FT                   /db_xref="InterPro:IPR007255"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI000199C617"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF4"
FT                   /transl_table=1
FT                   /translation="MRASLPELRAGCQRFAGRAEEISRARALNRRTLAAQGTLLDLLET
FT                   PTLQETCLRHGNYDEALDLEAHVEKLAALHATDVPVVAELAEGSKRSSRVMLRQLLTRL
FT                   RGAIQLPECLRIVGYLRRMSALDEVGLRRTFLRCREGHVADAVADLDDGNAYEYLKRLT
FT                   DLHRVHLFDVVMQYRAIFGDGADADEDDGTGAEGAEGAEGADGGLLYGWSAHRVGEYLA
FT                   LVEKTLPRIDEGGALASVMEHCGYCGGSLARVGLDFRPMLPPLFADAARGIFTRAMDTA
FT                   AGEFERTVETHRWATAPSSAAARAKERERDGGDGDNISAPPYALLEHVPVAALTNGILA
FT                   ALNDLRHCALPQLRQPLADELRACVERCAHALMRVEARRFGRSPGEEDPDAGTRAAFTG
FT                   ACRALAEVAAPYLEGCYGRVFRGGEKLVDVRGAVAGLKSSIVSAGLRGLG"
FT   CDS_pept        join(432536..432661,432834..437780)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638582"
FT                   /orf_name="MICPUN_102654"
FT                   /product="Predicted protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ACO69713.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniParc:UPI000199C697"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF5"
FT                   /transl_table=1
FT                   /translation="MSSSAGLASRVATPAALRGSDRERGRRDRRSCVVVKARRGVSSLS
FT                   GEPYDRRGDVRRPDLPRLDAGPPLVDSPARYADDSDLASASGDVVTTMWLPMRDMGLGD
FT                   AGTDVGMLQEAFGLPATGVYDKNTSRKIAQWQAANNLPRSGYFGAASREVFARSAQMQM
FT                   RRVVVTSETYGTGAATHPVERPRRAPTTNIRVTVGVDPVGASGATRPPPHQGVASLLGW
FT                   SLGFTAIATGAIKIRDGVKRSASRKKTDLGYYASRRAAAQLAGAPRRTTTSDEDDVGYD
FT                   FNRRFTDQTPKRRPDAVVARASSSRHTPVSGDYSTFGHTADGRARRGAGAGAGGGAGGG
FT                   AAVSERPRQSAPERRGGSEGSAPLTGFASDWGEKLAGMSAGLIERSRIDKLVRSYKGSA
FT                   SGKGTKPPPQQQQQQQQQQQPAKVENNVVRAPVASPPEVDVDVEADAAEDETDEAKVPV
FT                   DAEERKRREMAARTMELQRAALERERVAREDREAAAAAEAAAREQVEQAEQAAQAERLE
FT                   QAEQAEQVEEATAEEDVESVEEEEPPMTRSEAEFEAMAALEAAAQAAADLQSVIEDDSI
FT                   DEEEKAFLAAEAADAAMTIMDEAREVVTTQSDIEKLEKFQRELEEREAVRRREQVKRYN
FT                   ENREREQREKQRIEREQREEAQRKIKEEREAKERDGRVGHAKFADGKKDEDVNFAQRVR
FT                   AASVDAERVNKKAEMTFEQKKEMDFAARVKAAMEQAQQTPDFKFGADSEDDEAEEDGPE
FT                   SEAETGKEPEPEPEKEVEKIESASAAVVEKVERKEQKTVKEKKVEEIAKKEEHPKVEAD
FT                   KGVEAEEDVKADKDVEAGEDVDDDGDACEDGELTLECLGMPDDDFADDDFFSRVEAAAR
FT                   EAEEMDLAERIERGEAVPTPTPEPEDDEDEKALAALEAEREWKEEEARQRRERKKEEDE
FT                   VWAAAAKAKQEEIAEQMKKAAEAEKEWEQMMAAADDDDVGAEGAKASAEWPIPGTAAYK
FT                   AREIIAPPPAMPPGLNGTDAEVDEEAVRAYFADEEKRKAEAKAEKEEEEAKAKAEKEKE
FT                   AKAKAEKEKEEAKTKAEKEKDVADKKDDEAPPKKKKGGKFAAMLDDDAVESDWKNRNKP
FT                   PASSLDKKKKEEEPEKKEEPKREQEPKTGQEPKTDLDAAQAKVDEKKAKLAELRGEPVA
FT                   PETSEEKKERELAVSRLVGDAIENVVDKLNVEALSDCDDDDYTDSEECAEDFVEPPEPK
FT                   GEPERKPEPPAEEPKAEAKKTELPPLPPIGTEERTYSLFGADPNAPREPEPVDEVSEEP
FT                   PGGWPASALLKPGEHELMTPGAGMGHAMDSSEIHPEDAGDHFFDSRVAQQLAKAKEISG
FT                   DSSFDEEDDDDLDFDERVARALEEADYRQRPVDSEGDADFIQSQVDAQLEEEGERAVEL
FT                   WSEDADHVGWETRQSLDGSPREPWFVKPEEHELGTQWDHKVLSVLSERYGPGYLGEGVD
FT                   PRFGVAAGWNWKNGGLKPSPAKLEMIAAYEGLEHISPPPFDFEENDEEIARLQRERNWE
FT                   KENPNQAALGVVPLMPGPPETGPPSPNKSWDADDVREHMVPPQRGKFGKQPDPPELYYQ
FT                   PTRDQLNEDQANETEAPEGSQTREQDVPETIVEAVEKKVEKKNGAAAKAEAVPFPEEGE
FT                   VGAGNRKSSFSPPAAEAVVKKEEKKEEKKEEKKEEAAPKPKKKGKWGALMED"
FT   CDS_pept        437941..439014
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638583"
FT                   /orf_name="MICPUN_61858"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69714.1"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="UniParc:UPI000199C698"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF6"
FT                   /transl_table=1
FT                   /translation="MTSRRQALTLLALLVALGVANAQISTVDPNTGGGGTGGGGTGTGG
FT                   GDASGGGAGAPAGDDAGAGDDTPPPPPPPPPPPQVTMYGSIPLVEGRDHVGPVSEQTGY
FT                   RYKDLQDVIDAAEADPRVETRDALVEKYGEFGEDTASNETGADGEEKEKPSPLSFLYGV
FT                   DESSAEFNKRLICRRGCVDPLLDVNLVWCAGVVNYAFCNRTITGPSEVSVLNMESGAIA
FT                   AYMSLSRKVPNTDSACKMMLRSWMCYEFFNRCNADGTQFYPVCYTTCQAARFACGNPDW
FT                   IDCDEEVEELEGGYPDEWRGPDGSYIRGLKPDGQMGNPVFEQDALRCTGGSGRRYGAAP
FT                   AFAAFVSSLVSVVLLVS"
FT   CDS_pept        join(complement(441788..442036),complement(439094..441649))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638584"
FT                   /orf_name="MICPUN_61859"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69986.1"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI000199C699"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF7"
FT                   /transl_table=1
FT                   /translation="MATAVAASNDVMDEYDPDDDPLFGRLVSLRVDEPGHSWRDGIVAH
FT                   VHTEVVDGIERATGVYMVVWGKFDRTEDVMRIPAKEREWSGKIDMVRMQMQGRLRILDT
FT                   KIPGERDPEPRNADPEQPTSDQAQSEPEALHVRTPQQSHPTAVTAAPATSSERETPSED
FT                   QEYDPDDPRGMSVRLRGWIDELHTFQKNTKGDRLNTDLVKKTIGYFLDRHLQKAEGIIE
FT                   EIDTRRWRLMEASSSAAARGGSVTMQRRRLQQLDAEAFEFLTEIASEAQKKFFQPLCRV
FT                   NAMMLVDYLRQKYPGDRDVQPGHEAARREVDWTALGRDAGSIGRHLGQSEALARALGGT
FT                   LAGEPSLAASPSLEDAEEQAVALSVRYARKHGVEPGEWSGGRRLMKAGNVRGMGRLSRP
FT                   ETVGKETDESTAEERLELLEREANARIGRLQRSLKDDGARDFKDCFFDPNSFAKSVEGM
FT                   LDLATAVHSGNAGIVPEEDRSKWRESIVGRVGPADGPPNQENYQTQTFVVQFDLKTFRA
FT                   WGGVDEEPDPNDAAEDDGRLVWMARDRDHYAALLDDDGDKAKAALAALCLNGDDAAVVT
FT                   AVAFIYREAMSDETFFQKWASGVLGKFAGWCAAAQAGPVKEITERAARRVAREWLEIYG
FT                   EVDPQWRSEDVNFVSEGLHAIRELGIECEDTRAALRQVAAKFPSDWYLRGVDSKKPSTY
FT                   KSTEERENYEKMTTALIWSYFLHDAGIMDGRCIKGDTLEDIRRLCETDVDLREHMPLDD
FT                   VRNAPDFDQLAYFVTHKVFNYSDWGRKRLDPVEWSVELDFLRDHIDHVRVKNGRGDVHL
FT                   CGEFVCCLRTFGLYASNDEKVRQAVEWIAAAQNKRTGGWEIRDHDLQNSFHATICAVDA
FT                   LITPTMDGSAPLGKVNARKAGVRTSKRQREREEEEERRRRRARKEAPTIRLFPWEQPHP
FT                   LEEE"
FT   CDS_pept        join(442191..442463,442602..444917)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638585"
FT                   /orf_name="MICPUN_102656"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO69715.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199C69A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF8"
FT                   /transl_table=1
FT                   /translation="MAPKVVETVEFDADIHPSRLGRLVKVRHRDEEGALSAWSHGVCTW
FT                   AETQWIEEEVPGGIRKVEIPTGGYQLQWGLFETVEMALQQKRSRQRFSDEKEPYYIEEL
FT                   MQLNPPLAAYTDLDDEHGTLDVNKCDDDDAPWIVAKREKDAEEREARAMMAKKSAEASL
FT                   LKAEAAKRREKDLKAKADAKRKKAQMLTAVAEKAKRRKENESRRKSFQNAAAAEYRGPS
FT                   ASFGETGETNDEEDAAYALLAALKGGDRGRDAALYSRRSEPPRKSKPRSERRRPVETVG
FT                   ESRGRAAKPRLNRRCMQCSTCLNPRLKKRCLGREEGFIEDEPEPARNEEDENSPEKLLE
FT                   EVERDLNTVVFPQENTAVVPQEVAAIHAARAAHIARLQESLAIRVAETASMSMPPPVKL
FT                   RHSVRPPFVNNEEEPPRHDARPAFVNNEEEPPRHDVRPQMFNNEEEPPRHDPTPQNVDN
FT                   DEDEEEEEPAPKRKRGRPPGSKSKPKPDTAPQPHHHQPPPPPINAPVNNQPVNDRPVVT
FT                   TPPSGSDVDELAHEPAVRPVPGLHGADRWDVNPLTGVDSATGRVISDVFAGGRPSSWLV
FT                   RLLASYMATDKLGRQRMCVIIAALEERQHNFAERLIHDLNLEAQPGKSGDPIVAAWTYR
FT                   LLQYAYVRQGEREGDALKAGEIAEKMEREIRAAQEQHSWNNITGHGGELPVGGWRASDG
FT                   PRSSTAIATAGSAGAVGIVFDLIMSGILGKRPTKEDWARISHNAHAIAMQHPNDALILQ
FT                   LYGGLLWRRGEMRAASMVLMKAYQHDGQQARAAPWAFETLLLMGDKESATAMYERVHRF
FT                   NPAMSLRLKRIAESTISAVEARGPWPESLQDQNQQYHPGAIERFADRARA"
FT   CDS_pept        complement(444985..445698)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638586"
FT                   /orf_name="MICPUN_61861"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69987.1"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="UniParc:UPI000199C69B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIF9"
FT                   /transl_table=1
FT                   /translation="MGRRYVLLLCILASLQTVGAQLGDTTGVDDGTNNQAGTKKSVEVN
FT                   SYFTEFTRVGPYPYQVCADLPGEIGETDATKSARCIPVEAGELDFCSAVAYDTCSRVIS
FT                   PILYDEQIGKSHDERIARWELEFPALVTTECTEAFQLYFCLLAFPRCEEDTDNLGSFLE
FT                   LPLCFDYCVNAHMACIGDSLLSQAACDKAVVLGRVAPPRADVTCVSGARSLGASMVCAL
FT                   ALALLSWFASERGSY"
FT   CDS_pept        complement(446022..446498)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638587"
FT                   /orf_name="MICPUN_109014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69988.1"
FT                   /db_xref="UniParc:UPI000199C69C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG0"
FT                   /transl_table=1
FT                   /translation="MAAYNHQAGTNPDLVEGTTPSSATEGFSHIWPGTHLGLTASDIAE
FT                   VRFYCHTSNHNRVMHFSVNNDWIKTAILTGSVSGNSVSYWTSGTTKLAGHTAKLPDSTT
FT                   HVQSSSGFGLLDVPFYEWGAGHWRLRDNTGGQNWECDDYSAGTTSHQVWIKLAE"
FT   CDS_pept        join(452353..452550,452685..456296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638588"
FT                   /orf_name="MICPUN_102657"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69716.1"
FT                   /db_xref="UniParc:UPI000199C69D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG1"
FT                   /transl_table=1
FT                   /translation="MAPKTASMSGGDSERAGWGSRGPVATLVNELIDVLRPTEQSDRRR
FT                   RGVFRHIASLVDGCFAGENVLVTAFGSVPLRTYLPDGDIDVCLLGPHELLSRDDWTVRL
FT                   RAHVERAEAAAAEASIELGSPVAEFAVSEIHIIHAEVKLMKLICDGVVVDVSANQFGGL
FT                   AALGFLEEVNAFIGKGEIFKRSIVLIKAWGFYEGRLLGAHHALISTYALETLVLYILNR
FT                   FHKELSTPLEVLHKFLVFFADFDWDKFAVSVHGPVPLEDLHKVTGPIGKRPEVHAEGAL
FT                   LTPDFMWRMMDKYGNESVSAKLGGGADSTPRPMARKYLNVVDPLLSSNNLGRSVSQGNA
FT                   KRIRKALALGAQRLTALRESSTGGECFGAVRMLEQFFGNTMRHRRLGPMPHLPMAPSTP
FT                   GFAGRNHADEVSMTPARCPRTGAVSVLASPSSPSQYQSPLPRSVDGQPPGSASSRMATK
FT                   GTEAPAARTRRKTPVAAGEDGGEEDDGAEGGVDGSVPRRLEMGSPEKRGGGGGGGSDDA
FT                   ADDHWPHLERGGTRCPVLQRAENAARAEKAERDLHGEERGPFWGRWDPLPASEAIAQHA
FT                   RAFASEGFPALDGREGTKSTRCPVLAAAAREEEEVVASAIPSGCPFHAAAARRRDSEAA
FT                   RSDGSSDESSKEAKSASPTGPLSDGDGEGGKGDVSRVQGSEKAPAAPAAPPPPPGPPPP
FT                   GQRTSMDGARARMRREMSCPTFFPEHERRVPPPPPPAPPVKPGPAVLPAGSGSGGVSDV
FT                   FTGDLEAIWSHLQFGRAYHHLAIVQMRAFEAMGGDPRALQQHRFGGFNNGGGGGRRGAG
FT                   GAAAFNRRNSRDGGGRGGHARSGSWGAPGGGGGKPGQPPPPPGAPTLEQYGQRRPARQS
FT                   RQSCVSEGSDESSEDASRKPGAVHHHQQQQQQQQGRRSRDGRGGRGGGGGKSGGGSSIV
FT                   EEAPAGNWSKAVSSKTSAAEKAPGKVGDRDRNADADPPPLPPGPPPPGTRTSMDGSGPF
FT                   ASPPPPPPEQPRPSWGPKKTAPIDAIRAPPTPPPVPAEDPASPPREATRSRQQRPPTAA
FT                   EGRAAAAKGRLGVAPKGSWSSLVAAGGASGSSGPAEGGFAERRTEIRVVGRESASAPPS
FT                   PARPLAGAWAKGNGKDVLAAAAEASRAAAAAAEASKVAAAAAAITVAELGGRDAAAGGQ
FT                   GAQVAQGRSRASSSSGDSNSGEKENSAERKADSTAPARDGDDDESYTHKVEEFPTLGGV
FT                   GDGGGGGGGGGEKAAVGVAWGSGENPWSNRGGSTRLQTGGQPAT"
FT   CDS_pept        456573..457994
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638589"
FT                   /orf_name="MICPUN_61864"
FT                   /product="Predicted protein"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="ACO69717.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="InterPro:IPR009730"
FT                   /db_xref="UniParc:UPI000199C69E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG2"
FT                   /transl_table=1
FT                   /translation="MSGRVAKDRDVRVKGSNPAWLDRDREDRGGGGSKVAAKVKRYRAG
FT                   QAPAWAPGDDDGNESDGEEEELGAFAAGPGRRAPARAVVVKPARGGAGGAEPGERKVAA
FT                   PVVIRARPAERTKEEEEIAAENDRRRAEMRARALAQQQEEEEMPYESEDDSFGAGMEPD
FT                   PPPAFDGGVQRAAPRPKSGIEDEEEEEDEEGSSSWETDTDASDSDEPTGRKMIKPVFVP
FT                   KRERDTVAERERVEAEIDAEWDGRARQREIRVNESRQLAQIEVDRENQIEEAEANAEVS
FT                   DVDTSDEADPEGDYQKWVIREMERMRVYEEQREQWEKEQEELAMLRAMPEDEKEEWLRK
FT                   NRPELYAPKAEKERKKMNFMQKYYHKGAFFQEAPDDPFGTAGTDDIYKRDFSVATGEDK
FT                   VDKSALPKAMQVRKDKFGKVGQTKWTHLSAEDTTYAGRDKGEFNAWADKNNPNLRKLEK
FT                   KRAGMKGFEVKKHLE"
FT   CDS_pept        <458323..>458883
FT                   /codon_start=1
FT                   /gene_family="HOG000196670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638590"
FT                   /orf_name="MICPUN_72520"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69718.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398383"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C69F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG3"
FT                   /transl_table=1
FT                   /translation="DAWVARGVLTPGECDAIRAAADARGYSHATSRGARYGEADRDHGR
FT                   ASYDDAALADAIWERTGLGEALVPILGPSGDSSPAGLNPALRVYRYAVGEVFGAHYDES
FT                   TDVAAGGHTEFTFLLYLTGGVVGGETAFYRHALLARDDAKETFRVAPELGKALVFRHGT
FT                   RCPPHASLAVERGTKVVLRSDVVY"
FT   CDS_pept        complement(458936..460456)
FT                   /codon_start=1
FT                   /gene_family="HOG000264476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638591"
FT                   /orf_name="MICPUN_61866"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO69989.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG557136"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199C72F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG4"
FT                   /transl_table=1
FT                   /translation="MSLCARGLVGSALRALPRRPVRSSRDATPLGTSGGRRRARAFRGV
FT                   VSAASPGDAAPASTRAVAPPWKDEVLESHSLLGNVCFVLCGPQGPQNVGSVARVMQNFG
FT                   IYDLRITDPGPFVLAGGGTRDEDATPADGASSSGGINSGAALGPDGLGSDLPEALRPTR
FT                   IDSGGNPADDPASPAPPLCDEAYRFACAADWLLADAKRCDTALEAISDCTFVMATTARP
FT                   RGNVPLVTARVAAEMLAKEAKRGKVAVLFGNERTGLTNEELAQAHACVAIPTAGQGTLC
FT                   RRSLKYTGGTGPTSLNLSQAVGVLAYEMFMAADAANGVGTRGDGDGDGDGDGECAPKGV
FT                   NAGRIDLPASQLMTVGEKNTLLNELLAARRSLDVLPNEEADDDASSYSTAADDDDDLDV
FT                   REERGIERVLNSSPLARRDAAALFQLARRVRAAAKEGDAAGAGGAGGSSSGLLDAAVLR
FT                   AVAEVEGTPTVRKARAKIRERLGVSLTNREIARAIRRAAAGATPASSE"
FT   CDS_pept        complement(464917..466239)
FT                   /codon_start=1
FT                   /gene_family="HOG000100089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638592"
FT                   /orf_name="MICPUN_109015"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69990.1"
FT                   /db_xref="HOGENOM:HBG557137"
FT                   /db_xref="UniParc:UPI000199C730"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG5"
FT                   /transl_table=1
FT                   /translation="MPQLSTFTRRLRAFLGLPHDNGHFTCHPENLKKGERLKVPGVVKR
FT                   DAQDRSYVDWSESAWQEVDRDGFLDLEKGVTGETHFADIPRKTIDSRLSEVEEKVWRAA
FT                   NAAEGDETALSVSLAEDVWHLLTVDLSIAKLLLLEATVELFMIVSFAMLMFVVDIAESF
FT                   TDDQTKAELFRSKLMLSLTAVRLSTDSIFGWTGRRASSGIEVAILALQGWFHWLLLSIA
FT                   GAVIVARALKPLRQVIFAPDACLSDQDLSVRMQVIRHSTVTLYNLQFTMNLVAKGGKAW
FT                   TLPMSVPTLARWTSAMPLTIKHEIDENSPLHPSRGLLQALMYVRVSMSATDNHGIPVNA
FT                   GIVYYDPDSFFAQRPAFSRAFAKQGYLFPRLLRGKKFCDQMRMFRDEHMNMIKPETLPM
FT                   LICDLDNMPRTKVDEKATEALAPYQHSNAVNKVVTFEGKRP"
FT   CDS_pept        466402..468027
FT                   /codon_start=1
FT                   /gene_family="HOG000264654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638593"
FT                   /orf_name="MICPUN_61869"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69719.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557138"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000199C731"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG6"
FT                   /transl_table=1
FT                   /translation="MTTSRATTQPALATTASRLERFRTRSLGAFPAGEQGRMMGCRDVD
FT                   AGLSRRRARVLATASIKPLDPKYDRPPDLKIAVVGAGPCGLATALALRHHGFGDVTVFD
FT                   RFPEIRPALGAAFNLNGGAAVLDKLGLLPEFRAMNNPMRLVRSRRVDANGGPLDRLEIM
FT                   TVDVPKIIADDPVARDALVSATDGEPLCGTVMRADLLRALADALPPESLMLGREVTGCV
FT                   TRPANNGPGDTAGSAGRSVAALTFRDYPDGKETTEFFDLVVGADGIRGVVRESTFGASP
FT                   PKYGGIRIIFGCTAEGDSEAVNARPQSEHGEAHQWFGDGCYALVYTAGGERNKQHNVAV
FT                   CIADETETDENAEWRVNGGRSSSSKGKSDPAAARAACMEALERYSMPPEVVAVAERCER
FT                   FFDVGVHYHDPMATWSDPRGCVTLAGDSAHAMPPFLGQGANQSLQDAWTLGEKLGKVRL
FT                   AGRGAAVDAVAGVDYYGTVAQALAEYEETRKGPTSAIMLSSRVIGFVETGRGPVGWVRD
FT                   VAFGVLGAAGIAGKIFLKNAVPVL"
FT   CDS_pept        468145..469404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638594"
FT                   /orf_name="MICPUN_61870"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69720.1"
FT                   /db_xref="UniParc:UPI000199C732"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG7"
FT                   /transl_table=1
FT                   /translation="MASSAPSRRAAASLLASLRAVTPATRCPNPAVPSTRAFDRRGFAS
FT                   WASTPSPASGVAWMTSRVKELKDAARAQMDAAKVAPERLKSAARESVRRRLASALGPRA
FT                   AESIMSGTLSLNPATHARNLTLRARAFRFRHRAPIAAVAGAGATCATYGAAVGAAERLR
FT                   GRGDDDAQRLDATSKLATLALSAGCVAAAATYLRARSRVDPERVHAAVMRRLERHPGLC
FT                   EVLGAPLVSSEHRAVVTTGGVWTSRTYTPRFRDAKVHMAFRVAGTRKLGLVTVEAKKRK
FT                   AWGGGVRASWHHFIGGDPHEYALVAVDVAADNGDEHRVYLAGGSERYAKQGEVTGMHMR
FT                   EALVSVASEAYEAEQRGEEAEEDERLRREKAEARAESAPKPLDKGGGMWPAERVTDYVA
FT                   QKRHEAARFVTKLGVADARK"
FT   CDS_pept        complement(469548..470003)
FT                   /codon_start=1
FT                   /gene_family="HOG000260803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638595"
FT                   /orf_name="MICPUN_86059"
FT                   /product="Predicted protein"
FT                   /function="riboflavin kinase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO69991.1"
FT                   /db_xref="GO:0008531"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG735449"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="UniParc:UPI000199C733"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG8"
FT                   /transl_table=1
FT                   /translation="MRGPVVKGFGRGSKMLGIPTANLDVSPLKLQADALAPGIYFGWAA
FT                   VAKEDRRDVGGGVYRMVMSIGWNPFFDNAKKTIEPWLLHEFGGDFYDQELRLHVLGYIR
FT                   PEANFTTLEDLVKRIHRDAEVAKTCLALEEFAKHAHDPFLVEGLVPN"
FT   CDS_pept        complement(<470071..470471)
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638596"
FT                   /orf_name="MICPUN_76552"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69992.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C734"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIG9"
FT                   /transl_table=1
FT                   /translation="MPGAERLLALLRRHEVPTALATSTPAKYLSAKLASHPNLLEHVAC
FT                   VCTGDQFPLGKPDPSIFLLAAERLGVEDPSCCLVVEDTPLGCQAAKAAGMRVLAVPSIQ
FT                   NHDLYTGHADELCRSLYDVDPTRWGLPAF"
FT   CDS_pept        470992..473541
FT                   /codon_start=1
FT                   /gene_family="HOG000191711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638597"
FT                   /orf_name="MICPUN_61872"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69721.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG736934"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniParc:UPI000199C735"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGW6"
FT                   /transl_table=1
FT                   /translation="MSGKKADDGARALSGKEKKEFDNVVRCYETKQHKKGLKSADFVLK
FT                   KFPNHGETLAMKGLILGNMDRMEEAHELVKLGVRNDMKSHVCWHVYGLVHRADRNYREA
FT                   IKCYRMALKLDEGNSQILRDLANLQIQVRDLADFTETRRIILKDRAGARQNWMGLAVAK
FT                   FLQGQHRAAVAVIEKYEDFRAEERGSEPNLAKYEVSEMYLFKAMILEEAGAHEEALAVL
FT                   DKHSNKLVDVIGVLEQRARLYTALGRGAHAEATLRALIAKNTENHGYYRQLEAVLGLVD
FT                   GDVAKLEATYDALAVQYPKSDAVRRLPLDFLSGDSFAAAVRKYVVGPIRKGVPSLFRNL
FT                   KSLYADRAKAAVMGEAFKEIVKALESSGKFPGSDKSEADVAQCLCYARTLLAYHEDKVG
FT                   DVEGALRTIDSAIASTEPKVLECYLAKASFLKHAGDVVGAMNVANEVREMDRADRYLNS
FT                   YCVKRMLRAGEYETAEKTVALFTRDGNQASNLFDMQCAWFENEAGRCHQRGGRKNRALK
FT                   YFTAVRKHYDDMEEDQFDFHQYCLRKNTLRHYVQMLRVEDTLYSRRAYREAARGGVEVY
FT                   LDLFDNPLPDPAEEEEKMLAAMSKEERQAYRKKLKKAEEKKAKEDAEKKAREEKEAREA
FT                   EKDGKKKNQVKRKEDPDPNGDALLRTKAPLVEAERLLEPLLRHAADFEDTHLLAFEVFV
FT                   RKGKLLLALRACNAAVRCSPSSFAARRNVAHLAAIVSSSDAAVKTGAVKTVLHDGVKTL
FT                   TGGATAVAYAQALVAEARFTLEGALAAEAVKLAGGDAVAASAKVGDLEVPRSVDDAAAA
FT                   VAALERVGAGADALKAKLAVAFPYCEAFGGAKATKRA"
FT   CDS_pept        join(complement(474236..474373),complement(473626..474117))
FT                   /codon_start=1
FT                   /gene_family="HOG000241980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638598"
FT                   /orf_name="MICPUN_109016"
FT                   /product="Predicted protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO69993.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG379179"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000199C736"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGW7"
FT                   /transl_table=1
FT                   /translation="MGLFNNWFKSREDKLLDQIFNLKFTAKQLARTAAKCEREEKALKA
FT                   KVKTAIEKGNIEGAKIHATDSIRKKNENLNMLRLASRLDGVVSRLETQHKMNMVNKNMS
FT                   VIVKSLEQSLKDNNLEKVSENMDQFERQFENLDVQTEFVEQAMGNTTAATTPPEDVAKL
FT                   MQEVADEHGLEFAANLPEANQEALPEAPAAQKEDDLSNRLAALRAR"
FT   CDS_pept        479147..480577
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638599"
FT                   /orf_name="MICPUN_109018"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69722.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199C737"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGW8"
FT                   /transl_table=1
FT                   /translation="MPLTDFKKLQRLIGGGSKALLPQSVIVRAFVVRGKNIRPLDPSGL
FT                   CDPYMKVDLLGTGKRFGNRRDHVKETLAPWFYKMFQFTTELPGSSQLQFKLYDWDKNGG
FT                   DDVIGVNTVDLEDRWFSPIWKSQFSETPPLELRTLLNNDATGSQGSLELWVEMYEADEN
FT                   VPRAMKIAPPPVIDVELRVVIWRARKMVIKDIGGNNDLFFKVGLVGLDHKQTRFGQVQE
FT                   TDTHYFASDGKGSFNYRIIYRFSIPVTKAKLRVSAYDRDLIGSNDNIGEAILPLSGMCN
FT                   ELMRLIQAAPDGELSGNAEVKMDAKNQKHAPPMPKDPPFLSCGEDGVSVNFPSMDFGDV
FT                   LDAGGEGHWSPLYHPSKDDRKQGEVEVSLTLLPVRRADQRPVGKARDQPNRDPELPAAI
FT                   RAKLNPFDPIGSLITIMGPNMARNIILALCILACLAVCCSLAVFIINDVLSAYINIAIQ
FT                   QATGAGGGMMPAGGGLGK"
FT   CDS_pept        complement(<480787..>481668)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638600"
FT                   /orf_name="MICPUN_70649"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69994.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C738"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGW9"
FT                   /transl_table=1
FT                   /translation="AWRSLLFGLDGWRNYLKSGYDAAAKRFDDAPFRRDLTGVRALVTG
FT                   ANQGIGFEVTRQLASQGATVTMVCRDRSKGEAALERLREERLAGSLALSVCDISNQHAV
FT                   KALVEGIVSTGDPLNILVNNAGCMVHQRTLTPEGVEANFATNTLGTWALTEGLLPALRK
FT                   ADAPRVITVSSAGMLTERLATTDLEWAPGGKLGKFDGTRQYARGKRHQVALTEHWSRRG
FT                   GNESVLFVSMHPGWSDTQAVRDALPGFYSSLKGKLRTPKEGADTVSWLCVAPKDALEPG
FT                   GFYLDRRTVPKHV"
FT   CDS_pept        481821..482927
FT                   /codon_start=1
FT                   /gene_family="HOG000091642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638601"
FT                   /orf_name="MICPUN_85903"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69723.1"
FT                   /db_xref="HOGENOM:HBG621401"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C739"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX0"
FT                   /transl_table=1
FT                   /translation="MGGHGGLNILGQKSWNVYGQEQRAKVRRDEEEFAASNEDPDAGAV
FT                   PVGASGPAPRPAGHVGELPTAHHVTLAGHEGPVLAARFSRGGSYALTCGKDRTFRLWNP
FT                   FRGTLIKTYEGHAHEVRDVACALDNSRLATCGGDKQVFLWDVSTGQKIRRFRGHESAVN
FT                   AVTFAAEDQVVISAGYDRSVRFFDCRSNSADPIQSVVEWSDAVTCVVTHGGGCRVTGGG
FT                   VDGSVKTLDVRAGRIHSDDLGRPVTSLAVSGDGQCLLVGMLDGRMCLLDASDGSVMAEY
FT                   RGHVSATAKVDARLTLGDGHVVAGSEDGRVVFWELVDAQVDIELEAHPGKCVCGLDYHP
FT                   KRHAMVTSATDGTAKVWLPEGVAGTSFD"
FT   CDS_pept        complement(483009..486647)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638602"
FT                   /orf_name="MICPUN_102665"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69995.1"
FT                   /db_xref="UniParc:UPI000199C73A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX1"
FT                   /transl_table=1
FT                   /translation="MGLVIDDEEAEAAEKAAKAALDADAPWNAPDEDPPPGTAGEDAEP
FT                   ELDAEGNPVERPAPVDYKGIAKRLAMATTPAEGEDEVDHLKLVCDACDDIRALDIVAKD
FT                   GYDEMASKIKHFRVVELLFRHLRAMPAPLPPTPEPELDDEGNPIEPPAEDDKENERELT
FT                   AEERKAAEAEAEVRAKWNAVGMPCARALAHLVSVPGAIRREVTDSPYHTRALFALCDPA
FT                   PFPPRDALALSDVALRCLTQLARGSSPFAAAVAAAACGDDPALPGTACTWLTRMCALAP
FT                   PPKTEAQLADEAEREAEELQKKEAEGDAYVPPPPQPPHPRWRVAAKAMRLATALARSPS
FT                   HRARIMRVVEPARTPITVESLRAEREAAEKERDGETKKTKAAKDSEEPADILKVALECA
FT                   TKHPTREEPGDKTARMLALRLVRLACADASEALCRIVDGEDLDGIAKLMGTVTSAEEDP
FT                   DVRTEAAAAMLAALTKDKRAAEDFGDRNALAALRSLMPTISDEEPELVIPPPEGGEPAK
FT                   ETPPEETPAEDDDAGDGDGSDDDVSVTGENLLTEVFGLRPIGYVTPPPKPKPFRATRDP
FT                   LPLASQPTTHPALYPTLLRLLACVVTAHDETRRSIADKCGYLLTYREKMGKPPPKPDDY
FT                   DTLVRWCVTALREAVEDADPATEPPPRMTEEERAAAAEAEAAAEPEPESEPEPAGEAEG
FT                   EDGAGEGDVESDDEWATESVETIVPPEPDPETEEEKAARLDLEYRTWHAIRDRHAADYD
FT                   WHNPEVYAAVIAVFNALSGEEAVCKSILNEEFYPGALERIIEVIPRSFATIEEGATFVT
FT                   RVCEKGAYADVALDVEESMRRRVDLVEKLKAIAGCLAAPETGRMHRGRVATLAHEAALV
FT                   MLPLREYLPSIGVRPVPLAAEYHTVPTPPTNPMRTWRLKMTRNVDKERVDAECRVLPLH
FT                   TTLPELWLQVDPSTGEPWEHAGRKFARAIGELTHPVVVPDPPPEASGDGADTGEPAPSA
FT                   ATFDAAVKAVADAEAEKATGPRRHDPPPKCFFAALRFITTVIGEGDAFVQPPPPELPEP
FT                   VEGEEPPPEPEPQPPLDEFHRAMWRDPESAPRALIAADGALSAKMKTWLEENIAYADKD
FT                   VMGGPDPEAPEVIKTDKVLVADARAVLAAKETALPGIYVEDARKEGEAAYAMVRWCYSV
FT                   ARFCQLAAERRARRLERRTERLRLKRELEKEEEARRLAAETEAAAA"
FT   CDS_pept        <487477..487704
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638603"
FT                   /orf_name="MICPUN_74512"
FT                   /product="Predicted protein"
FT                   /biological_process="apoptosis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69724.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniParc:UPI000199C73B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX2"
FT                   /transl_table=1
FT                   /translation="KACKNCSCGRAEAEAEEEAGKRAAMTEEKKEEFKSSCGNCYLGDA
FT                   YRCAGCPMLGQPAQAPPGSTTVKLDLTSDI"
FT   CDS_pept        complement(489486..491264)
FT                   /codon_start=1
FT                   /gene_family="HOG000278176" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638604"
FT                   /orf_name="MICPUN_85926"
FT                   /product="Predicted protein"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ACO69996.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG735114"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="UniParc:UPI000199C7C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX3"
FT                   /transl_table=1
FT                   /translation="MFASAPVALKVAAAKPSGARARSARVVTVRGSIAEGAAKTSAAQA
FT                   GDRQKAVVVGGGVGGLGMASRLAHAGYDVTILEKNEDTGGRARSEFFGPDADASGWRFD
FT                   TGPSLMLLPDRYREQFTAVGKKLEDYMDIERVDPAYRAHFGDHTTLDLLYDTEKMRKQL
FT                   DDVEFGAGGRYIDWLGRARASLDYGVAAFIERDANSILDFVDLSRVGPLALAVNPLDLL
FT                   LPQFNQMAKYFKDPRLRALFSYQELYVGLSPYNAPGVFSLLAATELTDGVWYPKGGFDK
FT                   VRGSLKQLCDEEGVEIRTGAAVDAILTEPLGEGPSQIAGSKATQVVRGVRLANGDVIEA
FT                   DVVVANPDLPCVWDQMIDKETFPEAKKEAERWEDAEYSCSVIEFNWCLDTQIEKLLHHN
FT                   VFLSGDYEGSWVRPCVVSDFDAPKQHNFYCHNPVYTDPTCAPAGGSSVMILLPVANINE
FT                   QARMCKKRGLPVPTEEEMVNAGREAILRRFEEAGHGDLRKHIKHESVTTPSQWRERFNI
FT                   KHGAVFGLSHGLTQLAAFRPPVRTGIGALDSPECDGLHFVGASTRPGNGVPLVLMGVKV
FT                   VFDAIMKQHGAGVKAR"
FT   CDS_pept        492275..492628
FT                   /codon_start=1
FT                   /gene_family="HOG000019780" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638605"
FT                   /orf_name="MICPUN_109019"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69725.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG704211"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI000199C7C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX4"
FT                   /transl_table=1
FT                   /translation="MISHGNKVARLHRPADQRKALLRNLTTDLLRYGRITTTMARAKAM
FT                   RKPVEHMIQLGKDGGDHKKRQAEAYVYDKELVAALFEQAPARYADRTGGYTRIVRTLRR
FT                   RGDNAEMAIIELV"
FT   CDS_pept        join(complement(494961..>495076),
FT                   complement(494172..494814),complement(<493500..494099))
FT                   /codon_start=1
FT                   /gene_family="HOG000006022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638606"
FT                   /orf_name="MICPUN_66594"
FT                   /product="Predicted protein"
FT                   /biological_process="cell proliferation"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="ACO69997.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG410102"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010613"
FT                   /db_xref="UniParc:UPI000199C7C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX5"
FT                   /transl_table=1
FT                   /translation="KVKGGIASRYTTRNQALNRLQLKLADFRRLCILKGIHPREPKKKF
FT                   KGQHKTYYHVKDINFLAHEPLLEKFRDLRSYERKIKRARAKKAYHAVDRLEEKKPKYGL
FT                   DHLVKERYPTFLDALRDLDDPLTLAHLFAVLPADKRHGIPAEVLLESRKLSLEFQSYVT
FT                   KMHALRKVFISVKGIYYQAVVHGQEITWLTPHALAQTLPEDVDYRVMLTFLDFYTSMLG
FT                   FVNYKLYFDQGLRYPPVLDTRLEDAAGGIVASAQAKLTESRLATLSDKLAQIGDGEVDE
FT                   EAEAEAALRAERSDGEDGDDVEEEDELERAISLSAGGDPTAREDAKLCATLFKGMVCFI
FT                   QRECPRDMMVFIIRSFGGEVCWEGEGSPYDESDGGVTHHVCDRPMEGKMLAQREYVVPQ
FT                   WVCDCANWRILIPCADYRPGIVPPPHLSPFVSKDDEGYTPDYQATLEKLQMQAK"
FT   CDS_pept        join(495849..496556,496744..497760)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638607"
FT                   /orf_name="MICPUN_102669"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69726.1"
FT                   /db_xref="UniParc:UPI000199C7C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX6"
FT                   /transl_table=1
FT                   /translation="MRGGHGDAAKRQVADVASSRGVGNGVPDKFADYARFDDMFGASRI
FT                   FTDGTARQRKKETEMYVKDVMERRVYGYTHDLRMHGEPLLRIPVGAPLDEQPSSRGKEN
FT                   PVAREDDRKRRDLEGPESKATGGRKKARMSPGAGAFAQGAGVKPSPRAGAGFGVGRGRH
FT                   SDVNGITASLFEREDWETDPLWAAMEEAVANGGVGSLEELPLPGSAMRATALAPHPTNF
FT                   DGEFMQRSRFEEIEERIHNLENSLALARAAAGTERHAPGSLPVSQTAADAAAAAGGERA
FT                   RGEFGSDRGSGGKSPQSPSPHNWAPMNPSRSSDLICDAATGRIGSGGGSGDGARHAGGG
FT                   GGGGRRSNSFTSTPGPKHRVGSVMLTESHPTHTTGGAFIDEDARALAMEYERLREDRDA
FT                   NRREHELLRTEFEHAKSQTALLRESNRNYEARVEQLERLVRECNAQTSSLRSQLAEFTA
FT                   AGGLGGSQAGGWVPPAPITTVKATSRSRGSGDPNSAGATPRVPTPRVNFEVNHINTQTQ
FT                   AQNNPGQLKRVGSCFMSGTAAAAAARSVSLRPSLAQVSPDSSAGEFDGVGHLHVGAR"
FT   CDS_pept        498045..498941
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638608"
FT                   /orf_name="MICPUN_61883"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69727.1"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015451"
FT                   /db_xref="UniParc:UPI000199C7C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX7"
FT                   /transl_table=1
FT                   /translation="MEQVASAMDAEPRRMDARDTSAALAALLRAPKHREFPSLLARTGD
FT                   EVRAALDAERHHHALMQAARPTLHQAGQLRGVLVEGIVKNQIVFKLSTETTSLAVSYLD
FT                   VFLGSGKYSVLPEQGWAYHLVANACMTLAVKFQEPCDPTDPRPDAAAIQRHVDVAFDRV
FT                   CVQKMESLVLQELGWRLSPPTPASIIPRLLILLGHDPTDDEFADICGRTDVYALAILYD
FT                   VNFSSRRATCVAAAVVAVVLEDREGYDRDEVIRAIVRAFDDPGGIGEEGIASCARMVDD
FT                   FRAALSSSSAGDAIVGD"
FT   CDS_pept        complement(<499168..500513)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638609"
FT                   /orf_name="MICPUN_53737"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69998.1"
FT                   /db_xref="UniParc:UPI000199C7C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX8"
FT                   /transl_table=1
FT                   /translation="MAMQEETPWIVHTLTVPKGLVAAAGAVAAKRAVVREQERLARESA
FT                   RARGEPVYGTRNYDSEDDSDDVDTPGGTSRPDTAARAERLLARMGSATTRSSSPAAKPP
FT                   APAGPDVEKLRELRQRLEEAEEALNENAKRGSGVGGALGQNAMQESEVIRIPWEELRTN
FT                   QRDAAKIVSRVAQHGGEACAQISVKFKDRYLPVFVNFHFGWSYRMANTITKGAPLGEAR
FT                   DQDMTTKDTQFQMEGWPLDAYTMVFATQADALSYAHWHAHIGDPASPSLMKAAGAEFKL
FT                   TEVACAKDMDYLAALRCRVARSLVTSEPFGLSAQLCCAHMGVPMLTQTLQDANSMLQYL
FT                   VGASEAPEDLLVKLDTRGARTALLEYLDETEKLLTSPSLSYHLGANRIMVKNLATLRKA
FT                   ESESSGILGDEPLEKLREVNTWLAVSETCVTRGLYMITLKRDEVVEIKR"
FT   CDS_pept        505125..506480
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638610"
FT                   /orf_name="MICPUN_109021"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69728.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199C7C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGX9"
FT                   /transl_table=1
FT                   /translation="MGVSLELDVAWPGRAKIKLNAKSSVLGSIIIAVKDVEVYAKVRVT
FT                   LQPLMPTLCPFGGLIITLTEKPAVEFDLDLPLGLEGTVTAIVEDFVEKLLSEILGEALV
FT                   WPERIVIPIADEEEPLKIPNGETVTHQWYVDNVLTLRNTGLVCVTAKRAENVVGTDLMS
FT                   KADSYVRMYVKSKGKGKTNTEVIDNNNDPTWNHTVYMLVDDMNERKLTVAVMDENSPLP
FT                   DVVIGEKVIDLKSLNLIPNESEEIWIDFPETEKRNRSYKRGPMRLLLDVTYIPFDATAA
FT                   SMPLSPETMHRTRSATLAKLKGIGMLTCVLVKATGVKAADRSGTSDPYCKLSMPPGLEP
FT                   GGKQNGKPIKHKSRVVDKTLNPEWNETFEFVGVKESGVLTVECYDRDVAMMGMGKSKDA
FT                   LGVIEVNVMEDVIKAATANEWGLTEVEREFALKGDKTITGTVTMKLIWQPFA"
FT   CDS_pept        complement(506762..508012)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638611"
FT                   /orf_name="MICPUN_61886"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69999.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C7C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY0"
FT                   /transl_table=1
FT                   /translation="MLRVIASLTGRRALASSSRIPRAGFSSEDTPWRTVRYAAFERVGE
FT                   GFRPARPLEEEPTRDRPATEGDTSLASRARARGDCEKVVAVADCGHGVGRALVSALLEF
FT                   PECRMVVAGATPSSELTTSLHMQHWAECDAMQLDVSRVNLADDAEVKAWKDRVEFTFGV
FT                   PDVLITNCGELPSYWKLNYEAAEAFCPNDNEVVVGGCRPLEDSTLHADANAWDDDTGDA
FT                   PPPTTTIVRPARVWETRAIDWSRMMNDVKGVSALVRHFTPAMVARGSGIVVNVTHVLDP
FT                   QGGAEVAAYQASRAAISALTRCLSYEIARDLEVSATSRMIAVELDPGTLRGLRHEDPEA
FT                   DVGPLHRAHGDEAAQDWAHAAVPFVMNLTREVSGASLMVPGFGGGAAGGIGGRAPGHVV
FT                   PEGTPPAQRLDLVRDFE"
FT   CDS_pept        508161..508322
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638612"
FT                   /orf_name="MICPUN_61887"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69729.1"
FT                   /db_xref="UniParc:UPI000199C7CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY1"
FT                   /transl_table=1
FT                   /translation="MANKKNRGKERKKQKCIEEGVASIDVHESVASAIVAHVPEVKDRL
FT                   ALGCVSRA"
FT   CDS_pept        join(508660..509571,509619..509639)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638613"
FT                   /orf_name="MICPUN_61888"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69730.1"
FT                   /db_xref="UniParc:UPI000199C7CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY2"
FT                   /transl_table=1
FT                   /translation="MNFRLLTELKSYLNNPDEIDICQCQEPECTDIIDLQESVQCMACE
FT                   NKFCHECAHADHDDACADCRGFLCSLANCPGEEYAVEHLHLCEVCEEEFCDDCRFVFQC
FT                   HGNDTNRGCLKSTCDECSDMHLCDVCGGAWCDKCNDGGGAVEICFGSGKYDHKNSLMKY
FT                   SPGCSKSICEACNTDTTSGRCNLFDWCDCCDGTWCKDCTPGTFRCSCCQSSHCKDCMRY
FT                   GCDGSPIKDYHCCGSYACEVRWCDDCVERGADGICICSSEGCGNMSCGNCAADFEFFIC
FT                   PCCEDPFCKKCIQDLSPCKDCKKSQSLCR"
FT   CDS_pept        complement(<509744..>510535)
FT                   /codon_start=1
FT                   /gene_family="HOG000184356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638614"
FT                   /orf_name="MICPUN_75887"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70000.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="HOGENOM:HBG288158"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniParc:UPI000199C7CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY3"
FT                   /transl_table=1
FT                   /translation="VASWVTGTYSHVDRLWSITPAVYASVYAYASGFDARASTMAALTW
FT                   AWGIRLTYNFARKGGYSKGEQDYRWPVLREHPLLKHPVTWQAFNLGFIATYQHALLLLI
FT                   ARPSSAAYEAKGSELNALDRIAIGLFAFFVAFESLADQQQWIFQQSKHRAPGHARVNAL
FT                   RDDYKRGFLTSGLFRYSRHPNFFAEQCVWVSYYLFAVAAKWDGRADLFGASWRDAWVHE
FT                   QGVGAVLLVLLFQGSTRFTESITAGKYPEYAEYRKATSALVP"
FT   CDS_pept        complement(510803..513355)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638615"
FT                   /orf_name="MICPUN_61890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70001.1"
FT                   /db_xref="HOGENOM:HBG608451"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000199C7CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY4"
FT                   /transl_table=1
FT                   /translation="MAGAGSGDAASVLVVGADADGVAPSLLLTCDRGSKRQYLFGCAEG
FT                   FSRLALEHRVRATGKLRACFLTSFHPNACGGLGGTFLRLSGDGHGDLLVAGPSGVGAHI
FT                   RALRRFVRFRHPQVTALRLVPPAAAVDAAANPDDDHVAQSYEDDSICVLPLFKRFEHAD
FT                   ECQLCEMEAEAKRKRKREKDGAEEEEEEEEEEEEEEEEEATKKMPPPRNPTPENYFLGY
FT                   AVCVKGASDDDFGPTFLVLDCGDAAAAKEAGEHPTVGCCLLGKHRCAAVFHATASDVQI
FT                   HPAYDVCTWRSPSDALSRRWAETCAIEHGDHPNPRQHLPTHVNCVVANEVGFRAGARTL
FT                   ARLECVCGMAFPTPLAHHFPYKPPATPPKMPPFPHPRRVDGSLCARVRLRTAIDENEER
FT                   GFGARGSSRGIAEVDQTTERPEELDIEAVRDETRRLMRDASIAEVEGERFDGHSPATHF
FT                   PELLFLGTGSAEPSRYRGSSAILIKRAARSTDEGNVLLDAGEGCAGAMKRYLGHDEARR
FT                   AIRDLKVLWVSHQHPDHMLGVRGVLALRRPQQPGSGLNPGEVLTIVGPLSLKEWLEESP
FT                   NPPGLARPWRFVHSASVYAEGFGGGPFRTPQSFPQRPPPPPPPPMPPPPPPPPPMPPPH
FT                   PGSGANGYFLPRVADDTPAKELARHAGLSRFEALPVRHCPEAAAVVLGGGAPVSHGGLG
FT                   AWQMAYSGDCRPSVELARLARGVDVLIHEATFDDSLADHALRKRHSTTGEALRMASQCG
FT                   ERTQAVLTHFSQRYPRGVGVGSVDGEGGTGAPPVTAFDGMRCRLDEVGVVRECMGGVNE
FT                   MFARYERARDKTMDEDDVAGAVTLEPEAEEAAAEEEVR"
FT   CDS_pept        join(513518..513547,513713..514120)
FT                   /codon_start=1
FT                   /gene_family="HOG000207428" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638616"
FT                   /orf_name="MICPUN_85854"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69731.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG319710"
FT                   /db_xref="InterPro:IPR004023"
FT                   /db_xref="UniParc:UPI000199C7CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY5"
FT                   /transl_table=1
FT                   /translation="MDDFYVRYYVGHKGRFGHEFLEFEFRPDGKLRYANNTNYKKDSLI
FT                   RREMYVSETVMREVKRIVADSQILREDDREWPEGDKVGSQELEIVLGEDHASFTTAKIG
FT                   SLLDVQSSKDPEGLRCFYYLVQDLKCMVFSLINLHMKIKPI"
FT   CDS_pept        complement(514216..515154)
FT                   /codon_start=1
FT                   /gene_family="HOG000180834" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638617"
FT                   /orf_name="MICPUN_109022"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="thiamine diphosphokinase activity"
FT                   /biological_process="thiamine diphosphate biosynthetic
FT                   process"
FT                   /biological_process="thiamine metabolic process "
FT                   /protein_id="ACO70002.1"
FT                   /db_xref="GO:0004788"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006772"
FT                   /db_xref="GO:0009229"
FT                   /db_xref="HOGENOM:HBG557149"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniParc:UPI000199C7CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY6"
FT                   /transl_table=1
FT                   /translation="MSAAEVAPAPPGDDTARGPTRRFVTDFLTSRAPSLDPPKDAPRRS
FT                   DSADELLILNYKLPCVAPHLWHRCERRYCADGGANRLFDDMPRLFPDHNPDVVRAAFVP
FT                   DVIVGDLDSVRPEVLAYYRDGGARCVDLSADQDSTDLHKAMTHMVDSAWRVSQGTGNGL
FT                   GRVIAGKGWLMEHRIFAVGALGGRFDQTMSSVSAAHEFGDAHVVLIGAHSMAFVVPART
FT                   RVTIVPDVDNEGPTCGLIPVCGAAETVRTSGLRWNLTGGGLEMGRLISTSNALDVVGTD
FT                   GEVRIETDAPLLWTTDVSRMWSVEESPARLD"
FT   CDS_pept        515450..516325
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638618"
FT                   /orf_name="MICPUN_61893"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69732.1"
FT                   /db_xref="InterPro:IPR003659"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C7D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY7"
FT                   /transl_table=1
FT                   /translation="MSETASLSGSGGWESVEAALPRSTLSLLERLSEHHKCVFREEVLA
FT                   RLSVKDRLFLARTSHELRAAVLTSGLPIVGDGRRRVTMYRDGVHSIACGPLRVFQYCVA
FT                   QGCPWLSPHTPELASLAGNVPVLQWAHEMGCPWDRRTSLRAACGTTPSHLACLEYAHAH
FT                   GCAWDERDFADAAATAPLQTLRYLFDEGCPYDESIAECAAAHGRLDVLETFPSTAKSGG
FT                   VAVTSAAASHGHLPCLKYAVETLRCDVDERALSQAAAWGHKECVRYLVAARCPGWDAYD
FT                   EAWSPGSPQW"
FT   CDS_pept        complement(516601..517857)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638619"
FT                   /orf_name="MICPUN_61894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70003.1"
FT                   /db_xref="UniParc:UPI000199C85B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY8"
FT                   /transl_table=1
FT                   /translation="MAASINPRAVFTGGNRGGREGGEGGKPPDAAQIRRREQEKEQRRV
FT                   AAQRVVRSAAGVSRAEALRIGLDQRSTYTVLDFLRSEDILGPATSADAAPVKHQGPSMP
FT                   LNAGHRIADMPPAFVNEDALAEAFGLPARGAGGVDGDEDRDNLSKLAARMDSFAQRALL
FT                   YNKPSKAPGRAPRVLSSLLVDDAMYVQRFATQDERGEEATLTLRMTLEERLAPNYKSAT
FT                   VFEQWVVHSVTGEPAEDAHLPSEPHARVAPEAVVAAQLDALKWGDSERCRRFASPRNVA
FT                   SSVDASVFREMLDTPAYAPLSDPEGTCEVSRCVQLGSDSFAAVVTCRSWNHGGGRATYT
FT                   SWNVKGKGAPPPRYFVWLLTRQPGSGSASATDLAAAAALGGEPGSLVLSKCPNVDVSGC
FT                   WLTDAVMPARPQDLKKFGV"
FT   CDS_pept        518285..519286
FT                   /codon_start=1
FT                   /gene_family="HOG000264594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638620"
FT                   /orf_name="MICPUN_61895"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69733.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG730259"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C85C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGY9"
FT                   /transl_table=1
FT                   /translation="MAQCARVADGAISRPTASRSSVRRDHRRAVMTRALSSRSTPDRDL
FT                   RPRRAFIGAVLLSVPTFSAASVAGAAESVDELQRSLVAAYEVQDFTAALDVLGRLRRME
FT                   PKELKWIEADATISTDRKDFERALKSYDVAYEIAKGDAGAEARILNGRALAREGVYDWP
FT                   NALDDYDEVLRLAESNGFAPDPYVLNSRGNVRGSLNRWMDARDDYERAGDLFQNAKGFR
FT                   NGASTTQRLDGAIYAYSNRALATAQLGDEDGALRQLEALTRRAPNSADVRAAAAALYYS
FT                   AGRYAEAEDAWERACSREAGCAKYKDLDYVRRIRRWPPAMVGKLEKFLELKS"
FT   CDS_pept        complement(519423..520871)
FT                   /codon_start=1
FT                   /gene_family="HOG000250521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638621"
FT                   /orf_name="MICPUN_86046"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70004.1"
FT                   /db_xref="HOGENOM:HBG510464"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000199C85D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ0"
FT                   /transl_table=1
FT                   /translation="MACAAEEALERARVRFGNAPADRGATTAPRAASSESDAGDKTEAD
FT                   VVIIGGGLAGLCAAKKLAESGVDFLLLEASDAVGGRLRTDVVEGFLLDRGFAIFLTGYP
FT                   EAQAQLDYQSLDLRPFYAGADVRFEDGFHRVADPLRHPVDALASLNPAHPIGSVVDKIL
FT                   VGVVRVQSLLGDCYDILRAPETTIRQRLDAAGFSQEMTHRFFRPFMSGIFFNPELRTSS
FT                   RLFNFVMRMLATGQNCLPARGIEAVAAQLLASLPSGSVRVNAKVTGTVRVGDDGIAVEG
FT                   DGGPSKVTARSAVIVATEGPAAAAMLPSLNATSPSAPGAPVGTTCLYFAIDGPPPLSTP
FT                   ILYLNGDGGGMINNCCFPSTVASTYAPAGKSLASVSIVGVPSGIGDEALVETVRSELEA
FT                   WFGAGKCEGRNGESPPVKEWRHLKTYSIPYAQPNQETPSELERTTRLGDGAYVCGDHRS
FT                   PATFDGAMMSGRIAAEAVVADMGR"
FT   CDS_pept        522234..523082
FT                   /codon_start=1
FT                   /gene_family="HOG000198033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638622"
FT                   /orf_name="MICPUN_102676"
FT                   /product="Predicted protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69734.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniParc:UPI000199C85E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ1"
FT                   /transl_table=1
FT                   /translation="MIAADFLSLVGVGSFAAAGSLLLGLLCYDAFWVFGSGYVFGDGTA
FT                   DSNVMMAVATSDAFRGPFRLLFPRFDDPLNPQPVGALPFSLLGLGDVAVPGLLACLALR
FT                   YDASRATDMRGRATAAAAAFMSAFDDAWAEADAAESARTGDVESRAKSLDDSVADRAAR
FT                   AAEEAFDGAADALGDTTSGPPSASGGDGVDAAGGRVMRLAKVQNMVVPRSMGGRAFFSA
FT                   TLVGYAAGLSFACYVNVVTGQGQPALVYLVPATLGAVAYTATRRGEFGRLMSYKEPERE
FT                   A"
FT   CDS_pept        complement(523291..524334)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638623"
FT                   /orf_name="MICPUN_61898"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70005.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199C85F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ2"
FT                   /transl_table=1
FT                   /translation="MTARLATDRCYVPSRDAAFHPNLTRVLHLKVKGRPTTATHDLGAY
FT                   TYECRHFVDREYLCSVPGGVDLLEGIAPSEPPCRRVEMVGAAPAEVLGMLPDKLPCTLW
FT                   TPAGAGARRKLCLDLAGVLVVESLPVPLHVSLKSLMESCGDDETLASHLCVAAQGDPVE
FT                   NRFGRAAFPERYRDHDFWLDRDPKTDPKSNLTREQVIRAESALMAARGRDGVAYASCAM
FT                   CQLMGSEEDGVFLKRCAGCDVTHYCSRQCQHAHWGTHKASCVKSRGARGVDVERRGGDE
FT                   PWRADGIRSLEGSVRSLGLTESRADMGMLAADMPDTPQRRSIDGDSNFSNEDGGSPTFG
FT                   TCKPHAL"
FT   CDS_pept        join(524738..525427,525484..525546)
FT                   /codon_start=1
FT                   /gene_family="HOG000100785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638624"
FT                   /orf_name="MICPUN_61899"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69735.1"
FT                   /db_xref="HOGENOM:HBG557824"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C860"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ3"
FT                   /transl_table=1
FT                   /translation="MAPRKRKRGASEPEVVTRLRRGGVSILDAVFTELPDVFYGEILPK
FT                   LDLLDTANLAQVSKSWNDAVWSVGGVRSLEPKIKAHMEMIEDPFFCTEPMYWAAMENHV
FT                   PLARALLESGVDVNAKMRWGEGSTSALWHACDAGSPAVVKLLIEAGADVNVSCDQETAL
FT                   DNAARKGFTVIVAMLLKAGADVNLGYPLHSAMHADVHEANEAIVTLLLQAGADIDKVNG
FT                   YGKTVMQLGIGPGFPEGSHGYALEMVFA"
FT   CDS_pept        join(complement(530317..530550),complement(525699..530159))
FT                   /codon_start=1
FT                   /gene_family="HOG000264456" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638625"
FT                   /orf_name="MICPUN_61900"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70006.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG557154"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C861"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ4"
FT                   /transl_table=1
FT                   /translation="MSSSAGCAAASPRLRRSHAPPGGRGANSGKPILSPSTRRRRAVVV
FT                   AAKGAKEGDNGWMKGLEGIGGLLKRMPGVTIYQAAAPPPVLPGARVDFLEAMLQWHVGN
FT                   STSADLVLRDVQDAIVSEVTSFPVDKVALGESPSVAMHVPVPTLRQNPNGGPCNSQELG
FT                   AAAMKMNEKRSSGAASGASGSVTGLDEDSCDYASGEALMAGFPAWQGWTQPATALTLRA
FT                   VLMTASALTAAAGMRQPVIGDPAKDARAGGGAGLLKPQILFPEPTRELGDLREFFETLW
FT                   PDAPYSFGTYGRDSVSSDDRYLKGDGVDGKKKLGRREKRLVIVVNVSSPGEESAAESDG
FT                   EGMVNAAETLLELNVPFVVLTLWQDNSLVKSVQTKRARTEERDALRVLMERRTRILLGR
FT                   SVRRKEARQKIRDAYARAVKMPQGKGYVALEEALAEAKAAGAEVGSEGDAMLAEIRSQA
FT                   RSAETDALAAALTSACLQVPVDVASLRANLQRARGVLEREEAEADEVAAKTAAQLAGAS
FT                   ESPASAPHVTAKPGALINMVYNDGVAASLDVGYSIDDDEPVLMADPVGSVESSIDDEDE
FT                   EEDDDEVAESATPAAAGSLLGTMEDIDRFGAKTSDAGGGDARGLAALRAAVAGAEAALE
FT                   AVELEGDLRSTLQDQGSLDVAAVPRLEALMLRAAKVAERKPPLTQEGAAKLNTLVSRCF
FT                   SRATALQEMEGARAVLAEALEPSLRGRDISPGSLEPGDVPRLEKAVARARTSAWPWQLE
FT                   DAVAEAESTLERWRALAAVDSAMKSRSVARLRDAVGTCAAKHPSLDLSSAVALLSELDA
FT                   ERAMEDGDQRLRTYFAASKVAWAGGVLTDEAAAMLNTIRQSLDITDAEHEQVTRAASAG
FT                   SRTPEEAAAARSKEALDVQTKKRGGAGAGTSFEGTNGDAARIRGPGQRVSFSASGEGVR
FT                   RPMFEGSEDYRGLGSNDPDVESLWAEAVPDEGSAGEEITVTAGGGDDGALDGSGGAGVG
FT                   GGGGGGARGGWRRVGDTIIYNEEEIIGVGSSGTYVFRGYVQHTTRARHAVAVKRIQRPP
FT                   GEEGRELLKLVEREVELLTALNQSPKVPFFHCWGITSSHVFIALELCTESLREHVTRRG
FT                   DGMSVERRMDILRSVSSGIQWLHDPSKSSGCITHNDLKPENLLVDSTGEIKIADVGLGV
FT                   QLQNTGKSGDKYTMSTFRKYGIDIVLAGRAPEMLKHQPLTPAADIWAMGVVFYFVLTGR
FT                   ASPFSESGRDVPTNAAIINGRHHLQNLMRVKGLHPRRALEARHLLASMLAPDPASRPDA
FT                   AGVCDHPLFWDDDVAMRNVAALHARSASVQRDMSGVLNDIATDALLSGASSGNSERGAL
FT                   LAAASMDLTDWKRMVDPGIRDRITKHLVKESLVVAAGKNAAAGNGGKSKADVGRKPYGD
FT                   GFADLLRFCRNAYEHPPTGDEIAPIVDALAEASDALESSLDSDSDVKFDEKSDAPRTTA
FT                   SYELRSGSTNRPVRALLPPGVVQGMAYRRLTRRQRRALFGAYVTHLFPGLPLAVHECAV
FT                   AVGAEPTRETKRGGNAKNGGGGGGGNKGAKQKGGVAAQQGTKAR"
FT   CDS_pept        join(530763..531218,531333..531725)
FT                   /codon_start=1
FT                   /gene_family="HOG000163725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638626"
FT                   /orf_name="MICPUN_85809"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO69736.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG378130"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C862"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ5"
FT                   /transl_table=1
FT                   /translation="MSTPTPEAESLKDRGNELFARGKYGAAIDAYTNALDLCPRWITPM
FT                   KNRALCYRQRRDWANVRADCERALSIDRDDMKANYYLGLAMIGEGNHTDAARQLKKALE
FT                   SARTQGASIQTEIWRMYALAKYFEWAALASKRKARYDAIEAKLAAACGGAEGAAGAAGA
FT                   GGLGPGDWDTVREMLDAVRREDDRSDEPPDCFCCKLTFEVFRDPVVAPSGHSYERVAVM
FT                   EHLRKVGKFDPVTREPLVESDLRPNHSLRNAAHEWLNAHAWAFADIINPNQELAEFTGG
FT                   S"
FT   CDS_pept        531958..533481
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638627"
FT                   /orf_name="MICPUN_61902"
FT                   /product="Hep hag like protein"
FT                   /biological_process="pathogenesis"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO69737.1"
FT                   /db_xref="GO:0009405"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="UniParc:UPI000199C863"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ6"
FT                   /transl_table=1
FT                   /translation="MSAVHRALALVAVACASSLPATADHVVYAPPPPSPPLPAQRTFPL
FT                   LDATPLGLGPSPCLGGVNGLQARLAAVEASQAEAAQVVSAQARFLGGSERGFLGGAFEG
FT                   WGRRGAEEPGEESLDVVATGLRAAALGTSSAAEGNYSLAAGEATLSSGEASMALGKGVA
FT                   ATGDGAAALGVYTLSRGAGAFAAGGGGAALGDLSSALGAGTTASGEASSSFGVLTNARG
FT                   VASTAMGDRTVATGEASTSLGAETESTGKASLAAGVSTRATGEGAVAGGVRTLALGRGA
FT                   STLGVLTLANALGSSAIGLAAAAGGIGSAAIGAGAYAGPLSLGSVAVGLLTRAERHGSF
FT                   AAGFRSRAVDVGAVAIGRETCAGTACGSIEPLLPRLLPGRLTAKTTTRDANAVGYNDYF
FT                   DDASSVSIGSNTNASAPGAVALGHGAVATANGSFAFGAGATATGTNAVAMPGATAVEPG
FT                   SLAVLGTVSAAGFNLTGVDGELNSVAALVARVEELSARVAALETGVAIP"
FT   CDS_pept        join(complement(536318..536998),complement(534281..536174),
FT                   complement(533553..534211))
FT                   /codon_start=1
FT                   /gene_family="HOG000264488" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638628"
FT                   /orf_name="MICPUN_85826"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO70007.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG557157"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniParc:UPI000199C864"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ7"
FT                   /transl_table=1
FT                   /translation="MSVLVKRSAEHLDLDEDETIDATPVDANGNAQRARTGSRHHPSEY
FT                   KPGAVMKVRLHNFMTYSDVEMEPGPRLNVILGPNGTGKSSFVCALAMGLAAPTKILGRA
FT                   DKVAEYVKRGEEKGWCEITLRGERPDKPLVVRREMSRSAGSGRYLINGYPVGVERVKAE
FT                   IKKLGCQLDNLCQFLPQDRVVAFAQLKPTELLLETEKAIGDGHLFNEHEWLINEKKAIA
FT                   DLEREVAAKEARIEKLNKEVENMERDVARFNERNELLEKVEEYKLKRLWIDFEDKRKVW
FT                   KDAQAELLKINEQIKQLHADASEHKVPMDKAAVAKEEAKKAHMVASRALVAALKEKKKR
FT                   LQGVYNSETEHSVLNDKINSKEKEEREKGKRTRDRERAIADIEDQLAGLVEPPDISAER
FT                   TKALREKKAHNDVVVSLETKHDILKDKSHRHGFQLKDLEAKLAGFQSERQQRLVALQRA
FT                   GHNQIIEADRALQNMQNQFHKPVIGPILTLIKCDNINHRKYLEAQIGKRFLAAYITQDD
FT                   RDRSKLQEWTKRWQTTAVNMPSARYEEPIIDQRLKSLGITHRLDQCFEADAVVKAALCD
FT                   MNQLNITFVIDPKASQDVVDRAVTEVQDGKIFYTPSTRYTKIQSRYGRRETTTSSSPTR
FT                   DSTLFSSGSSTEDEQNLKRDIQIVQEQKAACDRELNQLKAELADGRKKLEAFTSRINNM
FT                   GSEMAKYLAEKNRFNTQLKAQQNALERLRQQDVGKEIETLKRDMAKILEKRSKETCAYA
FT                   DAVTACCEARAAETTALLHAKQCDALYKYLKELYDSETQQARDLVDTQNAQKEKTLALK
FT                   RVCALAKREAEEKAPLDEERKKRFFEMPQEIEPYPNPEPRPEEGQEDEIMCPNDMVLQD
FT                   FRDRQEERNRLRDDLTTKGGNLSERLEVIETKKQAWLAALRPLVDKINDNFKNNFASIG
FT                   CAGEVKLHDAGDRFEEWELQIWVKFRAVTDMHILDAHRQSGGERSVSTMLYLISLQELT
FT                   SAPFRVVDEINQGMDPINERKIFKRMTKAASSSEATQTFLLTPKLLNNLQYTEDCTVLC
FT                   IFNGPWIAKMAKRWREMQRALQPGGPVTP"
FT   CDS_pept        join(complement(538321..538329),complement(538007..538153))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638629"
FT                   /orf_name="MICPUN_61904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70008.1"
FT                   /db_xref="UniParc:UPI000199C865"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ8"
FT                   /transl_table=1
FT                   /translation="MGAPWLQEDEQLAHEHVEQPQDAHLAAQVQVPLAQPQLESQEQAM
FT                   MGCRCC"
FT   CDS_pept        complement(538558..540123)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638630"
FT                   /orf_name="MICPUN_61905"
FT                   /product="Predicted protein"
FT                   /function="extracellular ligand-gated ion channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70009.1"
FT                   /db_xref="GO:0005230"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="UniParc:UPI000199C866"
FT                   /db_xref="UniProtKB/TrEMBL:C1FGZ9"
FT                   /transl_table=1
FT                   /translation="MRGKGLPSLGEDAAKGGGVTFETDTMGGRLPGIPPPGSGDAFTPA
FT                   QTSRRISLKRATSRRITRSVGKVAVSLRARRVFDVDTVNETYGVQLQIYFMWELPYWEQ
FT                   APSEEELLKNTWLPVWVPKFRVKHQQACSSQEVTYKFIRSNDPETQPQMVLAEHLQQVQ
FT                   LFQPFDLSSFPGDCQGLTVDIEMEQDVAECQLVPFSDGTPLGDVLRNNCFLKDFKLLKM
FT                   PARNVTRARDIFLEKLKSPRKHEPLEPTGSSKHLGFLQNAAGMGKGWNWDDSDDEGAGE
FT                   HSGSGEQRGEQRGEEQTSHVEIPPPWIASLTTTDPAESRFGERFSRLLFRVHIQRKHGY
FT                   YLQNVVHVLFGVATLALSSCTYPPTDIAGRHAIDFTVILTATAFKQSVASMVPNINYST
FT                   ALDRYVVACFYFLFLMTGYHAVLPTLFGVGREAMQGTFEIRINEDDENEAFEYITKKKL
FT                   NLMQDVDYYINIVGSCVWFVFNIWWHCAFRWKRWHGRLRYLKDADNFERGIGFLINPKE
FT                   FESS"
FT   CDS_pept        join(540248..540328,540457..541743)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638631"
FT                   /orf_name="MICPUN_102682"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69738.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniParc:UPI000199C8E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH00"
FT                   /transl_table=1
FT                   /translation="MASSLWSELRARDPNPTAMLRPESIKRWVALDATFRRASTEIDGK
FT                   GKFDASTVRVHDDGSIAGACVGSKGTERYDVRVRVSVAHDDAANPPPQGASTFEGAWIE
FT                   ATCTCPAATKPPFVQHSAAAPKIQPPKGSCKHSCALLLWRARTLSAPRYPTAAVDGDVD
FT                   DAPVVDDTTATQPADPGPSAPPPLPAVSPPPPAVPPRAQAGAKRRRLPRSLVQAAAAAG
FT                   SAATDRATKTARKGAAKGTAGGEGGGGGGGGPGGGAARSDASKGASSTARVKREPGSVA
FT                   AAGGGGAATAGAAGESEPTSNPRADRFAEAKALTDDSYWLAACDRAMAAEKAAPGAAPS
FT                   APAAPSAPAAPSAPAAPRPPRRKDLLDDLFDFAPVPSSSIGTTREGSSVEPAPAPDPVP
FT                   AATTTTATATAMNGAIGGAIGSRQREGSEPVSGGSGGAGGPRKISLAELLGEYGMG"
FT   CDS_pept        <543673..>544815
FT                   /codon_start=1
FT                   /gene_family="HOG000200878" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638632"
FT                   /orf_name="MICPUN_68564"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69739.1"
FT                   /db_xref="HOGENOM:HBG713239"
FT                   /db_xref="UniParc:UPI000199C8E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH01"
FT                   /transl_table=1
FT                   /translation="LLMAHEAERMVESLRTFTIDDVGSAPWMKQREALERLNVQAHHNA
FT                   VNHTDEFVKEFLISHDKIHVLVHELLVVEAWKERVYPHFAKIDPDAMDAGLTNSQVYLA
FT                   HYCEATLVNLLEIAFFHQDACEAAGDDALLELCDYCARRLVYLNDGGASEDAQLLSRAK
FT                   REQKSAKDLLNARASDEFAEKEAEVRFGTATCALTVLRYLTDYINDVPLCVMARLLDTH
FT                   DVQMLLVPLLEERPWVRRVPGKNGGPVVNEIFADGRWVEQPREDRLQLTKCDAQTWLAL
FT                   NNLTVDAKCRAKYRYDDHRKNTMNRLKRFFNDILLDQLPVLKDLQRVTDEILLQVAPPA
FT                   HEVTQGRLILEQVPETRTRLLKRTEKEWIACARAQLSSHFA"
FT   CDS_pept        complement(546000..546866)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638633"
FT                   /orf_name="MICPUN_109024"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70010.1"
FT                   /db_xref="HOGENOM:HBG557161"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199C8E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH02"
FT                   /transl_table=1
FT                   /translation="MAWPKRGFELTRKIIDADADVVCLQEVDHYHDTFRPALHAQGYDG
FT                   VYREDEWSPCIKTTDGKLADGVAIFYKREKLELLGMHVPFTPRDVKVPPIEERRDAGKC
FT                   LVARFRMRAPIEQRRGTGWRDYTCAKLDFIVATLHLASEKNEEGVKRREAQALCAMKEI
FT                   LTFKAMSGAGREDRLSPIVVAGDLNAQPHEPAVEVFKKLGLMSCYARHIRAEPLFTTWK
FT                   IRTGPYKPGEAKMTIDYIFAQHSAFDVYDVLAMPRSDEIGPKGLPCRGHPSDHLMLKAS
FT                   LEFIAEP"
FT   CDS_pept        join(complement(548767..548859),complement(547170..548615))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638634"
FT                   /orf_name="MICPUN_102686"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="ACO70011.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="UniParc:UPI000199C8EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH03"
FT                   /transl_table=1
FT                   /translation="MANDDVTGGSGSGALREDMISNAVAFLKHPQVTSSPEAQKRQFLE
FT                   KKGLSAEEIDEAFKRAPQPAPAPAPASPVAPPAASVSPARDDAEPKSGGGGGLRWTQVV
FT                   SRTAMAIGALGVLTRGFNRGGAAGSAGAGSSDARADADRASSLRETERRLEEARVAAER
FT                   SAKEAAASRARSDELARSLDDVRGAMERAAAAGANTPTAVAAALDGIKRELRDELRGVV
FT                   AAAVADATASAIATTPKGRDGRTPGGSEGGATNDAMPESVREELAQIRAMLLASPLRET
FT                   PPPPAGATAAPGDARYADTADDDADVLVPPSKTTPRAALASSSSAIGQKGDEKDVAEPG
FT                   VEKRDRATPTPPPGDAPPHPPSYMHVLEMLEKGQTPPGIRDIDDKPPDPDARIPAATMS
FT                   RRRKPWEKSGVALNGGGDTAGGGDTAGGALGSPLSANGSTVEGGVGGWRPPSVPSMSPD
FT                   VSKVLMGRHGVGIPGTGGGGSRSDRGGWLAPGTPESEIQPAPGDLTPLKPSFDR"
FT   CDS_pept        <549279..>549536
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638635"
FT                   /orf_name="MICPUN_74169"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69740.1"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniParc:UPI000199C8EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH04"
FT                   /transl_table=1
FT                   /translation="LVNVDLGPAAVLGASVMTSAIALYQVRASRPEVSRDQDVFFSSVG
FT                   LLCGGILVFQGWRLDPLMLFGQLLTAGTAVAFASEAIGLRQ"
FT   CDS_pept        550338..550721
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638636"
FT                   /orf_name="MICPUN_61913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69741.1"
FT                   /db_xref="UniParc:UPI000199C8EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH05"
FT                   /transl_table=1
FT                   /translation="MKYKFAKGRRKGYQWANDQHNTMNSHDYKKYLVPLTDHKVTAFTS
FT                   SNIRKDYGKNGELKEDNFFAIGCQSKWGYGSREFRFLDGQIAEMQFYGENLDGATIKAI
FT                   RADLQRKYISPDSPAYVENINNQ"
FT   CDS_pept        complement(550846..553449)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638637"
FT                   /orf_name="MICPUN_61914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70012.1"
FT                   /db_xref="UniParc:UPI000199C8ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH06"
FT                   /transl_table=1
FT                   /translation="MSSTPALVTGMLAARLRDASIRRLRRARTSNWRALPVRAKSAPSE
FT                   ASADSGGGGVSHVLTSYEISIESQLSATPLRFESKGGHKRGKDGWSGDLGPKLWREVRL
FT                   LRELRPEGATGAPLASRAELFVAGPEPGTALRVGEPGSATAALEKKAAAAGAALVAGEP
FT                   IPIALSRSSHVATLREALYAHALATMGDEFEVSRDGARGVILTAKPGTPRCDATLENGR
FT                   VAACQQFILRVEDDAPEDAPVAAAAHAPMHLVVAAGRELRSAMTVRQIMDDASTPNVPE
FT                   SAQVVALGGPHLFGTLAYSSGDATRDAANASIGAPRPELGGDSLLSYHRKRYPARVPLL
FT                   RDADDGAAPVWLVPSRGPGGGKNRGFKKPDAMAYPAELLAPVVGARAAGATDQGVSTGD
FT                   PTTLQRRVSEIRVALGEPFAPHAKLADRMRRLPPWAGEPSKRVGGVFDGPAIAPSIASI
FT                   ASVPNPPRTLYVGADRALLAKEVESAMRTWKNTAGRGASTQLDDAVVDAIVADVLASDA
FT                   EPTPINVETNELEFLFRRARDSGYDAVVIHCGGGEETFEAAVREAASRARASRPRRCGP
FT                   ASGVHGSARLALELLSLPGRGGQATAWPGAATVRDTTFVGVAGGKGVGRRRVACVVDGD
FT                   GVIVSGRADVGYPGEGGDGGDGGAVDDDDDDIDDDAGDEPEDEDGAGWGFGSGSLREWA
FT                   SRSVALAETAVRVALEGSGDASPPGESPPPARLVVHHEGRSHPDFARACVAAGEARGVA
FT                   RVEVVDILREPQAATGRILRWSKASGVRSPGKGTHFALSATDAACVTTEGGPSGDGSVP
FT                   KPLLVRRRTRGGSSATALASEVVALAAIGVGNEGGSHALPVTLRGYGARPIVLIV"
FT   CDS_pept        join(complement(555812..555929),complement(555378..555530),
FT                   complement(553878..555073))
FT                   /codon_start=1
FT                   /gene_family="HOG000197981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638638"
FT                   /orf_name="MICPUN_106146"
FT                   /product="G2-like myb-transcription factor with a n-
FT                   terminal response regulator receiver domain "
FT                   /function="DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70013.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017053"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C8EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH07"
FT                   /transl_table=1
FT                   /translation="MSTPAVSKGFPIGLRVLVVDDDPLCLKIVEKMLKRCQYEVTTFSR
FT                   GAEALKTLRERKDDFDIVLSDVHMPDMDGFKLLEHIALELDIPVMMMSANCATDVVLRG
FT                   IIHGAVDYLLKPVRIEELRNIWQHVVRRKRESSQGNLRSGEGGSNGRTVSGGSTGEGGG
FT                   KDSKGSSEQHGDAKDKTGSAGGSGGSSKRKKGSGKKGDEGTDEVKDGSGGDENEDSSAL
FT                   KKPRVVWSAELHQQFVTAVNQLGIDKAVPKRILDLMGVQGLTRENVASHLQKYRLYLKR
FT                   LQGVNSGGAPGGGPGFMSPIALDGSMVQGGPGGRVGSPAIGGPNGPIMVGHGHIDPAML
FT                   AGGAPQTIQMGMVYGGPGMGPPQMMAPNGKGGGGMPGGYVMQPGQMMAPNGQMMPVGQM
FT                   GPGGMMVQGPGGGMMQMHDGGMMNGNGSYGSLQNMKQGNGVVMMPNGGMGGVDGAIPNM
FT                   ATGLINGQGLPDDDVLDMFLKDGLPEGEGF"
FT   CDS_pept        556797..558950
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638639"
FT                   /orf_name="MICPUN_106147"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69742.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C8EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH08"
FT                   /transl_table=1
FT                   /translation="MASETIILDDDYAMAATWAVEHVAALGVLDRAVLTDLFSICDKTR
FT                   NLPARVEQRLVWVLLNDVVEGDGVSPHVCKMMDKLSPLTAETSAEVAEICVRIRQAVCI
FT                   RSFDSPDGYLEFAAMLEELFPPKTGNALLNAARKDMLHVLATSMDPGVVEEAREKYAVS
FT                   DGKLRKDMRRFAELHGQKMGGTSINRLLDDIAAGRYNPPGPNRAHAAIPRIPAQQQQQP
FT                   RTGSLSPGSPASPRRKKSMLRTPSGAPKVRSPAKSPPKKKPALPAHLAFEDPSDPHGEM
FT                   DAYAFDEPDAAWNALGDLAENAAALEEAEAGPRPGKVKPGKKRGRSEEDEGDEGAKKRI
FT                   VERGGRPAGTPVLRTINALTTRLLGGGEDDETDEGIMPTQAAPTEEDLAAERKSRRRSL
FT                   PGRVLGAARAALTWRKGKGGVGDTYPAPSPAAADFAGLDLACVPSPPRAGDDDRPPPSG
FT                   IARRHSKLRDGGTDAEGYEDKRKAGRRKLWSKEEVVALCRGYEQLEREGKLHVVNKLRP
FT                   NGGVDWTTIYKMSEEIFAANERTTMDLKDKMRNLLKKKEKVEAEKNRRESLDAAGATKA
FT                   GSTKRKSGGFLSRIFGGNKADDDDESVKDLVALEDLVATAPELLPGVSNRHSLKNKKLG
FT                   LAPIGRKSKQMFSQEEVDALREGVAKHGKGRWKDILLESQHVFQDRTTMDLKDKWRNIE
FT                   RMAQKERAREEAAAEESEGGDSS"
FT   CDS_pept        join(complement(564579..564643),complement(559043..564461))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638640"
FT                   /orf_name="MICPUN_106148"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70014.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199C8F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH09"
FT                   /transl_table=1
FT                   /translation="MAAPEPQRQKQKQPSAWSTFHSNMTKNPLSLMVFDRDQSPRKEAI
FT                   AIMNDKNFNNLIFVSIIVNCLLMAALYDPLDETKNAALSDGTDVFFTFLFMFEMFVKIV
FT                   ALGLLFGEEAYLRNGWNILDGIVVIISFVCLDFVSGGAEGLNSLRAIRAVRPLRTLSRF
FT                   KSGALFVNTLFSSAQYIMNVFIFLVWFIILGACAGTVLFRGELRSRCFDISANTDPNTC
FT                   PSPDELYAGSIASPARYAVLTDMGDDVICGVTLDNCPVAGHTCCDYAKHGTMPSNGYVK
FT                   FDNVMWSSLLVLQGLTIDGWNETAYTLMDAIGWPVLLWYALMVCVGAFFVMQLLSAVVV
FT                   TSLQTCSAEQKMVDQIDAEREKRRIEAGGNPDDKEGDAMDEIGKTWRTSKSLEGVRKMV
FT                   RLHMPAVYKIAESEKFNNFILVVIALNTVVMMTRHYPESSEFKDANAIMEYCFNGVFIA
FT                   EFVIKHLGYGLGGYWSVGWNRLDGFVVISSVVDMAGSAINLGFIRALRVLRVVRTVRVL
FT                   KAAPEAMAVIKAMVTSLASMTGFLLVWLIFMLIYALLGTRLYGAACIFEIDEDAGRLSF
FT                   RSFMRAMLTLFVTASGENGFDVIHWTMEAEGPSASAFMISWMFISQILLALLLALLIDT
FT                   YTVGGEEEEVTEPTPDGADANKEGYEMRPMVSEAKPRRLSEELVDMEEEERRVSLEEDE
FT                   GRQERERRREERRFDNGDAKTWTSRDNLSETSTPQGTIIAPPRSHRGTEPTEMKTTARH
FT                   GNHYSKTPGSLVEKYSQAGYSHRSGKHNRPEDRHHNPHSPDTAAVKKQLNEIYDEKAAD
FT                   AEEAMPQTRLQMLQNLKRHKIMHEVAVVRQWLYDIDYDYDRSVEQPMPIRMTAAQEQKA
FT                   KDRLSLKKNFNWKKAKEQKMAFKRLALAPFTMSPTGEQMPMGQMPKSLKVLRDGEEMSS
FT                   MPKSMKNLTDFVEANQPSTEKTIWMQIAEDSRFGNFILFCILWSSIMLAMETPSWPAEG
FT                   SSAYRVFFITDIILTIIFTVEMGIQWMAIGIGPYFRQLANKLDFIIVFTAWLSLILSFA
FT                   GLDANALTALRSLRLLRILRPLRAIRRLPALRMVVDCTIGALPAIKWIMVLGAFLAMIL
FT                   GLFGMQFFGGKFYSCHFIPDVNDAAAYNAKGTQAACEAFGGIWAERTLTTCEHQAAIDE
FT                   NSDPSWPIASFECSMPPVVTKADCLALNGTWANNEYHFDNIGQALVVVFITSTADNWQD
FT                   VMYTGIDAVDVDKNLVYDENPWASAYFVIVTMLSCFFWANMFVSTLVDQYTKASDNEGV
FT                   IAMANEHSATLDKALLLAKQQALKDKHWAERKPKSQFAKVCIAIASHKWFNPVMMGVIM
FT                   LNGFVLMCIHADQPGWMDDVDYYSGICFQTIYCFEVVVLMSAMTPELYLADPWCRFDLM
FT                   IVMAGVVELSVPGDAGFVAVLRTFRFLRLFKIIKGFKELRVLMYTILSAIPGVSNIGLL
FT                   LFLLMFMYACLGVTLYGDIESPYGFPNGLNKYTNFRNWPNAMLLLFVMFTGNWESIFRA
FT                   TYWDCKGNDSDWGRECTYRYSAPFFFFSYFLMANAVLGNLFVSIILDKFTNETANEDEG
FT                   TDFIQVVHVAFLVSNFRNMLTNKIRIYQLLRGRADRRTLKRYRKRYEKILPPGCLDEGH
FT                   YRHSEALKIIKGLHDIKSIISAPQDVGDGAETRDGSPNTVLPSVQPSQMALTIVPDEEG
FT                   EDMIYGSETESGVGPAIDEEAYDSFDGDDLASRYSQDGGAQSGDWLSACNFNIIPQMDY
FT                   CYHPPPNREHRRQQNEEDRREMEEERRSRHGSEPEEDRREEQRSHRRDRREERRHDRKD
FT                   GKEPRRSRGDRL"
FT   CDS_pept        complement(565235..566494)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638641"
FT                   /orf_name="MICPUN_61918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70015.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199C8F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH10"
FT                   /transl_table=1
FT                   /translation="MSSDVGGDGWGGREWDDMVERCAAVVDRLRTNNGDEDDDDRGAAE
FT                   LTRALEEIVALIADDEEYVPALGAARGHDLLARLVTHRVPEVSSAAADAMEACARHCPP
FT                   GASFPGGDVDEPSHAIMRVGTLAAPLTLRMRHVREGYGGGERRSIPNIAWDSGLVLARW
FT                   ISRHPELVVGKSVLEIGAGLGAPSMAAARWGASMVALTDVDPLATRNAAYNARMNLGRV
FT                   ASAKVKCVTHDWNALESDSDSESDETNHGTNRGRATCSLGRALERFGGFRRSDEEGGGD
FT                   WANGGADDEVETTDEVETSRRFATFDVVLGADVVHERGMAQGVARMLGRHLGGSPDAVA
FT                   VIVNPAPAHRSGAADLPAALEKNGLSFVSARVTSAMLRVGVMEETEDVRLDMFLVRRRE
FT                   WGAPDASVMEDVTDEWVRHA"
FT   CDS_pept        join(complement(567453..569120),complement(566628..567080))
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638642"
FT                   /orf_name="MICPUN_97967"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70016.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C96B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH11"
FT                   /transl_table=1
FT                   /translation="MAGDDAPVEDPYAPGELPVLRYAEEILQAVRTNPTTVVIGETGSG
FT                   KTTQISQILHRASATLMPDSRMGVAITQPRRVAAVSVARRVAHEMGVKIGTLVGYTVRF
FT                   EDCSSRETRIKYMTDGTLLRECLEDPNLSKYGVIVLDEAHERSLNTDILFGLLKVLVKT
FT                   RQPALRLVVTSATLESEKFSAYFNDCPVYHVPGRVYPVELAYATEQPKNYAETALETVM
FT                   DLHCSQGRGDILLFLTGKEEIERTCRRLNERVREMPEDECPDMQVLPLYAALSPELQAR
FT                   VFAPPPAGCRRVVVATNLAETSLTVPGVVFVVDPGFTKQNEYDPTTGMDSLKVTSISAV
FT                   QARQRAGRAGRTRAGRCFRLYTREHFELDMPTTTVPEIQRTSLVGTVLYLKTLRIEGLD
FT                   VLDFDFLDKPDVEAMGDALRQLYALGAIDEDGAVTDLGREMSPLPVEPQLARAMLAARR
FT                   FGCVDEMATVAAMLSVERVYTGNGPPREGEGDGDGDRRGPPPESLCSEHERRMGDHVVL
FT                   MRTYQAWARGGHRRDFCERHGLSDRGMEFARDVRKQLLGAICVGFCNRLARRLPKHNGF
FT                   RTLNDNAVLAEVHPSSARPLANEITGLLPEWIVYHELVATTRVFLRNVCAVEAPWVAPV
FT                   TERLREVDLKRLSGGRVATRKAREEEARRERAKEAERQRIESGARRNDDKTVDDARARY
FT                   LARKAAAEKAKK"
FT   CDS_pept        570362..571498
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638643"
FT                   /orf_name="MICPUN_85942"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69743.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C96C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH12"
FT                   /transl_table=1
FT                   /translation="MAGCRSVFEYEQLNKIDEGTYGVVFRARDKKTGAIRALKKVKMDK
FT                   EREGFPLTALREANILLSMQHPNIVGVTEMVMGNSLDSIFMVMEFAEHDLKGLMETMTK
FT                   PFTIPEVKCLMLQLLGGVSYLHDNWVLHRDLKTSNILVNNRGELKICDFGLARQYSDPL
FT                   RPYTHMVVTLWYRAPELLLGQRLYSTGVDVWSLGCIMGELLCKDPLFQGKTEIDQIDRI
FT                   FRLLGTPNEKIWPNFINLPSVRKIKFPHQPYNNLRKKFPKISPNGGVTLSDAGFDLLNK
FT                   LLAYDPSRRMTCEEALGHEFFREFPPAKAKELMPTYPSKAAGQTREVVERAKAAARARN
FT                   AELRAMEAIEGEDPLETQRRREEAMAGRERTGLFSHLN"
FT   CDS_pept        572931..574763
FT                   /codon_start=1
FT                   /gene_family="HOG000264361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638644"
FT                   /orf_name="MICPUN_61921"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69744.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG557170"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C96D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH13"
FT                   /transl_table=1
FT                   /translation="MVHKGDAAHNEINSFQSKAAKYKREGDAHFGKRNMREALASYGKA
FT                   IEMSLSGTEEKAALFSNRAACYLMQNMYRHAINECSHALNEAPDFKPALLRRARAFEQL
FT                   QQYDRAVSDLEAAAKADPNSDDVRKKLQATRAARDNRKASRSVSGLGGGGLRAPGKRGT
FT                   QRLTPAQQQAAAAAASGQGQGQLPTLTIKATLVRGEAAETKNVVLPISVRYKDIVDQVR
FT                   NLFPDDLKEQPFALKYKDAEGDLVTVTSRTDLRGALSAAMHHAEQRAAATGVQRPRDAG
FT                   LAPVEVEVVPCAKAPSETPDQIIPDHVGSRDHPPNAEDEGAEDVIEIDEWLLTFAGLFR
FT                   KHLGEDGAKEGPLDLRQIGLEKCCEALEVAVGTDKAKELLGAAADKFQEAAAAAIFNWG
FT                   NVHVCASRKVVDCAAPAPEEGQPTPSDEQMAAAAKDHIKRIDDEYEKAVERYKQSLAIK
FT                   SDFYEATIAWGQQCFERAKVYHFAAKAGDAAAAKEADVMFDLAEVKFQESLAMCPKEDE
FT                   ASTSGEGEAAAEQPGNLGLKAQIQVLWGNVLFERSQVRHHRGDEKWQVDTDAAVAKFNE
FT                   AGCSKDDITKALMNHASGVWKDDEEAAKAKAGGK"
FT   CDS_pept        complement(574885..577182)
FT                   /codon_start=1
FT                   /gene_family="HOG000264360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638645"
FT                   /orf_name="MICPUN_61922"
FT                   /product="Condensin complex component, barren domain-
FT                   containing non-smc subunit"
FT                   /protein_id="ACO70017.1"
FT                   /db_xref="HOGENOM:HBG557171"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniParc:UPI000199C96E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH14"
FT                   /transl_table=1
FT                   /translation="MGVLGELNNTPASKGKSKSKTPLKSPAPAPVGLLTPNNDKREKER
FT                   NKLARQASEVSRRCVRDPDGIPRHRVRCDALAVAMQPRYRRSTSTVSRANHAFDPFNPK
FT                   RRTFTDALDDADDSTKGSTKEPLSRMTSINSTQTKKPALSAEGVLNLYSNCIKLASENK
FT                   INAKNTWSLALIDHISEIVRDSKDEDGQTNFQKSSCTLDAGVKIYASRVDSFHNETFKM
FT                   LGGMNKVTQNEEDEDAESAGAKGDGQGLDGEEGAPKKRAHRPVQTLEAPEAHTLKALDD
FT                   AVAVDPLFQKTSALFDEGGASGLLLNNLSVHRGCNICFDSEEVPEYGDAAVDDDEPPID
FT                   GVVVDLSSIAATIEQAQRSAASAVRITPAVGVIEDLLHGLTGGDVASTAAAAKAAAEGT
FT                   SGVSLFDFASGDGVQFAEYDDADDDDDTAGMPGYDDDAGGGFGAGFDDDGVNFADEFNP
FT                   HAGYGKADRAGVNGEELDMEGDAGLEWVVNSGMGGKMAWAGPSHWRFKAPPKGVNGSSG
FT                   GEGEGEDGEQKPKKREKGELTYDFENPGEIDEARFTLAATIEELQLVSAPVAVDTLLPP
FT                   DLGYDASQLVKLSLRPNAGVSGVGTNFGGGDDVGDGPGYDDDAGFGGGFDGDDGYGFDA
FT                   DGEGGFDDPAEAPTAVEGLVAAPRRCEKIQVNYARQTKEVNVKELKSTLWENINDDGIC
FT                   PADEATGAHSFNQLLRRFPEDNLAGATEDISVHMAFICMLHLANENGLKITDRPGLDDL
FT                   DISNLPGAIAAH"
FT   CDS_pept        join(577742..577940,578114..579009)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638646"
FT                   /orf_name="MICPUN_61923"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69745.1"
FT                   /db_xref="InterPro:IPR010820"
FT                   /db_xref="UniParc:UPI000199C96F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH15"
FT                   /transl_table=1
FT                   /translation="MAGDPDPFDMLKPIKPKSAVPKPNGASGEGKAETLEEFASGGGGN
FT                   VAEEEEEKKTEELLERINEIVGSNLNKFAGEIMTALAGVGSKLEAMQERLERNEAGVET
FT                   MAEHLKSAVESLRMAEAAAAAAATTTTTTTLATPAPVAPDPPVAASPVPSSAPSPPPAV
FT                   AAPAAAPAPAEQPAAPVAPVAHQWHASAPPASAPPATDPGASSPYAPPQPLQPGHPPPG
FT                   PHHASPPPPHQLHPGQPPGHRPPPAGPPPPGPHGYHPHHPPPPPPPSAYPPAPPPPPGG
FT                   YGGYPPAAAQGYPPPPMRSPTQLAGPAQLVNQSVKVNVERFIDDFASMGFTRDQVRGVI
FT                   RELSDSGQTVDTNVVLDRLMNSRR"
FT   CDS_pept        complement(579120..580097)
FT                   /codon_start=1
FT                   /gene_family="HOG000264931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638647"
FT                   /orf_name="MICPUN_102696"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70018.1"
FT                   /db_xref="HOGENOM:HBG557174"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C970"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH16"
FT                   /transl_table=1
FT                   /translation="MTTTPRAIFARSAPLAHPAATAPTASTGARHHRARALQHSLAPPS
FT                   PSPTRPSSGVVRRASSIAANATATNPASRQFPSTDVPSDAFYDAVVVVAGGMTDSGGLP
FT                   PWVVSRLDHAVDEYRRHVTATPPKKMYVVLSGSATPHKPPPLQKGGFMLHESTAMAEYV
FT                   VAAGVPPQAVLKDTASMDTIGNAYYSLTLHAAPRNWRRVQVVTSEFHAGRTRAAFEWVW
FT                   GLWSPGLNGADDDAGRQRRGGDPYVHLDFCTTANDGLTSEVVDARAEREARSEAALRDN
FT                   ATRVTTLADFGEWLYTTHLCYAVTRQHEIGEFAEMKTDPALKSY"
FT   CDS_pept        580381..582111
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638648"
FT                   /orf_name="MICPUN_61925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69746.1"
FT                   /db_xref="UniParc:UPI000199C971"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH17"
FT                   /transl_table=1
FT                   /translation="MARERLEPDVGLDFGLLVSRLTTAFAMLASSFGPPRSSRPAPPDS
FT                   DAWSKVDVELYFDDLTPEGTEAERKYSHMLVVQETADACEPRVGLPDHESVYDFVGRVV
FT                   FENVDMKEWNMEVTLATATTDESNLRHYDWSHKHLPPGVSLVHRDVGEHDDSADDEHVS
FT                   EGVTFARQRVEIKEIPKMRQGQLDTWEGTTLVLSFTSRHPHWDPDGARVSNEIWDAVHS
FT                   AVMGLPEGVQVRIRSPSRDKDGIDNVFQAPSRTIAPLIPKSSATVQPWDRTNREHFCAM
FT                   KSGRFVATDPRASCSVKLCFNVFPRRSSREMRLKFSCAVFMNHAAMKAEQSRGLVDSLW
FT                   VKPAQLWDEHNLAPITRSDERDRSTADVDPSAASPEDTRDALALWVHIRKRPAPGPSAP
FT                   SLDDDDVGDEIAAIIAGDGPGNDDAGDDRYLTDFPRDVYVPHEIKVYFVDDDVLSRGVP
FT                   ESTDEDPGFRLPPKLFHARGTRLPRQLRDRMIGLALKEALKDLKRQDRYGFIGGDERER
FT                   LRVCDAVIAAATGILEAAGPERAPEFFSRIQRMVDERPDLDWKKAFERKLRATAFGEIS
FT                   "
FT   CDS_pept        complement(<583195..583980)
FT                   /codon_start=1
FT                   /gene_family="HOG000237325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638649"
FT                   /orf_name="MICPUN_85600"
FT                   /product="Inward rectifier K+ channel family transporter "
FT                   /function="inward rectifier potassium channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70019.1"
FT                   /db_xref="GO:0005242"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG716702"
FT                   /db_xref="InterPro:IPR001838"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR013521"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199C972"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH18"
FT                   /transl_table=1
FT                   /translation="MRGRSLLGLITFDGFTTLVEMPWRYLVVFVASLYIASFLAYAGVW
FT                   FGISRHLPGCLSGFEDGFNAAVIFSVATQTTIGYGTRSIVGSCRTGTFVLLCQSLTAVF
FT                   VSALSIGLIFQRIADPKHRTRSVFISDAACISCRDGELTFMFRVGDARDRKVINPNIRA
FT                   CLYTWDGRRTKEGEHLPVVAKPMEIAYQDGHMLLPITITHVIDESSPLYRHTHDSLVAC
FT                   GAEVVVSLEGQIETTGLSFSARQSYLPQEILWSHQFVRII"
FT   CDS_pept        join(584761..585252,585437..586594,586814..587854)
FT                   /codon_start=1
FT                   /gene_family="HOG000239402" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638650"
FT                   /orf_name="MICPUN_95269"
FT                   /product="Heat shock protein 70"
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO69747.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG748488"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniParc:UPI000199C973"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH19"
FT                   /transl_table=1
FT                   /translation="MRSSLGRFLLAAVALLLCCATAARAAVLGIDYGSEYVKVSIVAPG
FT                   RTPISIVINEISKRKSTAAVAFTGGDRWLAEEAMNYNARYPERVFTRLRDLLGKDASVE
FT                   SFAEYLAKYKLPYKVVRDADRGTARVVSETGDEYAVEELVAMILQYAMKIGEGMGKGQI
FT                   KDAVVAIPPYFGQTHRYSLYDAADVAGLNILAEVSDLSCAALQWGIDKDFNQKGTWTII
FT                   YDLGATSAGAALVRYSTFEGKDAGKKKQHGQFEIKAVKWDESVGGEDMDMLLVDHFLAE
FT                   FDAKHKPSVSAFDSPKAIAKLRKQVRKTKEILSANKEAPLSVEGMHEDVDFRSTITRKD
FT                   FEALAKEKGIFTRAAGPLKAIVDSLADFDITLKDIEVVEAIGGATRVPGVKKALSEALD
FT                   GRALDFHLDADEAVAMGAGLFAANMSTTFRMRKFGAADAAPYALEVDLGKGPEHDRKTL
FT                   LPLHKRFPVRRVVSVANATEDAKFTVHHADPTRLPPGIVDAKVAEFAIAGVPDAMKKHD
FT                   KVGDIKAHFAVDSSGILYLEKAEYVVEVVDMVEVPDAPLPEDGDATARDQPDASADADA
FT                   EEKEKEEPKEEQPDASAAPPPAPEEPKFRQRRRVFRIPLTVTESGRAVPAMTPDAVKKS
FT                   IGVLKDLAAKDEAKRAQEAAKSNLEAYIYSIREKVYEDEGIAKVTDEAMREKFSGELTD
FT                   AEDWIYDGGEHATAVEFNNRRDKLQSVGDEWIHRAKELTRRPAAVEKAKDFIATARKTV
FT                   EKLGETKPWIEDDAKKKMLDDVDGFESWLNEKVALQEKKKDTESAAFTAAEVTVEAKPL
FT                   EAKLVRLKKTPAPKPPPPPPAPEKEETDAEAPAAAEGDAAEGEDPAAEGEEGADGATAE
FT                   EGADGAEATDGGEGEEPYHGDELKK"
FT   CDS_pept        complement(588030..588881)
FT                   /codon_start=1
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638651"
FT                   /orf_name="MICPUN_97969"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70020.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000199C974"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH20"
FT                   /transl_table=1
FT                   /translation="MTAGWSVVLDNFSPFVIAGPLTFVFHELVYFGAWVPWLVLDQIPY
FT                   FNKYKIQPEKKADGAMVAKCLKRLLLSHVFIQLPMQLLFHWVAQFLGFSMALPLPPVRD
FT                   LAWQLPAFFVIEDFYFYWIHRALHHKSVYKYVHKIHHEHTHPFGIAAEYAHPVETFFLG
FT                   IGTLLGPLFFAKHMVTLWAWLFVRLWETVEDHSGYDLPWNPTNFIPFWGGAVHHDFHHK
FT                   TFQGPYSSIFTWCDWAFGTDKMFRAQQKKLRDGKEGAYPAQFRGAPNFEALERERAKAK
FT                   VA"
FT   CDS_pept        589349..591220
FT                   /codon_start=1
FT                   /gene_family="HOG000079769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638652"
FT                   /orf_name="MICPUN_85720"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69748.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG557176"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199C975"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH21"
FT                   /transl_table=1
FT                   /translation="MRPSASTASLEDAATALAPLRRVRVDLVDLRYAPIVRDAKGNRAP
FT                   KRVIHGCTTSFLPGTVSALMGPSGSGKTSLLTVIAGFVDQSHVSGNLLVNGERTQVRKR
FT                   LVGIVFQDDMMLPALTAFETVKFAADLRMPRRCSDAERTEACDAILNELGLAHVRDQLV
FT                   GGAARRGVSGGERKRLAVGVELVTRPALLLMDEPTSGLDAAAALSLMRTLRTLASRGQT
FT                   VVAAIHQPRTTVFDSFDHLVLMSKGHALYDGAPDGCVGHLESLGLGLTLPPRTNPADWL
FT                   MDVIAADESLGEDTRKLPEGWKNAKTQKEKRVFVVGDSDAPGTDGAAGKRDDDDDEGAS
FT                   VWRQLRVLTVREDKSRRGQNLTAINASQMLVMAILTAMFWWQMPDDTDAFVMERFSILF
FT                   FCIIAQSNAVVFACVNTFAKERQLMIRENAKGMYHPLPFFIAKTASDTVNTLVMPCLYA
FT                   TVTYWCVGLKRTAEAYFVFITAFALCILVAQSLGLALSCAIPDVQVSLIVAPMVILMLM
FT                   ILGGFYVTFSNMPVFIRWLSWCSQARFGFTAMVVNEFSGRTFQCDPNGNHARYGTGCPV
FT                   RGEDVITALEMDDLSVGQCLLALALMQVGLRIAAYVAMVVNFTRLKQ"
FT   CDS_pept        complement(591324..591872)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638653"
FT                   /orf_name="MICPUN_61930"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70021.1"
FT                   /db_xref="UniParc:UPI000199C976"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH22"
FT                   /transl_table=1
FT                   /translation="MSAATCARVTASIAGSAHPRAPRATTRSPIAVRAGERRRRVGSIA
FT                   RATLGADRSPIHPIVHRSVGFAVATAAAAALTALAPSIALAESEFYVEDIPQGLNSADA
FT                   RTAPNLKTLTKGANGKEIEKCATKCIATCTRGGSGAPGLGPLSVRKAPVVFKEGFRSRQ
FT                   YCLSECTEICSITVRDSKK"
FT   CDS_pept        <592077..>592700
FT                   /codon_start=1
FT                   /gene_family="HOG000264964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638654"
FT                   /orf_name="MICPUN_76277"
FT                   /product="Predicted protein"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="ACO69749.1"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="HOGENOM:HBG727922"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="UniParc:UPI000199C977"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH23"
FT                   /transl_table=1
FT                   /translation="VIVKFGGAAITVKDGEPDTLNDEALGACCASIAEVVRTEISELAI
FT                   EFAKESPLRVIVVHGAGSFGHPQAKQYGVADGGDMDGDPVLREGVDKTQASVRKLCRLV
FT                   CDELTSHTAGSRAWVKPAPISPYGKFFTVGKKLNRNLSRGGFDEVRAALMEGKIPVLHG
FT                   DVVNDAEQGCAILSGDTLVECLTEEFKPKRVVFVSDVEGIFTAKP"
FT   CDS_pept        join(complement(593873..594090),complement(593293..593656))
FT                   /codon_start=1
FT                   /gene_family="HOG000049430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638655"
FT                   /orf_name="MICPUN_85539"
FT                   /product="Predicted protein"
FT                   /function="transferase activity"
FT                   /protein_id="ACO70022.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG621238"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000199C9F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH24"
FT                   /transl_table=1
FT                   /translation="MYDRMRQEIPLGNRVPSPGPDAWIAPNAVLIGDTDLAVSVSVWHG
FT                   AVLKGDLGAVRIGAFTNVGEKVVIDSAGGASRIGQYVTIGANSSISSAIVEDNVVIGAR
FT                   SVLEPGAYVEENAAIEAGTRVEAGALIPSGQLWGGNPARYVRDLDGHEIAEIRSVAEQT
FT                   YGASQDHAAQSTPWGMAYVETEALRKALAK"
FT   CDS_pept        join(<595103..595215,595364..595452,595587..>596473)
FT                   /codon_start=1
FT                   /gene_family="HOG000129993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638656"
FT                   /orf_name="MICPUN_69054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69750.1"
FT                   /db_xref="HOGENOM:HBG317043"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013322"
FT                   /db_xref="UniParc:UPI000199C9FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH25"
FT                   /transl_table=1
FT                   /translation="GLQPTDLYGKFTWKIENFSEISKRELRSNVFEVGSYKWYILVYPQ
FT                   GCDVHNHLSLFLCVADYDKLLPGWSHFAQFTIAVVNKDPKKSKYSDTLHRFCKKEHDWG
FT                   WKKFMELSKVLDGFTVADTLVIKAQVQVIHEKPARPFRCLEPQYRRELVRVYLTNVEGI
FT                   CRRFLEERRDQLAKFQEDETRWADMREFLGTAQGKAQALLASEKADVLLKGIVKRFFNE
FT                   KEVTSTLVMDALCCGCQALDIGSSSAEDACKQFVKGRSVWLSSSQNKCSIATDDLLSVL
FT                   ERAANPDLLDPDANDSTNDANAEFGDDAVERDERRLADLGRRTVEMYALSHLFTVKIEV
FT                   AFAEAQAIKMQEALIAEEEEAER"
FT   CDS_pept        598654..599166
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638657"
FT                   /orf_name="MICPUN_109028"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69751.1"
FT                   /db_xref="UniParc:UPI000199C9FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH26"
FT                   /transl_table=1
FT                   /translation="MKSIIAARSSAFSFARRRFSASNLAYASARSDLSRAARSAASAAR
FT                   ASSLSVVRRSSSRLARVRDASGMGSSPAGGRAGDAAGSAGSDSDAPPPTTPGWAAPFSR
FT                   THVSLLSIFSIRFILASEVGDWDFPGLCLGLLSGRPRSASSLLILLRTVLNDVAISSSR
FT                   VGSPAGE"
FT   CDS_pept        599390..600544
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638658"
FT                   /orf_name="MICPUN_61935"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69752.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C9FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH27"
FT                   /transl_table=1
FT                   /translation="MATYDCDAPARSLVAVGGGDATMFAAGTQTIRGGNAIHIVSHDRD
FT                   RDVARCAAVLTHPDGEIWSMDARCSDGGSGGVRDVLATAFDGTSRGGVAIWRLPPSLDP
FT                   RGDPTRGDLARVGTIRSSDLSDDADASDGPRCVRWSAADPAVLAVVADSFLAIVRVDAE
FT                   GGPDPKPNTRGVLPPGSFVPSPSCASFHPDAPDVLAIACRGPDVHVHDARAGLDHPPSQ
FT                   TIANAHALQVRSVDYDPGAAGTRLATCGDDGLVKMWDARNFAKPTGERGAAMDGHAHWA
FT                   WCVAHNPEYPDRLLASSGGDGVVRLWRTDGGGGGDGGSVGSIGGSIGGTQLCAAASFRG
FT                   SHADTVYQAAWGRGDDPWTLASVSYDGRVVLDQVPRAEKYRILL"
FT   CDS_pept        600672..601445
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638659"
FT                   /orf_name="MICPUN_61936"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO69753.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C9FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH28"
FT                   /transl_table=1
FT                   /translation="MTEVDPCEVYVRYLPRTCDEARLRAQFEKCGRIVRARVAKDRDTG
FT                   ECKGYGFMTFSNKTEARRCVREYNEHPRNYMDGKHAVITHATGSNPNKRPVAMCSFGVD
FT                   CRRSDCHFRHPDGWDPDAEPGADAGADNEGGDGDGEVGDGDGESGGDPAARDENPSKKQ
FT                   KRDKKDKKDKKDKRETKETKETKETKERLGVAGGSAPEAEDADQPKPALTWLQRQRKLQ
FT                   QEERRVNRGHKHKLGAKARKRAKAREAKAAVAGGG"
FT   CDS_pept        complement(601553..602542)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638660"
FT                   /orf_name="MICPUN_109029"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70023.1"
FT                   /db_xref="UniParc:UPI000199C9FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH29"
FT                   /transl_table=1
FT                   /translation="MLALEEACRRCAPPLRYQDPALTMNAEQARRYREEHPEQFTAMLP
FT                   GDEEPSAVAAAGADLGRPRLGSKGVEGAALERRPSASSSPRGSIRERRPGVPRVPRVPT
FT                   PTGTGTGTSSRVGRSGAGSRSGAGATSTGSSRGGAGVAASAGSRLSTGTTSKGRSRESR
FT                   ASSSHRGGSETAARPADPPTPPPPPPPGLTYRAARLLELMWDPDGCPGGLPFSLANADK
FT                   LARQNKPEGVERIRAWCRLIGIDAEGKPNGHHLCRLLRAEYRRALEALEAHAPGITEMA
FT                   RDAEEAEANEHNRGRGGTERRSANDGRRGWAAQLCASKSKKKTTMAKG"
FT   CDS_pept        603682..604611
FT                   /codon_start=1
FT                   /gene_family="HOG000100786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638661"
FT                   /orf_name="MICPUN_61938"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69754.1"
FT                   /db_xref="HOGENOM:HBG557098"
FT                   /db_xref="UniParc:UPI000199C9FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH30"
FT                   /transl_table=1
FT                   /translation="MAVMSVSRVAPAPSTRPGARSGARAPSRGPGPSSSFSGRGSRRCA
FT                   PLRARYGMTLGEWCDENGEYGDKLLEEWYDPDRTVEEVTRGNRVYKGLWRCSAGCTKDG
FT                   EAFTWEATVGHRTNSERPRGCPGCARKSPTDQNNLLQWCQDNGEHGRKLIEEWAEPTLA
FT                   MKDVTPGSTKKLSWRCLAGCTEDGEAITWEASPNNRTGSLRTGCPGCAGKSPTDQHNLL
FT                   QWCQDNGEHGRKLIEEWAEPTLAMKDVTPGSEKKMSWRCSAGCKEDGEPFTWEARVHDR
FT                   TGSDRTGCPGCSPSTPISLQKRLGKVAR"
FT   CDS_pept        complement(604788..605861)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638662"
FT                   /orf_name="MICPUN_109030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70024.1"
FT                   /db_xref="HOGENOM:HBG609571"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000199CA00"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH31"
FT                   /transl_table=1
FT                   /translation="MVDLDPEVSSGYTCLNELENPGAGATALGVFSILFSTCVGIPQAY
FT                   KIWRLKSSRGVSFLTLGLGNIGSFLYVLNLVILHYNQITLSLSRDFTFWVSAQRSLTFV
FT                   WVELFNALSMLCIYPIASLYVVDEPCPVKIPSLGINTVYSMRDAVYYGFLVQVGVVFVA
FT                   WLPAVFVFSVDGRCEPLALYGNFVGFLVGLIIVVKFLPQLRESWYARGSYSLSYLTYGV
FT                   DAAAGIVAWAQKVFVTNERVSSWLPPLFLHALEIFVLCLNFYHDRAGHQDMSRRHGPGH
FT                   DAHRRRASGDERDDDPEARYHHPGRGTAAPLGYVDDGGYGAGRGTGGGGRDWDTQRLLR
FT                   PLSPSGMRRQRSFTDFL"
FT   CDS_pept        <606372..>607559
FT                   /codon_start=1
FT                   /gene_family="HOG000043480" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638663"
FT                   /orf_name="MICPUN_67124"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69755.1"
FT                   /db_xref="HOGENOM:HBG288938"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199CA01"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH32"
FT                   /transl_table=1
FT                   /translation="LGISPPKLLRQTFESLGATYVKIGQFVASAPSVFPPEYVAEFQKC
FT                   LDATDPTDFAVIKRTVEKDLGVRSIDDVFASFDAEPIASASVAQVHRAVLRAGNKEVVV
FT                   KVLKPDVEDTLKADLSFVLVVSKVLQFLNPELSRTSLVDIVGDIRASMLEEVDFKKEAR
FT                   NIDAFRRYLDDADLNSIAKAPYVYAQFSGERVMTMEYFKGVALTDLDAIKGVSRGDPEA
FT                   TLVNALNVWFGSVLACESFHADVHAGNLIVCEDGKVGFIDFGIVGRIPAEIFGAIQAFF
FT                   QATAARDYDRMALALETMGATEGTVDKAKFAADLRAIYEALDAIEPTVVVQGEAAAVSV
FT                   DQAQVTRLATDLVTCAEENRVKLPRAFGILFKQLIYFDRYVQLLAPDMDVIDDDRV"
FT   CDS_pept        complement(607700..610264)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638664"
FT                   /orf_name="MICPUN_61941"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70025.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI000199CA02"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH33"
FT                   /transl_table=1
FT                   /translation="MGDGKYRLVTDPSEGPKLFQIDTRVTSRGETAVLLTGIDCAERVV
FT                   CHEAVSFDLAEGEFVFRLGAGNAAAVLDQLLQQGALKINRVFDMGGGRPGPVCVLTPGG
FT                   SPQPPFGAKSPSPIPDDAGASDGGFFGLQRAAPGGQGPPTPQGPGGAPNAGAGLLAMLQ
FT                   GGGGGAGSPLPLGTPNGVSPSPTAPPPHSTTPTPPRHMMPRTTRGSAGGGPRGRGGVGE
FT                   VGPEDALFDATGGRSSSSAAQNDHHRSTGTTTGKPPRSPLVANGRSSPSAGAATSALVG
FT                   GGGGGADLLGILDGARRSPGPTSRPGPPGTDAAGAGAPTSEDLLAMLGGGGARRGAGSG
FT                   GVGSGGSGAGSSPAPAGALSAAELEARMAGAAGAATPPVGSSQSGGGGGGGGGGSVDLM
FT                   SMLGRAASRGAEGAEGADSNGGLNVSAIDLSGADGGLGFDVDDDLGELLGGGSSTAAKN
FT                   KPPPENAPAGGGGDWPVSDGLTHREEERRAQADGEEAELARRVADAVKNGSDRLFEKPN
FT                   GKKSAFEPGAMATEPLPEDNVGRQLLKKQGWEPLVDPVTGAVVEEAPVPIPGTLPGRAG
FT                   LGAYDRETARLQAAAAASSADDGVDELVDRQSKLLAMMGIGERKDGVKSSIGKRREGSS
FT                   STKASSAAGEDSGDESWAEDEKPRERTKVEHSYSHAELKKLNVNCDAVPAGVDVSVFEE
FT                   ADRRKVEKEKAEAAEKKKREKAEKDAAEKERKEKAKAEREEREKAEKERKESARERVAR
FT                   SKSTDQLDDAPALGGALGLGFLGINSSSNSLASQEDAAKKDDAKEGEKKGMTVRELAAA
FT                   LMAELRGLEDRVEVLGEEEGPMVALKLGAALEAVRQEPFKSI"
FT   CDS_pept        complement(610463..611494)
FT                   /codon_start=1
FT                   /gene_family="HOG000223641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638665"
FT                   /orf_name="MICPUN_85395"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70026.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG585708"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI000199CA03"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH34"
FT                   /transl_table=1
FT                   /translation="MNIPDGIPTKLDAEETDNVRLFRDATPSVAFITNKQLIQSRYSLD
FT                   ATEVPVGAGTGFVWDDKGHVVTNFHVVKGANQLAVTFQGDSKTYEAKLLGYDEDKDVAV
FT                   LKVDKPDTRPIPLGKSSTLLVGQKVFAIGNPFGLDHTLTTGIVSGLGRELPSGNTGRPI
FT                   LGVIQTDAAINPGNSGGPLLDSRGRLIGVNTAIYSPSGASAGVGFALPVDNVKGIVEQI
FT                   IQFGRVTRPVLGLVLAPDGALQQLIGENGRNAGVLVLGVPEGGPAARAGIVGTIRDTLR
FT                   GDITLGDIIVRFNETEVKNSSDLYRALDMAQVGQDVKLTVRRGGAVVTVDVKLGEKVTK
FT                   FDA"
FT   CDS_pept        complement(612015..613145)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638666"
FT                   /orf_name="MICPUN_61943"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70027.1"
FT                   /db_xref="UniParc:UPI000199CA04"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH35"
FT                   /transl_table=1
FT                   /translation="MPIVIDDESDDDLPLFARPVARMPANKDGPGEREEPDWMKSFKSP
FT                   TSQALNADDDSDDGIMDIFQRHKTEEKFEMKSTPAKMVRSPPANAPKVEDDDKDDADVE
FT                   DEPIEIDDDDDDDDEAVGDGDGDDDDEEPAAKTKPKTPTPKKLGPQSANADRASVRAQA
FT                   EKTAGTSTPNRPGEVPLFMPSAVNRNKVFFELEGTGEAVDLEGDVGVVGRLLSNASEKH
FT                   GSGLQMDMKGVIYNARILPTPASVVILAVNANEAKVESITHDFVQLRRDPVANGGLGAT
FT                   LDGYLGVDSDDEEGAHRAAAGHAAAAAVRAMDDVSDHEGDGGAGKRKGGGGGSGARKSQ
FT                   KLGADGKRKATGGRGGRGGRGGRGKAKKKPAKRPKK"
FT   CDS_pept        join(613331..613380,613547..614333)
FT                   /codon_start=1
FT                   /gene_family="HOG000241575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638667"
FT                   /orf_name="MICPUN_106152"
FT                   /product="Predicted protein"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69756.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317868"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="UniParc:UPI000199CA05"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH36"
FT                   /transl_table=1
FT                   /translation="MANSADIILRSQGLLKKYEHYLPDEKPMAPVTGKVDGFTTMFSSL
FT                   QFNLKDLIAKAEEIKAEKNKAAIATANAEIRRGKNYLRGELPKLRKMMEKKMRGLTDEE
FT                   KEERVSQVDNFEYQIECVPDGVNKAPPKAPKPRGAGNDAGGGTGGGARRHVTINMEDLE
FT                   KGEGVSMEHSKESRAFRDEFEEAKQRQDEGLDEISKGLSVLKNLGGEMDDEIKRQTPIL
FT                   DVIDEKLDSTTSEMRTANGKLKKVITSMRSTRNFCVDVILIFLILGIAMFFFNSFG"
FT   CDS_pept        join(complement(615457..615606),complement(614611..615207))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638668"
FT                   /orf_name="MICPUN_109032"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70028.1"
FT                   /db_xref="HOGENOM:HBG557185"
FT                   /db_xref="UniParc:UPI000199CA06"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH37"
FT                   /transl_table=1
FT                   /translation="MTAVATPTDLKRLAFVESAAVSSYEYLTGSAYFAKACGYYSNAKE
FT                   TNALKGSITKIEDLIKAYGMPVVAKVQEKYPEYMTNVDGKVDVVVTKAVDIWTSKIAPS
FT                   APVAMAKSALAAYPVKVEELLAQREEYFKKIEAFLADLKAKAVALPADVSAAITKAIAE
FT                   ARAKIDDAQLFEKVKTAYETALKYPAVVAVLEKTAPVAAKAVEVAGPYYVKAKDIATPY
FT                   VAKATEVATPYVTMVTDRFKKVPELN"
FT   CDS_pept        complement(616035..617534)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638669"
FT                   /orf_name="MICPUN_61946"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70029.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="UniParc:UPI000199CA07"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH38"
FT                   /transl_table=1
FT                   /translation="MSEYETRPHVSGLKRKALVGVEYVPKKEDMAEGPFVCRLGATGGL
FT                   PPPGTEFRAWRKNLPYRGHMMLLRGRTDGVDYIGANHAPLGHYPAGDACKYLLGKLVPV
FT                   GKGKGGGGGGGDDDAVEYELKLMPVGGSRVIDLECRCHALDYNEPEWDGAEDLNDYQVR
FT                   AAHNARLLKAFASAKQQRKVAKIMAERRVDGNTIAAPDAMEATLKRATEGEMDASQLSK
FT                   LAGERRNIPEHNPSATNAIDAYPFNLFPMFALLEKRTKWKEMVKAAKKPSAMKELRDGG
FT                   GVDDFILGLVPKLAEHSGGATDREENDRQKTRAKALAALDFLLVFLHAKDHISEKRERR
FT                   KDVEGDDDDAYTGNKYLSWTTRERVDAGIQRACVDAFMEEQHSGGTATAGGVAPGPDEP
FT                   RRFSRPKAMKDLVCLHVILMALRVCNYDVDLDALGARMKMGVKALAPLCRELGCAVKKS
FT                   AGKKSDGGGVTRATLPLDGTKTLQDVLPEIKRRLKAAKKRD"
FT   CDS_pept        617890..618345
FT                   /codon_start=1
FT                   /gene_family="HOG000043436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638670"
FT                   /orf_name="MICPUN_85699"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="cyanate hydratase activity"
FT                   /function="hydro-lyase activity"
FT                   /biological_process="cyanate metabolic process "
FT                   /protein_id="ACO69757.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008824"
FT                   /db_xref="GO:0009439"
FT                   /db_xref="GO:0016836"
FT                   /db_xref="HOGENOM:HBG317643"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniParc:UPI000199CA08"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH39"
FT                   /transl_table=1
FT                   /translation="MTRNDVTELVVFNRMKKGITWASLAEACGKSVPWTTSALLGQHQM
FT                   SKEMAQAAGAMLDLPDDAVMLLQHVPYKGTGSIPVGQTVPTDPLIYRFYEMVMVYGSTY
FT                   KELIHEEFGDGIMSAIDFDMEFGRQADPNGDRVKITLTGKYLKYKQF"
FT   CDS_pept        complement(618463..620046)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638671"
FT                   /orf_name="MICPUN_61948"
FT                   /product="Amino Acid/Auxin permease family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70030.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199CA8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH40"
FT                   /transl_table=1
FT                   /translation="MGSEKDPLIPKDVALTDSGRPVVKRSVHWALLSFLILGEIAGQGV
FT                   FALPLHLGRLGWFAGTLTCFGTLAINNISLRIMYATHTRFPEAKSQGEAAGILFGPVGQ
FT                   GFIRAVVHLYLFTIQSAYLNSLGRTIMNEFYGTRVCLPLATGIASLIVFPFAQLRSYGD
FT                   ITGISIASFAAVVAVVFLIVGRSREVDPDPTSSTSFWPPLGITDSLTSVGGFFFASGGG
FT                   QCAFFEYLSEMSRPEDYPKTLWLTTPALFALYYGTAAAMYARFGDKVPGFLLDILPFDA
FT                   SRLVGNTLFFFHIIVSFVILNSALLRAYARYSVTDSSNAARRDWAGLSAIVVLGAYVLT
FT                   NTVSLFEDLTAAIGSLFVSTTVLLIPPAYLYAAHWFKRREDPERGAIGRENNTPVKRSP
FT                   SLKKLGGFIGKFSPMKKGRKGGEGGDAGGGGSSGGSTPGESTPRPTGFEVHWSVLWSLR
FT                   VMLAVAVVAVPVLSWGSLVRLVQDMATLAPPFSCGPCVTKECIENERAESAMAYLGLLE
FT                   RRVRGAALRG"
FT   CDS_pept        complement(620261..621184)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638672"
FT                   /orf_name="MICPUN_61949"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70031.1"
FT                   /db_xref="InterPro:IPR019399"
FT                   /db_xref="UniParc:UPI000199CA8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH41"
FT                   /transl_table=1
FT                   /translation="MTGGAATRTVGSGGTATRGGPASSSRGAGSVGSAASSKPHAASHN
FT                   VSAALSHRSSAGLAGVVAAAREKLRPVDPNLQERFCVHCRGPHRRNAPPHPPIAANPWR
FT                   MECEFSVMYKASELPADKDSGSFMGGKDCLRWKVDGAPFEDFDIAYWLPIFVEGAQETT
FT                   EPMRLIAITGSKQMIQADWSVIGPLIPAIVSRTRRALNSKTPAATAACLDIVRCLLTTH
FT                   PGACDAMMRCDGYRRMAPVPNLFIKSKEMVRTGYELKMVGGQKERLCDVIDDVLNLMAR
FT                   QGGARGLALLKSYIPTFTPNKPAVPR"
FT   CDS_pept        622298..622969
FT                   /codon_start=1
FT                   /gene_family="HOG000264969" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638673"
FT                   /orf_name="MICPUN_109033"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69758.1"
FT                   /db_xref="HOGENOM:HBG607822"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniParc:UPI000199CA8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH42"
FT                   /transl_table=1
FT                   /translation="MSPRSMAYTGIFMVSGFIVASVFNTNGDLGINSDFSAIDNMVTPA
FT                   AETLTRWLSIAGAATLGFLGIGQVASAASKKNDGDKTKLHKTLDALAEALAGFTFGLGL
FT                   TVSGMRRAAKVSGFLSATRASFDPSLMLVMGGAMALSIPGFAIANKKKAPACTREFSIP
FT                   KNRKIDDKLMLGGVLFGAGWGLAGMCPGPAIVSLAARPTQKLAAWIVSVLGGMWIQKYI
FT                   P"
FT   CDS_pept        complement(623348..623734)
FT                   /codon_start=1
FT                   /gene_family="HOG000232972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638674"
FT                   /orf_name="MICPUN_102712"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70032.1"
FT                   /db_xref="HOGENOM:HBG557189"
FT                   /db_xref="InterPro:IPR019616"
FT                   /db_xref="UniParc:UPI000199CA8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH43"
FT                   /transl_table=1
FT                   /translation="MLHDENNEHFPEVLRERRRFYRETSKEQDFWIVPNPAFLDAMPDV
FT                   KKKVRQPCVAVVTTDKVWNDFVKLRLDRVYKGAVEGTGVECLKSNELIAKDAFKAPDPS
FT                   KWTAPYLKYAPGWWEAFYPGNEDA"
FT   CDS_pept        <624719..626005
FT                   /codon_start=1
FT                   /gene_family="HOG000264970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638675"
FT                   /orf_name="MICPUN_69331"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69759.1"
FT                   /db_xref="HOGENOM:HBG284971"
FT                   /db_xref="UniParc:UPI000199CA8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH44"
FT                   /transl_table=1
FT                   /translation="TAESVVRGMYDAINRRDVEAALAFVDDDILYEDFNFPVPFKGKER
FT                   VRKLFEESCDGIPDDMLFIVDECTDGGGLSVGMTWYVELEGEPFPNARGASFYRIDPTS
FT                   GKLVYARDVVEPPFKLGDVSFSIIRAVAPAVKAQLRRAREARGDTEAAPKAATANATAA
FT                   IDPPSGGTAVDDEPGDAVAAAGLYALGAAYWFVLLLSPPGWQGLPGEPAWAVAPETLAE
FT                   VVAESTDFFFVLPALNKFGIDLLGPAPAVHPVTLGVFNFAEAFIFMLLPLMLMTRKGRD
FT                   LPTVKAWSVAMFLTNALMLPYLGARAAAPAPAAWREAKADGTAAGIAEVARGEKGLLSR
FT                   AFGLVGLGVGVLSVYWALFEDPAVGGDLAARGEYLRQLVTEDRVSLAFVVDIALFSVWQ
FT                   AWFIGEVDEEAPAACRFVPYWGLAAWLML"
FT   CDS_pept        complement(627593..629977)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638676"
FT                   /orf_name="MICPUN_61953"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO70033.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199CA8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH45"
FT                   /transl_table=1
FT                   /translation="MARPWLVAAFLLCVASAHTARALDADAAVIDLDDSNWKDLVIENG
FT                   REAWVVSFGADGCAPCAQMAPTFAKAAKHMGGIVNFGHVHVGDASIKLAQSLGLTKVPH
FT                   VVGLPAHKTLNPYTKKSEKIAVEYRNSTASHKRIAEFAATLLPDDRVTRIADADALARA
FT                   RTDASHLPVAVLVTAKETTGSLFKSLSLRFRGRVAFAEVHVSDAPDVLASIPGLADPAT
FT                   IEPPALLLFPPAGGEGGDVERHGGEMNARSLAAYIESKAADAAPEDDAPEVFDPRGGKV
FT                   GAGGNNGAGPGGESPGGESPGDSDDGSLFPSVTPARFEELVLKAPPVAVVAFTKLGDRA
FT                   CVDVSRRLASSAIKGVNGRVSLMEVNASSPEGAKLAERYAPETFFSANDQSESGEGTED
FT                   DKKCVAAVLFPHGTDKEDADPDTYDGDVDDAEAFAAWVREAIPDFTMPLPQPRLVEAFM
FT                   QNDPFAPKVILFADAKPDSALGRDFIALAANFHQDFQFATIPSGDKVNAAKFGVQSYPS
FT                   LRMMFVPPLKGGENPDTNTVQMQVAQFPGYTLDYLYMHSWLDQIRAQVLGKDPTGGDGG
FT                   PEKGAADPVKLVGTPKELDAECGGAGLCVVAFVPQGTEDTELRTAIVQAAADDKSDRPV
FT                   KFVVVDPVKQRSFAAAFEVSADDVPAVAVVSMRKNRFATYRATFSAERIAGFLDDVLSA
FT                   KQRTRMIQEIPKLVPGGEEPEEVFDEDVEEEFDLADIMGEDVEGEVTNEERLSRIEREL
FT                   AEEEAEKKRKKAEEEDAAAAAKKASKKKKKKKRKGKAHSEL"
FT   CDS_pept        join(630348..630467,630760..630833,631007..631211)
FT                   /codon_start=1
FT                   /gene_family="HOG000242632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638677"
FT                   /gene_name="PSBR"
FT                   /orf_name="MICPUN_61954"
FT                   /product="Photosystem II PsbR protein, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="oxygen evolving complex"
FT                   /cellular_component="thylakoid membrane"
FT                   /protein_id="ACO69760.1"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0042651"
FT                   /db_xref="HOGENOM:HBG609639"
FT                   /db_xref="InterPro:IPR006814"
FT                   /db_xref="UniParc:UPI000199CA90"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH46"
FT                   /transl_table=1
FT                   /translation="MAAIMSTSSAFAGVKVQARVAVKSQRAQTVIMANASGPKRGTKAQ
FT                   GGQAGVGYKGSTEAGSAPKTRSGKAGYVYKLGLRNGKANVDEYSPIYTPSEFKTDGDKY
FT                   EGDLKLAAGAVLGVIGTGALAILATSAL"
FT   CDS_pept        complement(631627..634185)
FT                   /codon_start=1
FT                   /gene_family="HOG000264971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638678"
FT                   /orf_name="MICPUN_61955"
FT                   /product="Bromodomain-containing protein "
FT                   /protein_id="ACO70034.1"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI000199CA91"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH47"
FT                   /transl_table=1
FT                   /translation="MTDVDMAPAAPEPVAPPFAQPSDPTTMNGGDGRKQLWPPGSEMQI
FT                   FSEKLCVLLTPNMSLKAPKGYAWVPEGDHDFVAEEWEERKRVKKNPNARVMPPPKAKKA
FT                   KAAPVVRMPDIPTFEPVAPLDVDEMDFTGLTEEEIKAKKKEIKRRKKEALMAQLAAINA
FT                   AQGKLEEAEAKATGTPTMSAHREEGKRPSKPVNRLVDNIARQAQSAAPGSGGKRQMKKV
FT                   AKRDKKGNVITHRMLKAQEIEGIRAIRHKALMKECRECLSSVRKHKYAWAFNKPVDPIA
FT                   LHIPDYFDIIKNPMDFGTIKEKLDKKSQQNGAYSGPQEFADDMRLVFDNCALYNTPDSD
FT                   AGLMGSTLQQEFEKAWLAQNVDAKIAEEEAVRAQEDAVIASTSDEPVEEEVLAESQQVS
FT                   EVNRQLAEVQRQLEELKKQQSMSNMAAMSGGGGGWGASTPPSGGGGGAPKRKRVDDDDY
FT                   FMEEEDYEEYIPAPRGGSRRGGGAPRSAPKPRAAPRATGGGGGGGGALPNRDMSYAEKQ
FT                   ELTELLGELPEDKQARVVQIVAERHAEMGGAEDDLIEINIEELDSVTLWKLDRYVRSCL
FT                   KPKKKKPTQADMLLEAQRLEAEAERELMQVEASLGVGQPIVPPGSMDAAAPSPAQPASK
FT                   AADGDATSSSSDSDSDSDSDSDSEDSAEGGGSNPKAGAAPAAPPQPAAGGASTLVEVSS
FT                   TQRVTEDLALKQNASKKPVNVQNADGWANLADDNGAAGAPAAAAAKPAADIPDSLWSEF
FT                   ETMAQQKTDREKEREQEEAREKAAAAAKEQAAREEEERKAREAAEAEEAARRAEEEAEA
FT                   AKRRALEEERARARAEVDGMAQTVDMAPEKVGTMMKEFEG"
FT   CDS_pept        complement(635036..635566)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638679"
FT                   /orf_name="MICPUN_61956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70035.1"
FT                   /db_xref="UniParc:UPI000199CA92"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH48"
FT                   /transl_table=1
FT                   /translation="MSPKAMLSGLTGQVAKPWFPLVILVLSLANVFIVFLSGGVTALFV
FT                   STCAARGRKGFMVAAVCNALGALLGYWIFGEIVERNGTDWVKAQYPDVFASDNWQRVQD
FT                   AMRAWGWIGAVAISAAPAPLHPLVVFGALTGVGRWVMLSAVFFGRLIKYAGFGFVATAA
FT                   PGTFRWAAKGKRE"
FT   CDS_pept        635694..636509
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638680"
FT                   /orf_name="MICPUN_109037"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="ACO69761.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR016068"
FT                   /db_xref="InterPro:IPR016069"
FT                   /db_xref="UniParc:UPI000199CA93"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH49"
FT                   /transl_table=1
FT                   /translation="MLAVARLSAAVSQLRVSPRSARAGAAHHSRRVRTRRVRSAISTTN
FT                   MTTTASWVDEGDFEALREAMTTYDEQRDTVIKRARDITKASKVAIYCLHRGEIDKADAQ
FT                   IATAAAVADELLPIVSANPPLRGGSYSGGLEEYAEAVVFAHFIKHGAVPPSTHPDLARC
FT                   DRDEYLGGVLDFTGELNRFCVAKATVRDVTAVNKCREIVDSLMGIFLKFDFRNGALRKK
FT                   YDSLKYTLKKVENTLYEMSLTSAAAKRSREDAGLDDDVPRKGGEVGEDE"
FT   CDS_pept        636678..637352
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638681"
FT                   /orf_name="MICPUN_61958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69762.1"
FT                   /db_xref="UniParc:UPI000199CA94"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH50"
FT                   /transl_table=1
FT                   /translation="MSRALTAPVGATGTHARRRCAASRCSSSGPTTRWTRATRCDASVG
FT                   KEDAGNGSRPKRPARVPRRVPRPDAGGGDAPAPTTKSKPAVRRRTVAATDRGKALTDEE
FT                   KAVRMRELRERAAAPRVAELAEAVRRACDAGEYKPAQAAYAELKAVPDGVVPPDVFETM
FT                   LSLCARLRMPSSAEGVFIDSLAAGAAPTESACWKLLETFESSGESRRAEKVLAYMESRG
FT                   IG"
FT   CDS_pept        complement(637438..637692)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638682"
FT                   /orf_name="MICPUN_85945"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70036.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG557195"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199CA95"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH51"
FT                   /transl_table=1
FT                   /translation="MDKRPGSFYKILGVSSASNAKQIRRGYRKAAGRWHPDKWQHEGGE
FT                   SLARAEAEFRRVSAAYEVLGNPSQRRAYDSDPARFEASL"
FT   CDS_pept        complement(<639629..>639809)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638683"
FT                   /orf_name="MICPUN_74694"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO70037.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199CA96"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH52"
FT                   /transl_table=1
FT                   /translation="FREVFDLVDKDKSGAIETEEVEELTKLLGLDLTRDEVELLVREID
FT                   KDGNGEVDFEEFLLV"
FT   CDS_pept        640350..642008
FT                   /codon_start=1
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638684"
FT                   /gene_name="G6PDH"
FT                   /orf_name="MICPUN_104959"
FT                   /product="Glucose-6-phosphate dehydrogenase (G6PDH)
FT                   chloroplast"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69763.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG322449"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI000199CA97"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH53"
FT                   /transl_table=1
FT                   /translation="MASNHHRAGGAPGVRFEAARTASRRPARSHRRSSVAVHAAATFPE
FT                   LTDDESLADIAKSAAKGESLSICVFGASGDLAKKKVLPAIFSLYYDRHLPENVRVFGYA
FT                   RSKMTNEEFKEKIRESLPCRISAAGNCDDVIESFLERMHYVSGLYDDPKDFKALDQAMA
FT                   AEEAKMGKKAMRIFYLSIPPSIFVPVAQNAARECSSSTGETRVIVEKPFGRDLESSREL
FT                   TSSLAEVLAEENTYRIDHYLGKELIENITVLRFSNIMFQPLWSRAYIRNVQICFSENFG
FT                   TEGRGGYFDNYGIIRDVMQNHLLQVMALFAMEEPASLDAEDIRDEKVKVIRCIRPIEMD
FT                   NVVLGQYKGRRDGDKQLPGYLDDETVPPGSKCPTFAAMALFIDNARWDGVPFLMKAGKA
FT                   LHKRQAEIRIQFHHAPGKLYKKQLGSASEMNSNELVIRIQPDESIYLRLNSKIPGLGMR
FT                   LDQTDLDLQYKTKFSEANLPDAYERLILDVVQGDKRLFIRNDELEEAWKLFTPLLKTIE
FT                   DDQMAPELYPYGSRGPIGAHYLASRYNVRWGDTYN"
FT   CDS_pept        join(complement(642574..643449),complement(642225..642317))
FT                   /codon_start=1
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638685"
FT                   /orf_name="MICPUN_102719"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70038.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CA98"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH54"
FT                   /transl_table=1
FT                   /translation="MKVEHDYPVPKLQPGGVLVKNKYSGINFIDTYHRSGLYKRELPFI
FT                   GGQEGGGFIAAVSPEAEAQGVKVGDRVAYSSVFQTYAEYTAVPANKVVTVPEEVPLDVA
FT                   VSCGVQGMTAHYLTHSAHAGLVKPGEWMLIHGTGSGTCQWAAQMAKLRGYKVIGTCSES
FT                   KQDIARATGVDELIVYKEAQGTSYEDYTSVDLVPKVMEITGGEGVKAVIDGIGLATWET
FT                   SIEVLARRGIFVSFGNASGAVPAFPPLRFINKSGFLTRPKLNDYTVTREELMSRANDIY
FT                   GWLAKGELKVVVDRCFPLEQAKEGHDYLEAGKSRGKVLYEI"
FT   CDS_pept        <646381..>646533
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638686"
FT                   /orf_name="MICPUN_74929"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69764.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199CA99"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH55"
FT                   /transl_table=1
FT                   /translation="ESADCTICMTTLNEPGETLCRLDCGHGFHVECLESWLHNERTCPN
FT                   CRTKVI"
FT   CDS_pept        join(complement(648603..649232),complement(647988..648500),
FT                   complement(647553..647936))
FT                   /codon_start=1
FT                   /gene_family="HOG000028944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638687"
FT                   /orf_name="MICPUN_85686"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO70039.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG306853"
FT                   /db_xref="UniParc:UPI000199CA9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH56"
FT                   /transl_table=1
FT                   /translation="MRAAACLLHGGTPLAVSIRQSLGAARRNPVAAGWPCVRGRRRAWT
FT                   SASSSSSSSSSTTASAHASPAPPRSVMFVSFLWPEASSSAAGVRTGSLLRAFQRWGWRV
FT                   HFVACARPNEHESILAASGVATHHVPPNRGAEFEAALAAANPDAVIFDRFMAEEAFSFR
FT                   VRAACPGAARILDMQDLHSLRYARQDAVKAGVDASTARRKAAKRNRGLARELASVHRCD
FT                   LTMVCSPTETRLMRDVFGVPARKMIPASFFCDLPEDARTAAPGFEPRHGFATIGTFHHP
FT                   PNVDSARWLAAEVWPLIRRELPTATMRVYGAYPTAAIESLHAPKDGFLVEGFAPTVGGA
FT                   MDDARVLLAPLRFGAGIKGKIVDAWMRGLPAVTTPVGAEGMTAAAWGGRWASTTAADIA
FT                   RDAVELHEDRTAWERARATGFELVEALFPAERNLGAVRDAIEGLFGASEREGCDTALEE
FT                   LRREDFTGAALWHHSVRSTEYFSRWIEMKETGGESGTPAAVESEEEEGGT"
FT   CDS_pept        649671..652052
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638688"
FT                   /orf_name="MICPUN_61965"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69765.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniParc:UPI000199CB11"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH57"
FT                   /transl_table=1
FT                   /translation="MEASGFLSGGDAAGASAVPTTTTTTVLEVPATIEENAAADLSSMP
FT                   AVGAFNPSPFQSVENFVTFATDEAEVEIEQEGNVATFASASVPATPRVSVTWAATEVES
FT                   IDAVTDAVTEYVPPSEVPSVVEVTLTLPPVVPEDEYIVRVPGKCLPAGECIGPLPEFTA
FT                   RERIRHKVLLAGLCATRARQQAVGALMRHRLCPSVVKNGVANLRGCVCTNQTCGDYFRL
FT                   ENEAAELLMLEEAQRTLRGVDPARWAAKYTGPGQCPWPVKDDETEAAMRKLGLAPSPTC
FT                   SVRLICSYEEHLRLVRMAIVGAKSHLNIMSCYFFANEAPFVNVVKHLLPDAAKRGVRVR
FT                   LLLDALPAQSALVKAKLWGPVTKYAQGAKQRLQFLDFYTGTLPEAVKSCPPGSFRVAFF
FT                   KATDKTNGHAIKSHMKMFGVDGRLAIVGGSNMLPTAPTGNNDCDCLVDGEAAEALDANF
FT                   AKVWLEQTGEDVSVTPAHEEEAAAQAAAAALARAAAAGHSTPITPAEERVLEQIGDAPA
FT                   AAVPTLDERHPLEETLAFQWHERNVRFVDVMSRPGSQGEDAILRGVIGLIDSAKEEFLM
FT                   CMGFAALHVPLVNALARATRRGVRVRLLLNSHFSCDLRPPMTDLIAGARALLVAAPDAE
FT                   VYLTGPREEWDVRDEEARGECEAFEPKYATGGCGDPETAPYKHPFTFVHAKYCVADRKR
FT                   VSLGSWNAWARSAFHEAEMNLFLESEELGEVMAEKWLKACRLHAARVKDATKLAPGGGI
FT                   FAPRGCKLCTPFGGFVGDAVERAMNGSLPLEEEKLTAASA"
FT   CDS_pept        join(652193..652270,652378..652437,652544..653116)
FT                   /codon_start=1
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638689"
FT                   /orf_name="MICPUN_109040"
FT                   /product="Predicted protein"
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69766.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="HOGENOM:HBG716160"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI000199CB12"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH58"
FT                   /transl_table=1
FT                   /translation="MGRHPRTLLVRIFNGLVGYSDGLAMQESLHAARRASTVHDTLLVL
FT                   QHKHVYTIGKRPNERNILADEDELRACGAEVHKTRRGGDVTYHGPGQFVMYPVVNLREA
FT                   KVGARAYVEGLEDVMIDCARGFGVRARGRVPGMTGVWAGDKKLGAVGVQISQGIASHGL
FT                   AMNHSLSLEWFDRIVPCGLEGRAVTTLERECGTRLEHEAVQASLVECFARRFGYDDVHA
FT                   RRLDADGWREASIF"
FT   CDS_pept        654529..>655023
FT                   /codon_start=1
FT                   /gene_family="HOG000200879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638690"
FT                   /orf_name="MICPUN_85999"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69767.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199CB13"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH59"
FT                   /transl_table=1
FT                   /translation="MLDAFVHRGGGGGGGPIDGGFHCLVFELLSHSLYDVLRSTSFKGV
FT                   SLGLIRKFARQILSALSFLRSRGVVHCDLKPENVLLVSADRSAVKLIDFGSSCLVGDTP
FT                   DFTYVQSRFYRAAEVILGLPYGSEIDSWSLGCILVEMHAGTPLFPGKDERDQLGKIAEA
FT                   LG"
FT   CDS_pept        join(655888..656120,656193..656739)
FT                   /codon_start=1
FT                   /gene_family="HOG000264910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638691"
FT                   /orf_name="MICPUN_85755"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69768.1"
FT                   /db_xref="HOGENOM:HBG557198"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniParc:UPI000199CB14"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH60"
FT                   /transl_table=1
FT                   /translation="MSYLRNLRNGDEVYLVGTAHISRKSADEVRNVIRSVRPDTVFLEL
FT                   CDARAAAMRRSMSGKSDEGGIPEPLRQLLSALGAPGDLGEKMLGAGLKTVYNMFRMSGM
FT                   DPGKEFKVGIEESDRIGARLVLGDRSQELTIRALRDAITLPDILRMITGGGSMQWRDVD
FT                   PQLVERFKRVDWNDPESAVELLKTREAVRALTGQMRREFPRVASAMLDQRDDHMTDGLL
FT                   NKCSGRTVAVVGMAHMDGIESRWRDAMGGDGGVTLIS"
FT   CDS_pept        complement(656832..657296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638692"
FT                   /orf_name="MICPUN_109041"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70040.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CB15"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH61"
FT                   /transl_table=1
FT                   /translation="MSGKLAAKYFGKNGGNLGGDGGHGRWMRYHQTKLANSVFAAELAR
FT                   RLRARGSKVMALCVAPGYAATNLQVTTHKDGGLNAAWLSWIFAQSVEDGTMPLLKAMLD
FT                   DRLESGAFMEPKSMIWGLPVVKELKGGCVSEANGKLLWEESEKAVGAFTL"
FT   CDS_pept        complement(658900..661731)
FT                   /codon_start=1
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638693"
FT                   /orf_name="MICPUN_102725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70041.1"
FT                   /db_xref="HOGENOM:HBG329959"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI000199CB16"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH62"
FT                   /transl_table=1
FT                   /translation="MRKKVDQRIRTLVENGVKLNERSMFVVVGDRGREQVVNLHYMLSK
FT                   ATVRSRPNVLWCYKKELYLSSHKKKRVKQIKKMVARGLMDAENEDPFSLFVASTDIKYT
FT                   YYADTQKILGNTYGMAVLQDFEALTPNLLARTVETVEGGGIIVLLLSNMESLSQLYTMT
FT                   MDVHSRFRTESHQHVVGRFNERFILSLGFCPTCIIMDDELNVLPISSHVQNIQPVGNDT
FT                   EAGAEPEDLKELKQSLEGTDPAGALVSCCKTLDQGKAVVTFLDAASEKTLRSTVALTAA
FT                   RGRGKSAAMGIAVAGAVAMGYANIFVTSPSPENLKTFFQFILKGFDAMEYKEHLDYDIV
FT                   ESSNPAFGKAIVRINVHRAHRQTIQYILPQHAERASSAELLVIDEAAAIPLPTVQALLG
FT                   PYLVFLCSTVNGYEGTGRALSLKLISNLRREAAGVARAGDAGAGGGGRLLREVSLAEPV
FT                   RYSFGDRIEAWLNGLLCLDAADHTPPLTGHLPPPSDCELYEVNRDTLFSAHKPSETFLK
FT                   RMMSLYIASHYKNTPNDLQLMADAPAHRLFVLLAPPKSAQVLPDILCVVQVALEGAINR
FT                   ASASSALAAGQSPQGDLIPWTVATQFQDPEFPSLTGARVVRIAAHPDLPGQGYGSRALQ
FT                   QLHAYYEGKLTNLAETDVPAQTEAPRAAPVTADGGLLQEQLEPRCELPPLLCPCGDQRP
FT                   ERCHWIGAAFGLTDSLHKFWSRQGYRPVYLRQTPSDVTGEFSAILIRPLDHEGNDEEDG
FT                   AMTTAPEWLVAFNADFKQRFTALLGGAFRDVAPGLALSVLAPKLTFDDDAKAEGAPASA
FT                   VRRSDGQPITAHDVKRLEKYAQSLVDHHLVADLVPPLARAFFAGQIPTTMSYSQVAILL
FT                   QLGLQYKEMDDVAKGLGLPTPQVMALYNKAMRKLYTALRTAKEREVEAAMPPGSVPELK
FT                   PHAVGLDEDLEDG"
FT   CDS_pept        661954..662937
FT                   /codon_start=1
FT                   /gene_family="HOG000162368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638694"
FT                   /orf_name="MICPUN_85499"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69769.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI000199CB17"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH63"
FT                   /transl_table=1
FT                   /translation="MGKASKDKRDIYYRKAKEEGWRARSAFKLLQIDDSFDILKNVKNV
FT                   VDLCAAPGSWSQVLSRRIYLPAKEKGLPDEDMPKLIAIDLQPMAPIEGITTIQGDMTSM
FT                   AKVEEILAHFTDGRKADLVISDGAPDVTGLHDMDEFMQAQLILAGLTVCTHILADGGTY
FT                   VAKIFRGKDCALLYSQLKLFFKQVTCAKPKSSRNSSIEAFVVCQEYSPPEGFEPDDLSR
FT                   VLHERAKGMLQEDAHGNALGTMGWPTECIVPFVSCGGIDAYDSDMSYDLPTYIDEDGVE
FT                   RVKPSLDPVQPPTEPFYKLAIERERAKAQSGKKSAKQLLHEEATRR"
FT   CDS_pept        complement(663030..663581)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638695"
FT                   /orf_name="MICPUN_85553"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70042.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199CB18"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH64"
FT                   /transl_table=1
FT                   /translation="MFKAFGKDGWIDERLQFPEFKERKPTLPLGYLPVLSIDEEVFTQT
FT                   EAILRWVAHKSSLYPTDLKEAMRVDEVCAVAHEVLYKCPFDADEEVKKAKRLEYAEGRM
FT                   LQNMSYVDSKLAGSSNGFLLPGGISMADLQVYMVVHMIRTGNFDHIEPEYVDRFPNICK
FT                   NAAAVDADPLIVEYRANYPN"
FT   CDS_pept        join(663902..664393,664434..664457)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638696"
FT                   /orf_name="MICPUN_61973"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69770.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CB19"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH65"
FT                   /transl_table=1
FT                   /translation="MAPPKVLLFGGSGQTGRYVAKFALEADHDVIAFVRNPDKLRSVLA
FT                   EVGVSPALMQDKLKVLEGDLTDLNAVRSAVRDSGLSHANGDVIIECAGKPKAFQILAGK
FT                   PMLLPAVRAIAETMREIGLKRILIQTGAMSVDPRLDGDPSYPFKTFMVTFMSPLMWIKG
FT                   MRWTTWSG"
FT   CDS_pept        complement(664676..666376)
FT                   /codon_start=1
FT                   /gene_family="HOG000245622" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638697"
FT                   /orf_name="MICPUN_61974"
FT                   /product="Predicted protein"
FT                   /function="DNA photolyase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO70043.1"
FT                   /db_xref="GO:0003913"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199CB1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH66"
FT                   /transl_table=1
FT                   /translation="MAAKRTILWFRKGLRVHDNPALVKACEGASAVQPVFVLDPWFIKP
FT                   ERVGANRLRFLLESLTDLDASLRARGSSLLVLHGDPARVIPAALEAWRCDRLCYEFDTE
FT                   PYAQKRDASVNEAARALGVEVHAPVSHTLWDLDRLLAKCPRGEPPTAYASFLKIAHGVG
FT                   PVPPVAPDVPSITPLSDGDALSDGKDLVDALRDVVTGSGIPSLERLGYEPIKAGEGFPA
FT                   RGGETEGLARLRKMLARTTYIAEFKKPQTNPTELWTPVLGKEGKVKGAPPANPFEAAKK
FT                   SSKEPKSTQLAEAFMAPATTALSPYLKFGCVSPRTFWHELRAVLDVELGGKHSKPPESL
FT                   EGQLLWREFYYLAGYGTPNYDRMAGNRICRQIPWTWDEERLAAWEESRTGFPWIDACMM
FT                   QLKQEGWMHHLARHAVACFLTRGDLFVHWEAGAAVFDRELVDADWALNNGNWMWLSCSC
FT                   FFYQYFRVYGPVSFGKKYDKEGAYIRKYLPQLKDMPAKYIYEPWTAPIEVQRKAGCVVG
FT                   VDYPAPIVDHAVASKECIEKIAAAYNAHKNGTAGSIVAAGKKRKAGDGV"
FT   CDS_pept        <666807..>667118
FT                   /codon_start=1
FT                   /gene_family="HOG000012418" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638698"
FT                   /orf_name="MICPUN_73928"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /protein_id="ACO69771.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG600578"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199CB1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH67"
FT                   /transl_table=1
FT                   /translation="LAAGYSQMDWMRLTKREPDMNGLRGGKRRKDITMTEVATHGTEAD
FT                   GWTVLRGKVYNLSPYLDFHPGGRKILTQALGKDCTALFDRYHRWVNGGYMLEKCKIGVL
FT                   "
FT   CDS_pept        complement(667240..667764)
FT                   /codon_start=1
FT                   /gene_family="HOG000261862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638699"
FT                   /orf_name="MICPUN_109042"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70044.1"
FT                   /db_xref="HOGENOM:HBG730543"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000199CB1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH68"
FT                   /transl_table=1
FT                   /translation="MSSGCETPSHRVFVYGTLKRGFYNHRLLREMDAKFLGEALTRKPW
FT                   RMVLGEYGIPYLMRGEADGSAVVPGELWEVDDEGLDALDVLEGIDEGMYERVTLDVATR
FT                   EGADGAVDGGFATTAQAFVCGPESERRGIGTTWSEEIAAYDLKTHEASYVPKHERAAGS
FT                   LGTESLGRRRS"
FT   CDS_pept        667908..671102
FT                   /codon_start=1
FT                   /gene_family="HOG000100787" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638700"
FT                   /orf_name="MICPUN_61977"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="mismatch repair"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO69772.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG557203"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="UniParc:UPI000199CB1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH69"
FT                   /transl_table=1
FT                   /translation="MSCASPALAACAATRVRTRGEGAARWRLPPSRSGVAPRAAQSATA
FT                   NPARGKDVSPEELAEQSLEACGWGELLEDLAEYASTRLGQEAVRVMQPPEGGAWQSEML
FT                   LDETEAAMVMENHLGASIDFGGIMSAEVRRALYKAEKYASLGGDELAAMVAFIASAARL
FT                   KKTVENVAVNGVPPPELAPLRNIVAAMAPRPEVADAIKQCVDDQGGFKDGASPELRRAR
FT                   SQRAAAEAKLRRALQNANGQVTTHQGRVVLAVTPPAPAGALVVGVAAGGGLVLIEPPGV
FT                   VLLNGQLAQCVASEESAIDAIRRRLTNTVAAATPDLFVALDVVTRLDVIAARARQASAM
FT                   NACRPTFVIPPGRAIDPMRGLGGLGFSGGVDGSYDETRALREAREAEKAAMFPSLVAGS
FT                   TGGGGYRGDDGEDDDFNDGASSGEEDDGAVELLVELAGLRQPVLAAQAIRAQRAARREA
FT                   AKRAALSKKRTGLDAEGGAPTDDSDVDDDLLLGVGRRGVDPRTYGGDDVARVKGPAPVD
FT                   VFVPLNARCVVITGPNTGGKTAAMKAVGLASLMARSGLFVPAEMARLPWFDSVLVDIGD
FT                   SQDLMQSLSTFSARLAKQRAILSAAGPDSLVLMDEVGTGTSPAEGAAIGGALLERLAGV
FT                   GAGGTDFNRAGLTLATTHHGELKALKYEHPGGYFENAAVEFDEAALAPTYRLLWGVPGR
FT                   SRALQIAERFGLEPAVVDDARAALGEGRATLEETIGALESARRGADEDIKRALSLLWNV
FT                   DRTAPRIAAAQARVDAAEEAADVKLASGIARAGRERKTRLAADARRAQVEVAREKRGAA
FT                   LASGATDFATAAAAARAAEAEAERAAAAAKLRPPAKVPSGWCPDVGDPVVVLTTGMQGK
FT                   VRKVAGSAVTVQAGLMQLKVDVADVRPDTDAPKQRKVTNARAHMPAGTRAAARIDALMG
FT                   ADSRRGAAERKNFTPPPPSFGYDFDAEDDVPTTGDKVRIIGGANKGAVGTVVVDEGGLL
FT                   TVQTGRAMLKCPVEGVEFASKVGGGGVGGGGGKGKKKKKGGGLPSPSKDIRKASQAPSP
FT                   KPSGDVNDLMAKFNRK"
FT   CDS_pept        join(complement(672626..672883),complement(672001..672489))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638701"
FT                   /orf_name="MICPUN_91839"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70045.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CB1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH70"
FT                   /transl_table=1
FT                   /translation="MSEDGRENNVVPPSTETEDGPKGPPDISGLYSLKLDNLDYSVTLE
FT                   QLKELFGKHGEIGDVYMPRDYYTKRSRGFAFVRFKDRTAAEDAIKEFDQKELNGRPIAC
FT                   RFAEKPRPDNPREAHLGGGRGGRGGRGGRGGDYYRGGGGSYGGSYSSRRPYGGGDDYGP
FT                   SRGAYREVYDRRGPYDRRDSDYNRGRDDYYYDRDRGYSDRGGYDDRSRGYDRRDDYYDR
FT                   DRGYGRDRYDDRSRGYDRRDERPRSR"
FT   CDS_pept        join(673304..676570,678119..681628,683000..685759)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638702"
FT                   /orf_name="MICPUN_106160"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69773.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199CB9B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH71"
FT                   /transl_table=1
FT                   /translation="MAGARGSGVSAGGWRVLVLILAAILAPRGASGGVHLVAPGVADVA
FT                   GSNRGVVIHGSNFFQHRDTACRFGGAKVPGEVLDNGRFACVPPPAPHGAGFVYVEVSMN
FT                   GQDFQGGRDTLVFEYVVPGRIASIRPTGADAGGGVVTHATADAPHGGGGGFVPASACTW
FT                   FATDARGNVTSRQVLGWTQSRFVSTALVTCETPPLDAGLHRVAVARHDAAFDDTHDSSG
FT                   SSDASRAFVAWRAIEGDGLRWNGTSGAWRGGAVVAARWMDGSSGGSGFGFGFGFGSRHV
FT                   ACRFGTTSVAAAVDPGAGARDDDGGERRGASRGDATIATATCVSPAGTPGSVRPLRLAP
FT                   GPGLGGTSYGTASHAYASVVVDDAGGGASGGVHSPDMLGSFGVHSGVGFGSAHSASPRG
FT                   ASTAGSHRFVAFVGANFDPLRSRCVVGAGQGRATDALAHVVSSALMLCELPPRAPGSGA
FT                   IAAGTDALEQSSTEHSPAVMYAVEGTVSGLALEHADGIVWTDASPPVGSTRGGDVVRVR
FT                   GSGFVDGDGSVAGVRFGTIAPVRAGWISRDTVRTIAPAGAPGRTVRVALDSFASHPSPT
FT                   SALFAYANPGGLSECVSSPSIVPVTGEVRIELASWGGSLFGSIHASRCAVGDAEPRLGC
FT                   VAPAAKPGFAAVWVRGYDPDGGGRPPVVNVVARPHVASLSPRTGFDAGGFLVSARGGDF
FT                   VETFGSNGDAGLECVFGSVGVEARFVSTALVLCEAPPAASTGAVTVEIAAGRGVAASQS
FT                   EMIMTYSSAMRVDRVAPARGPTEGGNVVTVYGANFVAIEPTACKIGTIGPLDARDNDAP
FT                   STAPSTAPSTAPSTAPSTAPSTRTTGLECVAPAAELGAYLVSAGIRTAGYTGDDVRYEY
FT                   ENAKHVAAIVPSSGSSRVATPVSLYGATIRVGSSSNDCVVGTVRVPGVVVFAGEVRCEL
FT                   PAGTFAGFVAVGVGGLRAESLDVVVYEFKTPARAIGTYPRSGYVDGGSVTFVTSRHAIG
FT                   VNVGCAVGEYAGHAAPVSSALVACETPGGDVSGELGVTLLDGPHLGDAEAAYGYRAEEI
FT                   VRGVEPEAATAAGGVAVLVATGSLNPGYSLSLACAFGTIAPVRSVASGGGGIEGGSVTY
FT                   VFGGDFDFDDITTSCVFASRAGGFDVLPASAVGVVADVVSGALIRCETPALVDGAAAPM
FT                   FGYGGGDASLHVQHRGGLAMSPAAAAWSAAPTPWIKETSPAGGSASGGTVLRVTAAGAV
FT                   ESIQSRGRGVSSRVHQSQNTAGGAAAACAFGSVGPVATRTAGGAFTDVECVVPAGRGAV
FT                   DVRIFSRRSVCLPRSPRAAANGGVGAFAYATEGRVYDALPVFGGGFGRTESTAAVLGVG
FT                   LTLPRGAAVACLVDGDATRALVATSSSVACDVPPGPSGFVVVSVSDAVGSDQTFDRSQP
FT                   PRTYAASPSAVDAGGGGVLSLAGVDMHRAVGFTFGGEADGAIVSSALGVVVSSALAVVE
FT                   APGAEKVVHRPADAVVAVAVGATRGGPIGYDAAGPAPPSSASVWLTPPRAIERVSPASG
FT                   PAGGGQAVSFSLFPKLAGGVGSDGEPGGGAASAECWFGTFGPVRGRDDGAGGIECVTVA
FT                   HVPGAVETHAAARPDARAGGYARRSPAIGGLGPEISENFEKADIPNGNSYSFFASRFDR
FT                   DGLSATTLRSVSVVSRAGRLELAVPFDYDGGVSLDGVAGRLAIEKSPKKSPFGVATVKI
FT                   PPFSNRGGFFALSLAAGGAGDASKPFGQVRVVPAPELGSANPSLQPKDGGGVLWIVGSN
FT                   LLAVRGGESELVVVVSSSSSSIDSVSSAVTAHVVSSAIAALESPSMPSGAASLTPSAAD
FT                   VTVPESAVAAAYLTRATVVEAEPSFTFSSGGLAGGAPVRVSGSGFRDTGLAACAFGTVA
FT                   PVAATVSSSGEMTCAPPSLTPGRSHVVGVSFNRRDFFRGDPNPGGNNDVAALVVAAPPV
FT                   ALAAVIPSAVSEPTAAGASVDVVGAGFVLTDSSSFVSPCGGFGTAKVIASGSTRGIARC
FT                   PPGALVAAGASVASQGFIAVAVADGGSGGAWHYSRDSLAVLVYAAPVADSVAPDVASAA
FT                   GGSVAVVAGRNLRRGDVFGAGPGSDADKDGGHIFFGDVAVPMHAVSSAVALCETPPASG
FT                   AVSREVFVVAGAADPSAGATSLVGSGAAAPTHSVRPEMVVRSVDPRRAPVTGGSVATIR
FT                   GEHLGVPGALGPIWCKAGTVGPVAGRRAVPVNETTGDADAGASNAPASMEVRCVLPAAL
FT                   RLGVVGVTVSDNRRDFSHTPSATRITRTPRPALDPTWTFEYVQPAVLEHAMPPAAIPGA
FT                   GGVFGPSNGMLATFAPPIPSPAIGGSLASRSGAVVGCQFGSVAARGARGGLLASGVGWI
FT                   ECGVSSSDPFAEGLLPVFAAGWDSAYSGVQPPGRTPVQFEFIQPPQMFAWQPQLAHVGG
FT                   GAVVRVVGMDLRVHDLSLVCVFATGPRVGGDVSGFAPAVPAAVAVSTAVAACECPGDLP
FT                   EGVAALSVGTAGSTPTPGGGAAAPLSVVARPSVVHVSPTAGSVGGGAALTLHGERLRRA
FT                   SGTDDLAARVGTFAPVAVRPGAATGSVEVVTPARVAGLADVGTGRSASDYASILGGAFS
FT                   YREPFAVSSASPTAVAAAGGARVTLFGRTGFLPEDGEWGGRLGLVVTRSNQAAVVAPPR
FT                   PGGGFYVLTVPDAWEVSTNGVGRSSAVLARLPQLEHRAAASVASVSPRAAAPGGGGSLL
FT                   DVVGANFHREYVSVRLGEFSSAAPGMPTAQVVSSVLLRVEACGDHHHDTRAPAEVASAA
FT                   DAAADDAAWSSDGVLVAFHRHPSTLGAAPSTGGEGGGTLVRVTGSDFRDAGAKLLCAFG
FT                   SVVVSAAGYVSTNRVDCVSPARAPDVIALHAPLAVSVNGRDFSSPATDDGGFPVTFSYG
FT                   ARVEVYGLAPDHGPSLGGTLVTVRGANFVPDAWEPGREFAFSCRFGAKVAPAMGGSGAL
FT                   TASSASCRSPPHAAGFVAVEVSAGGGNFSSFGVVFEYQASAAAEVLFPPVGLASGGTLV
FT                   TVVGSNFIASQQHAGYGHGMVAQPGSGSGSGSGDALSCRFGGVYVSGASAVSSSVLRCE
FT                   TPTFADATIDRALAVDASNNGGVDFAQSSTYFEPLGEALVSALEPRAGTVGGGTVVSVY
FT                   GVGFTADEPVWCRFGTTGPIPAAFLRDGVVRCKSPAKATHRHGVPLEVSRGNTFDVTRN
FT                   NVIFDI"
FT   CDS_pept        join(complement(692197..>692617),
FT                   complement(691857..691885),complement(690798..691375),
FT                   complement(689839..690425),complement(<688841..689415))
FT                   /codon_start=1
FT                   /gene_family="HOG000280352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638703"
FT                   /orf_name="MICPUN_75081"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70046.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199CB9C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH72"
FT                   /transl_table=1
FT                   /translation="DWDVSLVTDMNGLFSGKAQFNADISRWNVSSVTNTRTLFYGASQF
FT                   NADISRWDTSSVTRMGFMFYGASQFNADISRWDVSSVTDMTEMFEHAYEFNADISRWDT
FT                   SSVTDMSYMFADAIRFDADITRWDVPSYLNTDAMFLQVLLLGSQVLMADWDVSLVTDML
FT                   MMFYQASQFNADISRWDVSSVKSMSSMFRDASKFNADISRWDVSSVTNTEFMFLGALVF
FT                   NADISRWDVSSVTNMQEMFERAYKFNADLSQWDVSSVTNMYSVFRSAAAFNADLSRWDT
FT                   SSVTSMKNMFLSASQFNADITRWDTSSVGDMSASMAGMFAGPATAWQSRFHNCGYLSSS
FT                   HQADGVLIDTAVCKSPPFPDKAALESAVNNCIQAVSSGERCCSEWGADCGPAGIVDMPL
FT                   WDVSLVTNMYGLFSGKAQFNVDISRWDVSSVTHMYEMFRSASQFNADISRWDVSSVTTM
FT                   GHMFNGASQFNADISRWDTSSVTNMGHMFNGASQFNVDISRWDASQVTNMHHMFDDASQ
FT                   FNADVTRWDVRSDADMSNMFSAPPRCANAGCSDMPDWNTEFVTDMTSLFQNAQSFNQDI
FT                   SKWDTSRVTSMKIMFGSARTFDGDLSRWDVSSVTDMENMFLNARAFSGGDLSRWNTSKV
FT                   TKMNGMFADQGFDAKSQFNGDLSNWDVSSVTLMDSMFLRAVKFQGKGLSQWDVGSVTSV
FT                   SNMFNGASVFKGDITAWNLLSVGSADGMFSGAKAWH"
FT   CDS_pept        complement(693717..696428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638704"
FT                   /orf_name="MICPUN_102733"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70047.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CB9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH73"
FT                   /transl_table=1
FT                   /translation="MDFPSALAILASPGGHAVPRAEAESIVQAVVNDPSRGIQALCHAL
FT                   ECDGSRRLAAVLLSTAAARHWSVLGNDAKAAMRQRTLAALSRAEDRAEMRALVHAADIL
FT                   ASRSADDGSPWHELLPALDDAAKSARATHREAAVLLLGSIVESTGAHMNDHHAALVALF
FT                   AAHLDDPGWEVQQVATRALGTTALALQRRGDFLVVADLLPRILAACVDAAARRLDRSDD
FT                   EGVAVATEAIAAAASVDSDAAFGPDASLLPRVVDVLVGVGTDPRLCLDGRARAAAFDAL
FT                   GCLAASHPGLLDEPRPTAAAVGAGTAGTTVTAVTAPTTTLADEIMPRLCAAAAAAGVDF
FT                   TAAGRAEGEAESGGYAAAARSTLRRFSLHLPPAVVLPHVVAPLDAALIAGAAPSPGALA
FT                   CLAAVTEGCASDLAEDPIASNVIAAVAAAMESTDPASKVAAALAFKELAEHAGHALTEL
FT                   FSHAVIPTLVAAISLAVEHETEGGRGDAAESFVAPTHAAASALCANFGSDEIAPALPGV
FT                   IPPLLGGALGGWRRGDGARGVHPPIRVPPRTNPRARARCLDTLERFAHAAAWEFEPFAS
FT                   DVVAALATLATTNGGGGGGGTDDRDDEGVAAVRFRALAAMATVIAAVGEESAPPGAVDS
FT                   ILSSATLALSAGSSEDAVARECAFRCFGRLATVLERSLAPWLGGAIAAAAATLAAAAEA
FT                   AEAAGFQRAVSTGGFNESIAAAEALGALVNSCGFATRPHLAVALAALGRAASSPSSPVA
FT                   LRVASARSLEFSLRPLEESDGGGGGDGDGYEKSAPGDGDGDGDGDAAAAAARDLAAETV
FT                   ALLARLVTEDEEPEVALAAATSLEESASAAGRLGAAAAAATAAAAASALLDGSARCQAG
FT                   LAEGEGGEDGEDAGTVFFDLEDQARRLKKSLG"
FT   CDS_pept        complement(696587..696823)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638705"
FT                   /orf_name="MICPUN_61983"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70048.1"
FT                   /db_xref="UniParc:UPI000199CB9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH74"
FT                   /transl_table=1
FT                   /translation="MPQGPKAPIADPAGVSNMTAEQHKSALQALSNGQPVPYPATLRTV
FT                   VHAGTKAPKREDQDPDKKPPGYSRNARGGFFTS"
FT   CDS_pept        697202..698179
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638706"
FT                   /orf_name="MICPUN_109044"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69774.1"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="UniParc:UPI000199CB9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH75"
FT                   /transl_table=1
FT                   /translation="MSDEPAPEETPAEEPAAEEPAAEEAPAPEGDAPAEEEAAPAEEDA
FT                   APAEEEAAPAEEEAAPAEEETAPAEEETAPAEEEAAPAEEDAAPAEEDAAPAEEEAAPA
FT                   EEDAPAPAAEEPPAEPEPPAEPEPEAPALAPEPEPEPEATDAMEPDREPAAPDPPRYSR
FT                   SKENDHPNPNGATAASADSLLSKRQPVHAYLAQNIQLAVRHALRALSSQRPEEPFVLAA
FT                   DVIRRWTPESQPPRLSRPAGGVAVGARSYLEDTGVLAVLHDGMCAMAKVRPADPRQFIA
FT                   DYLLDHAPVPDYVKAMDSFDADAVGSKMDELHKGAREALSNKVE"
FT   CDS_pept        join(<698471..699211,699326..>703744)
FT                   /codon_start=1
FT                   /gene_family="HOG000264658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638707"
FT                   /orf_name="MICPUN_86084"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO69775.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG609251"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CC14"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH76"
FT                   /transl_table=1
FT                   /translation="ASEMASPAPTEAEELAALNKALTALGFTDDVKLERFLHVLMPRVI
FT                   DQMASKHESTKRKVLEILSHVNKRIKAVPAMPLPLEDLTALYVNEERPPTVRNFALIYV
FT                   EQAHARATPEDRAAQILPLLKGVGARPKQAADIICRLAIQALAVPERHVRVPVNDMEFM
FT                   TVARDRAAFVAHALLYLMYQPNTSGHAPVAAPAPSPAEQAARAVANVAGVAPGPASDGP
FT                   AAASLAAAPPPPTAPPGMSPASVERVLTHYLVAACDADHEVAKRGEELLRRRCVWDTNR
FT                   PTVDLEDGAIVSKLYRAFLGDPESVPIESRANPASPALKLRLIALMCRSVAAANAFPHT
FT                   VQAIFTGLYGAGTNLRMKAAAMELAVWVLRHATDSQLAQAAPLLFSGMIKLLDGETKGA
FT                   AASGGIAAGGVASLRGFCYQALGQLATRLPRLVVGTPDLAARVFTALGTEPEAVRPSVQ
FT                   TAARSLASAYKGCGGGVAMAIEGLLLSSIDAGAAGGGDDAGGVGARRLVAAQWARDLFP
FT                   FAHAPARYLCVVACGDEKQDVREVGRAGLRPPDGEGDEFARARRGRLAKRDEDSDNAGA
FT                   GVGSLPAAATFLDYLASRHPELSKPASLASKLPLPPLAMAAALDFVRLCVANDSANDSP
FT                   VDPKASSPPGYRRFLERCMVKSAPGDLTAAAATAIVELIERDRASVVDGDDAASLNGIA
FT                   RHFAGAVDGPTRQVAAKICGALASRLAPAPTAAVAELDRLLAIAGKDGVKAGSEVHGRF
FT                   EDQDGALRAAGYVAAAGNSEPLRLQNPPFPPGKVIEALDVFVAVAGCRNPTLAGTAVEA
FT                   IGHVGMTGLPDLPRAPPVAEGDGDGNGDKNGDKNGTTAARSDGIPDDGDAPSGTMDLLV
FT                   RRLARVMTKISDPGAAQRAARAAGHVIAGGCAPADAAFLVDALFKLAGTKSEETRVAVG
FT                   EALCFAFGGVGVTAEGWLFGSFASLAEFTEKTSVEKTSSSKAAAAAETGSAGDGVFAGT
FT                   DAIRDKILDAIFQRYLYSSRSEERCAACAWLLALVLHTRRHPRLLSMLSEIQEAFGSLL
FT                   GDQNELTQEMASRGVSVVYELGTEEQRKELLGSLMGVLSGESQRKRRVKLDDDTQVFQE
FT                   GTIKIDDKELAKKSDGDAPAGSTGGGSLSTYKELCSIVTDIGQPDLIYKFMDLANYQAM
FT                   LNSSKGAAYGFAGIAKRAGDALAPHLAKLLPKLYRMQHDPSPNMREAVKGIWQAVVDDP
FT                   KGAVDAHFSAVMEELLSECGSRMWRARQSSASALAELLSGRRFAEVEPYLERVWEASLR
FT                   SIDDIKETVREAGKTLCRASRGLTVRLCDSHHSSPAETRATIEKTLPMLLNKGLNSTVR
FT                   EVQALAMDVVMNVAKHAGSAELGPHIPTMVTCLLEALSSMEDSRLNYIEQHAPAIGLSQ
FT                   ERLEHARLQSAKASPMGETLDLLMNHVDDEVMKELVPAVGGVLRSGVGLNTRAGAARFL
FT                   SRLCLRRGSLVRPHAGKLFKSLLSAAETDKSASVFAAMVSAVAAVARHATEARVNQLVE
FT                   DVAAAYESVDDDNHERRATLAAALALELSRNASDALRDHATKILPLAFVGRFDADDKRR
FT                   KKWEEVWEENSSGASSTVRLYLDEILASALARLGSSQYQIKRQGASALAGLATAAPDVV
FT                   AGKAPEMLAALTKELPGRVWEGKESLLPAVADVVEKCPAAALTFGGDEVVAALVAEAAR
FT                   KKSSYREAALRALDRSLAALAGP"
FT   CDS_pept        705277..706335
FT                   /codon_start=1
FT                   /gene_family="HOG000220848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638708"
FT                   /gene_name="PSY1"
FT                   /orf_name="MICPUN_85839"
FT                   /product="Phytoene synthase"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO69776.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG693191"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniParc:UPI000199CC15"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH77"
FT                   /transl_table=1
FT                   /translation="MESGSPSTSTYQRRPEDVVASNGREVEQFALEACVARQKSGILVP
FT                   PPRVPPAMLDAAYERCDEVTGEYAKTFYLGTKLMTPEKQRAIWAIYVWCRRTDELVDGP
FT                   NASHITPEALDQWENRLEAIFEGRPADIIDAALCDTLSRFPVDIQPFRDMVDGMRMDLV
FT                   KPRYRTFDELYEYCYRVAGTVGLMSMPIMGCDENFEGDLTKVYKAALSLGLANQLTNIL
FT                   RDVGEDVQTRNRIYIPLDELAEFGIDESEIVRGGLYSPVTGKVDDRWKAFMKFQIARAR
FT                   EVFAEAEAGVNCLHADARWPVWSALDVYRNILDAIEENGYDNFSQRAYVPKMKKLMMLP
FT                   TAWQKAQKADTM"
FT   CDS_pept        complement(<706639..>706824)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638709"
FT                   /orf_name="MICPUN_74866"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70049.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199CC16"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH78"
FT                   /transl_table=1
FT                   /translation="GLDQWVVRCVCGTCDDDGERMICCDACEVWMHTRCVSIADSQGTP
FT                   RKWTCADCEDKGKVSSG"
FT   CDS_pept        join(711058..711321,711388..712329)
FT                   /codon_start=1
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638710"
FT                   /orf_name="MICPUN_96637"
FT                   /product="Dihydrolipoamide s-acetyltransferase of the
FT                   pyruvate dehydrogenase"
FT                   /function="dihydrolipoyllysine-residue acetyltransferase
FT                   activity"
FT                   /biological_process="pyruvate metabolic process "
FT                   /cellular_component="pyruvate dehydrogenase complex "
FT                   /protein_id="ACO69777.1"
FT                   /db_xref="GO:0004742"
FT                   /db_xref="GO:0006090"
FT                   /db_xref="GO:0045254"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000199CC17"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH79"
FT                   /transl_table=1
FT                   /translation="MPALSPTMTQGNIAEWKIAAGDKVNAGDVIADIETDKATMALESM
FT                   EDGYVAKILVPAGATDVKVGELVAIMVDEENDCAKFADFTPGAAAPAAAAAPRAAPSGS
FT                   RVFASPKARAMAEAAGVAIERIAGTGPNGRVVMADVQTAIRDGVPSATVASATSGDTSA
FT                   GFAKFFPPFEDVSVSTIKKVTAQRLTESKRTVPHFYLSVDVRMDRLMAMRSSLNGALQS
FT                   DGGSKISVNDFVVKASALSLKKVPDVNASWMGDKIRRYQKADISVAVQTDLGLMVPVVR
FT                   GACGLGLSGISGEVRLLAGKAKDGKLSATDMIGGTFTISNLGMFGIKQFAAIVNPPQAA
FT                   ILAVGAARKEVVKKADGSGYEEALMMSATLSCDHRVVDGAVGAQWLGAFKSYMEDPVTM
FT                   LL"
FT   CDS_pept        complement(712505..712951)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638711"
FT                   /orf_name="MICPUN_85806"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70050.1"
FT                   /db_xref="HOGENOM:HBG584688"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniParc:UPI000199CC18"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH80"
FT                   /transl_table=1
FT                   /translation="MALQLATLADETRAADIRVLGVTKSVHWARYFVLATAFNRPQMQA
FT                   VANKMRDHVNENYGTQLSKATTSQQQQGDWVCLDAGDIVAHIFTPQSRQFYDIETLYKG
FT                   AMDVPLPFETERPSDQMEEEDDDEFEVIFDDGLANSPFADGNFD"
FT   CDS_pept        complement(713488..715458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638712"
FT                   /orf_name="MICPUN_102739"
FT                   /product="Small conductance mechanosensitive ion channel
FT                   family"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70051.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniParc:UPI000199CC19"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH81"
FT                   /transl_table=1
FT                   /translation="MTTPRTRLGIERGAEHVCAKMYSVSSLVVGCASRPSPRAGGGPRS
FT                   RVAVRAWVRAPVPRGDAFKTRGGGRDYLFGRGGPRGAARRLRMADPGAESAAGGGESSG
FT                   KQGKKNKQGKKKNKQGKKGENEDPAAVTDEETEEGEGEGADDEVAEAADADARFKLSRG
FT                   TIVVSVILVFLSVVIAALVHLPFRAAALKSVKVTYNVLKILTQGGLNQARTNADTVDGI
FT                   LSILTLIVLRFALQPVAKRLYFWWTNTRSEKQYEASPLYWLLLNVYGPVELALVTVAGM
FT                   RLLEAGIERIGIIPTALLNTVVEKLVVVALVATLSRVALSWQDRFFEQQAFELELEGKT
FT                   LQADRLAGVSKLSSIATYLVTIVLGLKALGVNVGALVTFGGISGLAIGLAGRQILENAF
FT                   MGLMLYATAPFMPGDEIVFSTREEKNIQGHVIDIGLFRTSIRSFQRELYYVPNSLFSSL
FT                   VVLNITRKGKQWRIKQDILIRHSDSARVAAALSAYRSLLKSDGRVVQRLHRRVFLSEVT
FT                   PEGLMCRISFYVEAKNKDQFSGINQDFLSAFLETLRKNDVRLAVPMRGVMQMQDSDEIL
FT                   AELERYREKERKEKDEREMIELNDEGLPDEEENLRRKEKKEKQKSKLTEALEEISASAS
FT                   DSSKKSKKKEEEKKEDASAPR"
FT   CDS_pept        complement(715691..716995)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638713"
FT                   /orf_name="MICPUN_102740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70052.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="UniParc:UPI000199CC1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH82"
FT                   /transl_table=1
FT                   /translation="MVSWKDRDAVVETLYRDVDALSPRLKDRRLIRRFAATRDYDPTRT
FT                   LLLLVEYDKWLAKSGLLDDNLGRDPGVRDEMRRRGTMRLLDPRDAPAVHRAGASIEDAP
FT                   DERRRLSAQRLTFLQLHTPSMWRTARDKDGCPAVYTNLESYRRGASKDVENTFVWILET
FT                   VCREMDEDDAEDAAGEDTAGDGEGGRFTILLDASTCGERDFRAAAWIACCANLGRVLQT
FT                   ALKRGFRGRLNRFYVYPTGRAARSLLRIVKPFLGKYTPPKIVTVDGGERGVAKLVEVFG
FT                   VDALPPHLGGRSELISVPLSEDDEPAPPTERREDEDARENPPNVGTHPRRADPRGRRPR
FT                   RDLDDYAWFIKVPILNFLLVAGLVASSAAPGSSSRPGCSSRPARARRAMVRTARNAFAW
FT                   HVIGSCLFGLEFSGVLSAGVSAVCATWREARRSRR"
FT   CDS_pept        join(717259..717401,717659..717719,717829..719214)
FT                   /codon_start=1
FT                   /gene_family="HOG000167616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638714"
FT                   /orf_name="MICPUN_95291"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO69778.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG590318"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CC1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH83"
FT                   /transl_table=1
FT                   /translation="MLRPSRSEARKKGFKKVIDADEARRKREEGMIQIRKDKREEAFLK
FT                   KRRDGAATQGDSTSSAATNNVAKLESLPQMVEGVKSNDPRIQVEATTSFRKLLSIERAP
FT                   PIQEVIEAGVVPYFVEFLKCEAFPQLQFEAAWALTNIASGTSENTGVVIDSGAVPIFVQ
FT                   LLRSPSDDVREQAVWALGNIAGDSPKCRDLVLAQNALHPLLEQLNEHSKLTMLRNATWT
FT                   LSNFCRGKPQPQFELLRDALPALARLVHSNDEEVLTDACWALSYLSDGTNDKIQAVIEA
FT                   GVCRRLVELLGSKCPSVLIPALRTVGNIVTGDDYQTQIVINCRALPSLLALLTADHKKS
FT                   IKKEACWTISNITAGNKDQIQAIVENNIVPPLVYLLAHAEFDIKKEAAWAISNATSGGT
FT                   HQQIKYLVEQGCIKPLCDLIVCSDARIVTVALEGLENILKVGEVDRMDGQPNQYAQFID
FT                   EAEGLEKIENLQNHNNNEIYEKAMKILEEYFGLEDEDDQNLAPGMDAAGNQFAFEQPMM
FT                   PQGGFNFGGMGQ"
FT   CDS_pept        complement(<719580..>720167)
FT                   /codon_start=1
FT                   /gene_family="HOG000046392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638715"
FT                   /orf_name="MICPUN_71829"
FT                   /product="Predicted protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="ACO70053.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG565172"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="UniParc:UPI000199CC1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH84"
FT                   /transl_table=1
FT                   /translation="IIPYIKATANEGDPASVLTAMDTFGRYYPMYKLGDEKGRILAGLV
FT                   KERQPRRSVEIGTFLGYSAIWTASNLPRGATLTCVEFEPRHAAVARELVRFAGFANTVE
FT                   ILEGAGSERVPDVRRRVGEGVAADMIFLDHCKECYLPDLKLMEGAGLVGKGTIVVADNV
FT                   IYPGAPDFLDYVDTSRGRYETTLLEAAFEYDQV"
FT   CDS_pept        720519..721475
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638716"
FT                   /orf_name="MICPUN_102742"
FT                   /product="Cation diffusion facilitator family "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69779.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000199CC1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH85"
FT                   /transl_table=1
FT                   /translation="MGRVQVWLVEAPLRWARLPRDGRRLISYASILAALSVLELGAGLA
FT                   TADGALVRDALHVLAGCAVLMLNLRALVIGHERPPRLELVAAFSVSCFLAFTVLALLAE
FT                   GYRVKGELFSEYRHPASLMAPSSVRVAVDALGAAMFFTKGAEWIGDFSSAREMNLHALF
FT                   LFALADGFRSARVPISQWVHDVMGGESQNTEWGEAMFAAGCIVYNALPLMRRTSRALFG
FT                   GPNARARIESLARCDKELKRIPGVADVVESRAFKAKGSGELVAHVTLRVSDGVDDAVVV
FT                   KAARGVYNATMGATGGHVDCTVYLERDTHRGREDLPK"
FT   CDS_pept        complement(721527..723026)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638717"
FT                   /orf_name="MICPUN_61995"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70054.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CC1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH86"
FT                   /transl_table=1
FT                   /translation="MGAAPAALGDAAVIDSLSKWIKSTLAPISDADPAVLGKYVLALLK
FT                   KDEPLAVLRANCARELADFLEDQTGGFVDALFARIDHEIERHDARAAAADTGGTAEEDE
FT                   VDYGEGSSDSEESLDERPRGRREKEKDDAGVDDRRDERPGSGRSDDRREGRERRARDAR
FT                   EEPERRRGHRAPGSRSPGRSRSASRDRGYRGAPRGARRTQDDWDRRGRTPRSPEGGRFD
FT                   GRDRRPPPPPGPPPGPGPPRDRFAHVPPVSHRPKVAPPTYPTPLPEDAAREIPEPADGT
FT                   VRSVFFMAPERARKHFERFHRTDFAVKLYDFYSQFGVVEDVRPNHKRFYATVVFEDAES
FT                   ARRAVRYRRVLFWGKELQNVETRWALPDEEVERRREEKIKASAEERETAARRRTEEAEE
FT                   RERNRQKAVEALRVKCEAARKLAAIEAEKRALKERLEAATARKTAHAHPAKKKGNVAAA
FT                   ASKLERDARELRAKYEAMLAAKKRKAGTDGDEAKGNKRGKK"
FT   CDS_pept        join(723141..723629,723732..724019,724107..725282)
FT                   /codon_start=1
FT                   /gene_family="HOG000175933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638718"
FT                   /orf_name="MICPUN_86035"
FT                   /product="Protein arginine methyltransferase "
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69780.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG628479"
FT                   /db_xref="InterPro:IPR007857"
FT                   /db_xref="UniParc:UPI000199CC1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH87"
FT                   /transl_table=1
FT                   /translation="MPLARRTDLGDSAYAGLEVDVCGDLQRCLADTLAGGLDFLVAPLA
FT                   HPRHRRPSAAAASRDPSAPAPAPFARSDLLLNSAQWSSQVVGKTSPWIDADSPSAPYRA
FT                   DSEAALRQELGWAAHLSLHAVLLPPPRLGAANYARIVCQFLGALSHTALWVRVPLVDPA
FT                   SLASAVDACTRRRIHDPFEAWAFLRAACEGHPQLGVCLHVGASLPSDGELARWIGEPVR
FT                   AIVVAEDAFTTNKRGFPVLPKRHQEFLTSMLRRNVQVPTPAEAAAQAAASTGSRDGWHS
FT                   TRRRWEYLVYLFRKIPDATEQELVEAGYRDYLQAPLQPLMDNLESATYETFEKDASKYT
FT                   CYEEAVLACLRDRVTDADAAAGKETVLMVVGAGRGPLVRASLRASERCGRKLRVYAVEK
FT                   NPNAVITLQSLVAAEGWTNVSVMSSDMRAADPPEKADVLVSELLGSFGDNELSPECLDG
FT                   AQRFLKDDGVSIPQAYTSYLAPVTCAKLWNDAKAYGDLAHMETPYVVKLHRCSLIADPA
FT                   EVFTFEHPNHADVVDNSRYAKLRWRREPRSHAATMHGFAGYFDAKLYEGPAGNVHCSIY
FT                   PPTHTMGPTGEPMFSWFPIYFPLRYPVHVPAGCDVEAHMWRCIGPSKVWYEWSVTAPDV
FT                   GPIHNVNGRSYWVGL"
FT   CDS_pept        complement(726408..727052)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638719"
FT                   /orf_name="MICPUN_109045"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70055.1"
FT                   /db_xref="UniParc:UPI000199CC20"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH88"
FT                   /transl_table=1
FT                   /translation="MARSFLVVACLFSAIVLASAARPNPHDGLALKLSRHNLGTKVASD
FT                   LGHVLAATESLSTPECEAAYKILNNDKSPGGYIETVEKIFAIARAVGEEAGAVCGAHLK
FT                   VRWDSEPVYCKQSCQVFWTPERMALVDQIDAAVAKVLPGGHEIVWLHESVTLPFPPFPL
FT                   VDMKADFDAIVPVLIPAACQDAADMDGILGWYSSGCRDENPKLKKCEFSYD"
FT   CDS_pept        complement(727329..727895)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638720"
FT                   /orf_name="MICPUN_109047"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70056.1"
FT                   /db_xref="UniParc:UPI000199CC9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH89"
FT                   /transl_table=1
FT                   /translation="MGKNKKKGGGNKGGSGGGPKPAGEVPKPKPAPVEPEGTPSKKPLL
FT                   EEGSSSSSFVPPAPRVSAEIAPAAESTPEKAPEPEKAPEPEKAPEPEKAPEPEKAPEPE
FT                   KAPEPEKAPAAEPEPAEEEKAAAEPEPAEKAGADAEAAKAEPAKPADVKVEVDKKEETA
FT                   PLNAQPGSPVSSESEEKSQGCCIVM"
FT   CDS_pept        728183..728824
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638721"
FT                   /orf_name="MICPUN_62000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69781.1"
FT                   /db_xref="InterPro:IPR009943"
FT                   /db_xref="UniParc:UPI000199CC9B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH90"
FT                   /transl_table=1
FT                   /translation="MLPALSSIVGTQLAVPPVGVHSTLKSLAAPRLPPRAKVAVSAGIS
FT                   RRPLGSSEVTTKHRAALRAGSDMSWQPDDTGMEPLASASGRSSDWQARRGSDFAKAATL
FT                   VCHVGAAVMFCVIAWALYASTGGVPDNTTQVQWLISNPWGIVSLVDLYVGFTVFSMWIW
FT                   FREADAIVAAAWTACMMTTGWLGGCLYALIQLKRHKGDWQGFFMGHRAER"
FT   CDS_pept        join(complement(729925..730254),complement(728926..729600))
FT                   /codon_start=1
FT                   /gene_family="HOG000241387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638722"
FT                   /orf_name="MICPUN_97984"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70057.1"
FT                   /db_xref="HOGENOM:HBG748974"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="UniParc:UPI000199CC9C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH91"
FT                   /transl_table=1
FT                   /translation="MAVSLEERVAGHSDFFDRLVELIPARYYVPDEANPEWSKFQKTKS
FT                   AKAAAKQAAKENSKKALRAKLQPGNAMTSLEKMRLKEGAEGGPGAEGEEDSDEPESENE
FT                   SDFEDDAKIEASRVARKAEETAEKAAKAREWREKKKKTKAEKNAEKRKRKAEAAHGSDA
FT                   RTADSDSESDEPIRDKGANDNFDFGRVDMGELAIGAPKRKRAKKETLLARALDQRREIA
FT                   NAGGEETVAGQRVAEKFSWSAALARAGGEKVLDDPKLLSKSVRNEQKRKKKSAEKWEKR
FT                   EAFQKEQMADRQKKRKDNLKSRVKAKIERKIDKREKKRNRPGFEGRSQGPINK"
FT   CDS_pept        join(731070..732247,732347..732446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638723"
FT                   /orf_name="MICPUN_97985"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO69782.1"
FT                   /db_xref="HOGENOM:HBG557216"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199CC9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH92"
FT                   /transl_table=1
FT                   /translation="MTTQQALPAQKLELVVDLPEGRGLVATEEVRRGESLLDIPESTLI
FT                   TVERAIAESNLGPAHANLQEWSVLAAFLAEQALAIDAGADGSRFATYVRALPRRTGGVL
FT                   DWPEEDVKELLAGSPSQRAAMERQASVDAAIDEIRASFPQLTPGALRWAFDVLFSRLIR
FT                   LPNRGGALALVPWADMLNHRPGCDAYIDDTGGAVCLSPDRRYKPGEQVYASYGPRPSSE
FT                   LLISYGFAPAVGENPDDEFEVVLGIDPNDRHADAKADALRRIGLSPVEAFPLKLNGYPK
FT                   QLLQYASFALCDPDDPKELPGLAEKALIGNRAVGGLLGAITKGKRGTQGEVLGGVAGEI
FT                   AVRELLADITSDALSKYPNTLEKDREIATSDPTKPAGKQAKKKKSFLAELRGPVRVSER
FT                   RILAKTDSEVRLQLRKLKASQMTGGN"
FT   CDS_pept        join(complement(733714..733734),complement(733477..733530),
FT                   complement(732635..733138))
FT                   /codon_start=1
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638724"
FT                   /orf_name="MICPUN_91845"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70058.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG320156"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniParc:UPI000199CC9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH93"
FT                   /transl_table=1
FT                   /translation="MSAIRKKIVKDDGAALSEFEKEVAQALFDLEATNNELKAELKDLY
FT                   INGAQEVDVSGGRTAVVIHVPFRKLKAFNKIQQRLVRELEKKFSGKDVVLVATRRINPV
FT                   PSSGFARARPRSRTLTAVHTALLEDLVYPTEIVGKRQRYRLDGSRLLKVYLDPKDRNTT
FT                   EYKLDTFAGVYKKLTGKEVVFEFPVQESA"
FT   CDS_pept        join(complement(735996..736116),complement(733984..735848))
FT                   /codon_start=1
FT                   /gene_family="HOG000271639" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638725"
FT                   /orf_name="MICPUN_106164"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO70059.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="UniParc:UPI000199CC9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH94"
FT                   /transl_table=1
FT                   /translation="MATLCTPIVGFAVGARAQTRTRVASRSLSLRGSLAGTALAGTASR
FT                   QQANRRGSLCVVAGKKDKRKAGGGGGGAKTAGGGAKTGGNQGHKSPGKVKEGSAYQTET
FT                   RKIILSLSKVRKVTPTGKELIKNINLGMYLGAKIGILGANGAGKSTLMKILAGVDKEFD
FT                   GEIYLDDGIKVGYLPQEPPLDDGETVMENIEVGVASVKKDIDEYNQIAMDMTNPDCDMD
FT                   KLMARMDALQTKLDATNAWEIDRTVERAMDALRCPPGDALVKNLSGGERRRVAICRLLL
FT                   AQPDILLLDEPTNHLDAESVAWLEKFLATFPGTVVAITHDRYFLDNVAGWILELDRGEG
FT                   IPFEGNYSAWLESKSKRLESEQKKQDALSRTINQELEWVRKNAKGQQKKGKARLRAYEE
FT                   LCDEANKFTARADLDSITIPAAPRLGDVVVDVKGVSKGYEGRGLLIDGLDCAIPPGAVV
FT                   GIVGANGAGKTTLFKMITGIDEPDKGEVVVGETVKLMYVDQSRDSLNDDKTVFEELSGG
FT                   AEEISLGSRTVNARAYCSWYNFKSADQQKKVGQLSGGERNRLQLAKTLTSGGNVLMLDE
FT                   PTNDLDVTTLRALEEAITSWNGVTMCISHDRWFLNKICTHIMAYEGDSQVTFFQGSYDE
FT                   YEEHRKERMGGGEPTRIKYRPMPAMA"
FT   CDS_pept        complement(736226..738823)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638726"
FT                   /orf_name="MICPUN_62005"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70060.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CCA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH95"
FT                   /transl_table=1
FT                   /translation="MDLKSIKGALKSAAGKASKAAHEAGISAYASAKGAVANAASTATG
FT                   ALRCTREYDLDAPVAASGGPGCLFTVVDATRRCKGGATSKAAAAAAAAADPTTPNSRVS
FT                   VWLLDKRALTEDGRHSKEEVEQMLQLIRDDASRMLKLRHPGVLRLEQPLEETRTHLALV
FT                   TEPVFASAADILAKGANLAGKRRERAKSLEQATGGGAVGAAGADSSSGRGPSRGETEGA
FT                   RLAATKLSQLEVKHGAAALAGALRFIHESAGLVLRGLNPGCVVVTSRGDWKIGVGAFAH
FT                   ARGGTDGGNQADFYLGPSGAVNKPLNVGYGSSDSEAFVTGPLPLVPPAGYVAPELVLGA
FT                   MKGGYVGAGVAEPTGSADVFSLGAIVHELAGNPPLLGEACCASVGGGDVGEGEYRRGLA
FT                   NARFVGGCASVVSRMCAEDPGKRIGSADVTSDAWFANDVGLAALRELDGFIQSDVLSRA
FT                   AFLQSLQGRWDLFDARVTQYRVLPPLLTELRTPELQPLVLPLILNLAERQTPTDFSEWT
FT                   LPHLAPLLATATGHTLGTILKSTAAFADRVPSPETFELYVLPAVLRGVAAPEVLVQEEA
FT                   LRQVTAAAHKVTPETLRCTVVPLLHKTAVDTTAAAVRVNALVALGKIAPCFAVPEFDAT
FT                   LDALHRIAANDRAAATVMCVLGVADAMGKVGGVNLIASRCLPLACPLMLAPGLNRAQIG
FT                   TVSRVLGGMLRRVEEARVATAPPAPPPPKRPPASVEATAASGGIGGIGGGADPFAASGA
FT                   ATDLLRGANANANAGEGTLATRKVGGTPIIRGSTPMRLTPPPGAVPRVSSATEQLTAAL
FT                   SAGDNLETLFTDLGYRPEPPGPMFAGMNVHPGVGAGAGRTGRGAVDAKEFSLL"
FT   CDS_pept        join(complement(744685..745274),complement(743674..744630),
FT                   complement(742788..743418),complement(742299..742751),
FT                   complement(740943..741968),complement(740223..740876))
FT                   /codon_start=1
FT                   /gene_family="HOG000100091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638727"
FT                   /gene_name="CAV1"
FT                   /orf_name="MICPUN_95305"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated calcium channel activity "
FT                   /cellular_component="voltage-gated calcium channel complex "
FT                   /protein_id="ACO70061.1"
FT                   /db_xref="GO:0005245"
FT                   /db_xref="GO:0005891"
FT                   /db_xref="HOGENOM:HBG557219"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005445"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199CCA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH96"
FT                   /transl_table=1
FT                   /translation="MCEGIPNYSLFILGKRNPIRAATISLVKGPYFDQFILLLILANCV
FT                   FLAMDTNEVLFEESSWGKAVSMSEVVFTGIYVVEMILKIIAMGFVLGKGSYLSDPWNRM
FT                   DFFVVVLGLLAYLPGMGNFSGIRTVRILRPLRTITGVRGMRQLVVTLLRSLPMLLDVLI
FT                   LVFFAFFIFGIVGLQLFMSKTSQRCAILANPASGCALPAAPVWEFQGGEGGDELCSGPS
FT                   LGSYPNRGDGGEGNSCPAGQYCVTQRKQDLPNFGYSNFDNIAWAWLTIFQCISMEGWTN
FT                   IMYMVMDTVTTWTWPYFVVLIVFGSFFAVNLALAVLFVYFTGAGTDGEDPDEEKELPLP
FT                   TQDGEVAVTHKNALQKVCFNIASSTRFEQLTIGLIILNTVVMASDHNRMPKEQQQANEY
FT                   VNFFLFAYFVVEMIIKLIGFGPRGYAKDQMNLFDGFVVLMSCVEVVVGFISSDNGNNYL
FT                   SVLRTFRLLRVFKLARSWKQLNDIITTMFKSLAGISYLSLILLLFMYVFALLGMQLFGS
FT                   DHARHSFDNIFWAFITIFQILTGENWNEVMYDGMRHVSEWTCIYFIVLVVLGNYIILNL
FT                   FLAILLDNFAAGDNEEGEKGEGKKGSRPSSRANAGSRPGSQGPSIKDEKGNKLKSYNSI
FT                   AAWKAEDFNPKTSELDKLKAQGVDPKHILYGKHVPALKHRSLYIFGPKNPLRLAIAKVI
FT                   YHRYFEYFIIGVILISSIILAVDGPAYSKDAPLKTAMDILDIVFLFMFVLEAMMKVIVR
FT                   GFVAHEGAYLRSAWNVLDFIIVIVGLIAFGIEYSDGSSRDLMAVRALRTFRALRPLRMA
FT                   SRAQGMKVVVNALFSAVPGITNVAFVCLLFYVIFGILGLNLFMGKMYYCADTDDLSTRL
FT                   VPESMGSTCEPRAYNTHWTNPRDYDFDNIGHSMLSLFEMATLEGWLEIMYHGADTTEVD
FT                   LQPIRDNNPYYCLFFAFFIIVGSFFVMNLFVGVTIDKFNEMKEKQEKSVFMTDEQQSWV
FT                   TIQRLLVGIRLKKTANRPLNRMRNFIYDVVTSRSFETLILCLIMANILVMSMTHADMSD
FT                   EFENVLFLLNCGFAGIFAIEAIMKLIAFKPSGYFRDPWNTFDFMVVSLSVAGIAVTLTT
FT                   DISATYLSIIRVFRVARIFRLIPKAKGLKKLFQTLLYSLPALANVGSVLFLFFFIFAVL
FT                   GMNLFGKVRVTGNFLNRYANFETFGYSMLTLFRMATGEAWNGIMHDCMITKQCDLNEDL
FT                   YTNQCTPHPVGAIIFFCFFCILCAFVMLNLVIAVILDNFQNNSKTSELGVSKEDMMHFT
FT                   DVWMRLDPRATYYIPAESLPRVIGAMDHPVGTRGLSKREAKTKCMHIIMTVDIPNHDGK
FT                   IHFLETLHALTGRIAGTELPESEEVKVRDSMVDRLPTFASDKDVPKFTAAHFHAALYVQ
FT                   AAVRGYMQRYRMREKLAQAEKLAQEKREAAVAGK"
FT   CDS_pept        join(complement(746554..746628),complement(745946..746413))
FT                   /codon_start=1
FT                   /gene_family="HOG000239693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638728"
FT                   /orf_name="MICPUN_95307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70062.1"
FT                   /db_xref="HOGENOM:HBG746554"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniParc:UPI000199CCA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH97"
FT                   /transl_table=1
FT                   /translation="MLGDYLTALLVAVLGYIYPVYLCFKALEKHKRKPEALRGWCIYWV
FT                   VIALYTVGAQIADRFVFWLPMYCEAKVAFVTYLWHPRTQGALYIYDTFVAPFLAKHEPD
FT                   IDRRIDETRASVGDVVVRNSRGAVDFVRNKMANLLLSVPQANGDGRGSEARYMGARNAT
FT                   EAAATAYTRVPPKPRSD"
FT   CDS_pept        <747455..>748573
FT                   /codon_start=1
FT                   /gene_family="HOG000200880" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638729"
FT                   /orf_name="MICPUN_67858"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO69783.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199CCA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH98"
FT                   /transl_table=1
FT                   /translation="VKVVVRVRPLSNGELGRGERNTVEVADDQRSLTVVDGMRQFNFDA
FT                   CLSPDTSQPEVMIKCGVPRLLDSALHGYAATIFAYGQTGSGKTFSMSGREELIERQGWA
FT                   GGGGDDGIMTRSLAHIFAAVNRAGPGVKFRVKCTYLEIYNEAIYDLLSGDNERQLTERW
FT                   EPQRGFYVPDLVTVDCSCLDDALAVVARGTRNRRVGSHELNKDSSRSHSMMTVHVESHA
FT                   SRDGVTMSKFGKVSFVDLAGSERLKSSKSEGSMVKETGNINRSLFMLGKVIAMLSDGEK
FT                   NNHIPYRDSKLTKLLMDSLGGSSLALMIACCSPSSNHMEETLSTLHYATRARNIINRPS
FT                   VMQDPTQALISNLRHEVELLKKENAVLRGQLGL"
FT   CDS_pept        join(complement(750062..751723),complement(749294..749818))
FT                   /codon_start=1
FT                   /gene_family="HOG000203394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638730"
FT                   /orf_name="MICPUN_85708"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70063.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG320344"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI000199CCA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FH99"
FT                   /transl_table=1
FT                   /translation="MTGGPIEVSAGLKRAISVDVTNKDDMLEIMPLGAGSEVGRSCVLA
FT                   SYKNKTVMFDCGVHPGYAGIASLPYFDEVDLSTVDAMLITHFHLDHCAAVPFVVGRTNF
FT                   KGRILMTHPTKAIFAMLMNDFVKLNKQGDNSEALFGEKDVQECMRRIEVIDFHQEMDID
FT                   GVKVTPYRAGHVLGACMFYVDIGGLRVLYTGDYSRTPDRHLPGADLPPIPPHVVIVEAT
FT                   YGVSPHSPREERERRFTDMVHRVLTRGGKVLLPVVALGRAQEVLLILEDYWVKHPELKG
FT                   VPIYQASALAKRAMTVYQTYINVLNSDMKAAFEESNPFVFNHVNHLANSSGLDDVGPCV
FT                   VLATPSMLQSGLSRDLFESWCGDSKNGVIICDFAVQGTLAREILSDCKTVTSRTGQELP
FT                   LRMTVDAISFSAHADYPQTQQFLDALAPPHVVLVHGEAGEMGKLKRALEGKAAADGKKM
FT                   MVYNPKNCQAVEIMHSQSKTARVMGRLALNPPKEGDRVSGLLVQKDFGHMIIAPEDLHE
FT                   YTSLKTAKLTQRQKVPTTQKLGELRFALEALFEGIHTGSPEPPGLSVNGGQLTILKRPA
FT                   DKKWGAEHALLQWDADPINDMIADAVLSVILQLEEEPEHLTRAEAAHKDAMKNKDKAGV
FT                   QAARLRIVAAMLGVQFGEPRAIDEENQVVELRVENADVAVRYGNRDVDCADAAVKARVE
FT                   TALGRIDMAIADSSFSRALPSVSGVSGADPLKGT"
FT   CDS_pept        join(751866..752920,753023..753644)
FT                   /codon_start=1
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638731"
FT                   /orf_name="MICPUN_86019"
FT                   /product="Predicted protein"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="ACO69784.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI000199CCA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA0"
FT                   /transl_table=1
FT                   /translation="MAGHGSKSWGESATAIEFKGRRGPTIATRGMVASSQTLASEAGLR
FT                   ILRAGGNAFDAAVAVAAALNVCEPTSTGIGGDAFALCYHASSKDVTAVVGGGASPAALT
FT                   LDLCRQRGHLGTEIAPSTDALCVVVPGACAAWEDVVTRHGKLTLADVLAPAIELAEHGA
FT                   PIGPVTAELWRRQEHLLRAQGATCMLVDDGNPEDGETRAPHAGEVFANPQLAATFRRVA
FT                   AHGAKEGFYRGPIAEAIVDAIAQRGGVLTLEDLDAHATRFPAPISQTYRDDVRVWELPP
FT                   PNHGIAALLALNCLEAALPDAGPPPHCMTWDHASVEAMRIAFADSLEHCGDPEHADAVD
FT                   AAVTAGELVDKTLAKTDGLRPSPDTVYFCVVDGEGNACSFINSNYDGFGTGIAPEGCGF
FT                   TLQNRGHNFILREGHVNCVGPRKRPYHTIIPGMATREGTGDLYAAFGVMGGFMQPQGHL
FT                   QVISHMVDGGLDPQAALDAPRWCIGGVGSEKGSESIIDAPVAVEAGHRSANDLLRRGHV
FT                   VEHVAGLERTVFGRGQIIARDERGVLWGGSDPRGDGCAIGF"
FT   CDS_pept        complement(753844..754698)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638732"
FT                   /orf_name="MICPUN_62012"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70064.1"
FT                   /db_xref="HOGENOM:HBG557220"
FT                   /db_xref="UniParc:UPI000199C475"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA1"
FT                   /transl_table=1
FT                   /translation="MSAVAAAFSIGAARVVTRGSTRVTHVAKVANLAASHGRGRRDREV
FT                   AFRNNHHGDSCRGSRIVPVVERFSIVPAASGEEEAIPQDEIDPQAVAPEDYALVVELLD
FT                   SENGEELKEKVDLIAGNGLLTEGVVKAARVVVEQNEAAGQEQDIIELLRSVYDVLLRKF
FT                   QELYKPAAKAALEFGSTLMDVFSAEDLELMEQGETPVSIGKVKLMMQEEFDREDGDHVD
FT                   KMAFAKYLDEVLPIMDMQDDRLRQKLEEAPDDDTQQRLIMVMMSRTKERLKVEALRDIA
FT                   TNL"
FT   CDS_pept        join(complement(756315..756385),complement(755255..756200))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638733"
FT                   /orf_name="MICPUN_102755"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70065.1"
FT                   /db_xref="UniParc:UPI000199C476"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA2"
FT                   /transl_table=1
FT                   /translation="MADQRSAVWTARIRDAKQVLNELRAGTSAASPQRTDQERARFFAM
FT                   QRRKLQRFEDLIDDLEDLTADGDPTTAEREDRDAAVEAMRAEAKRLADGIKAAAAAAAA
FT                   AAAAAAAAAANPPESPAGEAAGRANPGGEASASGGGDATDDGTHGNGSLATLGRMADAA
FT                   KASVAGAVAGAAAGDLGGKIAEKLRVSEVGDKLKDAAGAVGLARRDDGETSTTKGLSSK
FT                   ELLDVQRAQMNAQDETLEKLIPLTEKLNDTAGMICDEVNLQSRMVEDLGRDFRHTQERQ
FT                   KKLRKQGFKLSGQKNEEEKERAEREEAMEELRKQVTLQQVQNSYEQEEEEESGCVVS"
FT   CDS_pept        756546..757607
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638734"
FT                   /orf_name="MICPUN_62014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69785.1"
FT                   /db_xref="HOGENOM:HBG620322"
FT                   /db_xref="UniParc:UPI000199C477"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA3"
FT                   /transl_table=1
FT                   /translation="MSASRLARCPHRTAIARSDAGGARARSRRVAARARHDDEAEVRGA
FT                   DLAVFDRRRALALSAGLALLDPSPALASSALLSERLERKDLSKPVFNKARPGPQRYPDW
FT                   LEGTWRCTATFAGFEFPSKTMSKSALIKEPTIPGFQKLSLVYVPDVGTSDVSYDVRFAK
FT                   FEGIEGVLEDRAFNLKSIVNAYLGKDAVESVEYEPTRDANRTTVNIRPGASPNAERIEL
FT                   FCNARESETRVADRTFFASEASRQVTLGYGKDFGTARVVNTDYQHVWTFTPTAWRSSNG
FT                   DETNGDETNGDVVSEARVTLSTAGYVQANDALRFTAAPSATGGAPMPSLGGAAGAAFEP
FT                   AVLYSHVMTLRRL"
FT   CDS_pept        join(complement(761258..761313),complement(760984..761092),
FT                   complement(757709..760837))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638735"
FT                   /orf_name="MICPUN_102756"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70066.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG557222"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="UniParc:UPI000199C478"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA4"
FT                   /transl_table=1
FT                   /translation="MGNAPKGGEDTEDMRGAKRLRATEPAPDEAPAATSPKVDSSAPVD
FT                   SDVHAAVVAELDSMRKREDRLQMSLKMLQQHLSEERARVAELHSRLIGRSIQTDAPPCE
FT                   HANSAAVLAKAEAAKAGEAEAAKAAGCPFHQGGAAMQTRDHKFAEFQAKFRATSESVVA
FT                   EVDEHITEQIQQRRNSIRRSSSQLSLQARLEGFKDEPPMALASLKELAMDSVQEGVTIA
FT                   DFSLPDQPLVYANHGFELITGYSIEETVGHNCRFLQGPGTEPEKVEHIRRCINAGLPCT
FT                   VQLKNYRKNGEEFVNYLSLTPIRTARGRVTHYVGIQSDVTELINTRTAELDALKKATIA
FT                   TAATEAKSKFLAHMSHEIRTPLNGLIAVGQLLEDTNLNRVQRDYVTTIRSSGETLQALI
FT                   SDILDFSRVEADKLVLRHEPFHPQAVIATVMEIVGLHSSRLKLNVGYHVDEGVPESVMG
FT                   DAMRVQQVLLNTLNNAIKFTEKGDIMIRLYLRKRSDAEAEYQRAMETANNAVEEEKSAG
FT                   TEQMHQAREWREEQTKRGMQEQQRRLKSVDWLRRSSTSPADDDEPGPASDASDGDDWVL
FT                   HFYVKDTGIGLNSSNIDSIFKSFQQVDLSPTRKYDGTGLGLAISQRLCEAMGGRMWAES
FT                   PGLGMGSIFHFCVKCVSLPGANERGGTPALPQVPGGARANPEDAEREAEARRRVRASGA
FT                   DTAKVMSLVRTPSQMTFDAICEGRNLRVLLYDESRMVRQTLAAAMERWGIFVHSCATAD
FT                   DIVSALDGGAEVGGLGRTAGQYDIVVAEKNVAFTKAIRRWAESHGKLKATDEVGGSKAT
FT                   NSDSGGAGFHCPNFVLMTWPNYGSSSDDLNDIGSWGEIGSLEHKLRRKSLNSIDSLARR
FT                   SDGSVGAQESEEADEDVEEFLSLRNTELLPKPVQHARLQKLLANIAHDIFNPGDTSARK
FT                   SDVMRPSASSAPVSDSSKDPEVKPKLPKKMRILLAEDHLINMKVACAVLAKCGHKDITI
FT                   AKDGVEVIEKLALLPSGLDSFDIVLMDLHMPRMGGLECVKQLRSLYPQSKVPIVAVTAD
FT                   AVEESRDKCLKNGFNSWISKPFRIEQLEGLLDEFVPGSSVGTRGRANGA"
FT   CDS_pept        <762921..>763616
FT                   /codon_start=1
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638736"
FT                   /orf_name="MICPUN_70576"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO69786.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="UniParc:UPI000199C479"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA5"
FT                   /transl_table=1
FT                   /translation="PIACRVAWHASGTFDARDGSGGSDGGTMRFEPERSDPANAGLGIV
FT                   RDMLHEVHKKYPDVSQADIFTLAGALSIEFAGGPHVPHAFGRTDDRDGARCPAHGRLPD
FT                   AAQGATHLRDVFHRMGMSDRDIVALSGAHTLGRCHFVRSGYDGKWTRSPLRFDNEYFRN
FT                   LIHYTWKPREWDGKLQYTDVETNELMMLPTDIALKTDPGFRPFAELYAKDQEAFFRDFS
FT                   AAYSRLLALG"
FT   CDS_pept        763728..764063
FT                   /codon_start=1
FT                   /gene_family="HOG000100788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638737"
FT                   /orf_name="MICPUN_86060"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69787.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C47A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA6"
FT                   /transl_table=1
FT                   /translation="MPLAKDVDLDAGDAGTGRAAIHKAAYWGHAHTTKTLTQDLRVNPN
FT                   VRDSEGDTALHDAARFGHVEVVKLLLATPGIQVGIKNNKGLTALALAEDYGKPEVAAML
FT                   RAKGSRL"
FT   CDS_pept        complement(764187..765125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638738"
FT                   /orf_name="MICPUN_62017"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70067.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG557225"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199C47B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA7"
FT                   /transl_table=1
FT                   /translation="MSAPSTSERNALRYFYPGSTARNGNLVFLAPGVRSLTGADAGELL
FT                   SLDGVDLSRWRARYQHDEYEGWAAVQDDTALEFRGDRRTLDLSLERRADPLERRAPLSS
FT                   PERIPGLENIETRARGVVVPAPGDESRDGYFGIGIVGGKNEANQGTLWRSAYQLGAAFT
FT                   YTVGARFEKSSSDTTKTWTNLPMYSHDNWNAFAASAPYDAAWVAVEMGGAPLATFHHPD
FT                   RAVYVLGSEDNGLNSSVLRACAHVVELPAEVGRGASFNVAVAGSLVMYDRLVKRRKGRG
FT                   GVVGGGVDERNSLPGGRVGVDSAKPVRGGGT"
FT   CDS_pept        complement(765247..766281)
FT                   /codon_start=1
FT                   /gene_family="HOG000214998" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638739"
FT                   /orf_name="MICPUN_109050"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70068.1"
FT                   /db_xref="HOGENOM:HBG318581"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="UniParc:UPI000199C47C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA8"
FT                   /transl_table=1
FT                   /translation="MATLYPPYCEKFGWMMDEKAAEDMRARNEARVAELDAKIKDAEDN
FT                   LGDSEVRDAMLAKAEFFAEVGDRESALAAFDACEKKTVAIGQKMEMVFSVMRLCIFHDD
FT                   WVALEKQIAKLKDLLEQPGGADWERKNRLKVYEGVYKMARRDFAGATSLFLESLSTFTT
FT                   YELMTYDEFVFYAVACAVVSLKRTELKAKVIDSPEVLAVIDNIAGGSVRDMVNSLHACK
FT                   YREFMLAFPNAADAVNKSTWLHAHHRYFLREARVAAYAQYLASYKSVTVASMASSFCVS
FT                   EEFIDAELSNFIVEGRLNVRIDKVNGVLVTNRPDAKNALYQSYIKEGDHLLNRIQKLSR
FT                   VIDL"
FT   CDS_pept        767037..767945
FT                   /codon_start=1
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638740"
FT                   /orf_name="MICPUN_86067"
FT                   /product="Histone deacetylase, SIR2 family "
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="ACO69788.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="UniParc:UPI000199C47D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHA9"
FT                   /transl_table=1
FT                   /translation="MPEPDPREPLLSSFDIAGVAEYIKSGKCKRIVVMAGAGISVSAGI
FT                   PDFRTPGTGLYDNLQKYNLPHPTAVFELDYFRENPKPFYLLAKELYPGNFPPTPTHRFI
FT                   RLLHEKGLLTRCFTQNIDSLEAAAGIPGDKIVAAHGNFDAAHCLRGHAADVNDVKAHVD
FT                   RGDVMRCKEVGCDELVKPDIVFFGEALPQRFNRLAATDFDDCDLLIVAGTSLAVHPFAG
FT                   LVDFPSEDTPRLLVNREVVGELDPRMRSLRRMLGRGAGFDFSEEGNYRDALWLGDCDDG
FT                   FMELATLCGWGDELQEMCERK"
FT   CDS_pept        complement(768646..770250)
FT                   /codon_start=1
FT                   /gene_family="HOG000280753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638741"
FT                   /orf_name="MICPUN_53790"
FT                   /product="Phosphate:Na+ symporter "
FT                   /function="sodium-dependent phosphate transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70069.1"
FT                   /db_xref="GO:0015321"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557226"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniParc:UPI000199C47E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB0"
FT                   /transl_table=1
FT                   /translation="MTAEEKADQAAQAKWLTPSNENPIKKAVLTILVFYCLWVFLLTLG
FT                   VMGTGFKLLGGKDSAKMFDVADNPISALMIGILATVLVQSSSTTTSIIVSLVGADELSV
FT                   NIAIFMIMGANIGTSVTNTIVAMGHFANKDDLRRGFAAATVHDVFNMLSVLIFLPINWI
FT                   YPFLEKMTYEMAKDQKSCEGDDCNKTEFLKPYISPYSKGVANYDKKVAGYISQNWCAGQ
FT                   CGKSYSTDAMKKISEEVCTSSTDCSNVHKNYESNWMSKGYLAKKRAPAYIVGTASGTPA
FT                   EFHYDKPAACSTSTKFFDNDTNFTSTVAGSLTAGTCYEVCGSKVKTGLCDKRLLKGGLL
FT                   LDDWDMTDNGAGTFLTVVSLISLCSCLFCIVYMLQIIVKGTAARILRKVVGFNGYLNIV
FT                   IGMFITIMVQSSSITTSTLTPLAAVGLINLEDMLPLTLGANIGTTLTGIMAATVVTSNP
FT                   VQAWQVALCHLFFNIFGILVWYPIPIIRKIPLDGARFLGKMTTNPKWGQIFPLVYTFIC
FT                   FFIIPGIAYGITAAASS"
FT   CDS_pept        join(complement(775007..775094),complement(771236..774870))
FT                   /codon_start=1
FT                   /gene_family="HOG000166512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638742"
FT                   /orf_name="MICPUN_85842"
FT                   /product="Condensin complex component "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO70070.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG526359"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI000199C47F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB1"
FT                   /transl_table=1
FT                   /translation="MHIKQVIVEGFKTYREQTAADFEPHLNCIVGANGSGKSNLFHAIR
FT                   FVLADIFGSTRAEERQKLLHEGAGHAVMSAYAEIVFDNSDNRLPVDREEVRLRRTIGLK
FT                   KDEYYLDRKHITKAEVINLLESAGFSRTNPYYCVKQGEIMKMATMHDEERLALLKEIGG
FT                   TSVYEDKKRESLKVMDDTKSRRDQIQETVEFIEQRLGELDAEKDELQKYLEHDRTKRSL
FT                   EYTIYEKDLSETRAKLDEVEERRRSYVERAKEEDDRAHRAHDEIRAAERECKDKERAVT
FT                   AAKEELRVADLELRRCVEKRTSAELDVTELRERAQAGEERLAGVAGDRVALDRAVAETR
FT                   AKIDAVKPKVATATAREETAESEIGEVNRRLQVLHQRQGRGAQFKTKKERDEWLGSQVA
FT                   DADATADRKREEVAILEDDVKELAKTIAAEREDEGRLKKKLAAEEAALAESEGEYQEKL
FT                   ATRNAAQDERKELQRRDAELDAELATKTEEVKRRDKHLEFTMPRELFRGLAAVQRIVKD
FT                   HSIAGVHGPLIELMECDERFFAAVEAAAANQLFNVVVDDDDVASKIISYLNKEKGGRVT
FT                   FLPLNRLQTRNREYPDSQDVFPMLSKIRHDDKIRPAMDKVFGNVLICRNIDVAVKYAGS
FT                   TNLDCVTMDGDAVSNRGAISGGYQDAGRSRLINMKMLRETQRIRSELRKESVAVKDKLQ
FT                   AAEQAVTAVLGDIQRMDSQRRHRQQGVDRLKTDIKDCGYAATRAEESLGAKEKTASAIR
FT                   VTITDLEARASDLRAEMATDLNAKLTASEVRELGELNPRLDALKEERLAASAARLSAQA
FT                   ELGELTATLESNLERRQRQIEATTTEVDISGVEADLARAEAEAAAAAANEAEASAFHTE
FT                   LAAKLAAAASAVEECKATLERLRGEAEDAKAGLADDEREMEGLMSKKATLQTKREGLQR
FT                   KIRDLGSLPGDAFEKYRGKALKTLHSMLSKTNEELAKLSHVNKKALDQYQQFTEQREGL
FT                   EARRGELDKAHAKIKELMSFLDQKKDESIERTFKQVSLNFREVFARLVHGGKGELVMQR
FT                   KKTLPAPDAENADPGAAANGGAEKSSSSVAKGFAEKYSGVKIKVSFGQGETMQMKQLSG
FT                   GQKTVVAVALIFAIQRCDPMPFYLFDEIDAALDPQYRTAVAAMVRVQADAGTQFVTTTF
FT                   RPELVKVARVIQGVEHSHKVSKVRELTLAEALNFVGDFPIGQEGKRGKRRKDVEDEEDE
FT                   EDEDEEDEEDEEDEE"
FT   CDS_pept        join(775472..777054,777168..777204)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638743"
FT                   /orf_name="MICPUN_102762"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69789.1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199C480"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB2"
FT                   /transl_table=1
FT                   /translation="MAAPRPPALLLSAFLALQVLFLSRPSRGDDAPPFPDWLERLYPGL
FT                   GSEVSGVCEGSFDVSVHWAHVSRCARVTGSLAVTGILPDVFTTREPYNRVLWTVDGDVL
FT                   IERNALLVSLRGAFPGLTRVGGNVRIVDTALVHLAGFESLREVNGAVLVADNARMLAFK
FT                   DGVTVAFQSLLSVGGSVVVSNNAAEELDGFRALRRVGVGAGGGGVTIGPSVDMRYVVGS
FT                   GPGWHGDVTRGETEAFPSLEYAGGDVEIIGGDGLRNIKGAFRRLMRAAGTVRIEGNTPA
FT                   LAEVSDSFSLLDYAGGDVRVRGNTNLVMVSQSFVSLRAAGGDLSIDDCESLVRVEGGTF
FT                   NRVQWLSGSLIVSKTGLRSLSFLYSLANIGTDIALRENAYLKSLDGLQNLRFVGRGYAL
FT                   QGLEGNFGRCGAISERYGVSHQCHTRQYRFCQPLSRSPALSVPGWYRCVDSIATKLLTT
FT                   PELKTTAALAQASGQMDSLQTPAAALTMFAPTDVGWLRSVGRLDAIRLRAEAAQSPNAL
FT                   SELLHAHTIRGDEMPREARRVE"
FT   CDS_pept        complement(778003..779571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638744"
FT                   /orf_name="MICPUN_53791"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70071.1"
FT                   /db_xref="UniParc:UPI000199C4FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB3"
FT                   /transl_table=1
FT                   /translation="MATLRVRPAGVLVSTRGHRVAHRRADRRLAARSDYSTNDRDVSVE
FT                   KPPSDDGAKQTPVKKVVVIGGGLAGLGCLASLSGHKHINATLLESTRVLGGRVRSKAAL
FT                   GALAWDQGASYFTAKDPSTPFAEVLRKGRADGVVELWAGGDASPGARVGTMCTKEEAGG
FT                   HVLDESSWEPFAASKELYVGVPSMAELPVFVAEKVANAVRPEASWLGDNAVPGTPEYLT
FT                   NAFADRIQALRTQDTGTWPANVPHSGSDRNWGLMIRCREGGHMWYKPWESDVVVLATQA
FT                   PAAAKLTAQILKSVGADGDGGNGYGIASKILAMASAADRIRGNHCWSLTVAFAEPLNLP
FT                   YEGVMMKEPFDGGIAWFANNSSKPGRPEPGKGKGAQTAGWAYRWAEVGTSLTVGQGECW
FT                   VVQASPEWSNERAEMSPDDAAKELCDAFLKLVGRSESEVKPVHVKAVIWKFAYPLNPAG
FT                   DPSDDSKRYLFDPDLGLGACGDWTSGPRAGDAYDSGVALGRAVAEHLASELNQKETSER
FT                   EGKAR"
FT   CDS_pept        779697..780686
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638745"
FT                   /orf_name="MICPUN_109052"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69790.1"
FT                   /db_xref="HOGENOM:HBG557229"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="UniParc:UPI000199C4FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB4"
FT                   /transl_table=1
FT                   /translation="MPPPLSQLLLLLAGFTRLVDAQGDCMPQGSVAIFMVYQAENPDSV
FT                   FFSEDGCLAGGGRGTGCCAGAQCRVCEPNQVTSAGGKLMRWNSCQCEPCPPGSVQFRVG
FT                   QNTCIECPAGWYQPVAGQTNCIQCPPGTFNPSRGRSATCSECPPGTYSKSSILAYREAT
FT                   TKLYRAADGTEFDDSAGATSCTECPAGTYQPSPRGRNADSCLPCPPGTYSNRGAAVCSP
FT                   CPAGTYQPHEGMAGEEACLPCQAGKCSDSDGSEDCYQCCPIANLACDAYMKRAQGFYGT
FT                   QWWYSNDGKTGQVPTDRYSDFLKALCRRGCTKFGVVNWCVTGTCSITE"
FT   CDS_pept        complement(780805..783033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638746"
FT                   /orf_name="MICPUN_62025"
FT                   /product="Chromodomain-containing protein "
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70072.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199C4FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB5"
FT                   /transl_table=1
FT                   /translation="MCSGTTHPLAGPLLGVPDGYAKKHKSLKEIIDGSRSGGDSDKAPE
FT                   LVDLVSEDDEPSDPADVAAGCSPPKRRSRSTPSAAPVFRKRSCVNFRAPIPDDREEPDG
FT                   AGLPVEGLEHIFELPDTDSDGNVKHVLRVLFPREKMGDEAARRRPGYHRLGIVETVWDA
FT                   VRLYNGTARAEGATEQELLEEHLDPSHIKCDEWIHSDLQGAHETGIRMTRKGTFCVRVV
FT                   ERGGTRPKTLSRHNDIEAAVEAFNAHSREQLVLGYASTRESQKFGSLKKLTDSFATILP
FT                   GDDNALKLGEDDDRSPSTEPSIKLKLKLTPSAREAAERMRTVRLAARGEAPPPRTKTKT
FT                   RKRTPEIRRNVCGIKGLHVLYEAFTEDVERTLFTHKKLFPFGATRSTASEKRIDSTLGL
FT                   AQMPDDIMRVANVVRDSGLEPTLITPDHVLSQSYPPRVGFMSHLDSSERWGEVVVGVSL
FT                   GADGVLFFTPNCRSDRGIGNRIRNAALENDFADYPTESGVTESDSWRNGRGSRVNKGQK
FT                   SWALELEIPRRSVYVMSGAARTDLEHGIRAVKAPSQESAPAWNPLGVRRSLTIRAQKPY
FT                   SDATLEHLARENPRDKGVSQRLRSQMSFKTAFEATTYGNTGRAGAEQARAFVAKNAATR
FT                   LRFEPSQVGFATEPGAKEDDVIRIELVDEDEDEDDEDEDEWGVDEIVGKRVLEDGETQY
FT                   KVAWSGTDGRGRPWKPSWEPESNLTSCREAVEKYETMCGVMKRSEYYC"
FT   CDS_pept        complement(783229..788430)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638747"
FT                   /orf_name="MICPUN_62026"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70073.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG557231"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI000199C4FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB6"
FT                   /transl_table=1
FT                   /translation="MPRKKAAPQRNEASAADAKRAREEADKAAADAARKRARSEAFTRS
FT                   VTKVVAPLVPEKHRDDDGVEVARLNGVRARRGDDASTSSPASVPTRLTLEVAGDGSKVP
FT                   RLAWSFADEEKDGSPSGDEREWRPERDPSFHAASALLFLIERGRFALRLDARDATRCTL
FT                   AVLVAPDALESPTHPEEFARKGHHGKQRAALAWLAPPRRRTLERYAAGIEEHDDDDVDD
FT                   VGPQLSPLVPASHNLLRDVYEAAKPPRDCPDGCDGCAFTELVPTPRPYQRRAVDWMIRR
FT                   ERGGVPAASKRGDSVEEDDGKTSSSNHPLWSRLGDEVYVNWSTGQLTRDRFDGGVAEPS
FT                   GGILADEMGLGKTVELLMCVLAHRFEPPAVVKEEKKEEEEEEEAGTGEKVADADDDEQT
FT                   EEIVGCVCGNTEDDYEGMWLACDGCRQWSHARCVGYTKADETRHRKKADAAIRASLDAR
FT                   AEWERAAAHAKSLARGGARYVDDDTASDAVKVAARLEEISEKKNADADAAAHAPPFLCG
FT                   ACVARRAGEVVSGPCRATLVVCPTPILPQWRAELRRHAKPGAVRVLVYEGQPRDAGGPN
FT                   AGKRRTNATFQTDTFQTDERLSNASDGVVSAANLAAADVVLTTYDVLRGDLHHDPLGDA
FT                   GSRASRHVKRYSVIPTPLTRLTWWRVVLDEAQMVESSTAAAAAMARMVPAVHRWAVTGT
FT                   PVSRGLEDLQGLFAFLGGPSPFADAGWWRRMVQTPYEAHHHSAREFLHRSLRRLMWRNA
FT                   RADVADELALPPQGQTVTLLRPSGIEAHWYQQQRKVCEGLARDALRRIKDPRAFKKERE
FT                   EERRKERMRREGASAAWNGRGRRLGRGELDELADLIDDGEDEAFEEVEEEEIVDLTAND
FT                   DDEDRYLTAEESRKVLQPLLRLRQACNHPQAGTHGVRSLAKGNGGGVIGAGGIHSGVIM
FT                   TMPQIHAVLIDRQRTEAEEAQRLVAFTLNASAGVAMCRGDYPAAVGHYREVLRLELAGA
FT                   EDGLNLRLDSLQRLHALHNLRAALEAAGPDAPVARTLRDDSLDDDAETERRKYVAQRAG
FT                   GVFAAAADLRKVSESVKKNARICGASGAGPAGAAWWSALIDSHSRSADGGRSTLDRLVD
FT                   NQLSGRWQGREVAFTDLAGFRFALETALDELGRRREEFLDRLEHLAKVTADADPVDVEA
FT                   AGKCVLCVAKTTMHDDDDGVVFAGRQRAKPASNRERNLRDIDARSGGGRTLCQHCAASP
FT                   LFKRYEDVLFGHLGMDAGMTTGGRGRIAQADVGDGRSAPSSAEVALKFLATRVPKQGFG
FT                   AVAAKESSLAHLEMMEDMRREFTRAMILVKHQREEMYARDELAMATTRIRVRASHEVAL
FT                   GGLPDPVPEHLRASVVHEWELDDMEEAYVADRAAYEDDLRKAKSQVRFLERLKDDEERE
FT                   NGGGDSGPFECPVCVEEVDSSAAAAELAVLPCGHRLCVGCTDALVSRAPPPAHPRAPRC
FT                   FKCPTCRVRTAADEVNYVAKGSSRVKCVRWPAAGAGDGADMDASLGTEREQLQHEAALV
FT                   VKGSWGTKVEAVVRRVMYLLDPDRPGGHRDAKCLVFSEWEDALRVVAAALKANDVPAAH
FT                   TLGGGRKLRDAIDAFKGVAPPPAGEPSPKALLMPLRRGANGLNLTEAQHVILLEPVLDP
FT                   GAEAQAMKRVDRIGQTMPTCVHRFLLQGTVEENVQELSRRRREAAPGEAEDVGRARSGS
FT                   GLRISEVEVLIPRRVVGAGAGSADASPGTETNVLTD"
FT   CDS_pept        complement(788568..788837)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638748"
FT                   /orf_name="MICPUN_74659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70074.1"
FT                   /db_xref="UniParc:UPI000199C4FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB7"
FT                   /transl_table=1
FT                   /translation="MMKAMMDSKDVTGVSGDLIDIKMLDFSEDRTMAYSAVVASATFSY
FT                   KGTPNDDVYVFTNVFKKVDGVWETVWGHRSTGRSPDEDPPAPWP"
FT   CDS_pept        <789456..>790004
FT                   /codon_start=1
FT                   /gene_family="HOG000200881" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638749"
FT                   /orf_name="MICPUN_72389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69791.1"
FT                   /db_xref="HOGENOM:HBG609757"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR015636"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C500"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB8"
FT                   /transl_table=1
FT                   /translation="WKAVHESMLVRDDPGCRPNHRIAAFDLDDTLQKTRSGKPGYMVTD
FT                   LGDFVPWNPRVPPKLRALHDAGYKVVIFSNQGGVKGAMEGKRADVVRARLDAFAKEVGI
FT                   PMQALCATQKGEKDPKNYRKPKSGMWAHFDSSLNGSVSPDLPACFYVGDAAGREGDHSD
FT                   SDKGFAVAVGVKFFTPDEFF"
FT   CDS_pept        join(complement(795667..795764),complement(790210..795487))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638750"
FT                   /orf_name="MICPUN_62029"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70075.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI000199C501"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHB9"
FT                   /transl_table=1
FT                   /translation="MRHRSSVAAVESDRGELHLVLSPARSVDTHVIRVCSTTGALEHGH
FT                   APGLDVFPSQSAAVAHLRRRGVCKTVTEGCALLGCAAFGDCALALIAKRVRTAVVLPNG
FT                   HEVLTVTEAQWVRCALRNPAAVLTREERANVQALTDIPLENLYFYCETFDVTRSFAHAT
FT                   DESIASPDGEWVWNEWLASPVRRLGIPGACPALLQGLAESRALTDARGVEWRLAVFGRR
FT                   SRLHPGTRYLARGLNAAAAPGNEVEMEQLVWRRGAGGAATNASTDQKAPSENNHTEPNG
FT                   SGRNSPAGSSGRTSPVVTDRSEASSPGGGTAGGPVRWSSYVWRRGSVPIRWGQEVKQAI
FT                   GEADIYIASENPYQGTGRYFSRLARQYRPGDATDTEGLPVTCVNLLRCAPGKPELLLSE
FT                   HFHEAVRGVRKRSGLSAITVLNFDWHANIKSLGEGKTVEGLWTALRSYLVDAGVSHGVC
FT                   EAGADPGSGSGSGSGSGSGSGSGSGSGSSGTDASAARLTKMTFKWQRGVLRYNCADSLD
FT                   RTNLASYFAAVQVLVEQCGLLGLEVVSDVSNDPDGAGANPATSAVASASAATYGRREAS
FT                   SAPTLPPGWESRLDPVTGRTFYIDHNTKTTSWTLPHAAQQSEPEMPSGALDDAHGGLRR
FT                   TASIGGVSNAGPGPWRLLGSGVDEVRGKMLPAALSAMCEIFLVNGDLHAAVYTASRAIH
FT                   TQIFHLLDGRSVKAGGSGGSSAYHAAASLSNMSISAQRRFLNMTQDVHRQQQFEMFLGA
FT                   HRERHFPSCSRYGGGGRGGGIVGGGLVRSDSGNNIAATPPSKSSSEPSSPDPANGGPST
FT                   ALTASSSIVDNDAAVAESTAVLTRPPAAAVLVAPRSMGEPLSPPEALLAACTAGATTPL
FT                   WVCPAGERRAAMAVWLGRPGAPEHLLLTSAPGAPEHAAPRFVDVLGGPSLDRLRPISLN
FT                   LAVPRSPPGTPMLFRLGLPSSSARGRGRGWSFDDSVPTTQLIAENAARDVGGAIEAMEP
FT                   PRGACRIIAVTFRASDDGDFADKFLVLGHVEVLGAPTATPAIEPVATYAAPATERAGGP
FT                   LRSVSSSAAALASNLSGNMSMSVPALRRPSNDGGGDDVGGDDVGGETTGGEGGGGGGVD
FT                   PLGGVVDPLGGVVDPLGAAMNIPSAAASTPPGTGATEIEYGDRAMAAMNAAEIGAGRPS
FT                   LESLLELERDRLRLGLPARSRDGVLAARGLSPRDFDPLPALLRRDVDAHRRALADERAA
FT                   AAERAAQTPSRLSSIASMSPWEQLMGTGVSVVRTAAGVVYPGAAASSGRDTPTREQQSG
FT                   VARDQDGSSSRASEPTDAASLATPAREAARPAALLEALRREREDSLLAEIEALASATHA
FT                   GRLRDAGAEGGAEGGAKAMDAAPDSPAMPLRALLPDGSVDANPIRRADDVAVSCATGTL
FT                   GIVTTSSTTRGREEETSTTFVLRTRAAVVGAVLRAGADGVAAATLTLSTGDDVPAVSSA
FT                   DATVSSVTTWTLGAPRVGIGESPRSNDDDGGDDDDDDASDAPTATQRRALRGGEVFAVV
FT                   LAEPTPPCRVVRLTARNVSSGDGARGSDAGDIPLDLASARFVVRPTFPANTPSLVGSPD
FT                   DEGLSDPAMVSSAAAADFADPTRDAVARLSSRPEVARALENSAPNHGIRSRSPVAFEEA
FT                   HSNGSVLHVGFPPASKTVSGFRVFPPDPQPRAQPWVIRVYALAEEEQQQQQQQQQQRHG
FT                   VSLGGDPLGSSLGSSLMGGPMSFEPPLLPEETLTHLGDFAVPTVRNRTPLCFDLGEEVD
FT                   ARLLIFESVAGEGRDTGWAAPPPSLSGRVQCYRLQ"
FT   CDS_pept        join(798845..799826,799980..801031,801152..>801739)
FT                   /codon_start=1
FT                   /gene_family="HOG000200882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638751"
FT                   /orf_name="MICPUN_85693"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69792.1"
FT                   /db_xref="HOGENOM:HBG609755"
FT                   /db_xref="UniParc:UPI000199C502"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC0"
FT                   /transl_table=1
FT                   /translation="MGHLEAYVGPLLFGRDHRLREVRALLESARPTPISLGSDGGGGGA
FT                   AGGGQGGDGDPEAVTAQQARLWSLAPRTSALAVGRGAFTLGTSRARPTESLRVPTLTLA
FT                   GCLPAQRGATVKLDLAASSPSTDFTAWPEFHNGAAAGLALAARTKGELTRAWIVFNRPR
FT                   EPSHAHAGVLMALGLTGHLRKLTNTDLYRYLVQEHDATTLGVLVGVAAARRGSMNPDAS
FT                   KMCFLHLPTRHPSAFPEVELSPAVQAAALLSVGLLYEGTAHRLMSEILLAEIGRDPGGD
FT                   GAAHGREGYALAAGLALGLVTLGRGRAAVGLADLQIPERLRRFLGGVNDRDRGVPPGED
FT                   QVAASTSGGQVMEGNMINLDVTAPGATLALGLMFMRTDDEGVAAHLRVPNTHFALEHAR
FT                   PDFILLRVVAHSLVMWNSIRPTMEWVLSNLPPLLRVSLEPPRDLEASLRAMEDLGGRAG
FT                   GAVDREAIAQAHVHALAGACMSVGLRYAGTADATAAATLREMTLRFVRLKSQCKDGKDG
FT                   LGALIDRPTLETCVGVAAVALSCVMAGTGDLASLRLLRRLRLRLDTSSLDAGQQGAAAA
FT                   AAAEAASGGGGASGLSHGAHMAIGMAIGFLFLGGGTQTFATDNGSVAALLIATYPRFPQ
FT                   NTGDQRCHLQAFRHLYALAARSRLLQTVDAATQRPVYAPLELTNPEAEPTDETETFHAT
FT                   APCLLPEEDRLVRLRVVGDRYWPVEVNLASTGPHRAAAIDLLYARRRLPVQRLTGALPY
FT                   AADPTGARAGLARALHAAAAASLRPPRVFDAREDDDDATGVAVRASTYGSSALEQDAVG
FT                   VFTSDPALLGFKRLMCGVVGADDAASAELAEFCRAALHECMTREDAASLPAYVDLHASV
FT                   ASL"
FT   CDS_pept        complement(802517..>802951)
FT                   /codon_start=1
FT                   /gene_family="HOG000200884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638752"
FT                   /orf_name="MICPUN_85372"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70076.1"
FT                   /db_xref="HOGENOM:HBG409942"
FT                   /db_xref="UniParc:UPI000199C503"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC1"
FT                   /transl_table=1
FT                   /translation="LLASFAGIAASEASKRLAHSVSFGVTLAVLTNIAQMVHWKSKTRG
FT                   GTRWNKRGPFLLTLASVPLVMLDLTRHVLQDGGAWIEGSRMYRPGCGHADVRCLSGIGA
FT                   TCLLATYVGFACLISGVLWSADVTRKLRDGWRRAARRDID"
FT   CDS_pept        803398..>803802
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638753"
FT                   /orf_name="MICPUN_85534"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69793.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199C57D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC2"
FT                   /transl_table=1
FT                   /translation="MALLFPAIRAARPTRASGSRFGASGPHPARPALTRAAVGPVRPVG
FT                   EDDHRHGVDGGATRRVALVAALAAPILGSIPRPAPALASELEAVVTDKVFFDLAIDSVP
FT                   AGRVVVGVFGDASPIAAARFKALAIGIQGLG"
FT   CDS_pept        <803995..804426
FT                   /codon_start=1
FT                   /gene_family="HOG000237430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638754"
FT                   /orf_name="MICPUN_85900"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO69794.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG186882"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199C57E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC3"
FT                   /transl_table=1
FT                   /translation="RAGLVSLTVERGAPPPPPKERLVSMNGKFVTVKDPPPPGPNGTGF
FT                   VVTVSGGASDTPGETADILDRTNVVVGTVLEGMDVVEAIAALPTVKDNSSSPFFAVAKS
FT                   IGDKRATVAEQAFGKPFAKVTVARCGIVRDEPPAPSETE"
FT   CDS_pept        complement(804520..804966)
FT                   /codon_start=1
FT                   /gene_family="HOG000198115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638755"
FT                   /orf_name="MICPUN_109053"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70077.1"
FT                   /db_xref="HOGENOM:HBG557234"
FT                   /db_xref="UniParc:UPI000199C57F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC4"
FT                   /transl_table=1
FT                   /translation="MVGALGSVQWTAPARSLRAGIARGGRALRAREGVRVVAARPPKGE
FT                   NDGSDNKPKKMLYEVKVVTPPERSLGPHMLPKNTHCGDTIELKNNKYYVVDRVCTHYRL
FT                   EYGKYRRDHTGLYVQEASRYILNKHLDALLDGPDATKAREEGTE"
FT   CDS_pept        807564..809249
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638756"
FT                   /orf_name="MICPUN_62035"
FT                   /product="Amino Acid/Auxin permease family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69795.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199C580"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC5"
FT                   /transl_table=1
FT                   /translation="MADLREGLLAPRGASEGDDDDSALDDPNGDDATRPGAPWTAAATA
FT                   TISLTMTAVGSVVLSLPATFAECGWLAGTCVLALVALLVDASLLFVVYAARSARARSYE
FT                   EAARALLGPTGGACVEVALIALVYGSLVSLQIIVADQVQPVVLGVLDNYSSHTRDEVSG
FT                   FAFVGERWFITCVSLAFVYPMTLARSLTVLASATTAAFFVLLFVAGALASEFAKKGWIP
FT                   APDVVAVETSRGAAGRCALALPVVAMAYACHFNVVAVDRELPRTRRGKACASNVIHTAV
FT                   LAGAFPFYVVFAFAGYLQFGADVSGDVLTEWRGGNENGVMTAAQLAVAGVNALKYPLMG
FT                   FSLKRAVNERLARLWHPTNRADRDRDEERDEGTADVHDDSYDDDDDDDDEGNRQMQRRG
FT                   TRGQMVRASPSAPFWAEATAGLILHASVAACALSAGSLQLAVDLVGSCCGVPVMLVVPG
FT                   LMFLAAFERGDASGAWVGENRDDESSVWDEEAADVDPRAREYFGEGLEWAARWERDARG
FT                   RLVARPRAVMAALAWTLVAVGSVVAATGLAGIAYELASGTGAAR"
FT   CDS_pept        809590..810234
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638757"
FT                   /orf_name="MICPUN_109055"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69796.1"
FT                   /db_xref="UniParc:UPI000199C581"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC6"
FT                   /transl_table=1
FT                   /translation="MAATVAAHAGVGSLAARAASTRARCRAGGRAVWANGARDGAPRTE
FT                   VTGRARGDAERECRRERHEVETPSTSSLGGRAFGALAAAVIASAGAGAGEHIAALAAGP
FT                   LSGVKSEVTKDLRLVEREIQIDAEIIERDIERVPLTLENFIAKEPPILVGMFFLACING
FT                   TIGLFWALFFRETAAGPGGEFGKGIVALRKEVVKGIFRFFGSILGSYVRER"
FT   CDS_pept        complement(810338..811570)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638758"
FT                   /orf_name="MICPUN_62037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70078.1"
FT                   /db_xref="UniParc:UPI000199C582"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC7"
FT                   /transl_table=1
FT                   /translation="MPAHPVATIRNRRDARVAKASSVYSNPSPRLRARPDPCAGLDFER
FT                   MGPGHGSGTSGGPSAKERALVEDARVAKANVARCKERIATHERTIASQQTLNVRLRERV
FT                   DALESTVARILPKTSRETVLAELENARDAAATVKEAELRATRAGARLEAEVRARDAERR
FT                   RMKHRALEVARERDAVGVRHHATLVRLRDVENEARFASAEVRRLKAELDRPKPPRDVVA
FT                   SDRSRARPVEDKSVDTRDDRAHETTIGEDYGEGADAVGGRVAAIGANVPAIADWTPEPE
FT                   RVTVVIEVREPPPPPPPPPPRVVEERVVLCIVVVDPEPTPPPVPSVVESLAVDAGCPKP
FT                   SDVVEAGVEGGDESVVTVTLTAEPPPAGRTPSKVASKVEALRKSRRFTRSGRHVERQFS
FT                   ATTKMMRKRRE"
FT   CDS_pept        complement(<812110..>813215)
FT                   /codon_start=1
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638759"
FT                   /orf_name="MICPUN_68463"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70079.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326850"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR022407"
FT                   /db_xref="UniParc:UPI000199C583"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC8"
FT                   /transl_table=1
FT                   /translation="DAKTPDAWVQRHPSLIRLTGKHPFNVEAPPAEIYDYGFISPVNLH
FT                   IVRNHGAVPKLDWDTHRIEISGNVPNPYSIGMDELTQMPSDCFPCLVVCAGNRRKEQNM
FT                   IKKSIGFNWGPAAVGNTYWKGVPLRIILNRAGIYKPGPGRRFVCLAGPEGELPKSYDGQ
FT                   DGGPGSYGTSIDMETALDPTCDVIVAYEQNGDRLHPDHGYPCRVLIPGYIGGRMIKFLC
FT                   KIIVTDEESKNFYHFNDNRVLPVGVDAEKATAEGWWFKPEYIINNLNINGAIIHPQHEE
FT                   TLHAPMKKYTIKGYAYSGGGRKVIRAEVSFDQGQSWKLANINVREKPRWAAGSSGDKAK
FT                   HWCWCHWEIEVDADEIRGANEICFRAFD"
FT   CDS_pept        join(814190..814234,814418..817680,817877..817907)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638760"
FT                   /orf_name="MICPUN_102772"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69797.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199C584"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHC9"
FT                   /transl_table=1
FT                   /translation="MASEPEPPTGLDAVPASSAAAAEAEESRIAPAASDPPAPVPPAPV
FT                   ATAETTATEPSTEPSTRTATGPAPEPAAPADPSTYRGVEGTDFRVAATETLVQAQSKER
FT                   IAELAGVDPNAATREADSIVAAAKAKADAEAAAAAAKAAAEKEEEDAALKIQAVFRGKA
FT                   ARRDVEEFKKGGGVESRSATTEAAAGGGVGAFAAGSNALHVEDTASKAVQPAPPAMQLG
FT                   HWETFAARQIARHVPVASGGLALGPAPRGYRFRVLAVEAFPFGPECFRIRDRGNTLEAK
FT                   VNVSFYDECTGSFHGATCSSAPEPAEIPATPGDGDGDAAPVATLDVQHDAYFTTRVCDP
FT                   RCLIVVEIVLVERRGDGSAARETSAGWAAMPAVGPGGAEPTGAPGSAPVRQGSPRYLMW
FT                   GRPRAGQHPPSQLGRAKLHFVHETCPALLRAAPLIPEDFPVTYGDVVPGVLRFDADGEL
FT                   TSDVDAVTTTLTSPLLAPTRAVSLSGMRVNLPKRMMDVVAASPDLAVALHGAGAKPPGV
FT                   DSLVANPTASAAAIAAAKCVTVRITAHNGRVFVGESVEASDFAVDPEGSPSCIVLRSDA
FT                   IVPDVPQDVLVVLVVEVLYRAPGKRGEPPVTLGWAATCPFRPGIESPGHATSDTFSGSL
FT                   ALRIGEDALLVTRRGRGPRAEPCVDWRSVVQAPQEVWRAVFRSGGDVSDKDETSVAFTF
FT                   AAAEGDTGGHRGASQAEAARALLDAPVADNVAQAKSKMAQAETALKDTSMTGRERAKAE
FT                   AALAAAKMDLSSQQQLVQVMERMQVQLNELASSVNVIKTDLRGSRDAAPAPPAAERARP
FT                   LDRSPRVSPEVRNAEPVPRVPEASHSTDPEPRVPEASHSPPMDEPVYADEEWPAAGPAE
FT                   GSSALFSGAAADAGEPLVSARGLGGFSRATRARLHAAGADATLPPDVRDAIRAAASRAG
FT                   APQNPTLDIVREHRDIRAVNEVIVQFLAYRKFDALNSTSQLADVHFTFNFFDFPASTSR
FT                   PCVLTPPDVPRGEPQMLVPKGAPRRSDGGERAGDAWFRFKVDGTGNGTGDKIPDGPDAM
FT                   HARRCAFVDYCATQRLSVDVWDGSSLMQHGTCSIDLTGLLRQGRDSAEVMVEAPVAATA
FT                   PRVTS"
FT   CDS_pept        818513..819676
FT                   /codon_start=1
FT                   /gene_family="HOG000207584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638761"
FT                   /orf_name="MICPUN_85751"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69798.1"
FT                   /db_xref="UniParc:UPI000199C585"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD0"
FT                   /transl_table=1
FT                   /translation="MEDDALAGNRLFLLAGESLKVPFKFQSFDAEPAKDSDSSDIKRGA
FT                   PDEGLHLRSRAVAVHFVNADDGTSASVLHVDIRPRAMTVARTFRFQTAENEFFKERLPP
FT                   PPGVATRDASGRGCLAVRASDPAVAATVVTTESEEDGEVDEVALRYKCGEGSVAFYVCV
FT                   YADSFLGKLAAVWRVFVHATPKVDVSSLVGQSSHASVVVQGGVATRRVAAFCSHPDELQ
FT                   VSPDRLTLPPGALTELQLAFRPLIPGRLDVAVHLVDLEKGELVHSRLVATDARGPVVSK
FT                   TFDVDAAPGARAHKKITYTNPYARPRTFHLRCTHPLLLHFRPDSLHLPAGGSRPMGLTF
FT                   EPAEDWERATRGAGGVRGGPAEVLVFINDEDDATEECFRIRVNADPR"
FT   CDS_pept        complement(819790..824049)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638762"
FT                   /orf_name="MICPUN_62040"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO70080.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG633062"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR015536"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI000199C586"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD1"
FT                   /transl_table=1
FT                   /translation="MAPPKQPAAGMRSIASFFAPKAKAPPKEQLPGIANGAIAPDPSES
FT                   PSVSPPSADAHGATRAAKSAKTSACAAPGSATPGGGDGKTPPTAPSTAVSNDEQHARID
FT                   PSPPEAESPPGDAPATATTANAAGAGDVGRRIAVLWKSERRYFAGNVAAYDAVNGKHHV
FT                   RYDDGDDEWIATSRHDVKWDDDAEAEAKKKPPPVDDDDDDDDDDDDDGSESESEEAPPA
FT                   KRGRVTARRAAAAKALRRVGSKKSGGGGGGGGRPARRAAGAKRKVVLSDSDDDFDAGGD
FT                   EDASEGGDESESEFEVESEESEEEEDDDEASEEESEEEESPGPKGKRGGAKSKPAQPAK
FT                   KTVTTVTPPKKATPKKAKNPPSSSGGKSLAAALSEPVLAPTGSPELNPAHYEARERLMF
FT                   PWLQPDKRRDASGRRPSDPEYDPTTLQLPGAFPKCKDATGKPFTVSPGQAQWWRFKAAH
FT                   FDSVIMFKMGKFYELFEMDAHVGAADLGLQYMKGEQPHCGFPEKNYAANAERLARAGHR
FT                   VVVVEQTETPAQLAARKAADKSVKDNVVMREKVAVLTRGTLVDAGMTDASPDATYCVAI
FT                   LEVEDKPVENRAPKTDGADDGDDDGDDDEPARWMGVCAADCATGRFLLGAWREDAFAGG
FT                   LRGALAALKPVEIVCAPGGATPRVMPALRDATPDASIRSLSAASASSLHPDDVVERLTG
FT                   ADGYFQSGALPEALATFGASTTRGERAAALGAFGVMTGYLADAMIDRDLIPLGRVEAIP
FT                   GPDAAGIEAARGGFVALDAAALVGLEVLEGSDGGCVGSLLNALDRCAGAMGRRLLRRWV
FT                   CRPLRSAAAVAARQAAVREMRSEKDAVAEARRALRAAPDLERAASRLVGQSGGRGRDAA
FT                   NVVLYEDAARARLHGFLRALEGVRGVLRAVRAFDGVRSRLKSPALLAIVTEGDTDDADT
FT                   TWATNDAAWGACAGASTPELSERLAFFERAFDWDKARESGRIEPKPGADEAVDAADDRV
FT                   CAADEALREWLVGTRKKLGGSKQDVNLVSANKDTHLCEVSDALAGKVPADWSREGKRKG
FT                   FEKFDCPELKALRAEREAAGEARELALENVLRALVAKFCDDWPRWRRASEAAAALDALS
FT                   SLAEHADEIAGSFPESCTPSVIAPEPSGTPSLDAVRLRHPCAPALAAGESFVPNDTKLG
FT                   GGGDAPFLLLTGPNMGGKSTLIRQVCLAAIMAHVGADVPAASFSMTAADAIFVRMGAKD
FT                   NIIAGQSTFMTELAETSAMLRRATSHSLVAMDELGRGTSTSDGAAIASAVSDHLVDLGA
FT                   RTMFSTHYHRLADDRANDARVRLGHMGCDVRGETGAEEVTFLYKLTQGSCPRSYGVNVA
FT                   RLAGLPEDVVQAAAKASKEMEEAMNARAVMRAVQAVRDAMDEFERTEDVSVLIAAQERA
FT                   RRVLAHVKDPVEEEAKE"
FT   CDS_pept        complement(824280..827120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638763"
FT                   /orf_name="MICPUN_62041"
FT                   /product="Predicted protein"
FT                   /biological_process="response to aluminum ion"
FT                   /protein_id="ACO70081.1"
FT                   /db_xref="GO:0010044"
FT                   /db_xref="InterPro:IPR020966"
FT                   /db_xref="UniParc:UPI000199C587"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD2"
FT                   /transl_table=1
FT                   /translation="MLDKPLFGQQLPFKTSIPPARLVPWPVRAGLSAGLASLLSLLKKT
FT                   LFKDVGWDDNVLPVPVFATVVAIVCTAKTRGGTYMNCWHVINGTIAGALGSALFLALLG
FT                   DSVAAVIVTNSLIGAGVLYPRGIPVLAQKFAFGGSTICVWGVYENLDFRWQTLGVPLSA
FT                   ALGALAAVIVALAPETSAIRSVKREADKVVDFLEEALDDAVTAYAWRSDPSQREMLRAR
FT                   VTNALTQAEAHLSKLKEAARDARWERKVLIGIDMVTKPEKDRKSHKSKAEEFIPVLAEV
FT                   SMSLKGMELALEGLNAVQVDRWHLLEGGEDSERVKGRPAPMFDGDPEGSLAAVKDVVVQ
FT                   AMRDAIKPRRRDDTQTSSQVAADLRESLTRLDDVITEERKRHYAPSQAASDARETVARK
FT                   ALQANHLWIFAFQNLADRLRAHHEPTWASSPGDTCQTCALAETSPAKPKKGPKGPLVDP
FT                   RDEISALFNCNFRANSDQVLYAMKLSTACAIAAIVGWIVSDNGSWAALAVSMVGTRESH
FT                   AVGGSFNAALLRMQGTIFGAMFAYTIMSCVQGEHESWAGGARLILLAVFNFLCTFLRLN
FT                   AEYSYAGVVAAFTAYVVALGIPDGASTSEARAYAHLRIEQNLLGLVILVFIEVVLLPTF
FT                   AHDAARRAASEATAAAEHAAEVIYDATVGTDCIMCRDRAAKDAGGALDDLRDKLATLNT
FT                   LLVQAAAEPHLWSPKFPLEPYQRIATETESVRRVLGLMRAALTAMAHGSRGGRTEGSGD
FT                   PRRMIRELLSPTDRFVTDLRRAVKQRLGRASHDLAEGEGHWETKKAAASIARAQASLHR
FT                   AFILHTLEIRVRYQAGEEDMFLPNHLMVPWHAFMSCTAVLALNVDNLSQASWEALLAVK
FT                   PPVGGDEEEDWEDEPEDDEPYSGGGGKYDDDDDDVRPISASQPSFKRSGSGNSGRSGDA
FT                   PYTNGVKSPEQSLGRL"
FT   CDS_pept        827829..828722
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638764"
FT                   /orf_name="MICPUN_62042"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69799.1"
FT                   /db_xref="UniParc:UPI000199C588"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD3"
FT                   /transl_table=1
FT                   /translation="MTRTTKRDARKDTRNAVLFPVDEDEAVETGASFLPPRLAHLRGPI
FT                   VAATPRPDLNGRGDDATMPVNVFAPGTPGSSVAVPPGVTPTVHAGHGRVLMGPWNGEFH
FT                   RAGSGPSSPSAGRPAASDRLDLVADDSLRENLSDLPFAGPEDMDMDEESVLREQWMEDA
FT                   MTGRGVAPSDDAAGQRFSSDGRDDDDAISEAGTGLEARLESGRGRGRAGRGRAASAPAA
FT                   VARRVGAARIAARRRLPQAIQRRAKESLAIARKESSRRAGDGPGFFHLNGAMRRNNGPR
FT                   NTAGVRCMQPRSGAFG"
FT   CDS_pept        complement(828852..829832)
FT                   /codon_start=1
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638765"
FT                   /gene_name="ODP1"
FT                   /orf_name="MICPUN_86033"
FT                   /product="E1 component of the pyruvate dehydrogenase
FT                   complex"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70082.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI000199C618"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD4"
FT                   /transl_table=1
FT                   /translation="MTVRDALNSALAEEMERDEKVFIMGEEVGDYQGAYKITKGLLQRF
FT                   GADRVRDTPITEAGFTGLACGAAMMGLKPVVEFMTFNFSMQAIDHIVNTAAKTLYMSAG
FT                   TISQPIVFRGPNGAAAGVGAQHSQCFAAWYMSIPGLKVLAPYDAEDARGLLKAAIRDPD
FT                   PVVFLENELMYGESFPVSKEALATDYVAPIGKALVMRPGTDVTLVSFSKMVGFCKKAAD
FT                   ELAKEGIEAEVINLRSLRPLDRDAIAASVRKTNRIVVVEEGWPQAGVGAEIATMVMEDA
FT                   FDHLDAPVERITGVDVPMPYAANLEKAALPQVEDIVRVAKRVCYK"
FT   CDS_pept        complement(<830010..>830303)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638766"
FT                   /orf_name="MICPUN_74622"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70083.1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniParc:UPI000199C619"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD5"
FT                   /transl_table=1
FT                   /translation="PPHQVVPFPSLSPTMTHGGIAGWKKKEGEFVATGDILAEIQTDKA
FT                   TMEMESMEEGWMAKIIVPEGTEDIPVGKPVAVLCEEQADIAAFKDYVPEASAD"
FT   CDS_pept        830868..831329
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638767"
FT                   /orf_name="MICPUN_102775"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69800.1"
FT                   /db_xref="UniParc:UPI000199C61A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD6"
FT                   /transl_table=1
FT                   /translation="MAESGVDALSEGLQRVIAPAVRECDAAASSCATAQADLTAHVDRL
FT                   AHELEVLLAAMPAEASEGHAERVRRVRARVEALGIRMADVEGRMTRLHRAAAGLRRADI
FT                   AKLLFRNGDDLELDDDDAELPPREELYRAGAVDDAGDEHGDEPEAKEAT"
FT   CDS_pept        join(complement(832088..832225),complement(831868..831972),
FT                   complement(831517..831714))
FT                   /codon_start=1
FT                   /gene_family="HOG000005887" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638768"
FT                   /orf_name="MICPUN_62045"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70084.1"
FT                   /db_xref="HOGENOM:HBG316789"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniParc:UPI000199C61B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD7"
FT                   /transl_table=1
FT                   /translation="MASGTMPADEMPVMREPYDIMRNGLPGAKAAVTHLGKHPVQLIQD
FT                   NGPTDTLRAKHAMLANTYGIAMPAKMDIECQILSKCRRLPGLPSSRLGLEIMTGDVDRF
FT                   GFESYLDRPDERPEAPRGDLHGVMENRLGLNKKPGYGPGSKR"
FT   CDS_pept        832481..833740
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638769"
FT                   /orf_name="MICPUN_62046"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69801.1"
FT                   /db_xref="UniParc:UPI000199C61C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD8"
FT                   /transl_table=1
FT                   /translation="MAGVYREERRRLPRPGDDLPETLWADATVLVPLIREQARGDRFYG
FT                   NFMRSLAPAVEKEARGTAVTRELAGSRGAGKYVAHLMGGRVRQLDGSAAGSDSEESEDE
FT                   EEDEEEYDDTPRARRSEGGGGFEDAETTARKRARRVNVMSGLAPGGKRMPSYSEHEEQL
FT                   MYRGRAMGLSWDDVGTILPRRTKRSISKFYYGTLKKKMGGDPSAVPNFHDAERRAMRTA
FT                   CGEAQARGEDLDYALVAEAANEARRELVDEPGLANCAPRNAVDAEIFCRLHMGVKHDGD
FT                   GDGDGDGDGDDDEMEDEDAGDDDVRGKTHYGRGVGRAAGLWQDWEQEAIYRMRRTGQAW
FT                   EDINTAVPERTLPAIKKLWYTKLCKKSPEEMGLPADLPNAEEDAKKKDVEDEEEEDDEE
FT                   GDEGDDDDDDDDDVPLTSLL"
FT   CDS_pept        complement(833814..834896)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638770"
FT                   /orf_name="MICPUN_62047"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70085.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="HOGENOM:HBG319020"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="UniParc:UPI000199C61D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHD9"
FT                   /transl_table=1
FT                   /translation="MLIQASRFVNSFWLIFFGLSVVADLNLVPGLSGFLRAVAKRGKDD
FT                   EGDDPAGKRRRPWWQVTVPHGWFTHFYVVGVLWNAVALFHSLIECAWAGSDPSVVGAAL
FT                   ASTLFQAHVTRRLYESAFVSIHRPGGRMHVVGYLIGVVYYICVPLTLAHPLAAAAVVGS
FT                   VTDAWRRGSIAYLLEPVDGTKLAAAADGIRHVLKFAFTASGRSGVGALMSGFCVMGGVY
FT                   AWGVGNAHQHRYHVALAKLRGGEKKRENVEKKERTGAAKEYGVPRGGWFESVSCPHYAA
FT                   EVLLYVGICAVACGSGLGAGGIATGAAGFGPAAALARTAPMLASVAGNLSIAARRNHEW
FT                   YLRHMPDYPKGRWAMIPGIL"
FT   CDS_pept        join(835048..835083,835242..836090,836513..836956)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638771"
FT                   /orf_name="MICPUN_109058"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO69802.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG557245"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199C61E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE0"
FT                   /transl_table=1
FT                   /translation="MSYFNNENAMPQSSNAFANGSDQNCGNVITDRPTTRLHAPPGGHS
FT                   SICFGAAPEDRVRSTVATAQDKATNSPSAVQSQVFGAPSAARSNSSNAFANGADQNCGN
FT                   FITDRPTTRLHAPPGGQSQISFGGGDFDAPAVRRPDTAAFAAKEREQAGSDIFGAGPAP
FT                   VAAAPEVWSAEEEVPPPATVQATNEDIKAMMHQELRELCRAHGLSPAGAKNTLVERVCE
FT                   AMVTGQIKVMVANRGVSGVATVGNNYNREQGQNVGNFLTGRNSSRVLAPPGGGSSFSLG
FT                   GYGSEPAPASHKNVSQAKHHEIIGNDIFSDGHAASSRALSDAKIAQLQGHDVFSDSPNA
FT                   FVPGKQVSHAKLQRDYRGSDVFSDVAEPRRPGTALSTAKANDMRGQDIFSDGPAREKGE
FT                   VSEARAAAVAAMSGSDVFSDGRDASRRSVQVSKPPGGGSSIVF"
FT   CDS_pept        join(complement(837926..838007),complement(837067..837833))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638772"
FT                   /orf_name="MICPUN_62050"
FT                   /product="Predicted protein"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /protein_id="ACO70086.1"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="InterPro:IPR013110"
FT                   /db_xref="UniParc:UPI000199C61F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE1"
FT                   /transl_table=1
FT                   /translation="MSLETSESHDPSPEEVRAARAKADAKRADAIAARIDAAKSSPPSA
FT                   SRSWDARDALDACERLFRDHPGSLIRERCRDEIFTPSKGRDDGSSSEHVRDLVYGEFGF
FT                   MSLAALFRKYSDQIPPRAVVADLGSGVGRPLFAAACLRPDLARCVGVEKLGGLHELAGE
FT                   LGALYDAELAPVLGAEPPRVELHRGDFLHGVEWRGANVVLVNSAIFSDELFEKTEARAA
FT                   EVLSPGALVVTLRRGFADCGHEGACWELLEATERRQSWGMSTVYVHRRTQNSPRRAGIE
FT                   D"
FT   CDS_pept        838752..839375
FT                   /codon_start=1
FT                   /gene_family="HOG000243835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638773"
FT                   /orf_name="MICPUN_85750"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69803.1"
FT                   /db_xref="HOGENOM:HBG412006"
FT                   /db_xref="InterPro:IPR021919"
FT                   /db_xref="UniParc:UPI000199C620"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE2"
FT                   /transl_table=1
FT                   /translation="MSNPVATVAPLFLLADGLRDDIKPSYFATLGLFVLSAPGLWSLVK
FT                   RSAKSKIDRKTFEVAGPSAEQAMPLDELAREISMYFRRNNYVIADAGEVITFEGNIAPE
FT                   RGTAAYITFCVAIGLLCIGLVCSIALPGGNLWYSLALLSPLSGGYYMDNAGRKERVKVK
FT                   MVTADDDMTTDVIVEGDVEEIERMRRDLNLVEKGKVYVKGILEQ"
FT   CDS_pept        join(839628..839688,839822..843663)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638774"
FT                   /orf_name="MICPUN_62052"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69804.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniParc:UPI000199C621"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE3"
FT                   /transl_table=1
FT                   /translation="MPSLPASAQRRIVRFIVRNSGAIVLCNAAAVIVMLFLLSHTHQRV
FT                   DATLRHYLVRGTRTGERSRQFDRLVSTSTVTTEPPREPASPEDVEFGTSIDAEARRMER
FT                   LDAEFPGAAARLTASRVLADFPRRSAPDKALATDPKAGAWGGAGGAEEFTVIVKTSRAA
FT                   ADGDVFTPHALRRVCELKRAIERSPGYGGACARVKEKTATKNQTQTPASAASSKNDWDG
FT                   CAPAFSVFDVVSAYEHVGLRGVPLAFARTARAVLLLNDGIDSVRRVCSSRETAGGVLCG
FT                   LRPSLGCDPRGCDAKLDVTARACVVGNGLVEVCDWIRSAAPTEEEVKTVAWADFRQSTS
FT                   SEDEGCEKGSFDSASAASAIKFGAVAARWSERSGGTLEMAALAAPWSLLADRRFGEAGA
FT                   DGDDDDARARTEVTRLAFRLAPRGTPGYAAATRWAKEVAGPIVESWGDGEMTASWRHMW
FT                   ALKLMGREYLWGDLRWAAGSFCTTLFLVRAHTGSTFLALGGMTAVIASLVVAQFVYVHA
FT                   IGVTWIGMLNFLGVFIVLGVGADDVFVILEFWKQSKREALSTAGEEDNRHSDDGESSTE
FT                   RVLVERLRWTAEKSLYVVTMTSVTTAAAFACNMASRIAPVRLFGAFMAALIAGNYLLVC
FT                   TTFPALLVLEHGMRARSARRWRRWRNRARVRATRLESVVVAPAHPVTHCPVTHRPAIGP
FT                   RTSPKHRRTASHAPRLAALEEDHGGVEMDPPSASKPTARRTSSLTLHDRLGVFWRDGGG
FT                   RDSDDEDDFSSLAAASVASSPSQSPVEALAASMHATRRAYEERGEAAVRVLADFVVSYR
FT                   WHVVAFAAASLAFSAFAARGVQPPARSSSAGFSIFPEGHNFNVFAEACSMFGFARSAEA
FT                   VRVTFVWGLERPRETDPADDEFEINSIDSSPRNPLGARALEETARRLGSKFENPTTSDQ
FT                   ERAAVPAFDTSFDATSEEAQAWMLSFCRDLRGSEATARRLKDPNSVVCFAEDVEDATRA
FT                   ASGGGFGSPMSPARYGAALRRYGRGESNDGAVRWFAPDRSGTPPAPGRGGPTLTNIPAD
FT                   IGGSNEGRVASVAVTAVLRTSSVSSSTAELVAEHEFWEGWFESKLAGAPPGMRGGFQTS
FT                   PTWTLTETETELVDGAWTALTLSLVFAFVVLLGASRSVRLALLATISVGSSAASLLAAA
FT                   ALLGWTMGVIEAVCTMVLVGLSLDYVLHVAGAYVRTSGADGRRERAKGAVRAVGLSVVS
FT                   GASTTVGAAAFLLGCTLTFFTKFGLFVAWTLTSSLVQAVVVFPAMCAVWGPEDVERVEG
FT                   EEDEQEGWRQTHAAAR"
FT   CDS_pept        complement(843725..845956)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638775"
FT                   /orf_name="MICPUN_53803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70087.1"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR016060"
FT                   /db_xref="UniParc:UPI000199C622"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE4"
FT                   /transl_table=1
FT                   /translation="MGRCVADDKCDFSTQYLYSMSSTSYYCSNKRAAGETASGSSWQCL
FT                   SGVSLGGYCCAEGVTSEGCASGKCDSGTGACSTKSSPGGSCTTTDDCFGGKACLGGEGN
FT                   KRCCDFAEWEFNENNGLYKGCNSCGDETAQDSFGGSKPGLCETCASGYTYLDGQAHPTI
FT                   TFRPGSYEFMGRCVADDKCDFSTQYLYSMSSTSYYCSNKRAAGETASGSSWQCLSGVSL
FT                   GGYCCAEGATAPSNGECCTHCAQSTGTCAVRSTCSPCDASGDIANGVASPCTSSLAAGT
FT                   SCEPTCNGGYTLTGSRSCDGQSLADTAACNAIWCDPDYYVEDNECKACATGTTSAGGSA
FT                   TTCTVNCDANQYWDGDSCEACLVGTTSAGGSATTCTANCDANQYWDGDSCQACPVGSTS
FT                   AGGAATSCTCPANKYAAKSGSTWTCADCTAGRTKAANSAIPGTGDGETEASACGAASSC
FT                   SANQYISGGACTACPAQSTSDDAKSKYCVCDGGHYAIKTAGVWNCAVCEGATGSRIPQE
FT                   SGEDAKCASALKAAAAKSRAALLDDIADESLKKKAQLLADAAIAGEKVKKITLKEEASD
FT                   KDSACSSAFTKADMKSTDGACVATASASGRRRLSATTYDVELLFSSSTVSDDKLTAAVN
FT                   SLKANGVEGVKSESAVDPIAELATVDGVDSTKLTTFKTEAKAAADAAAAPAASSSTSPP
FT                   PVPPPPPPPSPPPPKSVVLDDDDFGTALDGKAALATASVCAWVLLTLVM"
FT   CDS_pept        join(847265..847847,847995..849133,849245..849691,
FT                   850340..850477)
FT                   /codon_start=1
FT                   /gene_family="HOG000270497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638776"
FT                   /orf_name="MICPUN_97993"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA binding"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO69805.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG285811"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="UniParc:UPI000199C623"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE5"
FT                   /transl_table=1
FT                   /translation="MSDAARPTGVALRGRARTLDAIARELGLRERHVREAVALMDEECT
FT                   VPFIARYRKEATGGMDERALRRVADRLGELDKLEQRRDAILAALEKSGDLNPALARAVA
FT                   AADTPTRLEDLYLPHRPKRATRASAALDLGLGPLADDLLDPSTPYSRGFIRRFVKAPGV
FT                   ADDDAAMRGARDIVAEKAGECVEAREAARRASRDAARDYLSFERDIQRIQPHQYLALCR
FT                   AETAGVVRVSVEWDDTPAVDAARRALVRKGLRGEKAAEVEAAVKDGVKRLLRPAAERET
FT                   RARLRDDAIRRAVRDFGANVAALILAPPMRPAAPVVGLDPAHRTGCKIAAVSATGAVLA
FT                   AAVVHPRREDANAAGGGEAGRRFREFCERHGARAVAVGDGVGTREAERMVAAALAGSKK
FT                   SGSTSGIGWRVVSECGASVYSASELAIAELPDLDVSLRGAVSIARRLQDPMAELVKIEP
FT                   RHLGVGLYQHDVRAKELAAELDQAVESAVAAAGVNLNTASAALLARVPGMSKSLAEKTV
FT                   AHRESRGPFASRRGLLDVKGVGEKTFQQAAGFLRVDSAKDALEMTAVHPEGYEAAMEVR
FT                   LEDLRRLRPAIDSLLGRGASDPEFKTIASAAGIGELTLKETLRAMAKPGVDDRDVFDAA
FT                   SRLRTSALSLTDLKVGDVLEGAVRNVVPFGAFVDVGVGVSGLVHKSNMRGGNDKGRAPE
FT                   PHEVLSAGQAVRVRVMSVDAQRNRIGLALLHRERRAEVAPPIGVTRRVRRHVRPRLAER
FT                   HVVPPVAHPAAAEEV"
FT   CDS_pept        851206..851925
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638777"
FT                   /orf_name="MICPUN_62056"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69806.1"
FT                   /db_xref="InterPro:IPR018276"
FT                   /db_xref="UniParc:UPI000199C624"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE6"
FT                   /transl_table=1
FT                   /translation="MNLSSLLNLPSREGGFLSRVVESPQTSPGAANPASPGAAPADPPN
FT                   SPGRHQRAPNTGELRAYVCDHSTAPPAHQYITTDKTNILIRTLTQRRSKDALAANPAAS
FT                   QQQKLGVASASGAGARPRLPAFGARAEASGSEGARADNKRGAEAVGAGDGGGGGGGGAS
FT                   GGGGGGLGRRAPSGLERASKRPAIDATAEYRRLESLTAEQLREYLRGKGQTGGLEGAGR
FT                   AALLSRAKLAVAARGGR"
FT   CDS_pept        852003..852758
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638778"
FT                   /orf_name="MICPUN_62057"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69807.1"
FT                   /db_xref="UniParc:UPI000199C625"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE7"
FT                   /transl_table=1
FT                   /translation="MSRAFTASDFEAGARVLVDRWCRDPAAVNASMTVRWVEESDTVRR
FT                   NAAAGGYVAAEGHLVVPERSRTIQNDESDEPPGSSDHEDVEDHHEDHEEEDDDAAAPRT
FT                   VPPRGAHVRSYHVVYSKSYGCPVLLVRGVSCEPGGRVMGHAETEASLVAAATRGAEGCA
FT                   EEERRRRAVSLPNVDGERGLTAFAPWEHPHGRGGGWVGVHPCETRSAMATLLAGEGGGV
FT                   GSAGYMSAWISFVAAAVADLPVPAHRMDS"
FT   CDS_pept        complement(852870..853481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638779"
FT                   /orf_name="MICPUN_62058"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70088.1"
FT                   /db_xref="HOGENOM:HBG557252"
FT                   /db_xref="UniParc:UPI000199C626"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE8"
FT                   /transl_table=1
FT                   /translation="MGDHITQKFRALFVKANDTLGRWTATQSRASALVVSAAMVIERLP
FT                   ELADDQRFGPLKERFPTLPQATREAQAVALDRVMTNLREEIEYFDELVKELDRLQRNAA
FT                   SLLGGMDPPPPGGGGLRRGPTPAVAECVLGLRDLWRIHRDELAIKRALVDELTCDALMS
FT                   DLEEVKALFAAEPNLDPDAVRRLVDSILDATPDPQARRRQ"
FT   CDS_pept        853573..854718
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638780"
FT                   /orf_name="MICPUN_62059"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69808.1"
FT                   /db_xref="UniParc:UPI000199C6A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHE9"
FT                   /transl_table=1
FT                   /translation="MVPADEQTRTHAPLMLAPYLNDAKDLARRDDVFIARQPPAAAPPV
FT                   TARSPVTSRGEPIVAQPVSSVKSADIPPMDGSETREQRECRVLRAQVRRLERSVTLARD
FT                   DARMATRREHTAVANLALATSNLERERGRLERACEARIDEAAKRAKDEGAAARLELKRR
FT                   VENRERANTNLRERIDEARAALRDARAHGEAAETDARDVARERDDLAARINALEADLAA
FT                   TSRRLDDTERALRSTVASAEARTRALDAELARERARGQDARAKLGEATERISSLDAEVA
FT                   ARRAAAEAYTRRITQAEERTRGMERKVTHVRSRLADRERDLANAAKVRAREMEKEAERR
FT                   REFESARGWFDAQMSAMRGEHARLMALVKRFESAALPDWMS"
FT   CDS_pept        complement(<858394..859591)
FT                   /codon_start=1
FT                   /gene_family="HOG000029489" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638781"
FT                   /orf_name="MICPUN_85476"
FT                   /product="Monovalent Cation:Proton antiporter-1 family "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70089.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG682773"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018418"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniParc:UPI000199C6A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF0"
FT                   /transl_table=1
FT                   /translation="MAGSPPDAVGGEAVHVEEHHDNAYEALYFLFLSLCLGAAARGAVR
FT                   NSRLPYTVALLFVGLAIGFSYSYLDLGVLSNSLDIWVAIGPHTMLSVFLPALVFESAFS
FT                   LEWHTFRKCAAQVLWLAGPGVLLGTFLMGSLLKATLPYGWGWGSSLMLGSILSATDPVA
FT                   VVALLKEVGASKRLGHIIEGESLVNDGTAIVVFSLLNQIAKGEDKTPLEIFTFFVWVPV
FT                   GAVLVGVGIAAGCHAWLGLGAVAGDHIVQISVTLFACYLCFLVAEFEASASGVLACVVL
FT                   GISIGAFGRGFFTGETEHSLHHFWEMLTFVANTVLFILTGVIIAKTTTEAATDRTLTAH
FT                   DAGYGLLVYIEVLFARAAVIAVLYPILRKCGYGLTPYDATVCWWGGLRGAVGLALALVV
FT                   "
FT   CDS_pept        join(859812..859847,859912..861570)
FT                   /codon_start=1
FT                   /gene_family="HOG000249250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638782"
FT                   /orf_name="MICPUN_112691"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO69809.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG522200"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="UniParc:UPI000199C6A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF1"
FT                   /transl_table=1
FT                   /translation="MFARLRAWATLHASWLRSAVVWPQFQDPTPAGNNHRHTMLRSLAS
FT                   ATRETLLRQARGLATSAVIASGGSPVFNSPGKESTPRRFCVVGSGPAGMYAADRLLAAF
FT                   GEDARVDVVEKLPTPFGLVRSGVAPDHAGTKSVVNRFDGILRDPRVTYLGNVSFGEHVG
FT                   LDDLFARYSATVLCYGAEGDKKLGVPGEDLPGSHSAREFVGWYNGDPRCVKDLDAPLRR
FT                   ALTCAEGDTVVIFGLGNVAVDCARMLLRSPEHLASTDVCQHALEALRRSTVRRVVMVGR
FT                   RGVAQGAFSPKELRELLNLPGVRVTVDPRELKLEPEDEADLAAQRPRRRAYEAIVKSIE
FT                   SPPAGVEADLKAGGGRELVLKFLRSPTEFLPSDDGKNSVRAVELAVNRLEGAAGSRKAV
FT                   PTGEKERLDRVSLVLRSVGYKGLPAKGVKEGFPFDHERGVVPNVAGRVMEKMGGYPTHV
FT                   TGVYVAGWLKRGPTGIIGTNLHCAEETVESIAEDAANGRLRRPDYRFKGKGVRPLLESR
FT                   GVRVVDAEGWGRIDAAERAAGEAAGKPREKFVSVDSMVRTALAIGES"
FT   CDS_pept        join(complement(863023..863121),complement(862803..862904),
FT                   complement(861614..862687))
FT                   /codon_start=1
FT                   /gene_family="HOG000264994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638783"
FT                   /orf_name="MICPUN_109059"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70090.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C6A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF2"
FT                   /transl_table=1
FT                   /translation="MARDPNTPKAPRPKKKPKNKDTAPAPERNETPEERAERKRKAKEE
FT                   RRTKAEPVLREDGDKKCKICKEVLPTSKFSPAQLRKPRAACKSCCESRAQDDRPDHVPR
FT                   SKSMKERREELRRLRETKRKERDEVKAKPATPAMPNRADEPAAKRVKPSEPDGGDEERE
FT                   RPAPAGDGNDEAPVATKVDGGDGAANVDEPASDAEGDEAMKRQIYVGGIPFYKTEDEIR
FT                   EAFDNENLPVESIDCMTFPDSGRFRGIAIVTFATAEAAKGALAWNNEEWEGKFLVVRKY
FT                   APKDGATKAVAAKEDATPREEVKKTEGQTIAFIANLDYSVTEEQLRTALVGCEVKEVRM
FT                   GKDKETGEFKGFAHVEFVGDDDLEQAVSLSGTNLMGREMKIAYATARKPPKEDRAPPRF
FT                   GEKKRGKRDMRHKGDFKKIRRAKRG"
FT   CDS_pept        863392..864327
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638784"
FT                   /orf_name="MICPUN_62063"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO69810.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C6A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF3"
FT                   /transl_table=1
FT                   /translation="MGICFSAPPPVYRPPPGAMHRQLPAPGTYNRYYDQAKAAFIAGDT
FT                   DRNGVLDAQELFQVLTRLGFFNGVPPSQINQIMEQELSKADRNQRDRLITFEEFVPYFE
FT                   YLMQELQRRGGTVLPPAQPTQYYGQPGYGVIAPPYGGHSAATTSVIIQPKGGYSSAQQN
FT                   HRTVNLGHHAAPATRGGRSGGGMSTATAVAGGAALGVGGVLAYQNAGAIGDFAGDAAGA
FT                   VGGGIVDGANAVAGWAPGAAAAAGDGIVSGANAVADWAPGAAGAVGDFAGDAGGAIMSA
FT                   GGAVADWAPGAMDSVGDFAGDALSAIADFF"
FT   CDS_pept        join(complement(867104..867140),complement(864547..866789))
FT                   /codon_start=1
FT                   /gene_family="HOG000225092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638785"
FT                   /orf_name="MICPUN_62064"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="magnesium chelatase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ACO70091.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016851"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG553490"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="UniParc:UPI000199C6A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF4"
FT                   /transl_table=1
FT                   /translation="MSSAVATPVPFAARRSQVHGSGASNLRARPVRVVKGPRSVVRAAV
FT                   TDPDVIAQRVAEAAQMEADGDRPIESAGVRQAFPLAAVIGQENIKSALLLGAIDPALGG
FT                   IAISGRRGTAKSIMARGLHALLPPIEIVDGTICNSDPEDPNSWEDGLREKLSRDANGEL
FT                   VTRIREAPFVQVPLGVTEDRLVGTVDIEASMKEGKTVFQPGLLAEAHRGILYVDEINLL
FT                   DESVSNLLLSVLAEGENVVEREGITLRHPCKPLLIATFNPEEGALREHLLDRIAVTLSA
FT                   DQVLTFDDRVMAVDQAMNFQNSADKAVTDAEEATEGARTQIILAREWLKECEISEEQIG
FT                   YLVGEATRGVCMGHRAELFAVKAAKALAALDGRSKVNADDLKQAVRLVIIPRAKADMDV
FT                   PPPEDDEQQQPPPPPPPPEDNMEDDQDEQDEEDNEEENEEEEDDEVPDLPEEFMFDAEG
FT                   GLQDKEVLQFAQSVNRRGGRSGRSKNVIFSNDRGRYIKPVMPKGNVMRLAVDATLRTAA
FT                   PYQKARRDRAIAAGEVPKKVYVEKSDMRAKKLARKSGALIIFLVDASGSMALNRMNAAK
FT                   GAALSLLEDAYQSRDMVSIIPFRGDAAEVLLPPSRSIAMARNRLDTMPCGGGSPLAHGL
FT                   SLAARVGINAMSSGDVGRVMVVCLTDGRANISINKSNGEPEYIGPEAIKPTADELQEEV
FT                   DDMAGRLYAAGMNLLVIDTENKFVSSGTAEKLAQKALGKYYYLPNGTDREIAAATTSAL
FT                   AAAKAE"
FT   CDS_pept        <867851..>868636
FT                   /codon_start=1
FT                   /gene_family="HOG000096858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638786"
FT                   /orf_name="MICPUN_70768"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69811.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748611"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C6A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF5"
FT                   /transl_table=1
FT                   /translation="VEKLSDEPKAFLYHGFLSAEECDHLIKIGTPHLKRSTVVGGKDDT
FT                   GVLDDVRTSFGTFLPKKYDDVLYGIERRVEDFSQISYENQEQLQLLKYHDGQEYKDHQD
FT                   GLTSPNGGRRIATVLMFLHEPEKGGETSFPQGKPLPAVAQRLRGMRDELSDCAWRDGRG
FT                   LAVKPRRGDAVLFFSFKKNGGSDIASTHASCPTVGGVKWTATKWIHEKRFDTGVWREPK
FT                   CVDEEPANCPGWAKSGECANNPAYMLGGETPGKCLRSCCA"
FT   CDS_pept        869081..870271
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638787"
FT                   /orf_name="MICPUN_62066"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69812.1"
FT                   /db_xref="InterPro:IPR019152"
FT                   /db_xref="UniParc:UPI000199C6A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF6"
FT                   /transl_table=1
FT                   /translation="MDTPGEDVAELRRQLETMRLEAAREKARASSYAAQIEELKRQNLS
FT                   AHSRVEQEEELLTNNLMKKLEKVNSEKREMLMRVEQEEEFLTNSLQKRLDRVMREKLEL
FT                   EAQMAREHEQLDKASGDLERRLEALSSERERLSAEKVELERQLEAEQEFIVNKLQKQTT
FT                   NLAREKEQLRAEREDLRRQVEKLLSDKIRLNKEKVELENVMEAEEESIVNRLQMQMLEL
FT                   FQRNKYLERRLEAGSQTPSVVSESETSEDEGGSHHASRRQFGHGTSPQHRSWKHPHAMG
FT                   IPHGVGGMAPWESGMYMSVQRRRSGGSASASGSEPGSLHSTGGGGRGAGRVGGASGAGG
FT                   LSGGHGASGGHGASGGHVPQVSTARDAGGSGESADATPRSSMGNTPLTTPRSERRG"
FT   CDS_pept        join(complement(871205..871530),complement(870638..871058))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638788"
FT                   /orf_name="MICPUN_106174"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70092.1"
FT                   /db_xref="UniParc:UPI000199C6A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF7"
FT                   /transl_table=1
FT                   /translation="MFDIHGDGLVGVRVNTSSNITLLIISTSAQSISDVNASAERALQT
FT                   LLKLKVTDPVMVVDQQGFPQTFVPQEYPLGVVTNIVRDLGGILTTKQKGDSVLATIPAR
FT                   TNGAGRGRSLKNDNVPLSNLLEGLANGGGKNGKPEVGLFQAKRRKDRLKPFKFGPSELA
FT                   ELAVGLRAYVTAKRETSAPVTSWSNLLARKWPREYALAKQAAGFKCTAQKVREAIDANL
FT                   LNRYGSVWQWRGGWPAEAEKYPACSI"
FT   CDS_pept        <872831..>873073
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638789"
FT                   /orf_name="MICPUN_74531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69813.1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000199C6A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF8"
FT                   /transl_table=1
FT                   /translation="FIEGDFDAYCVGMRRPNAWGGEPEILMLTHVVETPIEVFMPEAGE
FT                   SLRSIGVYGGEEYCDENDGEGRISVLFHGAGHYEAL"
FT   CDS_pept        join(complement(878742..879005),complement(878473..878681),
FT                   complement(878106..878373),complement(877935..878021),
FT                   complement(877554..877847),complement(877119..877454),
FT                   complement(876647..877049),complement(875133..876499),
FT                   complement(874941..875078),complement(874533..874583),
FT                   complement(874272..874397),complement(873201..874037))
FT                   /codon_start=1
FT                   /gene_family="HOG000264961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638790"
FT                   /orf_name="MICPUN_96640"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70093.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG557259"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199C6AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHF9"
FT                   /transl_table=1
FT                   /translation="MRGYHPVPKDARTRAAVVAAFGHARCDWASSLDRGHPHHRHARAG
FT                   FCGVVGCEIHDASRGGPTGSLRGALERLRPRAPTYVPIDRAVAMALDAVLSRLDPRGCA
FT                   AFASTCVGARQRIDCRAPGLKLRLHPHQEAGLAWMRARERPNGSASMPPLPDPRYWVNV
FT                   LTGEMSTSPPPSYADSPGGLLCDEPGLGKTVTALALVLATRGARPAPPDGHRARRDEAS
FT                   GCWYYEGTARLAAAATHDGDPTTPSVRRSRRSTTPGVGHFAKIERAAFLLDNPRIEDDK
FT                   NETVEDDPSLPPPGFRQVTASAARASKERAMTQRNVSFFQRAIAIASHNVGKEVAFDAC
FT                   EFVLMNAGGSIADVTPLRLPKFRFNGEALKDATWDPFAEPIALDTDALEEALSLSRGRA
FT                   RGGAEETPKIWLSSATLVILPPVLISHWLEQIAFTTGAAEDGPSVCVVGGAKGKSKGEG
FT                   ANGAANGTGDASRWLFGIEGEADVTDLGRHDSLSSFHGLAPRELANRWDLVIIPVNRLS
FT                   YEFSRDSPILRVHWRRVVLDEGHQLGGASAITAKLSMACALRAHARWVMTGTPTPATLK
FT                   GAGVGHLHPLLAFLRQAPYASSQQLWMQAIQRPLDGGGAKGGGGADAAARLGSLLRRVA
FT                   IRTLKSDIRLPPLEREVRGLAFTRAHALSYNEIVSHVRRSLLLADWADPSHVESLLNPR
FT                   QTRLAMEAVQNLREAACVTGVYPVHCFGPEMDETVEDLVEALKRRGHGHESATARANEL
FT                   RYPLTVAKGRCQRCDVDAFMPLVTPCGHLLCCGCVAVVGDESGRGVSSAPQEDFLHETR
FT                   APVRCPVCASPFKMQAPDPRLDNPAPRQAVPQDLIEIQPSYVQLPWKMVDALEAQGEST
FT                   KVEYLLARLRELGAAPLEREKGAPGDGDDAGDLERLAVWSRRASGPPPKCIVYSGFRTH
FT                   LDVIDLALSGAKVNFANIARIGMSRWDKDRALASFRADPDVSVLLLDRAAAEGLDLSFV
FT                   QRVFVAEPLDNASLEQQVVSRAHRMGQRGTVIVEVLAMRGTAEETLLDVQAELAAAAHA
FT                   AAEESRARKKREEDDDWSDEEEEDDEEEAVQAGVAPAIAAEALSRRRVLQTLKLIPVPE
FT                   LLPADDELGGGAGEEGAGGAGREWKIRLRALRSALAFFDSSLGVHSLSAGVPPRRLTGD
FT                   DDDSTLRSLGVNDRDGKKNKLGSSDDRVAVGVGGSVGGDVPASAAAAEAAAAAIAGGGL
FT                   GEGEGRQLTVADIDGRVARRTALHAARQAVSTAAMLDDPDGGDDDGGDGGAAARMAADL
FT                   MRAAEASAARGSAADPTIASLQNAFRAIVQERAAEAEGNRKVSAAVAGRVTFQSLIDGR
FT                   LVVRYSAPDVAAGRVGVDGEQTEIVQDLPAALLPLVLRVVAADQSPAARQNLAPAAMAV
FT                   ASPRVFWAIVRHGGVGGGDGIGFAEALERLAPGAADWASIAVRERRRPERYSEYVSH"
FT   CDS_pept        join(complement(880835..880987),complement(879790..880596))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638791"
FT                   /orf_name="MICPUN_62070"
FT                   /product="Pe-pgrs family protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70094.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199C6AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG0"
FT                   /transl_table=1
FT                   /translation="MANEGVDWALSFGDGADVDDDGPDVNAQAPGPASRGGAGGANEKA
FT                   PQEPKTCRVTGCDAICQTVHEIRARACASHCAALYVQLEEEPEGTQSRFCYQCHKFHTM
FT                   DEYITPDGSLLQRHNCYKSQQRRLMRRRNKSNEKAAANKTHGGRGRGRNQGANPQAYYL
FT                   SRAAGANRRSSVAGGAEGGIGAEGGGGGAPGTPSPMYAHARERNEGPDAGAGGMMPPPP
FT                   RRVSGGVLIEPVTYANYEEPVAKTYQELLPPGMRAEAEEASRNTAAMDAMPAGPGEMTE
FT                   EMMRRLREEAVRAHNAQTLRFGSFTESSLKPRTAPSAS"
FT   CDS_pept        join(881504..881692,881828..882577)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638792"
FT                   /orf_name="MICPUN_109062"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69814.1"
FT                   /db_xref="UniParc:UPI000199C6AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG1"
FT                   /transl_table=1
FT                   /translation="MGAGGEQKPPARSGGGVCGGPVRRRLQPIGKPMERRASSLQRIKD
FT                   AADWKRIGLHQKYADQTMTRPLMRGWFHALTAFIFTALIALDAHTLSPGPVTWFAVVTF
FT                   VIPYWASTALHCVPWRRRTAHDLALALDFLGISAGFVGQSVGWVGVGTWRGVDEGASWR
FT                   LRFAAWCARGNVSLAAALAWLLTCALYNRHRQPVMLYCRKARFAIVGANMLLLGCVETA
FT                   LCHDWRLNVALQLLGRVFVPWYFLRCVAVDAGGKGWLPLWDGVWSPHENWHCAILVLHC
FT                   LQLHAVSIRHDGTSAFVTFLEVVGGSGHAGG"
FT   CDS_pept        join(882688..882754,882852..883180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638793"
FT                   /orf_name="MICPUN_62072"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69815.1"
FT                   /db_xref="InterPro:IPR009395"
FT                   /db_xref="UniParc:UPI000199C6AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG2"
FT                   /transl_table=1
FT                   /translation="MSTFKDMQDEHAARQAVLRERVEISRDAALASVSGLTEQMVDAVN
FT                   AGTVEVFENQKRVEEQARELRRKGAKFAGVTSEWVRIVRGFDDDLREIGDFEGWIKRVE
FT                   LDLNNLTQAMKKVAEQGSGSPRERGAS"
FT   CDS_pept        join(complement(884842..884998),complement(883251..884743))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638794"
FT                   /orf_name="MICPUN_102792"
FT                   /product="Glutamate-gated ion channel neurotransmitter
FT                   receptor family"
FT                   /function="extracellular-glutamate-gated ion channel
FT                   activity"
FT                   /function="ionotropic glutamate receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70095.1"
FT                   /db_xref="GO:0004970"
FT                   /db_xref="GO:0005234"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR015683"
FT                   /db_xref="UniParc:UPI000199C73C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG3"
FT                   /transl_table=1
FT                   /translation="MRQALLLGVLACSLSHAAAAPVYVDFCSLAIPQQLSGGYKNVSQA
FT                   VGFDAASGSVPSKSNIRGLLDGKTLRVIAHVDPNRVEHATFKTVPGCSSDCPYPDVFFC
FT                   APHIPGRTCDLEGGLKGRDYLLFQEMAKRGGFNVEWALTRDVSKTVPESYTAMAVNFTT
FT                   DDRFDLSTNWWTDTSDRRKLGLVIGHHHTDASRVLITARNSKKKSLDLDLLVRPFTGLV
FT                   WAVWCAIIVTYSIMMFTIERNWIDNDDLGKNRAERLVKGLSLELYLTFERFSGGSQTQK
FT                   PMSRAGRGITSAFGLFCLLFMSLYTAKLAAIIVVQDSAGEGLIKNMNDVRDNGGAVIMF
FT                   KGDPLKKRMETAHPYLKVNEDYSMGNMTRLALGKLLADNQALAEILPANVARNVVLQKQ
FT                   NCDVTVTSSVFTAGGGFMTSVEKCRSNVHVILDGLLMEIESDGTLDDRIETKTVDMCSG
FT                   GGLDADAAGLETKALDIDQMMGLFMFVGGSMCAIFFTNQLFGGASKALNNPNYLDILGG
FT                   AAQRKPSKENSAHGGEEDGKAAHHRMFASSKV"
FT   CDS_pept        complement(<885470..>886195)
FT                   /codon_start=1
FT                   /gene_family="HOG000264992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638795"
FT                   /orf_name="MICPUN_69792"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70096.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG609657"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000199C73D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG4"
FT                   /transl_table=1
FT                   /translation="SRVNPAQIKKAVAALAKHLEKVKAEGKTQLFEEDGDGDYYSVMLS
FT                   TRRVPQKGSNKLVPVKIPNPLLNPDKTEICLIVKDHQGEGHKEAKKKVADMEACGVAKV
FT                   LGISKLRNNYKPHEAKRQLCDSYDLFCADARVLPILPKLLGKSFFKKKKQPVPVDLTKK
FT                   DWAAQIRKAAAATYAHMGAGTCIHVKVGTSGMEVTKVAENAIAAIDDLVQHVPRKWSNV
FT                   QSIYMKTNESVALPVYNALP"
FT   CDS_pept        join(complement(888878..>889219),
FT                   complement(888317..888790),complement(887822..888292),
FT                   complement(<887243..887707))
FT                   /codon_start=1
FT                   /gene_family="HOG000264991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638796"
FT                   /orf_name="MICPUN_65858"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="guanosine tetraphosphate metabolic
FT                   process"
FT                   /protein_id="ACO70097.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0015969"
FT                   /db_xref="HOGENOM:HBG594146"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI000199C73E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG5"
FT                   /transl_table=1
FT                   /translation="SHVDADFLYDSIRDKLGYLTDYERSEVKDATRMAFNAHDGQKRKS
FT                   GEPFVTHPVAVAGILADQRMDHETVIAGLLHDTVEDTDAVTFESIQERFGPAVRRIVEG
FT                   ETKVSKVSSSQALAAAANVQADDLKEMFLAMTQDVRVIIVKLADRLHNMRTLGALKPEK
FT                   RVKIARETLLVFAPLAKLLGMYNVKNELEELAFRYAAPETHAETARWFDELTKRQDPVV
FT                   RRAAEELQALCDKDEFLKQACSKVEVLPRAKEFYGLFRRANGGSKPGEIDNLRRVNEVA
FT                   QLRVILHLRGDDESDGEYAAMSEARRMVSSRVCYQALSMVHALWPPVPGRMKDYIATPK
FT                   LNGYRALHTVVLPIGSDQQGSAPERQGPIETEVFPLELQIRTYDMHRMAESGIAADGEV
FT                   KAAWRATAKRTARKLRKLRRRAADADGDVKVEWLSNIREWQEEFLGVITAEEFVDTVTG
FT                   DLLGRRVFVFTPSGGVMNLPHGATVVDYAFYTDAGLDMVEAKVNGVAVDFDTPLHNADV
FT                   VEIITQAAGGYNLLDGAGESTAAALAGAVAKQKISLQKKFLDMARTRSAKYKIKKFLAE
FT                   QGVKLGDE"
FT   CDS_pept        join(890082..890307,890490..890998)
FT                   /codon_start=1
FT                   /gene_family="HOG000007231" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638797"
FT                   /orf_name="MICPUN_62076"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69816.1"
FT                   /db_xref="HOGENOM:HBG715783"
FT                   /db_xref="UniParc:UPI000199C73F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG6"
FT                   /transl_table=1
FT                   /translation="MQSGESIYNLIPQPVVAPERPPMHRSKYPGDVDPATFEFGDRVRK
FT                   GTGTFGRSPGTIKPKTDAFLKRTSVDKLPSPASTMTRTKVKKLPPVPKRDEAPAMGLVS
FT                   DKNFVKTNALEAMLAKPPKKEAPLLATQKKDYGKVPKYLHTIKSQIAAEKEMIAEFQRQ
FT                   QEEAATQSIRPMSEDERDELLYDMKVKWGKLNEAYGKLSFTLDVPSHMRRKEELEAEMT
FT                   QLEKDIKTLQGRQVVVVDERRV"
FT   CDS_pept        join(891176..892503,892547..892583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638798"
FT                   /orf_name="MICPUN_62077"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69817.1"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="UniParc:UPI000199C740"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG7"
FT                   /transl_table=1
FT                   /translation="MRALFLLALLLVGSARTFAEGIEARGHHPREDERAAKRRAAEARG
FT                   RQVSVDVVEDDGGLSVSRLDALQRWVEVSQTSSPRSSPADPNGAPRALFAAATHAARNR
FT                   SCATRDRSPEELREKERARRSLRMRETAEDFRVEVPVVFHVIWNSAQGAGWVSEERASA
FT                   QVDVLNRAFGGRTLRHDGSANSNAVDTGVSFRLHAVRYTDVSTDGDASRASFFREDCAP
FT                   GGGERVIKRALAESPETHLNVYTCEPDGGVLGWISHWPDEIDEGDVDNGVFLLHSTLPG
FT                   GDANPYHLGDTAVHEIGHFFGLYHTFQGGCHDVWDLEAGDAVFDTPPQAHESHGSCPEL
FT                   AAESPDTCTLPGHSDQTVAPYFGADPYWNFMDYAHDNCMSEFTPGQASRLREVISQYKP
FT                   TLCASMPGQSCEGVEGNVQAFSGSPGETPPPPPPPSLTPPSSIQRTTGRWKLGGG"
FT   CDS_pept        complement(893083..894771)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638799"
FT                   /orf_name="MICPUN_102796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70098.1"
FT                   /db_xref="InterPro:IPR013246"
FT                   /db_xref="UniParc:UPI000199C741"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG8"
FT                   /transl_table=1
FT                   /translation="MEQADAMDPIEPEGGLEDPFAQPPQSSNPVQPLQSPRTPGVAVQP
FT                   ATMEDPALQAEYAKLTAQLQALWRLKQGAENPNSVVGATIITYRQLLDGLIRDVAVETH
FT                   RSLSLGLDTLDSVQDRVPGAAEAAAAQTPTKAQMAALGSMGPAEITVETPSGKVGKGTK
FT                   DIYGRTGGASKEATTCPLCLQQMAASRFASHLERCLGKGRTARGPGGIPAGLQQRVRLA
FT                   AAGRAAVGMAPAGARGPLVWATGAAPLGAKEQAVKKKKPKAKSLAELTATEDEDDDVPL
FT                   SVMAAKAAKKKVVKGVKAAKEPGAKKAGKTKSLSDIFSSPPAKGAKGKKGKKGANAEEF
FT                   PMGSPFPMGGIPFEDFGGDGFNFDDADAFDLNFEIPGGMEGASPLAAPLAPAPPVKKKR
FT                   RSPGASKAGVGGRGGRGGAVGARGFGDGFDGALPGLATELGTGNGRGGRGGRGGRNGGR
FT                   GIVTAAGLPGRGVGAKPKAPRAAKPPKEAAAPKRKKVAVKTTKAPTTAVAGLDAFDDVF
FT                   GTGGALEMPGDAMVGMPDDDLELLFDGGGNRGGGGDQAFGNLFDD"
FT   CDS_pept        join(complement(897068..897103),complement(895184..896953))
FT                   /codon_start=1
FT                   /gene_family="HOG000100789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638800"
FT                   /gene_name="VLF3"
FT                   /orf_name="MICPUN_102797"
FT                   /product="Variable flagellar number 3 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO70099.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="UniParc:UPI000199C742"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHG9"
FT                   /transl_table=1
FT                   /translation="MAQASNADETETAELAFHGVEYVVSVSSFNGDMLSIEVEQKQEGL
FT                   RWRGDFTSRYIEDITTKTGNFKKFGVFHKMLVAAVVEESESVFIDLLTYADLEALKNKR
FT                   QGGAAPARTTSAKQNNKRYLILTYAAEYDRVHYPLPLLFEDQPSVESLNATVARLKREN
FT                   ARLAATAGVGKGDSSEIGAENARLRDENEQLRRTVRQLRRDLSKAEKSASAGGVGAVEL
FT                   SAVRGSTDGAFASSASGEQVDHLQAELKAVNKELRVVRRERDDLSRQLQQKETELANVE
FT                   ASKKRMLRSKQRELDQAVEDAGRRRETERELRIKVKDLTTQCDGLERRLRSGGYGGSFA
FT                   ASGSRSTSRAASPARTLGSGTPRASYGLRSGAASPARSGTPSRDYARPWTPGGVARARS
FT                   QSPAPSHGFRTPTRARSPSPGPDARGRSPGPARSGAASPRFDPTAYVREKRERDAARFR
FT                   NSARGIAQGLASPNRMRPSGTAGGGGYYTPGGGNSRGASPARRGGARDGSGAASPAPVH
FT                   RGNWRKNAERTSAVASSPGRILRDVKNKLADIAAKENSDARPAKAEVKPPMAKHGDASA
FT                   EIADIDTRLAALQSFLKEAKATATA"
FT   CDS_pept        897393..898478
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638801"
FT                   /orf_name="MICPUN_62080"
FT                   /product="Flagellar/basal body protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO69818.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="UniParc:UPI000199C743"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH0"
FT                   /transl_table=1
FT                   /translation="MADLTEYEQDLLRRNALLEERAAASIARAKAVVEGSAVLASQEWS
FT                   AGEIAGKSSLFEDAMLKLARDEVEHFAAGDVTLDSVDYESDDPPPPPDHEEWPDENDPE
FT                   PPRFSRHFPATKSARSSRPTSVRSSVERVMRASRDSAPLEEFGRDAPAASFANPEEDSA
FT                   GRLARARIRALQDELQAQAKELREAHARLKDRDGELKSLLTEKLNVGKQVKQMQVALDK
FT                   EKRAGADAKAAAEAKERELAETKKEIERDRRSNKAADAEAKAKDVRLNRALEEVERYKH
FT                   QLEQAREGQRGAATGLKGENDRLRQEVKRLERQKTELVAAFKKQMKLIDVLKKQKVHME
FT                   AARTLQFAEEEFMRTLDTDAR"
FT   CDS_pept        complement(898595..900001)
FT                   /codon_start=1
FT                   /gene_family="HOG000061737" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638802"
FT                   /orf_name="MICPUN_107122"
FT                   /product="Aspartate ammonia-lyase "
FT                   /function="lyase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ACO70100.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG284369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI000199C744"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH1"
FT                   /transl_table=1
FT                   /translation="MIIPADALYGIATARAMDNYDISGVKVRDYPEFIRAFAHVKRACA
FT                   TANGRLGLLPGDVVDAIVAACDELIQSDRHHAHFAVDMVQGGAGTSTNMCANEIIANLA
FT                   AIHLGEPVGDYSRVHPNDHVNMCQSTNDAYPSAAKLAVVFKHVAVTHALEDLIASLRKK
FT                   AIEFEHVVKMGRTQLQDAVPMTLGQEFRSFASSLAADLTFMQRNVDQLYELNLGGTAIG
FT                   TKICADASFAEASVAALSEQTRLPLRSPEDFIEASSSTSSFLLFSNILRRVAVKVSKIC
FT                   NDLRLLSSGPRCGFNEINLPAAAPGSSIMPGKINPVIPEVMNQVCFQVIGTDHTIASAS
FT                   EAAQLQLNVFEPIIIYNLLNNMNLMERGLNTLRTKCIDGITANPERCKELVDNSIGIVT
FT                   ALLPLLGYKKATAVAKEALETGRPVAEIASRFADPREVAEMLRPEAMTHPRRLVDVNTE
FT                   TLARHSRASA"
FT   CDS_pept        join(900657..900950,901011..901103)
FT                   /codon_start=1
FT                   /gene_family="HOG000100773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638803"
FT                   /orf_name="MICPUN_62082"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69819.1"
FT                   /db_xref="HOGENOM:HBG557269"
FT                   /db_xref="UniParc:UPI000199C745"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH2"
FT                   /transl_table=1
FT                   /translation="MITPAQGFLLSTAGNAAMCVGLPRKQVTDIYLNGTQIQDNSEADA
FT                   GWRFFGLAGGAACAAVYLADKTVTNADDRKILNGAIAANAIGNAALFVQHKFMDHVKPE
FT                   LRWLNLGMQAGVAGLAVKALLDKK"
FT   CDS_pept        join(901729..902237,902365..903454)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638804"
FT                   /orf_name="MICPUN_102800"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69820.1"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="UniParc:UPI000199C746"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH3"
FT                   /transl_table=1
FT                   /translation="MAATAPFEAARLMVKEAVTGASSLSSITTLRGSIERVMETTGVHG
FT                   YVLDALAWLPPEVVLVLDSVHIWFPLLTLFAFFFFGPAAAHQGSRVGNRAWLAFSTAVT
FT                   VRQLVLWFVGLPPVKGMLLAVGLEIIPARRRRASRPRTTPGVGSAPSTCIAAKYEPVSN
FT                   VPTAFSSRVEGEVQQKDYREFKERMEGMPARLPPVEANGEWSEMMNKSGVGFSYRAWRH
FT                   VLPYGGTEYLSRTVFENATVEEMCDFFNDDDVRASWDRLLFRHRVLERDDRTGAECVFW
FT                   ERALPVISNRDYVFTRRTWKDGETYWAITKGCVHSQTPVSPNLKRVEPYFSSWRMRAVP
FT                   GPDGRLTSAECILSHFEEQHVNQDVARFAVKCGMWGVVKNMDVGFRKFQKERVGSAPAG
FT                   GAISRTSSGPGGVDGATGQTVVTPGGSADGNGTNLGGGLARKIAFGTCVAAVGALAAAL
FT                   DAKSRSQKGGKVSGPRGGRRRTFSHVHSHKGARRRVRGRDLDLERDDVVEEESAELTRV
FT                   DAEEPGAAPAEVSEQ"
FT   CDS_pept        complement(903526..904533)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638805"
FT                   /orf_name="MICPUN_62084"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70101.1"
FT                   /db_xref="HOGENOM:HBG608170"
FT                   /db_xref="UniParc:UPI000199C747"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH4"
FT                   /transl_table=1
FT                   /translation="MASRVITVASTRASAPATTVCRRVVRGGAATGGGATKSSATIRGR
FT                   RSVRAAAEEPGAAAAAVRYDDIIAVLREAPIDGLDAAVDAVKLELTTGFYEHAVRRIDA
FT                   CRSAGDEAEADALDELCGRVMMASDRTFGAILPSLGDGSGEEIDGEASEALVTAGDLTP
FT                   AQQEQLQRRWDGIAARLAAEGEANAIAQVEKNATSRRDSVVAILGRVPMGPKELRSLNM
FT                   VTAERRIIDVLLTFPRGPERSDALTDALTPPPETETETDDGDEVNDGRGDNLELTDDDM
FT                   LVGDEEEVFTTPARLLAAVELAIKEANAGGDDVATVEELRSLRAEVAQRCDFLN"
FT   CDS_pept        906665..907696
FT                   /codon_start=1
FT                   /gene_family="HOG000198194" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638806"
FT                   /orf_name="MICPUN_85995"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO69821.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C748"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH5"
FT                   /transl_table=1
FT                   /translation="MLFGEKAFPVLPAPTRDKTTADYTLLRELGRGLCGTVYLGREKES
FT                   GRIVAFKVMRKSKLVDVGEARHASDERKLHEDISSGPFINRLLASFQDPWALFLVLEYA
FT                   PCGDLFQAMNFHGLPSRNDAVIYAVQVATALEHMHNKGYVYRDLKPENILLHAHGSVQL
FT                   ADFGMAKKLHPGKRTNTVCGTAQYMSPEVLLHRGCSFEADLWAMGIFIYELTTGDTPFS
FT                   SNSGSRQELYRRLMSHDPEKMTMANSVDRTTASIVKGLLQNVESQRLGAGGNWAELYAQ
FT                   QWFHCVDVGAVQRGEVVPDLSPRRRNVINDPRLQQVLEQGDVPWQRGSIVEDPAVLALF
FT                   ENF"
FT   CDS_pept        join(908338..908523,908720..908760,908959..909598)
FT                   /codon_start=1
FT                   /gene_family="HOG000265708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638807"
FT                   /orf_name="MICPUN_106177"
FT                   /product="Animal specific-mbd4, 5 and 6 "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO69822.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG557272"
FT                   /db_xref="InterPro:IPR000135"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniParc:UPI000199C749"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH6"
FT                   /transl_table=1
FT                   /translation="MAPKKAPVEKGAGTKDSQVIKRLHQILKTADLEKTTVKNIQKQLE
FT                   ADLGVPMSDRKQFIREEVEKFLKSNAGKKIGIKRKAEGEAGAKRGKKADKIGKDGKKKR
FT                   GRGKGKDVTDPNKPKGPKGAYMCFVQIARPKINAANPDLKFAEIAKMLGEQWKNMDTTT
FT                   RAGYEKMAEQDKERYQREIAAYVPMSEAGLEQLRKEKAAKKSAGGLQKPYKCSAALTKF
FT                   LGGDKTISRATLTSKMWSYFKEKNLMDPENKRWIIADKPLSDLLGIDRFQGFTVSKYLS
FT                   PHLLPME"
FT   CDS_pept        910369..911832
FT                   /codon_start=1
FT                   /gene_family="HOG000238309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638808"
FT                   /orf_name="MICPUN_97997"
FT                   /product="Glycosyltransferase family 2 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO69823.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG602904"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199C7D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH7"
FT                   /transl_table=1
FT                   /translation="MSALVAADRIFHFYVALYWRWVSRVDPKSKWRFEPLPEPGSISAE
FT                   NVKDFPNVVVQLPMFNEKEVCQAVIDAACQLDWPKSRMMVQVLDDSTCAETRRRIEDKV
FT                   FEHRERGVNVQHRTRTNRGGYKAGAMNDAMCDIEQFDHCAVFDADFDPAPDFLRRTVPY
FT                   LTHNPKVGFVQARWVYSNGTESLLTRVQEISLNYHIRCEQYARHAASLFFNFNGTAGVW
FT                   RRKCIVDSGGWNCRTTVEDMDLSLRAYLRGWRFVFLDDVTCLNEIPAQYGAYRKQQHRW
FT                   SCGPMQLWRQAIVDVWNAKDIPLAKKLYLNVFFFGTRMFATHLVSFFLYGCLIPICATA
FT                   PEVAIPFWALVYMPLLITLSTVWFTPGGWVYFVPYVLYENAMTIVKTTAMCAGLLQWSN
FT                   AHEWVVTAKLGKFVDKVAHSKVGQIVKTAVAKRVKKRNMYGKELVMGIFFLTCAAYGSV
FT                   VNDMWQYGVFLCMQGCVFIAFGLDYVDSA"
FT   CDS_pept        join(complement(912993..913236),complement(912643..912917),
FT                   complement(911875..912573))
FT                   /codon_start=1
FT                   /gene_family="HOG000237441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638809"
FT                   /orf_name="MICPUN_86007"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70102.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG746572"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199C7D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH8"
FT                   /transl_table=1
FT                   /translation="MPTPKASTAKDVAIHAEVTSVHVCALVAVQLAYGGYHVVSKVALQ
FT                   EGVNRYVFCAYRDIIAVAALFLFQFVSRCICGIKGEVVVGSTPWRALFVLSITGIFINQ
FT                   LLFLKGLSLTSPVVAGALQPCIPVFTFLLAVTLGTESVSPRRKDGALKLLGVLLCVIGA
FT                   MITSTWQGDVLGGHAVAQAVAATTPKGGHRRGQPHRAPHHVTGVVFLLTACASMAVFLT
FT                   VQQRVLTRFPKPNTVTRWTYAMGGALLLAVAAVMEPPWRPQHVEHWILNRDETMGVLYG
FT                   GVVASAMNYSVMAWANNAVGASVVAIFLPLQPVAGALLSYSFLGTDIYAGTLVGGLCVA
FT                   AGLVSVTMGRRVDAKQWEASKSTLPTTAAKPDKSLKTLARRGSSGSIIEMMGFGGSGDD
FT                   LSKRIS"
FT   CDS_pept        913460..914944
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638810"
FT                   /orf_name="MICPUN_62089"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69824.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199C7D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHH9"
FT                   /transl_table=1
FT                   /translation="MPFKVAGHRERNPRVQFGGQVKVSPEDVIEKVGWRSGGYQQFLLL
FT                   VTCITIASEAAEVALLSLILPHVKNEFNLTNWETDKVAMSIFAGQMFGCFVMGALADSF
FT                   GRKPCSIIASALVAVGGYASALADSTTALMICRFAVGLGVGAAFVPVDMLAEACPDHVR
FT                   TTRTQLANLSFSAGVVAVTVVGAVILEPWGWRLLAFVAAVPPTVALVMAFYLDESPTWL
FT                   ADVGRGSEAKRALDRICVENTGYPLPEGLHIVGEREAGGGATMDVAEKGVASAGGGAGE
FT                   ASAWYNLAGNLVNLFRTVCLWSLAFVQTFNFYGLMLNAPVVFRVKQYADDGVTELTNRV
FT                   VFDYAAILIVNSGDLVGNFSALLALRMKTNPRRVAAACAAISVPMLFVPLVPALNSHRW
FT                   GLVFLMLVGRIPAAPIGSMSWILNAVAYPTLFRATGHGWANAVARFGAVTASSMYSMPA
FT                   ALSIPIHALALVAAIPAALFMPAGALEHDQSPKGRR"
FT   CDS_pept        complement(915028..915900)
FT                   /codon_start=1
FT                   /gene_family="HOG000008117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638811"
FT                   /orf_name="MICPUN_113832"
FT                   /product="Putative uncharacterized protein "
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70103.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557274"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C7D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI0"
FT                   /transl_table=1
FT                   /translation="MTDDRRREVHKELEKELERRRGHFAAARQRRAFIAANYRPLHPNV
FT                   YTLRDEFVDPRWIELAELARTHRSKDALLEAAAGVVRQRPRGVFAFPALTPRFCELMRE
FT                   ELDHFERSDMPRAHPNTMNKNGLLLYELGMYDELLTPLLERYVSPVAAALFDGGEREMA
FT                   NGSDSLDHHRSFTVRYEPEGAGKDVDLAYHFDDAEMTLNVNLGGHFEGGELLFGGLKSD
FT                   GDEKHSARYPHFHREGIAILHRGSHCHEALPVDSGKRTNLIMWCRSSQVRIRYCAMCGR
FT                   DKITTSKIE"
FT   CDS_pept        916358..916918
FT                   /codon_start=1
FT                   /gene_family="HOG000265710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638812"
FT                   /orf_name="MICPUN_62091"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69825.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000199C7D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI1"
FT                   /transl_table=1
FT                   /translation="MEKHHKLRRPAGSSIHACNICGKEGHQAAQCTNGTVNWAAKFGPA
FT                   WTSDLDAVKKEPDYKDIAAQAKAFAAKRLAEEEKAKRKAEGLDVDEDSDKEADHDDEGK
FT                   AAKDGKKDSGDDDGDGDEDGANKKRARDDDDADEGDDEEKAAKAKKEAPAPASDWKVFY
FT                   DTSGRPYYHNAKTGVTQWTPPTA"
FT   CDS_pept        join(complement(917354..917887),complement(917025..917084))
FT                   /codon_start=1
FT                   /gene_family="HOG000100790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638813"
FT                   /orf_name="MICPUN_102807"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70104.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG557276"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="UniParc:UPI000199C7D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI2"
FT                   /transl_table=1
FT                   /translation="MIVERLPMVAPPPEPWEAEYQQWSDERRRKFLKKLPEGLVNPKAE
FT                   FEERDQGEDFEPAPRETEADKTGDQRTMHRRLDEFLFLVVQNAKTGQWGFPRREHVEGE
FT                   TMRDVARQAMEEAVGDSIETYLVGNAPLGHFYEAKTGADGKEGGQGTNFYHRAQWLDGT
FT                   LKLESRYKDYKWLTKEELGAHFNEEHHEFIKAIC"
FT   CDS_pept        918590..920386
FT                   /codon_start=1
FT                   /gene_family="HOG000260890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638814"
FT                   /gene_name="BBS1"
FT                   /orf_name="MICPUN_85433"
FT                   /product="Bardet-biedl syndrome 1 "
FT                   /protein_id="ACO69826.1"
FT                   /db_xref="HOGENOM:HBG525220"
FT                   /db_xref="UniParc:UPI000199C7D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI3"
FT                   /transl_table=1
FT                   /translation="MREQQAAQQAAQQAPPPRQVKDKNTPAWLEAWQDPMAGADAFSSC
FT                   ICTADLAGDGEFRLVVATAMKKMKVWNGTSLTSEHDLLEPPVAVCTFYPAEPKSPKRPS
FT                   LAIAAGTHVYIYRNLRPYYKFTLPALTVDEQEIEVWKMVRDGQIGPKEAFDELANIRDA
FT                   GVSLTSRSLDLLAMEDGAAGEVEQLRAAYCAAQAPEQLQHFTSITCMGSIKKNMDEWDA
FT                   TSCLFVGTESAELYVLNANGSAVKTTTRLPSVPVFVASTGLLDVDYRIVVACRDGRVYT
FT                   IKNDELSTVVIELETQPCGLVRTAKQIHVACMNQVIHCYHAKGKKAYSLYLPAEITCIE
FT                   SMEVTRTRAVRCLLVALANNELRVYNEKHMVSKFDMMEPVRGLSFGRMGREDNTLILCT
FT                   KGGCLQVKIMPRLANLEAVSQNGPPPEQDIPLAVPKKTKLYVEQTQREREQAVDMHQAF
FT                   QKDLLKLRLNTARAYVKVMKDGQSPVNDSFEGVTVRIQASVQGLGPLFKIRVHVVNTGT
FT                   KPVYDVPILLVPSDVDMYDLEEVIMQCPALLPGLPWIDAVKCRQKDPAAGAGEIRVIVA
FT                   TKTSPVPLITALIKMPLSEFLD"
FT   CDS_pept        join(complement(921118..921295),complement(920935..921002),
FT                   complement(920564..920698))
FT                   /codon_start=1
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638815"
FT                   /orf_name="MICPUN_62094"
FT                   /product="Ribosomal protein L44"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70105.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG496807"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000199C7D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI4"
FT                   /transl_table=1
FT                   /translation="MAASCSVLTSRPALTTVPFPHASQVNIPKAKKSFCKKCKKHAPHK
FT                   VTQYKTGKASLYAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKIVLRLQCNTCKAVCMH
FT                   PIKRCKHFEIGGDKKGKGGLYQ"
FT   CDS_pept        921774..922847
FT                   /codon_start=1
FT                   /gene_family="HOG000100791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638816"
FT                   /orf_name="MICPUN_109064"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /protein_id="ACO69827.1"
FT                   /db_xref="HOGENOM:HBG557277"
FT                   /db_xref="UniParc:UPI000199C7D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI5"
FT                   /transl_table=1
FT                   /translation="MSDGKAKVEGMGDTNEDSNNAATYLWRSTRVLGIILVYCAIGSQL
FT                   SVVNKVVVTFIPLPNFILFCQFTATTLMLLLAHYTGMVEVEPLTWRIAGIYTPLVITFF
FT                   ALLYAGMEVMKYAPLETFITVKSMTPVLFSACEYLFLGRALPNWKSSLALVGIVVGAAA
FT                   YVKVDAYASVKAYMFCGLFLVAAVSEGLVAKTTIEKVPLNNWSRSYNINILSMPLAMAQ
FT                   MLLAEEMLQMGEAKNEWSTKTITLLVASCVMGLGMSVATMWIREALSATSVSVVATCNK
FT                   FISELVNWFIWNKHTTSDGLWAVLIIMVCGIFYEQAPLRVPGQGYVREEICPCLPRSWL
FT                   GFTPKVRKTDGGAYGAI"
FT   CDS_pept        join(complement(923635..923790),complement(923039..923362))
FT                   /codon_start=1
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638817"
FT                   /orf_name="MICPUN_62096"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70106.1"
FT                   /db_xref="HOGENOM:HBG748242"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI000199C7DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI6"
FT                   /transl_table=1
FT                   /translation="MALSPLVRGSSDLFFRDAFREADDVRTPSQASHTPMLPRYTNNNA
FT                   PSPRSFLENKDGYTLKADMPGTKKENISLEVDGNIIRIGVSEDEGVTEESESPDKKWHR
FT                   SERREFHSFQSRALRMPENTDFSKIESKYENGTLQIDVKKQPTPKHPEPKKISIK"
FT   CDS_pept        924114..926213
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638818"
FT                   /orf_name="MICPUN_102810"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69828.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199C7DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI7"
FT                   /transl_table=1
FT                   /translation="MSSLVDLPEHVALRVLSRLDSRDLRSLGASCRAFRERMHHDGLSL
FT                   VEAGAAEAVAARYPWLGSPRENETWLSLLRFAEHAELAGLPSMTAAQDTTVIVDARGAV
FT                   HVWGPVVDGESSAPTERDGEAPTELTKLGELWPVCTGRALTAAAGRCFNVAAGVGSSPL
FT                   TVLRNKDGIDMEIGWYNRSADADSPASASGRPPLSRTSSSERFDTPGLVRLMTPPRRGA
FT                   FGGQRVVSVAVGTLHAIAATESGRVYTWGGDAKGQLGHGSIRDSVALSRLSLGGSPGGS
FT                   GGTPGRARRDRRRSESPRGGGSPRSNSPAIGAAAAADEREQWSRPREVSELFGHKVVGV
FT                   AASGDTSAAFTASGSMYTWGCGRFGKLGLGDNMNRDVPTRVALVPIHQSPSTLGSVSVP
FT                   STPHSRSVSPFVFPGAMSDTEDEDDGDGSDGSSDASGQCNANVTPMSDPNYGKVVGVWF
FT                   GAAHGLAITARGDLWSWGDDSHDQLGRFREGDERTWRQRACHPGRVQVDWHLLDASVVV
FT                   DGYFDGPLNDPPDIRFVSAAGGERHSVACDSEGRVWIAGVGDGAGDPRMLYQNDDDDPT
FT                   LHREGMSLMRTRMMWESIDPRLRPSDDEKYPRVVSVAAGNNHTVLMTDCGDIWSWGDPT
FT                   YGQLGPVPVAKIGPDDDPIQVDLLDEIGVTIPLAPLARACFDRPFDPNCRESASCWNFK
FT                   RDLRS"
FT   CDS_pept        complement(926276..927337)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638819"
FT                   /orf_name="MICPUN_62098"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70107.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C7DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI8"
FT                   /transl_table=1
FT                   /translation="MASTRAAIKNQGTRMWSAANLAELVVWFVWLLHSEFIARFQRRRP
FT                   VERRVPAWLGECDDDGRRPAAIVTGAGSGIGRAVAVQLARMGAGALVIACRTLAEASAV
FT                   TDEIRAAAPEDVVLKPVGVDLRDPAQIVAMCEDIRVDKSLHVRLVVHCAGVFCASWRRT
FT                   EWGEEETAAVNAVAGPRILRGLGVKGIRFVAVGSFTHRATSSARIRRWMAAVHTTNIRP
FT                   PLTPAAAYSCSKTAVVAYAWGARRRWGGDGFTACVADPGLVDTAINREWPAALRGLYLA
FT                   VARVTGLLTASSTGAAAVLRACFDEEATYVYGARGVQIQPSDTDLTAREEVFNHLEDLA
FT                   GPQPPPRWWTGEH"
FT   CDS_pept        complement(927478..928755)
FT                   /codon_start=1
FT                   /gene_family="HOG000265709" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638820"
FT                   /orf_name="MICPUN_62099"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70108.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557280"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199C7DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHI9"
FT                   /transl_table=1
FT                   /translation="MNALVRTSVSLAGLALPVASSIGSQRHAMVAVPLSPASRRGCTSV
FT                   RRTGTAAVLRRDNALSFGPLSRLHRRVASVIARAAGDAEESISESSAVTVDTAGAPGVW
FT                   YGRALLIFVAAAYGSLSVAFKYVYSLPGPPSAGTIGAVRGVIAALCFIPMIMNAKKGEL
FT                   EAGSMNINTEEGKKKFWLAAGELALWNLLAQGCCNVALLFTDATRVSFLTQASIAFTPV
FT                   LCVMIGDRVAGITWVGCLLALAGVVALGFDGGGSAAAAAQSIGLNLGDIIALIGAAAYS
FT                   LYIFRIGAFAKMKLPGNLTQAWKTVILAVLYCVWAAADAIKYATAAPGTVAAPWAGWTN
FT                   PLAWAVLAFTAIVPGYLADVCQAKGQESVSASESQVLLAGEPLFAAVFGLVLLGETLGF
FT                   MGLVGGAGLVVGAILCGVDDGSGKSD"
FT   CDS_pept        complement(929123..930271)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638821"
FT                   /orf_name="MICPUN_102812"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70109.1"
FT                   /db_xref="UniParc:UPI000199C7DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ0"
FT                   /transl_table=1
FT                   /translation="MGFSPDTKQPNRMLREWEETHARKAHESRVRSAVSTLSATFSGAS
FT                   ASRRSPVKPWQKASASPEPVDPSTPLETARAAYRARPTSSVGSARPAGSTPSPSGRAGT
FT                   RPASALERGAASSAGRTPPSTGGTSTSSGDRGGRSTGRSIAAYLKRRQAMRQRQREETE
FT                   AHGGEDERATGDGDHGVAANATPPVSRGRYDEEEEEEEEGVRRHIISDVRRGGDLAGEL
FT                   ARLSLDAGGAPRDDDAMLTGVSSFLAPSPIGVQSPAVDDAFEAYAASLSDRDPESPANR
FT                   SPAEADTPSPLRAFGAASTSRGAGTSRTAASSYARDEYGDVEDDGEEVFGLREEDLSPF
FT                   KMIAPSVLQAAAANHARSLSLSRGGFGELGSITGPIESRRYG"
FT   CDS_pept        930597..931031
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638822"
FT                   /orf_name="MICPUN_62101"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69829.1"
FT                   /db_xref="UniParc:UPI000199C7DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ1"
FT                   /transl_table=1
FT                   /translation="MAAMMCSSAMLARTTAPRSSVRSRAVKCAAAKPARQAPVRKSHNE
FT                   SMKKVAPVLGGVAALGLAQVLAPAPAAALSITDPVFGDIEVWQFIVLTAGYWLGIEYYL
FT                   DKKYDDDKKDSASIMPKVSEAKKSTFAEAAAKQEDGGSSE"
FT   CDS_pept        complement(931169..934048)
FT                   /codon_start=1
FT                   /gene_family="HOG000100792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638823"
FT                   /orf_name="MICPUN_62102"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70110.1"
FT                   /db_xref="HOGENOM:HBG557283"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="UniParc:UPI000199C867"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ2"
FT                   /transl_table=1
FT                   /translation="MAPPEWNFGHVAGICDVSFVGSGDEALLVTCGADNAVTVRNPETL
FT                   EIEESFTEEHDDAVNVLAVSPDGAKFATGSDDNSVKLFNFAGASREFESNVVRFTLPVR
FT                   ALAWSADGTFLAAGGEDNAVKVVKMDDKSVALDLATRSKCVKSLAFDPKGDFLGAVDDA
FT                   GVLTVWALKAIAAGDDDDADMSDGDDDGKKGSTEPGEIVLAATVAPMTEPDSCEVNRAC
FT                   WRPDGAVIAVPGREHDVTFFARGTWTELENHRLIAEDGSEGKGHGENVVLAQWSPNGKY
FT                   LLTSAKDHTVCVWDVKERKVINFIKHESTVCGACWRQTGNAVALVDGDGQWTLWKNPVP
FT                   PSGYTGPTAQVDAAELDFFEAEEPLAPLAGGMGDEDMDGEDNVASEDEEDMGDMDEEQY
FT                   YSELERRKRMKRKLAKSAQGTAVAAAPTPQPPFQVGSVPAKTAKDDAGNDANGSTRRFL
FT                   CYNMIGSVVSTGEPGGDFNSVEMAFHDTSRGGRIPTITDYHGYSVGCLGERGCALASPA
FT                   KQSGGSSVLFYRPYESWTHKSDWSVTLPVGEDVVSVATGKDWVAALTSGRMLRVFSHAG
FT                   AQRQMVQLDGAPVTAAGKGDSLVVAWHASAPALVPDAADPKVLRVEPRIEFAEYDVASG
FT                   GKVLSKGRIPLPPGATLTWLGHVEDGNGAIAFGASDGCVRVRTSEFGGSWTPVFRSQDA
FT                   RQQEGEHHWTVAVSVAESALYCVVGGNANGPAVHPRPVLTPLPLGMPVALPDSSSGELE
FT                   DAAARAQLCVALASAAAAGDTAGFRDDVDPAGAAMDALRAAQTEADKALLRLFHAACKG
FT                   ERPARAADVASALNLTTSMHGALKLANAMSQNVLAERVTNLIEASMAAAAAAAEVEAAR
FT                   VYGGAVELDTPGQAPQQHYSQPAAYVAPSQATQPEKDSNPLGRRRSVAPATDENADAPK
FT                   VSAKVKAGYEANAAPAKKGRVANPFARAR"
FT   CDS_pept        join(934470..934592,934796..936793)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638824"
FT                   /orf_name="MICPUN_113839"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69830.1"
FT                   /db_xref="UniParc:UPI000199C868"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ3"
FT                   /transl_table=1
FT                   /translation="MSTHSVTPALSAVTLCGPKSRAINPVAPVTRAGADSLRLKKVFTG
FT                   TALRRATLRSTRRQIPAAVRAHGHGHSHGDGGHEHGQDYDDKDDVNIHSHTWPPKAGET
FT                   WKNFKPVEKREPGDRLAEVLDVIRNAKYESISRNQGRDDLAMRLAAAEQENEKLTEEVK
FT                   KQQAINDKAAHELLKDAEELAFMSMRLENLEREAEALKDLNVKLVEAADQLAVMVGNND
FT                   VASTTATHLDHDLTALRMEADSAKDALATAEARAAAERSDLIARIRTLEIDLAEAEGEA
FT                   EEAAEVGAMVIGGAATAGAELEKARLTVEKLSALAKRRGDELLAAEAAASAAAREVASL
FT                   KEQLANSSAGTGHLARVRELEVLMSEMLTAEEANILEARIRELEIIMADMIEPEELDAA
FT                   LARIRSLEIVMADMVDAEELEAAEARATEMEARAAALEVEADRLRARVRALEAEMAGMS
FT                   YDDGEDLAVAPVEPRKGGTFKRRSGQFIMRKFDFAAVKAKTAPVKAFKRSGTFSLRRMK
FT                   FSPKAAATSAAPAKKVERSVEEPVVFNFEQKKPGFKRTPGTFTKRKLSFGEPKVVASEP
FT                   STFRRSGTFTLRKFDFAAVRAKTAPAKAFKRSGVFSLRKMKFTVRPAQPTSGAGFTRKS
FT                   GQFTMRKFDFVAAKVKAQEGKSFKRGGNFTLRKMNFRENAQQEIALETRSGTFVRSGGN
FT                   FTMRRFDFLKAR"
FT   CDS_pept        complement(936851..937579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638825"
FT                   /orf_name="MICPUN_62104"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70111.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000199C869"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ4"
FT                   /transl_table=1
FT                   /translation="MTSRQICMTCGTRGHGASQCPERTRLHREHVLGTSEMPDVTAGAL
FT                   RRGPGGLQVLSYAKDHTSALFQQAKEREERLREERASRRDQEAPPNANSQPAKSGMSMV
FT                   RLVKRKGVGVAEPGKKAKLQVVLEDQFKDDEDDEEEGLGGLLGDYDSDDDAEEEEPAKQ
FT                   QQKEDKEEKKDDKPKVKLPAPSELGVLDLPDWTDEVHLGKVEEQKVSAKPVSKARAVCN
FT                   DFLRGRCDRGKRCKFSHDVS"
FT   CDS_pept        937642..938283
FT                   /codon_start=1
FT                   /gene_family="HOG000265716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638826"
FT                   /orf_name="MICPUN_62105"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO69831.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG557287"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000199C86A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ5"
FT                   /transl_table=1
FT                   /translation="MDVAFRRVKPGEEIPPRPKELDAWAADTATGTMAGMVYGVMRARA
FT                   AEARAFDPELADIVRRRNLWMRSVHEATMGGVRFGSFVAVFSAVQLGSQSYRGDIKDMW
FT                   NTVAAGAITAGATGLALPGGIAMRLQGLALGLVVGGGLCLPLGYLLQEMEKHALPISIR
FT                   ASKENVVDKGGKQGGRDHIADVIASVESELQSTPDIKSNSKRWFPWFRGG"
FT   CDS_pept        join(complement(939604..939654),complement(938355..939500))
FT                   /codon_start=1
FT                   /gene_family="HOG000246602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638827"
FT                   /orf_name="MICPUN_62106"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70112.1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C86B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ6"
FT                   /transl_table=1
FT                   /translation="MMFSSRMSTSRGYGLSKDRRFDLESGALLDDNSKSRRKGQSFLTR
FT                   QLVRLLWAILGVARKRWFTSTLLVWITFRELVPRAPSSPTPRAPWKMPGSAHVPVPGGL
FT                   RGLETYPYPSATDLVVVCGHAVYAAGDYSPEVSRLESSWFLEDYQQVKGRAETFVEHAK
FT                   VGVMEAANNPKALLVFSGGKTRKSAGSLGEGTSYWEVARANRWFGKADSVAPRAFTEDF
FT                   ARDSLENVMFSITRFHELTGKVPRKLTVVGYEFKRDRFVDLHRAALRFPRDRFVYIGTG
FT                   AAGTEERSAASEIEVRAQFKADPYGCSGELGRKRRERDPFNVGQPYSRTNPELAPLLAH
FT                   CGPELFDGNLPWPKEKELVGDVPSGGERASKTGEGNGDAAKGEESANAETSNHAHDDV"
FT   CDS_pept        join(939827..939967,940087..940293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638828"
FT                   /orf_name="MICPUN_102816"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69832.1"
FT                   /db_xref="UniParc:UPI000199C86C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ7"
FT                   /transl_table=1
FT                   /translation="MDVWEDPAIWDELVDFGKEHPTVGPSRRLLGGSFDLTAEENQVYL
FT                   FMVIFGAILFATPPFLKCLQIIKKMRGLKAVTDTDLEMWDFAEEYEDMKHIHDPLDGEQ
FT                   RDNKKKKKRRG"
FT   CDS_pept        join(940751..940810,941025..941945)
FT                   /codon_start=1
FT                   /gene_family="HOG000188299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638829"
FT                   /orf_name="MICPUN_95334"
FT                   /product="Fatty acid desaturase"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO69833.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324309"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR013866"
FT                   /db_xref="UniParc:UPI000199C86D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ8"
FT                   /transl_table=1
FT                   /translation="MSSGELETKKSGDFYWSKDDEPHAKRRREILEKYPQIKDLYGPDW
FT                   TTCPQIFAVVSLQLAVAWWMGNNASWPVLLLTAYVFGGFATANLFLANHELSHNLAFKS
FT                   AAANRALGLVANLPIGIPFSVAFKKYHLEHHMFQGHDAIDTDIPTVGEARLFSLGGSLL
FT                   KIVWVIGQLFFYAIRPLFVRPKPMGKWDFLNLVTQAAFDMAFIHFAGPRAFVYLLASVF
FT                   LGGGLHPIAGHFISEHYVFHPGQETYSYYGPLNVFVYNVGYHNEHHDFPKVAGSRLPKV
FT                   REIAPEYYNNLKYHTSWTKVIVDYIADPNMGPFARTMRKKVSKSD"
FT   CDS_pept        complement(942019..942786)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638830"
FT                   /orf_name="MICPUN_113859"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70113.1"
FT                   /db_xref="UniParc:UPI000199C86E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHJ9"
FT                   /transl_table=1
FT                   /translation="MERTRDEVRIPSPATAELVAHTLREVIKFLLYVRQQLPCSYDDLR
FT                   SGLEESMGPEALGVGEGQRRADILPGLKRKRATSSERRSLKLFKALEAMLSRITPQMLQ
FT                   ETRATELALLLGSTPLRPKEMYNFVLSDASSSYAPYEPAPGTERMMDNAARRVIRECLP
FT                   AVAGCPSAAAPMKVFVLVKVPTPETGGGEAEGFLPKRGFAPLLRQTKIAADFVMKVKRA
FT                   EGDVVQGGGVVQGLPGMWYQCTSSVKGVKGPGS"
FT   CDS_pept        join(942897..943136,943283..943351,943545..944378)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638831"
FT                   /orf_name="MICPUN_102818"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69834.1"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR019053"
FT                   /db_xref="UniParc:UPI000199C86F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK0"
FT                   /transl_table=1
FT                   /translation="MAQAQQYIGSKISLISKSEIRYEGILHDINNVDSSLTVQNVKSYG
FT                   TEGRKKVGPQIPPSAEIYDYIVFKGTDIQDIQIEQSGAPQQRPPQQQAPAPAPAPQHQA
FT                   PPPQNYQQLQYQQPPRQQYQQPAPAPAPAAPPSNPWNRAPVAQPAPVMRQQQQQQQQQR
FT                   RQAPAPAPAPAPAAPKPKPTSFAAAIGGGGGGVQPKGQVARVPSSTVGGRAPPAPRAGT
FT                   AGGRGGARVPAPRAGPAPVMGDGFLPTRMAVPQEDFDFNAAFSKFNKEELFNKAEMKKA
FT                   LPDVSAGPTYVKDDFFDTMSCEALEKQQEMQQQGGRARFAQMRRHDMETFGAAGGARRT
FT                   QDQGGRGGRGAPGGRGAAGQGGRGGRGAGQGGRGGRGGRR"
FT   CDS_pept        944846..945649
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638832"
FT                   /orf_name="MICPUN_102819"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO69835.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C870"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK1"
FT                   /transl_table=1
FT                   /translation="MDTVKTLSDLSLAKDWLPGEIAHTVSRMEHKLIVIETTHDAGDAL
FT                   AKFAELECPKDAILVMGSRGRQGWRKTLLGSVSNNVTQHSKLPVLVVRSRKYRDIPDLT
FT                   SDTIGQAYLGMTAIGKQRKIAIALDGSETGVELCAWATKYALTTSDQVHLLHSAAQETP
FT                   EQTLIATANVQTCISTISEFQKSDETGTVDSVLLDLTGDVRDLIVDYVEAMGGALDLLV
FT                   LGTRGIKGTLKRALLGSVSSYCLAFAPCPVIVVPGAVAHAAALAA"
FT   CDS_pept        complement(945734..946822)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638833"
FT                   /orf_name="MICPUN_62112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70114.1"
FT                   /db_xref="UniParc:UPI000199C871"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK2"
FT                   /transl_table=1
FT                   /translation="MFCRTGQITSQRRFISTRRATQGKAPRRMQSERHGDPSAVGIGVP
FT                   VHLREHLHAPDREIFEVKAKLQALTKRLHQAEQDRDEALKVAVAADARRKAADEHASQK
FT                   LEKVRTRAEAAERAAESSELLADATSAALQEMEIRAQTAEAELHRQTERVARLEEALEK
FT                   QRAKGVTLEDDVDILRRRVRNLERGISSFSKASQTATEDFVDSGPREEDHSFGVNAAEL
FT                   LRELEDVGTDAHIDATGAVRRATARDPREPEGLGAEIMPPRLEAPVTVPEDDWGPDASD
FT                   DEEAGQRRVEEWDQPEASEGSALVAVASGEDVVNLEQEREERDTQEFKGLEGHVIESAG
FT                   VGEMEDDGWAGDDPSWVADKEL"
FT   CDS_pept        join(946960..947095,947181..947249,947349..947440,
FT                   947575..947964)
FT                   /codon_start=1
FT                   /gene_family="HOG000228289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638834"
FT                   /orf_name="MICPUN_109068"
FT                   /product="NADH dehydrogenase"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on NADH or NADPH"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69836.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016651"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG724359"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI000199C872"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK3"
FT                   /transl_table=1
FT                   /translation="MLRQATKKLSAGLNLRAAANWGSLQAFNRGKASESNHGSNLPKKM
FT                   GTTQVGDAVKAGSSTPMPTDLNGVLDASAQTLFLTEMFRGMSLAMKYFWEPKVTINYPF
FT                   EKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAEEREDGSRRTTRYDI
FT                   DMTKCIYCGFCQEACPVDAIVEGPNFEYATYTHEELLYDKEKLLANGDKWELEIQKNLA
FT                   SESLYR"
FT   CDS_pept        948761..949576
FT                   /codon_start=1
FT                   /gene_family="HOG000241876" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638835"
FT                   /orf_name="MICPUN_85896"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO69837.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557294"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199C873"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK4"
FT                   /transl_table=1
FT                   /translation="METSPSRWHPCWADKWLKVPDGGFCQVPWNGVVVAQVMILWFASF
FT                   LLVGHVGLPSAVRWLGFNCQELSARGLALYSLSADVVEMFVGLFVLFQCLRPYFPLPER
FT                   WFPASLRGGWIKEILLGCALFPIVSTLNNLNSNMMPIPSNTLPVSPWEQSLMSNDLVSI
FT                   LFYVAVVSLVAPIWEEMIFRGFLLPSITRYFRVDVAVLLSSLIFALAHFSMERLIPLTF
FT                   LGMLMCVVYIRSRNILAPIILHSLWNAFAFVELIWKPGALFTWLLDFVL"
FT   CDS_pept        complement(949629..951089)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638836"
FT                   /orf_name="MICPUN_62114"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70115.1"
FT                   /db_xref="UniParc:UPI000199C874"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK5"
FT                   /transl_table=1
FT                   /translation="MRCPRCTIPSVYLLAIVLMTRGAQSDSQADAFYPFAKCSSWENPY
FT                   SSYSGYVKSFNAELLMDAKIDSEFGDHYNYVAEGTGRTVRWTEGRSKLSFSFRFGLSAA
FT                   QNIDTDQSWKAHIHASRCDVSSGGAHYLQNQNGLDGGENIFEVVFDAKRSGDEIMGTGN
FT                   VTREFLADYNRAASVVVHIADGTRILCCNLAPALPKLPDTWSATIEANINNFDAGSNLS
FT                   YTMLRKEWYHAETNNLRIDEHSAYSRQTRMMNTVEERLITMHRNDTFPDGLCSDHPLQS
FT                   RMSRFLTRGGTDHTIKSTAEMFSFEGDAPDEYHGITASHEYVRGVPCEKWTRNVTMGTK
FT                   KYTYEFYFPLSSWMIRRESYHRMLWRVVVKSDEGFRGQPVLHFYDFIDMVPFIEDMEVF
FT                   NPCNVYNTGKPLAGNCSCGRIGAPAPPPASWGGGGSGEEGMNAGEVAGLSIFFLIFGSS
FT                   VSFIGTYVYFTQFANRVPLFPEMEMSHA"
FT   CDS_pept        join(complement(951971..952424),complement(951643..951893),
FT                   complement(951315..951569))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638837"
FT                   /orf_name="MICPUN_62115"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70116.1"
FT                   /db_xref="UniParc:UPI000199C875"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK6"
FT                   /transl_table=1
FT                   /translation="MSGYDRTPGPTSPRPSSRRRESRRGYDSRASDVAPTPRRDNASVR
FT                   SQRGSMRSQGRSEADRMPQTPTTVDRAYGRTDARSGRSGGSAKSGKSAAFRRDSSLAGF
FT                   IKRLRDVEILSDVALGKIRASGHKMPGDLEAFQKRKDEVLRCVDEMKGLPGAEQILSGK
FT                   VSDEMFRELRYTSRYIDEFNKVPLMPMNTLLGSSLSSWLVSDETLDNNPAVMNLRQLRE
FT                   TCESLQTIEEILTSQLSVLNWDVGEAMTPPPPEIIVNPKDVEVGLRREQSSSPPEDSTC
FT                   CFCCSSAPIEAPAPAPRKNNSSTRGRDSPASGRSSGRR"
FT   CDS_pept        complement(954512..955450)
FT                   /codon_start=1
FT                   /gene_family="HOG000148138" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638838"
FT                   /orf_name="MICPUN_85939"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70117.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557298"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C876"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK7"
FT                   /transl_table=1
FT                   /translation="MSSPSTSWRSVNDRRPVRHRLSLVPKASSSDNTASAFGVSQRILI
FT                   TGSTRGLGFELARSFLARGDKVFVTSRDAAKVSDAVATLRETFGNDSVAGLEADVSKAA
FT                   SVEAMANACVDAFGGVDVWINNAGSNGYKYDNLEEADPSVLEEVVLTNSLGSLLCTRQA
FT                   IKTMRKTSGRGHIFNMEGAGSDGSATRKFAAYGHTKAGMAQLSKTMAEELKDIPIGVHT
FT                   ISPGMVFTELISSGRYAFGSQGRLFVNALAEPADSTAELIVEKLKEATESPDSVNRTIA
FT                   IKILTPDVALRKMFGRFVLGENKDRYYPEAD"
FT   CDS_pept        join(955733..955799,955915..957026)
FT                   /codon_start=1
FT                   /gene_family="HOG000265706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638839"
FT                   /orf_name="MICPUN_62117"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO69838.1"
FT                   /db_xref="HOGENOM:HBG608167"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C8F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK8"
FT                   /transl_table=1
FT                   /translation="MGIPPALERGANRVDAPTRAHYGRVFDVAFCPWDESLIASAGEDE
FT                   AARLWLDAGSGSGVSSYGVCRGHKDEVVRVSWHPTSKILATASADGSVGVWRVAQPGME
FT                   ASATTHDPDSGTTALVDKLEGHPDQVYGCIFVGDGDGGGPMLATAAGTDLHLWDLERVT
FT                   VLSKVGHEPIPVEAGSERWEPGFLFSLASDGGARNLLASACSDGAVRVFAHDSKASTAE
FT                   TVATLPVHSGALGCATTFLSGGDVLASMSTDGTVVFTDVRTMTPMTKVTSPCPTMGCCA
FT                   VPSGGDGSIGSWFAMCGRDGIIRAIDVEGSSAPKVLNQATDHPVPLLCVAADHSGRRIA
FT                   AAGKAPETPQGTNGLGTLGSGGTSGFGGVGILGARKAPNAAGIILWDAAGSS"
FT   CDS_pept        complement(957076..958542)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638840"
FT                   /orf_name="MICPUN_53832"
FT                   /product="Flagellar associated protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO70118.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="UniParc:UPI000199C8F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHK9"
FT                   /transl_table=1
FT                   /translation="MTSPGRLGSPTSPGRLGSPTSPVGKTLGGSFVSEDGEPVMYSPGP
FT                   GASGGVLKSTAFEEEQNRMLAARRKAQKQVEVMEQNALKKLERQAAAEEKVRRAKELER
FT                   QRAHEKALEDQKKANETFIKLQQLKLNQEKLEKEKQRRAAEKHERELELKRLREAEERR
FT                   ARQEKKEKEELRRQRNAEFQARVDAMRAEKNRKIAHKARLMEEKEAARLAARRKEEQEI
FT                   AAKNQAIHLFQAQKREQAIVRSEQTTEQFRTKTMKKTTAADMRWKDLTSKKAAKIQDMR
FT                   SKLSERSQYVLSRNQAAKDIEQKRINALIERAEKEEERIKLIADRRKREAAMETLERSL
FT                   SVEEKREKVECMKRYKEYQQAQLLEKIERDTARTVALQSAKEELRRQRREENMRVSLEI
FT                   KKMQKEIDLRALRSSARSKFEIQQMQKDIDEFGHGGIRSRPGTAGPSSVSSLYRTPVHP
FT                   REVGARRPGSARPDSKRSAGNVGRPGSARR"
FT   CDS_pept        959311..960984
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638841"
FT                   /orf_name="MICPUN_102824"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69839.1"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="UniParc:UPI000199C8F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL0"
FT                   /transl_table=1
FT                   /translation="MGPQGKRWPKWKQRRDNSGDDVTEENRQKKLHHGIKCIRKALKKA
FT                   RTFEEQKIKRRTAQATAAAKSGGKKPTIVASAALLDADKLAQQLVAVKALDLEALGSYM
FT                   GRATYDAVLASRDAPTAEKALPTADETETATAETAVGPGAIEAAGVQQALVVARRILAA
FT                   ACVRTEVNALQEKLVLVGDRQEWAKGRLEREELRRLAKEEATAAKEKAKEEAEKAKQEE
FT                   KDRTKHRGPGAVDDGKVGSEGGDDSERESGDEEDDWSSGGEDDGRPDLSDSDDEDSDSD
FT                   DIVIKDDDGELERFLAEEAANEGGDVGSSDDEEEEESESDPDEELPPELAKILGVEQKR
FT                   KKGGNVKDEKKGAKKKAEPPAKKKPKKRMGQRARRAIAEAKFGQNANHIKAEREEQMRR
FT                   ERQAREQEEMAKMHPAWAAKRAAAAALAAAPKGTKVSFGDDGDAVGVQKLKRTSEGAQV
FT                   RNERDGKKSTTPKPKAPKPPKVHIEIKGGTGEVVGKVTKPMGPSGAKKDDDKSAKKKPS
FT                   GGYDGYNPDAAESHPAWAAKRKAAEQATAKPAGKKIKFDD"
FT   CDS_pept        join(complement(962934..963164),complement(961027..962784))
FT                   /codon_start=1
FT                   /gene_family="HOG000046860" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638842"
FT                   /orf_name="MICPUN_96641"
FT                   /product="2-isopropylmalate synthase "
FT                   /function="2-isopropylmalate synthase activity "
FT                   /biological_process="leucine biosynthetic process "
FT                   /protein_id="ACO70119.1"
FT                   /db_xref="GO:0003852"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="HOGENOM:HBG701974"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C8F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL1"
FT                   /transl_table=1
FT                   /translation="MSLSLLSGAPLASRSVANLNRRRAGGRARKSKEIPSLFRVPGSVR
FT                   AVVPRAADSPGSAGDDADVVCYDTTLRDGSQQVGISLTCDDKLAVAEHLVGLGVAYIEG
FT                   GYPGSNPKDVEFFSRWTSSGLADRAAAGGTKLAAFGMTRRRGVTADDDEGLKALTDCPA
FT                   PCVCIVAKAWDEQCEKVLGVSPEENIAMIEESVAHLVAAGKEVLVDCEHYFDGRKANPE
FT                   FAVKCAAAAAKSGAKFVVLCDTNGGTLPWDVEEFTREVKEAVDATGADCSVGIHCHNDT
FT                   SLAVANSIAAVRGGATMVQGCVNGYGERTGNADLLVVAANLELKMGRTALPEGSLQRLT
FT                   QVSAAVAKLCSQHQDPRQPYMGSSAFAHKGGLHVAALQKMPASYNHIVPTLVGNEARSV
FT                   ISELSGRGNILSAAMASGREVSKETAAQVLSQIKDLESRGFVLEDAGASVDILFRRADP
FT                   NYRAPFNVLEFNVTASNSSFGGFTPNDLLVGGDERLQDVLPEDELEAPFTHPQQAGYKK
FT                   GSVAVNQVVVKVDVFDNDTTPASRNTQLCVAEGNGPVNALANALRLSLTDKFPQLKQIH
FT                   LQDYKVDLLSTAGTSAAVTRVTMDFADRDTDITWRTVGAHASIIEASFRALVDGMEYGI
FT                   AQCSDDGCMVDPGPAHAADREGAPSSR"
FT   CDS_pept        join(963468..963589,963681..965724)
FT                   /codon_start=1
FT                   /gene_family="HOG000265258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638843"
FT                   /orf_name="MICPUN_62121"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69840.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG557301"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C8F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL2"
FT                   /transl_table=1
FT                   /translation="MSLPKLEFAKTGRSTCRECGEGIAQGVMRVGIEAFVAGRVCDCWS
FT                   HVKCSLGAMFLEKCTAARGKCKATDEPFKKGDVRLAVCSKAHKAYYSMAGMGDAVRPIV
FT                   EASEGEYTASDITGFLALSKDERAAVCAAVDVKATASAKKRSRRGSDVTVAEVTVAAVK
FT                   DEKKAAADTPASANRRPGRRSSAVSAPPAPATPAEDEEGEEAGDSDGLTEFERQREELI
FT                   ARNKARMAALNIGTLASEVATASAKPANGPSQRGIGSKRKKEPKEDAGPPRRSLRGQKI
FT                   APDATLAGGVDYERRDGTVILANGMYSGSGTRSDSPPPPSRPTGDVKLNSVNGEESADE
FT                   AFISFLRDTLSGVTAASSDFGDGVTIKHDRGSFTSAKSLVGAKIKLTDEAVAKVVPRGV
FT                   THLDLAPYDPDGPLVAAAGDKDGNVGLWRVDYEAPGGADDEGDGSDDGVLFYKPHGSYI
FT                   CHLKWGRGGLAGRLLTCAYDGAVRTLDAEKGVFTELFVSEDEDEFSACDVTADGRTIHL
FT                   SDNVGNYHVVDARSGKLTSPAVQLHEKKINTVHLEPGAERVVATSCGDQTVCVWDVRKC
FT                   GKGAKPLSRLQHSKSCQAAYFAPNGSGELLTTCYDDLIRVWRPKSGADAGSVNDDPKSC
FT                   LKIKHNNQTGRWVLPFRAVWTPAGDGVVIGSMRREIEVFESSSGKLAGKYSDAERMTAI
FT                   ASRYAVHPSKDIIAAGTASGRLHIYRK"
FT   CDS_pept        complement(965776..966462)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638844"
FT                   /orf_name="MICPUN_62122"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70120.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniParc:UPI000199C8F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL3"
FT                   /transl_table=1
FT                   /translation="MSTPSAKELAQKFEQMARENSTDATPPPKSTTKSPSTKILAAKFE
FT                   NISSGTSATPPKPPKKEEKQEAPPKSPAMTSPLTSPLASPPASPLRPKMAFPLGPNMAE
FT                   EAARARATEALEVGIERHEPEEPEPEPEPVAAKPAKFNPKAFGANQPKCPKCSKTVYFA
FT                   ERVVGLNGTEWHKGCLRCEGCEKTLGSVAEITDHKGEPYCKVCYAKNFGPKGHGRAGGG
FT                   TIFHTA"
FT   CDS_pept        complement(967265..968566)
FT                   /codon_start=1
FT                   /gene_family="HOG000265719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638845"
FT                   /orf_name="MICPUN_109072"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70121.1"
FT                   /db_xref="HOGENOM:HBG557303"
FT                   /db_xref="InterPro:IPR018790"
FT                   /db_xref="UniParc:UPI000199C8F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL4"
FT                   /transl_table=1
FT                   /translation="MSLAAASHAAALCRPTVSGTSRSRPAAFASCEQHRGRLDAPGVAS
FT                   VAPASTVRLARGRRGRPSTTVTRAHVGDPEWFANQALAAGVILAGFVATGGLEELGLGS
FT                   PSDGSEDGPGEPCSYCEGTGRTECQCTRWSDDGEGCASCGYTGVSICPACRGGGRAVRV
FT                   TLEIPVETEEQTKEQLRQRDEQRRFVNGSSRGFKLPGVAVHASTTLEPDSLPRSWGAAA
FT                   ADAAVGAEKSGGAGSNGSNGDDDPASSKDDDFYAQSGEAIRTLREDYPDLLDRQLTWGI
FT                   YRDDVGLVDNTGEWHDRGHVVASGIGEYKRTHKWLRTAASILFSHVEVNVVRIWSPLGS
FT                   SGVRTIKVRWSITAKLRLVGNLTEDCHFDGISEYKLDRAGFIYQHSFTDLDWDVAQMKD
FT                   RIAALSFGQMRQREPQLGSGQWFKGIVPEGWWNH"
FT   CDS_pept        968929..969453
FT                   /codon_start=1
FT                   /gene_family="HOG000242384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638846"
FT                   /gene_name="PETJ"
FT                   /orf_name="MICPUN_104960"
FT                   /product="Cytochrome c553, chloroplast "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /protein_id="ACO69841.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG752107"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniParc:UPI000199C8F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL5"
FT                   /transl_table=1
FT                   /translation="MISLAPTTKPTARPGPWRSDRHGPVVAAGRVASEAPRTRRTRGAS
FT                   PVAVQSAARPLASPSTAAAILAIALNASAVQPSFASSEELFTRTCAGCHAAGGNVVQAG
FT                   ATLFPADLTRNGVNDADAVYDIIYGGKGKMPGYGEGCAPKGQCTFGARLSDEDVRGLAG
FT                   YVLERSAAEWK"
FT   CDS_pept        <969914..>970489
FT                   /codon_start=1
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638847"
FT                   /orf_name="MICPUN_76259"
FT                   /product="Predicted protein"
FT                   /function="holocytochrome-c synthase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO69842.1"
FT                   /db_xref="GO:0004408"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG627179"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniParc:UPI000199C8FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL6"
FT                   /transl_table=1
FT                   /translation="EVNPTNMMPTPDQRKSGGQRNNLSTHRVASTIPISERNRSMPQHQ
FT                   KDAAATGTWQYPSEQMFFNAIKRKGWTPKEEDMTNVIAIHNAVNERCWAEVLRWESLHA
FT                   KECDCPKLLKFRGRPRDYSPKARFLNFLGFKLPFDRHDWVVDRCGTDVRYVIDFYNAKS
FT                   ADPRSPIAMHLDTRPALDSVSSAMDRLYV"
FT   CDS_pept        join(complement(971337..971512),complement(971153..971209),
FT                   complement(970900..970982),complement(970587..970789))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638848"
FT                   /orf_name="MICPUN_53837"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70122.1"
FT                   /db_xref="UniParc:UPI000199C8FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL7"
FT                   /transl_table=1
FT                   /translation="MRSQVSLSAGIAKPYLGGLFSNGGHHFNSPPTRCCPASSSTSRAR
FT                   RSRAARRPRRPQWRSPCRSRSRSRSPRLPPRSRSRRLPSIPGSPSRTRRNTATPVTTSS
FT                   TSARLSRVRTPRSARSTPSTTAPSAPRSGWRSGTRSARTAPGRAGTKSNGVQVFLIFRD
FT                   GSVDSPRVV"
FT   CDS_pept        971818..972315
FT                   /codon_start=1
FT                   /gene_family="HOG000185228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638849"
FT                   /orf_name="MICPUN_113873"
FT                   /product="Putative uncharacterized protein "
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO69843.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199C8FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL8"
FT                   /transl_table=1
FT                   /translation="MIKAFLVVNNHAMVRLCRFYEQLPTEKQTELCQTVYKIVTARPDH
FT                   LCSFVDDEKTFGPDTKLVYRHFATLYFCILSDRSESELAMMDLIQVYVETLDRVFENVC
FT                   ELDLIFNSPKAYTVLDETIVGGLVLEINSQKILNVYDELMKLEKAHSSMLDNMPNIYTG
FT                   SK"
FT   CDS_pept        complement(972365..974155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638850"
FT                   /orf_name="MICPUN_113875"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70123.1"
FT                   /db_xref="UniParc:UPI000199C8FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHL9"
FT                   /transl_table=1
FT                   /translation="MEAGVDPFTLLERPLESFKQKGLTDDLVKMAHATHLKTRAAKIDA
FT                   LLKDRAKLPIGFKPNKKKDFAVATKPKKGESAVEAAMKLLGDEKGVEKIKEAAAKVEKQ
FT                   RLKMEADRKRYEALEDQIQREYNAKMAAVNARAAAVKDEMARKEQQRLDDQIAKGKAQA
FT                   KAADKFEVDERKHALQKLEEEMAELEVQRKAALREKRKEEKREREREQAELERRAKMAL
FT                   LAAKKEQAIEHLRLEVEERAQRLEEFQSELTSLRAERLKMSRDGPNLPDRIKANLERQQ
FT                   AVQERHKEELIMMRMAKDAHAAAGRVTADNSEKRAEQERISAEKRARVQALVEAKTRSK
FT                   MEKIEAHKARQEAYAVKLEKDRKKEAARKKVEEQLKVAERMERVQNVKRKKEVYLARLR
FT                   DQTAEKMGRGSLFSGTKKAMAKERYDSNCDRALKESVAKFEASETLRVATRERWLAAEM
FT                   DKKRLNDAIGKKQTAQKPKPKPAPSPAPASYKPTPPASVTASQQVSQPASRTVSQAPSE
FT                   GSMASYAAAKKLEEAPAPTAPISSDDPTPPMEPSSGEEFTRSFETEELEPPVVPSAEPE
FT                   GERTRDTMDSIDDSLEVIHL"
FT   CDS_pept        complement(974829..977093)
FT                   /codon_start=1
FT                   /gene_family="HOG000075695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638851"
FT                   /orf_name="MICPUN_62129"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70124.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199C8FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM0"
FT                   /transl_table=1
FT                   /translation="MVVASDTDLVTVLSSAHGRQRRSERLISKRDLQAAVKYGERAPSY
FT                   TDKGELRWMYTFRGIVYITDETSRHEITSWPLPAFGFDVPLVDITQPMLRAHRAAKRAL
FT                   GNPASWTSHTVAVVDQSGSMRNTDVDGGATRSDAVWITLALTWVDAEIKAGNRTSTDVM
FT                   SVVSMRNNSEVVVDAEPVDWILFNKLVGLLRESKPTQGGNYLAAIDLAERCLMRNTMGS
FT                   CATALLFFSDGRPSERMPRVQRSRSCKTTKYTPKDSRDARDKMLASRIGELASRFGRRL
FT                   TVGSIGFADPSEEFSTLQAMTKACEDYGCQATFHKPSLTAESLQSILSNLSSTLTTTKT
FT                   ELTELGGSKQRTVRNVKRESYSQIKLGETHVNESDWWIYKGPSVTRYKRVEGPRVYRGN
FT                   RRFPAPKFDKLKAFEHEKAFGIAHHQRAFGEGAERLVYRLREIDRAGKFVGPWLVAKQS
FT                   RFVEESKDQDVQEFHRTFCATQQIAARIAKTFNRKLEEVPGVKGNTPRIEFLECHVLRL
FT                   YDRQLGEIGVLTEKMLDHRKYKKWNSNNGYVAGMSKGHDAAGAKSIEGAFASLDLNATV
FT                   LPENLGAIVEEDEEGEEFTDSDASDEELVPEEDGRDLQCASAMDHRRGVKFSVEDIPQA
FT                   FSCFSYKYSKRKYLVCDLQGVLDQTRSPPCFELTDPVIHYRSNTFRKNVFGRTDRGQSG
FT                   MDAFFKTHTCSELCHALGKVWKYKHIDRVPRSLIKPKLENTLGRRTDPFARSSFLDSLR
FT                   D"
FT   CDS_pept        977594..990394
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638852"
FT                   /orf_name="MICPUN_62130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69844.1"
FT                   /db_xref="UniParc:UPI000199D594"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM1"
FT                   /transl_table=1
FT                   /translation="MSSRGTPRLPPTGGSSSSLLADAARRLEESTGSRSNDDAESLGLP
FT                   PPGSFIALAEVATDRAYVIVEGEDGSLNLELSDRTAQSFLAGPSHSHAEDVVVSLRRIG
FT                   RNVGFFHPRSGRFLQARGKGLKKLGFYAYNFGVSEQFEVLERTMGPMQQMFPNALGSWF
FT                   VESRRHPAQKYNFRFYSVRFETPAPSPTKSGLLSLPSLSRGGSRAPSAAPTPPATRPET
FT                   WRRLTGAARNLADGARSLASTAPNTPSVLAASVMGTPMVDDPTAVTNNDAMDLGIKVLQ
FT                   RFVKQSKSVPQKAGLRKSFAGWRNYTARIKKNTLYAMKIASLMRRSIQRRYMYRMKKYA
FT                   MEQAYDGLVISQFVRTRRTRLTRLTFGCWLAEYHSLLGVRRAVTRSAQRMLRRHLAGAF
FT                   YDWADFVARKMENIRTAVTAEEEREARKASLERMMNNKRKRLEFHWNERRTRLAWGAWG
FT                   RWLEDEKRVARLLARAVGRLSSRLAAAALERWASVADKRRRDRLVVTRVLAKLSRRALA
FT                   DAFYEWLDGLNARKDWERRARSVERYIRAIRQRILHVAFNRWRDKAKEYVEAETKVRRA
FT                   LQRYFRREVSNAFYHWESLASTRRAREEKEARDARLWESKVRRAERFLLAMTQKVFFRA
FT                   FMRWRAMRMESVRLKSLLRSATSRMRKRAVVACFEKWSDVAVEMRRQRAIVSRALAKLS
FT                   RRNKQAAFYAWIDFTNEEDERRRTEKGEWLSGVKKAERFLFAMQRRDQRRYFTVWLRRT
FT                   KDLRYQRRMLANAVARMTRQRLVSAFNRWLEAAVELRRLRVIGMRAITRISQRVLAEVF
FT                   FDWLDKVRSKSSWESKVQLARKFAMGVHSRVLFASFSRWREMARWVRESEVKVARSILR
FT                   LQNSTLANYFFDWNEMLNAKKAAIEREEREHKVWEQKVRRAERFLLALCNKLLTATFTT
FT                   WYYNVITLRRQRRRLNATLMKMTHRILDAAFQGWFISADRAKHQRKVANFVIHKFQDNI
FT                   KTSAFFKWRDAATERKESEAKARALWERNVVKGKRFLLAMQRRSLHQAFYQWASTWQRM
FT                   AAERNILRVSVSRISQLRQYSAFTGWRLTVVELKRQKVIVRRALLRVMQRAAARAFFHW
FT                   SGMVRDKRIWEKKLERSERFLASLVNRTLHRSYYRWKDATRQLREMEVKVRRQLVRWTG
FT                   KTLASRFMDWQDAVTRSREEAEEAERARREWERKVARSERFLMAIQNKTINAAFVQWSV
FT                   NWRMAKVDRHRIRTSIARMQKRWTFKSFNAWTSAVERARRQRALVRFCLARMLERRKSS
FT                   AFYEWADKVEAKRLHKMEQAGDWRSGVQKAERFILVWLRRSIGHAFIRWRNNARDLIIQ
FT                   RRKVQVCLARMSRRRCFSAFNTWHANARELGIQRRKVQTIVARMSQRRVLLAFNSWVSV
FT                   AADLQRQRKVISYVLAKFMSRAKEAAFYDWLCVVEDRKHAEMQADESLKVNLELSRRVA
FT                   LTWTKRNISFAFIRWKNNARAYKMQRRRLESALVRMTSRVSFAAFSGWLHVVERNKRRR
FT                   TILRRAAMRMSKRLLSKAFSDWRAKVDEKRYWDAMAGKIERCALAIANRSLKRALGRWV
FT                   EQWKTARMHRRRLATALTRMTQRSMFRCFSQWVDETAYRHRVRVALSRAIMRLSRRVQA
FT                   SVFDRWMEHTKESAAANLELAEWERKVRKAEKFVASFGRKILRASFSRWEAMARERSAM
FT                   RRKALNAIARFGKRRMVLAFDMWAEHVATLRRQRALAQRVAAKLTRRVFAEAFHDWCSF
FT                   TEARREHKQREQREWFFKLRKAERFVLAWRKNSISFSFIRWRNQTIRSRAHRAKLRVAV
FT                   NRMSQRRIFAAFNGWQAQAKELKRQRVIVTRAIMRMSRRRLAGAFYDWQRKVSASADFA
FT                   EKVAVSERFLAGIRSQMLFRIFYGWRDTVRSLIEQEVKVRRSILRLQNNTLGHFFFDWH
FT                   EKLLAKRAHTEQEERKRRVWEHKLQRAERFILAWQNRTVADAFSQWRSNWLDIRLERNR
FT                   VKIVVARMTKRLLFAAWGAWLGTFVDLQRQRKVVRLVLVRIMDRLKASSFYDWHDKVQA
FT                   KKEHVLKEKEEWQVNIVKTQRFVLAWQNLRMNAAFQCWASNWREMKRQRKILENCVKRM
FT                   THRLLFAAFSEWYEHANELKRDRNILRRAAMRMSRRQLASAFFDWHAYIRESKEWAQRI
FT                   LISERFLAAIHSGVKYRAFFRWSDAVREVKQMRVRVTRVLNRMLGRTLANAFYDWNQWV
FT                   VDERRWKTSLARSERFALALRNRTMFAAFARWKEAAVELATLRRKLVKCLGRFRHRAAS
FT                   SAFQGWRDKAAELRFQRISLTRCAARWNNNRLRAAFDGWHESYAETVRMRGVCVRYIAA
FT                   MGSRQLRRSFNSWARFVEGTVVEKDVMLKSLVKMTRNGVSKAFTSWASHTAVKLHNFES
FT                   GCRMMRSNTRRRVFKAWRKRRLTTNTAVKTAAARFRLQSLRVIRDAFRSWEIGIGDFRQ
FT                   RRLAGTKILSNLAQRGSTWGFTHWRYLVRSARKRRVATSRFLIKMERSRKRSWFAQWRE
FT                   NVAETRRLRALSTRAANRMIRRLTFKAFERWVEAAGDLQRLRAVSKRAAVKLHKRQLSR
FT                   AFDGWIDAVAEMQRRELVVRRAIHSIMNRIRRSAFDGWLESVAVVKRIRALSNRAANRF
FT                   THRSLSVAFDAWIDKSLDLKRLRGVSSRAVARLERMHLSRAYNSWVDTASERLRHRVIM
FT                   TKMALRMSHHKQNQAFLRWCDQTATLRRHRNLLGSMLVRMERRVQAAAFDGWRDRADSM
FT                   RVQRQLLRRCVDRLSKRRLVLGWERWMELIDEAREAARDAKELDLIAAVEDAERRNKMS
FT                   EAEAREAVEARLRVLDDMTQEKCRRFLNAAGHRTQHRSWRRWRFAIVERERFEAVARRC
FT                   LARLSARRNRVCFYAWLDAAHRNAVKVNFEQSGAARMIKRWMRRSLDMAFQGWSDTTAR
FT                   RRKMRKSLTHCVNRLNRRSLTVSFDTWSERVADARRWRKTVNDAKKFLVGVFFRRTFAA
FT                   FRGWKEHATVRRISLERARRALGHLTVDERVRGAWHAWVDAWEASKPDPTLPRMMTVAR
FT                   RMHAKLVRKDLYAAFDRWDEHTREKKKLRAVALKVTRRMAARYLAGAFGTWLHWYDAAV
FT                   AWREGIERRERVLLVMRNRRLAAPFRAWVANADKLKWARATLARVAGRIQRRHLARAFD
FT                   AWTAAIAEGRTFRSSVSKAHRLIRLIMTRHARAAFYRWEELAATRREKEKKVRRCVQRM
FT                   LRRHVSSAFFHWEALAVESREKGENEERETRKWEGQVRRAERFLRSVLFQNLFRGFTRW
FT                   RAAAAESAGRRRKLSSAVARMRKRAVVACFEKWSDVAVEMRRQRAIVSRALAKLSRRNK
FT                   QAAFYAWIDFTNEEDERRRTEKGEWLSGVKKAERFLFAMQRRDQRRYFTVWLRRTKDLR
FT                   YQRRMLANAVARMTRQRLVSAFDRWDEYVADIRRLRVIATRVAARISQRQIAVAFFDWL
FT                   DRVRSKSSWESKVQLARKFAMGVHSRVLFASFSRWREMARWVRESEVKVARSILRLQNN
FT                   TLANYFFDWNEMLNAKKAAIEREERDRKVWERKVRRAERFLLALRNKLLTAAFEGWRDR
FT                   VVELARQRRRVNAALTKMTHRVLAAAFDGWAESVARAARHRRLAARAVRKMTRRRASRA
FT                   FGRWSHAAGEAQRKAAATERHASRLWRRKTLAAFNGWRDSAVTRRRNRAVAMRVVGAVA
FT                   HQTAYRAFRSWAHGVAESIRKKIAVTRALARMRRRALVDCFYAWLNSAEDARAAWSRAA
FT                   RAEGLARRGERRLRAACHRAWAELAANAGRRRDAEDDAVERATLAVLDAHVRVRRTRLV
FT                   AGVFGAWRGTRLGVDLAKLRGGVDAARTAIEREREQAIAFLFVRRVMKKRINVLHAWRR
FT                   YVVDARRRERVLGDNMRRVLRERKCRLAVRAWADAAWERVQRHRKSHAARRHFGSRRLE
FT                   RCVAEWRAQCPTRKRWLKERAQKLAAAQRSGAAPVAVGSSVSQIAFDGWSASAMVRTAV
FT                   YRDGQEVDKKEVDKKEVDEPGTAQQPVGDEGTRAEAGTHETIASAAAMAALRASFEEFN
FT                   PGDVDDDDASDKGTGPIARLSGVPTVPAVPTVPSPAVGSRAAVAAASTPSPPSPLHLDW
FT                   NFDAPFAENVAASSPATRSPLDASAASVLTGFDHRASSAASASSTRQRRAGEGLHRAGR
FT                   DSTGAARVVGGLESRYREVMGEIATLEGSLPPPTSPPPTRATLRGSDRDGLERLAGAES
FT                   RATSALHAARDDQAELRRVFSRSTSPYEPSDE"
FT   CDS_pept        join(<991448..991907,991965..>992290)
FT                   /codon_start=1
FT                   /gene_family="HOG000200442" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638853"
FT                   /orf_name="MICPUN_68357"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO69845.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199C8FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM2"
FT                   /transl_table=1
FT                   /translation="VNQDAYCALPNGFASSRGGFLAVFDGHGPVGHLVSRYCKDRIPAR
FT                   LIADAHSRATLMENPRRALEAAFRGVNAELNSIDGLDVEYSGTTAVALHIYGRLITCGW
FT                   VGDSRAVLGRENLETGRIEAVALTCDHKPELPAERRRIEAMDGRVARLMQHGEGPFRVW
FT                   MKNLWVPGLSMSRSLGDSIAHRVGVTPEPEIRTHEVVENDRFIVVATDGIWEFVSNEEA
FT                   VAIVAACDAPEEAATAVAREAFKRWKQRNDGEMIDDITVL"
FT   CDS_pept        join(complement(996567..996644),complement(992515..996441))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638854"
FT                   /orf_name="MICPUN_62132"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70125.1"
FT                   /db_xref="UniParc:UPI000199C978"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM3"
FT                   /transl_table=1
FT                   /translation="MNRLMEEMRAAGMTPGQGTGPSFVNQGFSFNDGMGPTPGAGVPGT
FT                   GMGRPPSAGPGAWAETPVMGGPGPMGAGPGPGMMHMPQTGSVGPMGGAPRMSSGPPPSA
FT                   FPRPPSFSTPGPPHAAGVGFTPGPSSAPTMTHQQSGGAPVTHPSSHHPTPGASNPSYDV
FT                   VHLSARNARLEEKLSKALAKNRSMAKYYDQLLAKTRDAQEREIEDLKGDLMRAQAAAAA
FT                   SAGARDSLQQMAAERDALSSEVASLRQQLASLKGLKGGADADEVKRDLDDARSKLARAD
FT                   GEVASLRAQLATAQASLSSVGHVAGPRGSSTVSESASGSIRPESANPGAASTTLAQMQR
FT                   MLDAAREERNHERRQAAARDAEMARQLNDIKEQALDRIRESSSAAKEVAALKERVHAAE
FT                   HERDRLRDRMEEMEGDVSDHRELRRRMQLAEERASGLQKKADRCELAEAKLRAAEANAQ
FT                   NLQEERSQAHKRLQEMTEKLLHVTNEKDVLVRHSAHQVHVEAELANAKRELEQARRSGL
FT                   AVRAERKEHAVEWNEAAENMGRVLRHHIYSHTRWEKDAGGEVAGAAEAHAHGQRSAVRL
FT                   VAAAEAEAASLAGEAVDVVRTTRQLLREHAAECAAVIEEIERVHAQRADERIDAALSML
FT                   REAEVRAEKAESDAERSHAASRRARAAAERAGVLPSALADPHERRGGGSTNDDDGVRGV
FT                   TPSDVHHPDDADPDADPGVSFGRGLVRKEDFDDAAERATRKLRRCQFQMLGLAMWRVAT
FT                   SQEKTEGHEMLHAQLVLARRKAAVASARAENWERIAYNKGSTLRWSLLSAALLRKAEKA
FT                   RRGTMDDVEFALTQKTLQLQVAVTERDVANEAAARAERELAHSRAVLEGLRREHDGALR
FT                   QLQKEHGLRVEISDMVKRDGSLNPGGVDVDLPVSELQKVLEQLADAADRAGELAKIASR
FT                   WNGRDDDDDVPGASDEDHDDEGSDKENDGRLTGSATNVRALKSHLPSLTPGAARRELDR
FT                   DLEACHDALMIMRDEDDADARAERVATQSMGAVPHEPRGSFEKSTRAVKRHALEVKAEL
FT                   LAALVDGAENARARERLQSQCDALERRLADTGEHLASVRGAAVSRAFKGAAIRAREAQV
FT                   SHARERELRAAAAKSRWGAAGAKVGGEVAASAARRARLAGAMDAERTRAAAAAANDADD
FT                   STLARNGRNGRNGRAVTIVAESESDDDEDFGGYKPPPAHAAAASKFDDPNDFKIGPDGS
FT                   IVARGGGGGKAAAAAGGGSFSAVIRARKAAARAGASSQKRAESAWSGGLRSSPARGGGG
FT                   GGGAPPTWDSTPMSPKPEPKRTAVSRTGLRAAKKNDLASRAYGSTKSRGR"
FT   CDS_pept        997439..998155
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638855"
FT                   /orf_name="MICPUN_102832"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO69846.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C979"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM4"
FT                   /transl_table=1
FT                   /translation="METISLKPPVFRVRDFLSPDERARIIELARSELRESHVVATEPEP
FT                   AANASSAPPPRKSQTAWLVADADDTGHLERVRRRAMALTVLPNTVKSERLQVLRYDRGG
FT                   YFGVHHESTAFLRRYATLLYYLEGPGEGNGGGTAFPLGPDGDGGVRGEVALAAAGEAIG
FT                   SGDVRRVCDSSRVGGVVATPTPGDAILFYNFGADGEVDRHAIHAACEVTGGVKWAANHW
FT                   FTLPEEDAGGRERDEL"
FT   CDS_pept        complement(998708..999493)
FT                   /codon_start=1
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638856"
FT                   /orf_name="MICPUN_85635"
FT                   /product="Predicted protein"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70126.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI000199C97A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM5"
FT                   /transl_table=1
FT                   /translation="MPKSRRDKVIALTQTKKKDREWKGGLIEQIREALEQYQSVFVFRC
FT                   ANLRNNAFKELKATLADSSRFFMGSNKVMQVALGKGPEDEQRDGLHQLAEHVRGHAGVV
FT                   FTNLTKEDVESAMAKYEVSDYARTGTVARETIVVEKGPVHGPHGGLMEHTMEPTLRKNG
FT                   MPTKLNRGVIELLADHALCKEGEHISPQGAILLRLFGHELATFKMDLLCGWVSASSGSI
FT                   SSGSISSGSISSGSNSPRVSRFSKSLGSDDNSHWDNLRG"
FT   CDS_pept        join(1000038..1000134,1000276..1000988)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638857"
FT                   /orf_name="MICPUN_109077"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69847.1"
FT                   /db_xref="UniParc:UPI000199C97B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM6"
FT                   /transl_table=1
FT                   /translation="MAEEARPKLSIKTERPVGQHVVPPSPTTLLDNVPFSPTDGICTPS
FT                   PKSFMGAFIDNNGAVQHRPAPGGWWEWQARQVAAAHQAAGMNHMGVGVPPMAVPPPNVH
FT                   PAAFYAQYYAQLGIAGLAPYQVAPNGIVPPSPRPEEARRARGPGGGGDASSSFNSFDGG
FT                   SFPASADGSASSSPGASPGATGGFFRPSVPGASASPGTGFGFAFDRVQGGGPMNAHDPS
FT                   GGAGKQGRRSSRGGRGSRAARARRRSAERAEAAGLASPGEDAGAGGE"
FT   CDS_pept        1001380..1003611
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638858"
FT                   /orf_name="MICPUN_62136"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69848.1"
FT                   /db_xref="UniParc:UPI000199C97C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM7"
FT                   /transl_table=1
FT                   /translation="MLTERPSSRKAPVAEAENIPPPPRRGGRPSKPVDAGGPARTSSAP
FT                   SPTTWIPEDATPCGEGHRSVESQYQDALRALDADRETLRREVERVIAADAAREGEHASL
FT                   RDRCAELERELKDARAAAAAADPNDDDDDDDRRQRQPATLAMVRRLRQELSEARAAAAE
FT                   AARAQVDKIQTLSFSGAPDETELSAVRVEIDRTRAEMAAALGEVSAAAKDRDDALEEVR
FT                   VELGVLQAERMRLRTRVDSFGKKLQAESTSQGSTADAAGLRARVRDLEATNASLLADAE
FT                   RFESLRVETRALAESIAADATRSAEAEDAMRREIRTVKSELKLARHRLEEERKRREDAE
FT                   EATERERRGAEEARRVAEEATAAKTKIQSQIQKPKIQKPNRLLDPEALAEVANLRSDLR
FT                   DEIALVRGALEEMDALASAVHEGKGALAAVKADLERARIDGDAAVDAELERLRAELARF
FT                   DGETRADVVNVTRTLATTRARMDEAEAEAEEARRAVRAMEGEVARVLDASAGVVAEKEA
FT                   LVAEVNARARELADERAEGEHRRRSHNAEMEELQRQLYALMRDREEALARFRHERNRWG
FT                   DELREARMGRTSSSFGGTTRRETDGSRSTAGGFGREFAPHVASRAPSSFTSTESFPRDD
FT                   DGDDDVSRSSSSFAATRRGGHARDGAMPSFAPPPASSPIPGPPPPPPPPPGAHSRPTSA
FT                   ASLSVSSRSSSSRSNGSSVAKGARESANELVNALAAGGGRRGVSSSTSY"
FT   CDS_pept        join(complement(1004589..1004663),
FT                   complement(1004380..1004445),complement(1004114..1004198),
FT                   complement(1003854..1004005))
FT                   /codon_start=1
FT                   /gene_family="HOG000242129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638859"
FT                   /gene_name="PSAK"
FT                   /orf_name="MICPUN_62137"
FT                   /product="Photosystem I subunit X, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I"
FT                   /protein_id="ACO70127.1"
FT                   /db_xref="GO:0009522"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="HOGENOM:HBG600339"
FT                   /db_xref="InterPro:IPR000549"
FT                   /db_xref="InterPro:IPR017494"
FT                   /db_xref="UniParc:UPI000199C97D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM8"
FT                   /transl_table=1
FT                   /translation="MQAIASATAVRPQFATQRKTFNAKKVVAVKRDVSVKADWSIGSPE
FT                   NVIVCVNTAACLFAGRFGLAPTVNKNYTGSDSYTMTEAERPVVGSRDPAGFTIVDVAAW
FT                   GSLAHMISAGEILGQHAKGFF"
FT   CDS_pept        join(complement(1006170..1006220),
FT                   complement(1005001..1005978))
FT                   /codon_start=1
FT                   /gene_family="HOG000239918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638860"
FT                   /orf_name="MICPUN_62138"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70128.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG627554"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C97E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHM9"
FT                   /transl_table=1
FT                   /translation="MGTTSSRPAPQRYPVPPGQAYYGQPAPANNGQLYGQFNQRPAAQP
FT                   NNFVMPAPYGVQQQQQQQQQQQQQQQGGEQTTRTSTIRNHVNLKKNTLAVHPVGGGGGS
FT                   KLRVTFDFDANVECWASVFLAACENPKEGCALSLPHGDRARPARSKHRRGLGQAFDEPT
FT                   GVLDLDSVPADALTTASPNSYPLVIRLECVTGVPPGHDGGLDTVSLPEPAGAKLETWVQ
FT                   SQTTYATLSRRDDGSWGVTVVKQKIWVDGVSYELQEIFGIENCGASGMPGAEAGDDGKE
FT                   CVVCLSEPRDTTVLPCRHMCMCSGCARMLRHQNNKCPICRTVVESLLEIKVATKAEGGA
FT                   SA"
FT   CDS_pept        1006752..1007822
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638861"
FT                   /orf_name="MICPUN_109079"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69849.1"
FT                   /db_xref="InterPro:IPR009890"
FT                   /db_xref="UniParc:UPI000199C97F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN0"
FT                   /transl_table=1
FT                   /translation="MAATPASARVSPRLPPDTPSRIASHCAAMYAKGAVAALSMHRVAR
FT                   YASRSKRLRTLAARCVLVNGVVFLGSLAVLDHALVPFIGWVLHRWTAADAAGGAGGGAG
FT                   GRSSLAASASSSFLWTARAAWLYPTYFASTVVNSFTAGEMARISCALAAEDDAARALAR
FT                   RRVTGSVELDAGDSEKKDGSRRGGVAGLAEAVYHVLIVNSLFAQITALSFVLTGPIGTW
FT                   VTRALQTWLYAYYCHDYLWSARGKPPGWRVAHFEGNWCYFAGFGSPIVLISAMNLSTFY
FT                   AAAVQAMAFPVFMIAAIASGGEDAEVCLEGKNAARTRQGAFPVFHLASASARAVLRLAG
FT                   VGGGAGDGGAKRTKGE"
FT   CDS_pept        complement(1007898..1008257)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638862"
FT                   /orf_name="MICPUN_62140"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70129.1"
FT                   /db_xref="UniParc:UPI000199C980"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN1"
FT                   /transl_table=1
FT                   /translation="MAEPFRPHDRESSWEFVGVVVAAFALVVVALGRATLLRWCADCAR
FT                   ARAARRERSAEEEALRLTRTLLPTHDDGSHGSSSTNATVIELAVDGVPPPTSAPPGTDA
FT                   SSAAAVPHRETTNGA"
FT   CDS_pept        join(1008543..1009157,1009222..1009530)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638863"
FT                   /orf_name="MICPUN_106187"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO69850.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199C981"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN2"
FT                   /transl_table=1
FT                   /translation="MLTITAPGRVLTRTSPIGPTAPRAAAAARAPASLAPASLARLDRN
FT                   KTRGHRGRRAGLRAVASHGSGVSPDAAHLLPRSSSSSSTVGASPRAVVAEIAAKPPAPP
FT                   PAVVANDNAFYAFCRANWPAFVVVQTCALTGAVVSGVSSRKKRIELELIMKKYRRMMDR
FT                   VDDMTCTFDWDLGMEQCTDDWPGSTELAIAKMLLDENGDADAALVKFAEAKAAVVKATD
FT                   GLRTLAGDAKATSSWVSAGKGAALALVSKGTEETLRAAVEELKTVAAAAEREGDSTVYG
FT                   MLGDVLTDLGDYAEAGEYYDKVLAMD"
FT   CDS_pept        complement(1009647..1011140)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638864"
FT                   /orf_name="MICPUN_53851"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70130.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199C982"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN3"
FT                   /transl_table=1
FT                   /translation="MYQLFTYCPPGRWGGAHWCGGIVFDTSSFNEDITGWDTSKVTRME
FT                   SMFNGAAAFNQPIGSWNTSQVTDMEWMFSGAASFNQPIGSWDTSQVGDMGGMFNGAAAF
FT                   NQPIDSWDTSQVSKMSWMFNGAAAFNQAIGSWNTSQVTDMDGMFSGAAAFNQPIGSWDT
FT                   SQVTRMEYMFRNTDAFNQPIGSWDTSKVTDMGSMFLNATAFNQAIGSWDTSQVTDLESM
FT                   FDGATAWQARYANCGYRFDPPVVSNTACCSSGAQGGTPECTGSGSEIDCEDGAGGACDN
FT                   DACWANPCGACSFDCPHRSTHSTHTACSEFTSYTSSACSYDGPPTAWVRKDNACDAAVP
FT                   PANGAAGTCSDTLVSGSSCQPTCDAGYTVSGTSSCLDRVLTSAACSPAPCDASSPPANG
FT                   AVGDCTSSLASGSSCQPECDEGYYATGSSSCSLGTLTAAACNTNPSPPPPPPPPPPFPS
FT                   PSSSPPPPPPPKSVNDEDDHATGLTGILVALVATIFNML"
FT   CDS_pept        1012173..1013102
FT                   /codon_start=1
FT                   /gene_family="HOG000265648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638865"
FT                   /orf_name="MICPUN_53852"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO69851.1"
FT                   /db_xref="InterPro:IPR014955"
FT                   /db_xref="UniParc:UPI000199C983"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN4"
FT                   /transl_table=1
FT                   /translation="MSHARGKSLRRHFRAPLPSARRAMTAGAVAAAVVSAPARSIGTRR
FT                   YGRRGGATRHARASLSDPGFAADDARWDAAWTSVRDASTRVAFIDGDARRALRARLTRT
FT                   NLREALAAIPGEVHLRAEVRTGASEALADVRAMDLHGGLFGHVDAGATDDGVRRGIETL
FT                   ERDIADVVRSFGKTCGETSAVVQVSLLRKTLCSKYHVDWVPLRAMVTYFGDGTEVLSAA
FT                   ASDAITRARALGPFAEDLAKSLAAATAVSKSCKSGECDVVLMKGERWPGNAGRAIVHRS
FT                   PDVDGDAGEWRLCVRVDAPRWVNPATNE"
FT   CDS_pept        complement(1013136..1014833)
FT                   /codon_start=1
FT                   /gene_family="HOG000005759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638866"
FT                   /orf_name="MICPUN_62144"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70131.1"
FT                   /db_xref="HOGENOM:HBG317595"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C984"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN5"
FT                   /transl_table=1
FT                   /translation="MTRLEIFTGRARRSPLAHRLEAPPRLDLLAPRSSPPRYTDEIRVV
FT                   QFAPAIATQREARVRRLGRRAFAMYSRRKLKHWRRRKNELEKMGMRYNEGRYKLSCVVR
FT                   QDPADHVYCCALNTVHLAHADKLATTAGPRAYVYRLTPDGGVKLMQCYVDEDDEEDYFA
FT                   CCWCASAVPERSGRPMLAVAGGYKGVVRVIDCVSRVVKVNLRGHGGGVNDVKAHPLRPH
FT                   LLLTASKDESCRLWNLDSGACVAVFAGEFGHRNEVLSVDFKPGVDPYDDAPGGDSSGGG
FT                   SSGGRNGVGQNGVGHVPDDSAGDVVFVSGAMDNQIKVWSTRGYPGLVRRSDGWRKGSTA
FT                   SGDSPPGESPPGGGEKTANIAFPTAHVQTPTFSSHKVHGNYVDCVRWFGDLVLSKSVEN
FT                   VVTLFQPRLGGVGDLVTGSGFRKVQDFPLRKCDIWFMRFALAPDATHMCCGNTAGEVFV
FT                   WRMGGGGGGHTAHTTASATLAHKRCVKAVRQTAMTADGRIVIAACDEGTVWRWDLVDAG
FT                   AGGGSVGGEKRARTEKDDATDEKGRGDEGVDGGDVVTGASGDTIEILD"
FT   CDS_pept        join(complement(1014011..1014566),
FT                   complement(1013136..1013929))
FT                   /codon_start=1
FT                   /gene_family="HOG000005759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638867"
FT                   /orf_name="MICPUN_62144"
FT                   /product="Polycomb group protein"
FT                   /protein_id="ACO70132.1"
FT                   /db_xref="HOGENOM:HBG317595"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C985"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN6"
FT                   /transl_table=1
FT                   /translation="MRYNEGRYKLSCVVRQDPADHVYCCALNTVHLAHADKLATTAGPR
FT                   AYVYRLTPDGGVKLMQCYVDEDDEEDYFACCWCASAVPERSGRPMLAVAGGYKGVVRVI
FT                   DCVSRVVKVNLRGHGGGVNDVKAHPLRPHLLLTASKDESCRLWNLDSGACVAVFAGEFG
FT                   HRNEVLSVDFKPGVDPYDDAPGAGDVVFVSGAMDNQIKVWSTRGYPGLVRRSDGWRKGS
FT                   TASGDSPPGESPPGGGEKTANIAFPTAHVQTPTFSSHKVHGNYVDCVRWFGDLVLSKSV
FT                   ENVVTLFQPRLGGVGDLVTGSGFRKVQDFPLRKCDIWFMRFALAPDATHMCCGNTAGEV
FT                   FVWRMGGGGGGHTAHTTASATLAHKRCVKAVRQTAMTADGRIVIAACDEGTVWRWDLVD
FT                   AGAGGGSVGGEKRARTEKDDATDEKGRGDEGVDGGDVVTGASGDTIEILD"
FT   CDS_pept        complement(1014928..1015203)
FT                   /codon_start=1
FT                   /gene_family="HOG000211145" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638868"
FT                   /orf_name="MICPUN_85371"
FT                   /product="Predicted protein"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="ACO70133.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="UniParc:UPI000199C986"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN7"
FT                   /transl_table=1
FT                   /translation="MASYPLIKHCDMESEMRNEAVEICTGAVEKYGSTDLERASQLIKE
FT                   SMDKKFGAPWNVVVGQYYSSEITAEVKHLLYLFFGGQFAILLWKAQ"
FT   CDS_pept        1015636..1017432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638869"
FT                   /orf_name="MICPUN_62146"
FT                   /product="JmjN/JmjC protein"
FT                   /protein_id="ACO69852.1"
FT                   /db_xref="HOGENOM:HBG623558"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000199CA09"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN8"
FT                   /transl_table=1
FT                   /translation="MRPHPEGVLPVGNAYLLPPEEAVASARAKRDGLGAFASLDDALIL
FT                   RVLAGGDDDDDEGVGPDALACLACCSRAARAFAYHEDLWKAATLRAVGGDFRFTGGAWR
FT                   RTYARCVRAMPTEASSTDDDDCTRVGGGGAGRRRDAPVGGGDRSKTLFSDALYLRHLGA
FT                   HLPLDPEWLAVDSIPRVDARDTNPARFARDFESVNRPVIVSGLCADWPATRGEWTRDRL
FT                   LATHGDVEFTVGGYQMRLRDFYAYGDDASDDLPLYLFDKKFCEKAPSLAAGYSPPNIFA
FT                   DDLFALLGEHDRPDHRWLIVGCERSGSGFHKDPNATSAWNAVVTGRKKWILFAPDATPP
FT                   GVHPSADGSAVVQPVTLVEWYMNFYRHVYETDEDDESETDEDDGDEEDEDEEKDSEVNR
FT                   SSVRRRRRRRRRRANAGTSSDAPPRVMEGICGPGDVLFVPSGWWHMALNLEECVAVTQN
FT                   FCSPRTLPRVLRFLRDAGECAELVSGTCRTRRGSLYERFVAVLAEKRPEELAAAERYLA
FT                   LGTRAPARYGGAGEAATDESFKSTDRSSNGAIEHHIGRDEKRRRGDPGAANGAAGFDVV
FT                   RRCSTLSDAFRSGEGGSFSFNF"
FT   CDS_pept        complement(1017500..1019026)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638870"
FT                   /orf_name="MICPUN_53854"
FT                   /product="RNA-3'-phosphate cyclase "
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70134.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI000199CA0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHN9"
FT                   /transl_table=1
FT                   /translation="MSDVPVCIEGSQLEGGGQVVRVAMACSAVNRRTTTVTNVRAGRPN
FT                   PGLAAQHLAGVELLAALCDGTLRAGGGPSGAHARGTRDGGVLRRGCVEFTHEFTRGVVD
FT                   EPDRLDVTRASKPLDARHVRSLKYHASDDRLEIAADVGTAGSVALVLQAAMPWLVRTND
FT                   GGRGRGRGRGRKVGTPSTARTVSLTLSGGTDVPFAPTMDYVQHALWPVVSGNANRRGFA
FT                   CDADVTFEVLTRGFYPRGGGTVRVNVVRRDGSDADGSDGADGSDSGSRPPVRLTRNTNR
FT                   HGGTRAGRETWAVVTRAAGGPGSGGGTRTVTREDLVDACDVANEVCKIGVASVASDDST
FT                   FTTGDVDQSTVDACTSGRHEPGGSVTMTATLLRVSDGTSGRGDGSDDAPPGESSPGESP
FT                   PVHFGASRAWDVRSGETLRDVASAVAKELADVIVSGAAVDDCMLDQLVVFLALGGGGEV
FT                   LARNPISLHARTAMAVCEQAMPWVRFRTTETNDGRLVSVTCDVGAEPREW"
FT   CDS_pept        1019329..1021521
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638871"
FT                   /orf_name="MICPUN_62148"
FT                   /product="rRNA/tRNA pseudouridine synthase "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO69853.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199CA0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP0"
FT                   /transl_table=1
FT                   /translation="MATCAVMRRLVLAAAPRGGSRGGGRDGTSGRTPGRGGSGGGGGRS
FT                   SRTGGRGGRGSGRGVARPDRPGPPSRREGAVGYGRGPSGGARGRGDASRHRGATPSIRG
FT                   ANNPRPNAVDERGACDTMANASMSLELGHPRCPMCAQEFASGGTRARHLALCCPDLIDP
FT                   VGWASGDGEVVRRCAALRHPKASFRWAVLSRRFGWSDNDGDGDGDGDEKSAPGMTAVAV
FT                   AKSLRVDLATVTKLVRHEIRDVPLQPDPSPLHVVYEDEWLMAVSKPAGVMTYPAHRLRG
FT                   ESVVSRAVHHLSVSAARRRGRLPYSSEDLPEESGVGTPVGTPGGSFAGAWTSSQVEPIA
FT                   VHRLDLETSGVLLLAKDKRVASELQAKFEARGVRKTYLAVCAVLEDAEAHKATATRRVD
FT                   FEADVDTDVDSDADMDADVYADTDGDELGVFDESDLDDDDDDDAYEDPDDELDELDEPG
FT                   VVRVVNAAIGDPEPGTRRSAAADDGGRCVRAVTPDGKPARTEYQCLSSRLGVPTQVTMP
FT                   DGVTRRTVVGTALVLARPLTGRTHQVRLHLAHAGFPIVGDGLYGVDYASVAASIGAFRL
FT                   SGGGITREEREAAARRRLLFASSSPSSSSAVSPRDDASAGGESPGSESPDDVPSPCARL
FT                   ALHAWNVDVLHPRALVPLRLCVDMPRDMTDLARALGLATSSVTLGPAASAAARAAGGAP
FT                   ARHALRRERRREAAKGRVRRMVARKAGRDADERAGE"
FT   CDS_pept        1021647..1022978
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638872"
FT                   /orf_name="MICPUN_112737"
FT                   /product="Ytidine and deoxycytidylated deaminase zinc-
FT                   binding protein"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69854.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000199CA0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP1"
FT                   /transl_table=1
FT                   /translation="MASIALLSAAFAGAKIQDIVRGVIHDRRARGRGADGATVAGADFP
FT                   SGDSAADAAPAAPLSPPRPALTKLTRKSIGSPNAAATKQSVEEEVVVCSVCHQGVGTPS
FT                   SPVTPLNHHRGPPSTPGSNTTTVNSHSGFRGVPAPKPDPYAPKPRDRYLKWDDYFMSVA
FT                   FLSAQRSKDPNKQVGAVIVGPDRVIMGVGYNGFPRGCSDSDLPWAKKSTNGNPMETKYA
FT                   YVCHAEMNAIMNKNSQSLHGATVYVTMYPCNECAKLIIQSGIREVVYFEGKLPMARGGE
FT                   RKVVCGDGARSETVGGDDPKMATSNGGNGPTWKDWVDGDLDDEDPDGNGSSYEPPGEVS
FT                   ADGGVGESPDVSLDASSEDLGSPVGIEGSRVFPLRELRFKHTPEKRTPTVDGKSSARPS
FT                   SESTPTKGGMQNDPTYAAAEKLFELAGVKIRQHTPNAVVDVTYH"
FT   CDS_pept        join(complement(1024078..1024161),
FT                   complement(1023877..1023951),complement(1023135..1023527))
FT                   /codon_start=1
FT                   /gene_family="HOG000100793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638873"
FT                   /orf_name="MICPUN_109083"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70135.1"
FT                   /db_xref="HOGENOM:HBG608153"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniParc:UPI000199CA0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP2"
FT                   /transl_table=1
FT                   /translation="MSALRVVAPVARVSASKARVARSAVAAKPVKARSVVVRASSGDVS
FT                   ERLEDALKIAEECVGECAAMWDEVEELSQAASDKKPAPAELEPVPISEADMNFIKETQA
FT                   ALMKAKEAANVDVETLRALESASQSAKKVTVSSERLKQLEAALEAALESARACTGEDCA
FT                   VEWEAVEEISAAKSQIENRD"
FT   CDS_pept        complement(1024527..1026854)
FT                   /codon_start=1
FT                   /gene_family="HOG000100799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638874"
FT                   /orf_name="MICPUN_106188"
FT                   /product="Pyruvate dehydrogenase"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, disulfide as acceptor"
FT                   /protein_id="ACO70136.1"
FT                   /db_xref="GO:0016624"
FT                   /db_xref="HOGENOM:HBG557321"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI000199CA0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP3"
FT                   /transl_table=1
FT                   /translation="MPAVRAGSNLHRRTNNAKKQSRSSVIRRASTTKTKTIEAPPNLER
FT                   LRILTPWEEAQPVLKSEFGMSDAEIAEAGALSDEEISEAYTMMQLCRDFENECNQAYMA
FT                   GKIRGFMHLDNGQESIPALLGNAIRKTDLKHSYYRDHCHALACGVDAGAVMAELFGRDG
FT                   GTCRGTGGSMHIYDMETNFQGGWALVAEQLPYAVGAARSIALDKHLGTGEAEDRIAVVF
FT                   VGEGGAQNGRMAECLNAAAKENLPILFVVIDNGRAINTFTKDVATNQEVFNQGKHYGIP
FT                   GVLADGQNVQDTMRIGRAAIQHVRTKGPAILQVHTFRFNGHSPADPEHERNRKDEKRWA
FT                   RAACDPIKIFEESADAARVDLAACTAKAREEVRKALEFANASPPPPKDLAAQLEYPDPT
FT                   GSVDYSKREPVMGLAAAEEITKRIVPEATLTALKARIEALRAMAGSEAGISIGDAVNLA
FT                   ILEEMLRDPTTTAHAEDLQAGSSYNVPANTQQAFGTLRAADEIIDEGHFIGKALGEAMN
FT                   GYRPIVELMNANFGIYGIAELSSAGNTFATTGGQFEMPMTIIGAGGTAPNQSLGAEHSQ
FT                   PFHAYIMGIPGLKICTASKPHEAYGLAKSMIRDNSPGVLLLPVKLMKTRGPCQVDNFLP
FT                   LHKATVHRHASQAAIDAGKAVTVLTYLHGTKEAEDAIDQLNAEGYDCDLVELTCLKPFD
FT                   ADTIRASLQRTHKLCILDESTRSGGVGATMSALVAETMFDELDAPVSRLCMEDAPVPYA
FT                   TEMERAMVKRAADLVEGVKAMC"
FT   CDS_pept        complement(1027502..1028188)
FT                   /codon_start=1
FT                   /gene_family="HOG000265699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638875"
FT                   /orf_name="MICPUN_62152"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70137.1"
FT                   /db_xref="HOGENOM:HBG557322"
FT                   /db_xref="UniParc:UPI000199CA0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP4"
FT                   /transl_table=1
FT                   /translation="MLAFFYTCAFVCAAWLPFVWHHREIHGVVSVTHCALTLFNAVNLL
FT                   ICLWENALFIHRAKVRRVYLRFKKQVGDRNFPSPLCLFENITLRQALSYEYWSVIWSTY
FT                   SLLDPSYSDQKSFGFWIDSGNGVVTVAPTLLLSWFATWDALPHGLGTLSPRFIGALGMT
FT                   FNWQMLYGTLLYFGNYVLQGYYRGTSGAYVAVVCVANGIWIAFPAWWMWVCWGIVESNS
FT                   FASLRT"
FT   CDS_pept        join(1028717..1030165,1030273..1031160)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638876"
FT                   /orf_name="MICPUN_62153"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO69855.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199CA10"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP5"
FT                   /transl_table=1
FT                   /translation="MAGAFPPGSLVDPMSHDDDYGGATVATITFDDHGAFGVELKASQG
FT                   RAGWKTSGLDTLLAPSAIPAHGAPFDATAPAVPLADAHDIVPERYRIRDVTHHALDDLE
FT                   LFHRAVDGDDDTWDVLLGAFEEHCLERGHRANANADLLDARRDDAAADDHHPDPADPTP
FT                   PRRPRASTSKSTSGDERVRRPEEAEGTTGQMLSVDRRCSDDDGSNGSTNRTTVRQSPSH
FT                   ADLDEAVRRWSVGEGDGDGGNRGSRDGGGWYESLHPAADADHQTYRNTFTCAFDDDAYP
FT                   FACATDPSTHQATRRIAHAPLEHDDDDDDDASPPRLIATAGTSAAGHASHVLRSLIFGK
FT                   GELRRGKTKTADRSKKVRRKPAGCGRAKRTRSGFSAKDAANDDVNGVGVGVARGRLADG
FT                   DDDDDANEEEEDAAGTFAARNPTRWVASESAAATSDAVDADVSAAIHAATQSGAKSGTI
FT                   AAMTRALSSLRNGIADELVTLSHTEARTVSAAMAADARAGRVNHRGLLFDDADTAHSSG
FT                   LSEPGRSIELFVGNSSSAVALRFRECRFRILRQFNRDAMRCLVAHCGVDAAREWDTGDV
FT                   VDPRVFNDSEGSVLERPPRAPLRLDQNFLPPDHQGAGEETTADRLCRTHSQTLTQLARD
FT                   APASLKASSGLLARKQLLLGGSDLGRELRAESSSPRRTKKKVAGSNPTQRSRANLTARK
FT                   QHSGEATEVLERWFWDNFYPTEQRPKPVPTREEKRALATATGLSERQVADWFVNARARK
FT                   WKPRMEQIMREVCGEVGEEGVEGGA"
FT   CDS_pept        1031328..1033505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638877"
FT                   /orf_name="MICPUN_62154"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO69856.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199CA11"
FT                   /db_xref="UniProtKB/TrEMBL:C1FHP6"
FT                   /transl_table=1
FT                   /translation="MAGEKPGFEWNVPEDRDADAAARAARMDPPAPRPPETVIHEGEDA
FT                   ARVIYGEVCAICRDDVTRRGRIDACDHLFCLPCIKRWAKIETKCPLCKARFSFIQPEDL
FT                   VPPDPESRPSTRGARAGGPQKELKRIYLPHRDQIYEGDGELPDGMDIEEVLCGRCGDGG
FT                   DEDKLMLCDGCDQGYHCYCVGLDSVPMDEWRCAICAVEDEDDDDGNVTTDHLHETAEDE
FT