(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_15

ID   MICSR_15; SV 1; linear; genomic DNA; GRV; PLN; 1084119 BP.
XX
AC   CP001577_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 12, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001577.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1084119
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 12"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        complement(577..4125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638941"
FT                   /orf_name="MICPUN_63350"
FT                   /product="Lipase"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO70423.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199C481"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH0"
FT                   /transl_table=1
FT                   /translation="MQCENCAKSRLVDTWMGAGNKRTKELFLVHAGWAQIRRRRIQSRE
FT                   TRGVVGRHGRGGVMASTCSMASTSFACGSRGDAAPFNPAGPRRTNYSAGLLYDGSRRGR
FT                   VRSYRTRGNRRTRPSTVGRASDDRTDALDGDSGARGSSVSVDTLDATGRGANEEDGQQN
FT                   EWWSWTKRWAVGDSDEDEDEDERDPSSDSIRAVLEAKEEEGEAVPFLERVPLPPWLKFQ
FT                   VDRVWKTGDEASVAVEASAGSTADERHKLEALADAVETLESPSSSSAADLGEISGRRAE
FT                   FVDQALRGANEASVKATEAALDKLSAALAAVEARERAVVATDAAAKANDVLKEKAAAAG
FT                   LDEKGEVVELESWEFPGPSSPVGDEERQRLKDLEDALKVARLKSEEARLASKALSKAVD
FT                   DVARVRAELESMGYQSEKERAGLQSSLGAAAERVKTASRASQAALFAAGAQIFAVVDMS
FT                   KEGVVGWVRGVTDKDSSSSNDFDIAAVTAPLVETAEAIELSSTIARITQWSAASAVSIQ
FT                   KIIAGGSISPDVGVAGSDFGGDKPMTAAEVGRMIQPALQTVVAQSLVPAGPQEIRSARV
FT                   ACSMAAWIYYLPTTHAALYRYGLRMVVSSLDQVKSQAGKPKDANNVVARTSSFTMAQME
FT                   EMKERVTAAADAAILELERATKLKAEDPERETAAREAAKQAAAAAKELESLSIIIEEKE
FT                   REKKAAREASSMFDPEGSSSVEEAPKPTPLKKMDFDPVKKGNNAADKSYIDRPLPVNYC
FT                   VAADDATGEIWVVIEGSTSLKSWQTNLTFQPVVFEDPTWDVRVHRGSYDAARAIYDRIE
FT                   QAVVDHVNAFGTDRARVHVTGHSIGGSLAALIALMLIMRGKVPREVINDVWTFGSPYVL
FT                   CGGEALLARLGLPRSFLRSVAMGKDIVPRSFSCYYPQWARKALEFAPGSLKVDTNKQPS
FT                   FLEEEMFYSPMGDMYLLQAIHGSAHPLLPSGPGLYVLEGDGMYEMLVERVIADEAGDGD
FT                   EELWLTKGRRGGSSWGEWTHDESSDSDSDSEEAIRIVSKGDESNRDAVTREAQTAWERA
FT                   VANREAKKKKKESRSRRKEDGRSRRLNRLACLTQSEAALTATLLLGSVESESLVSSDTR
FT                   EVMLQERGRDAAQRVLLNTPHPLTVLSDPRAYGAKGSISRHHNPFNYLRALGKTRRTWD
FT                   GGSSEVNFDSPNVGPR"
FT   CDS_pept        4219..5784
FT                   /codon_start=1
FT                   /gene_family="HOG000186273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638942"
FT                   /orf_name="MICPUN_87180"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="ACO70170.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG527090"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniParc:UPI000199C482"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH1"
FT                   /transl_table=1
FT                   /translation="MASKEEEAVDALRARYEAAGQGHVFAHWDKCDEGERDALAAQLRS
FT                   VDLDHVKKIFDRSIADHDAGAAAKGEIEPVVADASVLKASAEDLSEWREAGLGVASLGE
FT                   LAVVLLAGGQGTRLGSSAPKGMYDIGLPSGRTLFRLQAERLAKLMAMSSEEANQGAPVR
FT                   VPWYIMTSPHTHAATEKYFHDNEFFGLDSADVTFFQQGSLPCFTPEGKIIMQSKHEMAT
FT                   APDGNGGIYAALHASGVIDDMAKRGIRHVYAYCVDNALVKVGDPTYVGFCALRNVEAGA
FT                   KVIAKAYPEEAVGVFTRRNGEVHVVEYSEMPAELASATDAETGKIKFDAANVVLHYYSF
FT                   DFLKKCCAPDDVVQSSLVYHVAKKKVPRVTEDGAGTETPETPNGVKLEAFIFDVYKYAK
FT                   DVAFLEGERGADFAPVKNKEGTGKDSPDTARALIDALHREWIMNAEGSVDEDDDDGLGV
FT                   THADGKRYVEVAPAASYAGEGLEPVVRSYFMGFVPAGLSIEPVRDNKRAAENATDEDEP
FT                   PAKK"
FT   CDS_pept        join(complement(6800..6880),complement(5863..6702))
FT                   /codon_start=1
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638943"
FT                   /orf_name="MICPUN_95648"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70424.1"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C483"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH2"
FT                   /transl_table=1
FT                   /translation="MSVSTQAAFESGHTDQIHDCQYDYYGRRVATCSSDRTIKVFDVAG
FT                   EQQTLLANLTGHDGPVWMCAWAHPKFGTLLASCSFDHKVIIWKESEQGVFSAIYTSPAT
FT                   LHDASVNAISWAPHEFGLSLACASSDGCVSVITHRADGTWDAQKIQGAHSIGCTSVSWA
FT                   PAPPPGSLVAAGGASAAPVKRLVTGGCDNLAKIWRFDPSAGWKEEHQLRAHGDWVRDVC
FT                   WSVNMGLPMNTIASCGQDNKVFIWTQNEPGGEWNKTLLNDFGAPVWRLSWSVMGNVLAV
FT                   SDANNMVTVWKESVDGRWNQISATE"
FT   CDS_pept        7099..9549
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638944"
FT                   /orf_name="MICPUN_63347"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70171.1"
FT                   /db_xref="UniParc:UPI000199C484"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH3"
FT                   /transl_table=1
FT                   /translation="MEAVSTEVGYPPPPGEDRWEELCSMEAALEAEVSELRLTVASPTS
FT                   MTVDGGRSAEAEHERDENASPSRAVRSDAYWGSRGPRPVVRRADVAGVAPVREEGDYEK
FT                   RYDELQRFSPKPAVSRPARRGGRDAGAPVAQATGDASPIVERPKWGGKYDDDGLRVSRY
FT                   DFAYIVPKSNKSHQRASPSRGGARTKELSTPPPRTSVLSPANEMAKSWERNLRKGGGAT
FT                   PTRAPAVQRMSPRGWSRENKSNDAHREGDANVVAEVEARVQEKLRQLEERLLRSVGKMR
FT                   KPKKERTPSSKPRMKRKSDVSSDSDAGPAAAVPAAVPAADAADWTVAVEFTEPLSATDR
FT                   VAERSRLIEQGSSSGPLKDRPLRAVKNSIDEYLERRRKRREEEREAEREKERRALEAAA
FT                   GMRSESIDGFEPVYSPVVARRASARVNVSKMRDLDGGDEMTESEGGHRASSASPSSTFE
FT                   TSSSSSPSTTNIFDDDDFYQAASAATEVVHRRKLLAAVLEEWSFLVRWGRARAEAHRHR
FT                   HLKWASIKVLRALTADARVSSRVSERFHRSARRRKICAALRGWLFIAKDAKVRAARERR
FT                   RRAALGEWPSESGSDGDSDDSEPTEVLTEDDMEALRREAWMPLHDELKVLDAEENKLIM
FT                   EEREASSSEGGFSPENKAEFEKSYDDALKAVDIAVRGLIGLWQLATPEKPTPLGTRPRA
FT                   TPVVESHAPMTDPRRILKFDPLRVGDWLTNQTEPEVSSEEEEEEKEQEEQEGDVEQEEE
FT                   QEGERADFITPLGSAPPSGVRPYRVLTNEQGEAFVLTSSPDAGGSQHEYVSLTDWIEFA
FT                   SKSI"
FT   CDS_pept        complement(9598..10425)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638945"
FT                   /orf_name="MICPUN_52636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70425.1"
FT                   /db_xref="UniParc:UPI000199C485"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH4"
FT                   /transl_table=1
FT                   /translation="MASCVGRRAGSLSEAAATGAQTGTPQPPPPPPPRPKKRPNPRRGG
FT                   RGPGPACSAPGRHRPQPRDSARPSPPHPRRGRAPTGRRTGRSLLAPTGRPSGPNRRTRR
FT                   PLPTRKLRPDPRRPCSRTRCSTRPAVTLTRGARWAGRGFRPSRGVAAPRPSPSRPASNG
FT                   RNRWDPSEGLGPGSGSSWTTGRVRSTRIQTRRRTRRRRRRARRKLRAARCCPAAAACCP
FT                   SRGRRRRRPGSSAPGRTTGGGSNRGQGYRDVPWTSALPTTSTRRGKWTVTTRE"
FT   CDS_pept        join(complement(11825..11957),complement(11579..11655),
FT                   complement(<11003..11485))
FT                   /codon_start=1
FT                   /gene_family="HOG000065696" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638946"
FT                   /orf_name="MICPUN_86881"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70426.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C486"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH5"
FT                   /transl_table=1
FT                   /translation="MSADEDDNDAGEDCPLCCNPFDATDKHFRPCKCGYQICAWCWHQL
FT                   MELAAKDDKVAQCPACRQDYDESSITGASSGITIPAPNAAAIAAGKAAGADGGSRKHLF
FT                   NVRVIQRNLVYVVGLNVQYCREDVLRRGDLFGRFGRIVKLQVSLPKPGDFQRQGSAYVT
FT                   YHRGEDAARCIKGVDGTTLDGKVLRACFGTTKYCNAFLRYQQCSNPDCLYLHDMGSDND
FT                   SFTKEEMLA"
FT   CDS_pept        join(complement(14097..14148),complement(12443..13950))
FT                   /codon_start=1
FT                   /gene_family="HOG000265377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638947"
FT                   /orf_name="MICPUN_107179"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70427.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG380809"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019382"
FT                   /db_xref="UniParc:UPI000199C487"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH6"
FT                   /transl_table=1
FT                   /translation="MVRQFVVYFYRHIREKNVYEILSMYEKSFSAISERYFKASSWPSA
FT                   EAIARYADNDHVFGLLYKEMYFRHVYGKTTPTLDQRKESWENYCNLFGVILHGNVNMQL
FT                   PNLWLWEMIDEFIYQFQSMCQYRGKLSVKTKEELAALKGCDDVWSALGVLNFLQALVDK
FT                   SGIIAHLDKERRGEEKFSDTEGYDYNQSNVLRTLGYFALIGLHRVHILLGDYTTALKVL
FT                   DPIDLDKPGIFTKVPGASVSTAYHVGFAYFMLGRYTDAIRHFNASLVFINRHKVAATRP
FT                   YALDILLKKQEQMYALVAMAVSLGGAASGGGANARSGVVRLLEEGVVSALREKHGDDMA
FT                   RMGQGVVSAFDELFSLSCPKFVTPAPPAGSAADAEGAAANYNEEAYRSQLKQFLQQVSS
FT                   YEKLPALRSYLKLYTTISVGKLAGLMEVEAGALKAQLENMKAKSRLVEWKGGSSALDGE
FT                   EVSVSDVEFTVDGENIAVHDVKPVKKNGDFFLRHIAKQNELMEDLGPAKPLVYKGKPVA
FT                   SA"
FT   CDS_pept        join(14612..15274,15338..15822,15862..17593)
FT                   /codon_start=1
FT                   /gene_family="HOG000191945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638948"
FT                   /orf_name="MICPUN_87130"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="ACO70172.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG434190"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniParc:UPI000199C488"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH7"
FT                   /transl_table=1
FT                   /translation="MSAQRSFVKKTKAGRVMKVVREHYLRDDIYVGCELATEEYRGPDQ
FT                   STWKLSPGASKFIVIDTNVALHQLDLLAHKSIADVVVLSVVLEECRNRSKSSYDRLRSM
FT                   CQDPTKRFFVFANEHHRDTYIKAEPGESPNDRNDRAIRVAAKFYQRAIPSKRIVLLTND
FT                   RGNLLRAKEEGVDALSVRQFAREHAADAPELMDLVAGNDIDDEDVAAAAADDAPSAKRI
FT                   FAEHLSASQMAAGIKGGTLHQGSLRTGRFSPWEGYVGSDAVGGDIMIVGRTDMNRAMDG
FT                   DVVAVELLPESEWRRPGTKIAKPGEEHKDDKEDDKEDDKENETVSLAPAVAEDADDGSA
FT                   VKAKREDGVVPTGRVVGVVKRNWRERGYAACIDLGPGAAGAAAASRLLAVPQDRRLPKI
FT                   RIQTRQAAALVDQRIVVVIDSWPADSPYPEGHYVKSLGKLGDADAETAAVLLEADVDDR
FT                   PFAPAVHACVPPLPWSFDERTHLQAQPHREDLRNLRVCSVDPPGCRDIDDALSCRPLDD
FT                   EGMPGMLELGVHIADVTSFLHPDTAMDDEAKRRGTTTYLVQRRLDMLPKPLTEDICSLR
FT                   GGVERLTFSVFFRFDAKTGLPVPGVEPRFTKAVIKSAAALTYAEAQTMMDDPNDTSPLA
FT                   NDLRRINACARSLRKRRIDAGALTLASPEVRFEMDKETNQPLDVGMYVTREANQMVEEM
FT                   MLLANVASAERILRAFPSHALLRRHPTPAPRMFDPLLKACRAAGVDVDVSTSKKLADSL
FT                   DAAVRPDDQYFNTLLRIVATRCMSQAVYCVSGAHSVNDRVHYGLAAPLYTHFTSPIRRY
FT                   ADVVVHRLLNAALGLERAHASLQDSEALKAVSDNINVRHRNSQMAARASVELHTHIFFR
FT                   KKAAETEARVIRVRANGLIVFVPKFGIEAPVLFDDEEEEGDKKAVLDEEAMTVTTKAGK
FT                   TWKVFDACKVCIQIEELAAGRSRLAIKIL"
FT   CDS_pept        join(complement(18269..18687),complement(17770..18181))
FT                   /codon_start=1
FT                   /gene_family="HOG000265378" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638949"
FT                   /orf_name="MICPUN_63343"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70428.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG558053"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000199C489"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH8"
FT                   /transl_table=1
FT                   /translation="MPSPKKQQQQQQQQQQFQAQNYVATYFSIDVECVATGNEHNARDV
FT                   AQIALVDQFERCLLNVYVKPPEGKKVHSYLTPLTGITEDVLSAHGVPLEDAMQHVRAAL
FT                   PPHAVLVGQNIAKDVEWLRLEEGKDFTSLVDLAGLCCVDTRTRFVRSVLDIFSFFLTGT
FT                   HTCGFDSTVWRVWNPQYKSWSVFSQDHLVKTLLGSDVGEQHNAALDALKSIRLFNYFNY
FT                   LQSGQGGGEAALDAVKQKLLESPPEPSFAKKNPSWEGVCMGNRKTCTCGAPFFG"
FT   CDS_pept        <19197..>20462
FT                   /codon_start=1
FT                   /gene_family="HOG000200890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638950"
FT                   /orf_name="MICPUN_68581"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="ACO70173.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="HOGENOM:HBG610491"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI000199C48A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIH9"
FT                   /transl_table=1
FT                   /translation="VERGVPFTRKRAFYRVESAQARDLAMLLASVHSDEAVAASSSSFR
FT                   DRERISGGVSVLDAMSGCGVRCVRYLLQGEVSSVHANDADPNVMDTLSENLTSAHARGA
FT                   TGVSSVTNVDAHRLLAKCYLDEARYDIVDVDSFGSENLVSATMRCVKLGGYAYLTSTDA
FT                   LALCGKSPGALSANYGGAIVAPNTQGVNELGLRVFVGDAVRIGAAMGLKVTPVFSLFHP
FT                   HGPVFRAMLRVEALAGEWERGSVGHVGRCRECGDARVIDPGELGGAFCHRCDAIRAFGR
FT                   DDDGSTDGAMDRRSCLEVSGPMWLGPLHELATVEKLRSKAAEKGWIGREGASAEDGAKV
FT                   KGQMSLEALLGSFAAESDPRLPPFHHRTDELGRSGRGLKRGIPAMKAWVEELKSRGFAA
FT                   CKTHVDSRGLKTNAPMEQIVDAA"
FT   CDS_pept        complement(<20667..>21911)
FT                   /codon_start=1
FT                   /gene_family="HOG000018073" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638951"
FT                   /orf_name="MICPUN_68035"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="histidine-tRNA ligase activity"
FT                   /biological_process="histidyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70429.1"
FT                   /db_xref="GO:0004821"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006427"
FT                   /db_xref="HOGENOM:HBG616575"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniParc:UPI000199C48B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII0"
FT                   /transl_table=1
FT                   /translation="VDLEPASGTRDFYPEEMRLQRWLYDHFRNVGTLCGFEEYDAPVLE
FT                   RQELYKRKAGEEITQQMYSFTDKEGVEVTLRPEMTPTLARMVLGKAQSLMLPLKWYSVP
FT                   QCWRFETTQRGRKREHYQWNMDIIGCKGINAEVELLAAIVLFFKNIGITSKDIGLKVNS
FT                   RKVMGAVLKSMGVTDEQFAPVCVVMDKFDKIGPEETQKELRDTQGLDADTAKKLVDCLL
FT                   CKSVDDLAALCGEGVDRSGVDELKRLFELANDYGFGDWLVFDASVVRGLAYYTGVVFEG
FT                   FDRAGELRAICGGGRYDRLLSLYGAVQEVPACGFGFGDCVVVELLKDKGILPDLPKEVD
FT                   FVVAAFNEGMQGSAMKTASLIREGGAQVDLLLEPKKKVTQTFDYANRVGARYMVFVAPS
FT                   EWEAGKVRIKDLRLGE"
FT   CDS_pept        complement(22355..24265)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638952"
FT                   /orf_name="MICPUN_63340"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70430.1"
FT                   /db_xref="UniParc:UPI000199C504"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII1"
FT                   /transl_table=1
FT                   /translation="MAPATMIQTPLRSGRTGDLGGNLARIDRELRRIRFPVAFDEDGAR
FT                   EGSPMALLPALHYAMLGFSRHVTRSLSDEGHDLQAKSDSRFVENAWKALRESFHYNPTL
FT                   TPTQFLSPGFAERKLLLLADAIELCKRRHNEHARAARAADVKAVVAKEGGPRVARETRV
FT                   KDTADGGRAEERKQRTPGRPIQIRRDPPANAATLARGVANLRVSTEDNEPRTAENSDDD
FT                   DDDDDDGNFEFRPSPSPNRSRPPLADLAASGDAPPWFARSAALRSQASSIAIDPTHDER
FT                   DSFTVRESRESARADERLEGPTEESASDRRGDTANLSPGGEHVEPAMRLGSVRRSGGFP
FT                   DENDPRTTAPTTTTPAVDHAPAIETLRVELIALVSRVADAEARAADAERRAAVAVDVAN
FT                   NAERRASMAEDAAADARKECDAIAQRVAAANAGLAEHGARAFLLEGRVRILEESARRRH
FT                   DDVDDVADDGGDGAKRPASEGAPATNDDDEAPAIAPAAAPTPPRSPRASAGGAIAAVEW
FT                   PNVRDSPWAYRSPPNARSSVRDSDQSYFAPPTVAGVAAGVFADDDAASDWDATVNSSAE
FT                   WGEASPIRSAVKGSRAGGVGAGRDARDAKPPGIDAGAFVDYYSKLLSTTEETLRKTKGA
FT                   E"
FT   CDS_pept        24469..24774
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638953"
FT                   /orf_name="MICPUN_63339"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70174.1"
FT                   /db_xref="HOGENOM:HBG607543"
FT                   /db_xref="UniParc:UPI000199C505"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII2"
FT                   /transl_table=1
FT                   /translation="MEIVPPSYTGDPNAARCSESAFKYGFYCFNAAVAYDRIGMKNLMD
FT                   FGHAFSGDTLIAIAEEVRARRDVANGVEPKSKRERLGEYAYRRWARWRKKRMVNKL"
FT   CDS_pept        join(complement(27045..27101),complement(24902..26941))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638954"
FT                   /orf_name="MICPUN_63338"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70431.1"
FT                   /db_xref="UniParc:UPI000199C506"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII3"
FT                   /transl_table=1
FT                   /translation="MTTNTGTGTMRMVNPLVSQLVDFAHARSANARATVQPSILGATHS
FT                   HMHPDTASSDLYERFEAMCAEVERDGFVDRDFRPYVPPRGPGTAPPRPPTKSIEVAALF
FT                   DARVQVGDQRGRRGKAVWSDKSAPPKKGPLRCLFDDYAARDDVYDLDDTNDKPSLMSRA
FT                   EAFQLAHDFDIVPGLLRRRDVAMAFANADRPAYGDDAADNRENQLDFDEFVSFVCQMAT
FT                   LAWHRPAGAHERKTDRKDGSSLSTGRGRGEEGGRGASLDDARAVDAMLKKLECDSSDVA
FT                   ELKRRLAVYARRQIHNPRDLDAYPRYDKYAHVDAVGTIRPHAAAIERVSGGAPVPSEMI
FT                   ERATRRDSRPADRPRWTHFRHTAIDVGTLLPGQTRRFRIVVKNRNLQGSVSVHVECHGC
FT                   PATEVRFTEGGLAPGMSKCVDVVAGSDTAGEWLGCVVITAKPLATRVYLMRAGERATAM
FT                   RRRTKNRDEEFDEGERSDRLDEFLDGDEEEEEEEEEEEEEEEEEEEDDFDAMSSERLGT
FT                   HVVRVPVYLNVVGHHRELVTRAGATVGFRQHVEAASSVATIYPEIHRSFRADPGGDATA
FT                   AERLAMPAPVMRCVAPRGTYRKLAELPPDARDDATALYPDFLKPVMAGVLTARTNKAGN
FT                   VVVPERGPMAFGGSVVDAVADAEAASRFATAASRVRGEVGGDPVGRNALDASGYRLSSR
FT                   GLCY"
FT   CDS_pept        join(complement(28264..28405),complement(28104..28166),
FT                   complement(27309..27982))
FT                   /codon_start=1
FT                   /gene_family="HOG000265763" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638955"
FT                   /orf_name="MICPUN_63337"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70432.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG557788"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C507"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII4"
FT                   /transl_table=1
FT                   /translation="MLPNTRDFPPLTPFAASVVEGKRRLPLSDTENLMVGAFGGTLECA
FT                   VQMPLITLKICQQSKKPFPTTIGGWFRGVTAAAAPLGPITAVQVAVNGAIERVVTGGDR
FT                   DPTDPERVGVAMAAGAVSSVLYSPVDLVVIQQQKLGLDSPGATISAIVKEHGASGMMRG
FT                   FWSCVVREAIYTAGYLGLAPIAKDYLTGNVEYFKSNDLAASIVGSSIGGTVAAVLTHPV
FT                   DTSKTCAQSDIAGVKYPNARTALGMVYKDGGIGALYGGGLARTARLCGAFFIINNIREA
FT                   AIDWKTARAEA"
FT   CDS_pept        join(complement(29744..30556),complement(28799..29662))
FT                   /codon_start=1
FT                   /gene_family="HOG000015213" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638956"
FT                   /gene_name="AE_5"
FT                   /orf_name="MICPUN_86990"
FT                   /product="Anion exchanger family"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70433.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG318202"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI000199C508"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII5"
FT                   /transl_table=1
FT                   /translation="MPNGKVEPDWKTGADGEAEIQCCVGFGAGIAKDFRRRRPLYGDDW
FT                   SRGTGVGLKIFAPATYIFFASVLPALTFGEQFREETQELFSIPHILCATAIAGVLQSIF
FT                   GGQPLLIVGVAEPIVLVYYYMFKYADGQSDLGPELFRPFCTWVLIFTALMHFVLAFANA
FT                   SEYINAFTRFSGETFGTLIALLFLQAAVKGLKDEFKEPHDAPVAYRMVNGIWSVFLATA
FT                   LVLLAIFLMGARKWHVGRPWLRALIADYGAFVAVIIITCVSYAVEAPDGHLGDVPAGQV
FT                   AVALIPALIITVLFFFDHNVSAQLAQVDDFNLEKPPAYHYDFLLQGLNTLLLGLLGLPP
FT                   TNGVLPQAPMHTRSLMGVGQDRSKPGAADIVLEQRMSNLIQSMLVGICLFISPVIKLMP
FT                   RAVLWGYFVFMAIESFPGNQFIHRLTLFVMDIQSLRRGESQPAYVDLVPMRDTQKFTVI
FT                   QLTALGAVYGVTWAGVYGIAFPLLIMALVPLRQHLIVKWFPAASLRHLDTAEDVEEIIE
FT                   EDGPNVDHKLDKFSGGGVLDGAGAFVQKKHEAPVEELMNRK"
FT   CDS_pept        join(complement(31383..31548),complement(30917..31167))
FT                   /codon_start=1
FT                   /gene_family="HOG000200513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638957"
FT                   /orf_name="MICPUN_52633"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70434.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG621898"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="UniParc:UPI000199C509"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII6"
FT                   /transl_table=1
FT                   /translation="MVKSVVECSPDLTWALVAKNNVFIRRSRSATRQKCFRSFSAEPTN
FT                   LTSEHKFKYSGIAASTPVGVNAFKYPADYSKKKNPTAVAVTVGDKTSKVAGIFQQQAKA
FT                   VAGAVAAARPDLTVPALAKLSSVQRGLRVAAKAQ"
FT   CDS_pept        <31787..31993
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638958"
FT                   /orf_name="MICPUN_86820"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70175.1"
FT                   /db_xref="InterPro:IPR022214"
FT                   /db_xref="UniParc:UPI000199C50A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII7"
FT                   /transl_table=1
FT                   /translation="TTMDNVAVYQAKETLDIAHEISKLLDCGLDKESLAILIALCENGV
FT                   NPEALAAVVKELRREAAALQADA"
FT   CDS_pept        join(complement(35490..36808),complement(33611..34835),
FT                   complement(32243..33097))
FT                   /codon_start=1
FT                   /gene_family="HOG000265379" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638959"
FT                   /orf_name="MICPUN_95643"
FT                   /product="Predicted protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70435.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG557810"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="UniParc:UPI000199C50B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII8"
FT                   /transl_table=1
FT                   /translation="MGYFRYPHLRGDALVFVSEGNVWFTKKSGGAAARISASYSVEALP
FT                   KLNEDGTLIAFLAESIDGYEVFTLPVAGGVAKRVSYGSAAVRLEGWTREGKILVVTSFF
FT                   SPTGLAQLAEVDPDTSEMTVLPFARASGGTQDQDGCYVFYPLRQTSATKRYEGGEQSRL
FT                   WRWCDGDDEATLLTPESWSKRGAWSPVTSPEFPDQIFFISDHSGVANAWVMNKDGSGKR
FT                   QLTNSCDMDVMEITIDGKDGIARIGGGLHKFRLDAAELGNEKELEGAILVEAPHEISIT
FT                   LTSEFRAAAEQKIFAPLEELRELALSQDGFYAALVIRGQIFFTPLLEQLGTRIEQVTKH
FT                   DGAVRYRHVQFVKSDSVSDNMKIIAMSDASGEYEYVLLERQKGGKKGAPWTETQLTKGG
FT                   KIRGVMSYSDVSPEGTALVFDDTYGKISVLNLTSTAVNTAKPEAAGDYSWSPDGKWLAF
FT                   SASDASEFSCVHVWNVETGETQRLTHPSYNAVEPKFSPDGFFLYYFSDQQIESEAGSPY
FT                   GARGGEPSYLGTQQLMCLPLREGFKCPFFKGDELNVAGQLFDPAVGKQIATKIAMNNIE
FT                   KRAVPVPFLEKKQYFGLHIIGQGNTFIMQMWDGIGFYLVAMDIITGTVLPIYPDPIGVY
FT                   VSGDNSVVMIAVEQGLALFSSDAIATPGVAQDQLLASAVVWAPPETWTVTINPRAEWMQ
FT                   MYNDAMRNMRDAFYDPNMHGLDWEGITEMYRPLVYRVSTKSELRDVLQQAFGELSVLHV
FT                   FVSIRSEAVTLPVGEPSACLGGNLRKTDRGLEVVRVFDTSGILGAPDSPLSAMAVDLRP
FT                   GDVITRVDGEPLNATGALVSRSLLGKSGMQVLLEVDKVGGIQNVVVTPLSHWECSTLRA
FT                   ADALNARKNHVTSRSNGDISYIYLEDMEQMGEGSSNSFDDFAAQFYPAIRKAGLIIDVR
FT                   RNSGGNIDTWILERLRRVAWMFNTERSGPGDTTMQYAFMGKVAVLVDEMTSSDAEIFAA
FT                   GIQRLGLGKVIGMRSWGGAVGYSSNPELALVDGSGFTIPSFGPYAGDRWMIEQQGVVPD
FT                   IVVENPPVASFNGHDAQLDAAIDHLLKEITEVKGDEVIPAKPKYPDWSFDREVCKSGGD
FT                   GSKRSRDARALVMGTTKVDAEEVVA"
FT   CDS_pept        complement(38575..42066)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638960"
FT                   /orf_name="MICPUN_63332"
FT                   /product="Nucleosome/chromatin assembly complex protein "
FT                   /protein_id="ACO70436.1"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI000199C50C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FII9"
FT                   /transl_table=1
FT                   /translation="MSAKKATPQKPAAPITSFFAKAPSPSQHAAVGMKGAAMAEGDKAT
FT                   VGVKLNFERPPSNEPSNKDSRSPLRTLDNAAPATEPKSASGANRRVSDGPSEGVAASTR
FT                   DPAAAPTAEGSPVSASVGDAHFMTPAHALRARDEDATPEDTPATVRRLARSSDAPGATI
FT                   FKNLNPNPPRGAPSSFPRGDRHRPRDPNATLTPRSPVPQALDPRAAPAPRPGADFAEDR
FT                   EEQDRVTSSAAKASSANLKTPGFGQSAVKSSQGGKHGQTPSEMAKMADALEKEAAAEME
FT                   RLADDAKRAAATADADKDKPTTEPGRLLKRARRARARAEKAAADEELRAKAAAEKEAAR
FT                   AAKEQEKAEREKEKEVARERAAKEKAEKAARIEAEKAAKAEKLARKKAEKEAKLAAEKA
FT                   EKEAKLAAEKAEKEAKLAAEKEARAKALEEAKAAKAERDAKLAAEKAQREKEREDAKLA
FT                   KEAERAKAEADKRAATEAAMAKKNKQKNQFASFFAKAAKKTPEPEAAVVAPPVPAAALD
FT                   EKRGDELVDAVLTGGNTLGGNNDASSITAFLDDARARWRRGRATRTSGDRWGARRVPKR
FT                   RRDEGLLGSDRALQDAVDASVIHSVGTHAQPKRRKLISVQCSSHVVVDGACVQEGSYRH
FT                   AFQLGPDALSPGGTDGTPRESFAKTFPVDGGRPPFWGSGTFPERPGSVSTAVTGRRPFA
FT                   RDPNVEYVTTDGEHFDSGDEWEEVEEGESLSDEDVDEDEGEVVSDEDEDGFVVKDGELS
FT                   EGEGVKDVEWGDDPMDLADADFSDEDEPTEADPAAPGAPDSSGFRDRTLARLVQWTKQA
FT                   RRRHQPLVIAGFVDQAGVDEPAGAPEVDPQAADDSGSRRDVLRALAPVRFRPGSRAVIR
FT                   VYDPTVAVNDDAGADAPFSAGKKRPNAEDGGDGGERVRKERSEFPDDLVKPLVEFLLAN
FT                   PKLQSKGAREGFLETSTANGSRPDLTKAAVQRKIADVAEYRLKAPQRWEVKVEVLASVG
FT                   ITAEEADAIRPKDESEFPDDLVKPLVEFLLLNPKLQSKGAREGFLETSTANGSRPDLTK
FT                   AAVQRKIADVAEYKGRRWEIKSDALATVGIAPEAAEAMRPPLTPTKAEKAAAERAAKEA
FT                   ARDAIKAENMAKAFAANGGAFFARVTSPKQAAPERPAPPAGPVGDPQSGSGGAGGV"
FT   CDS_pept        42334..44208
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638961"
FT                   /orf_name="MICPUN_63331"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70176.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C50D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ0"
FT                   /transl_table=1
FT                   /translation="MTVCSVGICLRLSMWPGWHRNLPSTSEGRNNRIGHTIDMSGFATV
FT                   GDGGHLSSGSGSFSATRRAERRERRERERRRKGAAASDEAFGGDDVALAEAYSAARRDD
FT                   VPELEDALQRGVMPRATDADGNTLLHAACARGALRAAKLVVRWAVYSTHPPDRNFLNLQ
FT                   SAEGFTALDLARAGGFRKMEEWLVALGALGRGGTGAGSLAYDPSGARSTGPPGGAYGGH
FT                   HNSHHNPYNPPGGWTHPGMPPPPLPYGSSAGGAYPAGMGYPGHVAPTHVAGRHVSSYEP
FT                   YVPSNAWGEDPGALDRSLARAAGAPGASSSSDTYLMGALEAALGGGPDDDRVGQASEER
FT                   RRAQAVVRQVAEAMEERDDALDELDETMEKMRRLEAALADAEARAERAVRDAKAEVASQ
FT                   REDEQKAVLSALGLAEERAVQMAAECETTREERDAIASALDFVNDEMENLRARAEAAEN
FT                   ALVHRREEDYRAGFAAGLMAYREELGLPAIGAIEAAAAAANAKTPFDDDGPRAGGGNEG
FT                   SGVGDPTGHEGVEYTATVADTPNESSSNSDADSDADIPVAELAASGAPNNAPDQNRSSL
FT                   TPAGAAALARAHERRSLSRSQSLEKGAAADAAANALGGLELFEVPLCE"
FT   CDS_pept        join(44412..44446,44819..46571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638962"
FT                   /orf_name="MICPUN_63330"
FT                   /product="Tubby-like protein"
FT                   /protein_id="ACO70177.1"
FT                   /db_xref="InterPro:IPR000007"
FT                   /db_xref="InterPro:IPR018066"
FT                   /db_xref="UniParc:UPI000199C50E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ1"
FT                   /transl_table=1
FT                   /translation="MEGDGDEGRPMGASKLSRRPAGQPPAQPIRPVSANTFNGAQRPGT
FT                   GGGRPQPRPPSARTYHTDLFDEEENAGGAGDVLAGNNSISAAQKLQQRRELAAQKRRER
FT                   QLAAGTVTRNPAAGAPGGGHQTMTAHQTRPRPPSGGGSMPPPSAAVGANPYSTPRSNPL
FT                   FSGQHAVGGMQQNPLAAMNGALNQPSAMNHGSTNQPHPPAFDRHTMAMYAERRSFNISG
FT                   DGHGAAQQRVPDGRVRGFDEPETDFGVGHRRQRQAPEPEGVAELRRDLEAHGLADEFDP
FT                   NEGRHPMEVAAERERLKRIEAAAKLGPKAKRIAERPKAARVDASDKRVFLTRPGPEDAP
FT                   VQCHIVRRVNKGFLPGSNYPEYFLYLDGPGAKPGDPTNEAKFLLSARKRKKSKSSNYVI
FT                   SLDEEDMARQSGNFFAKLRSNFVGTEFTIYDKGSKPGEKPDGKSAGLAPREDLGAVTYE
FT                   YNVLGTRGPRKMKGFIPRVDLTSGERARFVATTRDGAHGILDCHKHGRRDDLIVLTNKS
FT                   PRWNEQMQAYCLNFNGRVTHASVKNFQLVDECDEDERVVLQFGKVGKDMFTMDFQWPMS
FT                   ALQAFAICLTSFDSKLACE"
FT   CDS_pept        46660..47136
FT                   /codon_start=1
FT                   /gene_family="HOG000100803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638963"
FT                   /orf_name="MICPUN_63329"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70178.1"
FT                   /db_xref="HOGENOM:HBG557837"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199C50F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ2"
FT                   /transl_table=1
FT                   /translation="MAPRPDLDVDTVEACVASTRDGPLRVQPSLIPGAGLGLFTAKDVL
FT                   AGTVLTGCSYGGDVLTFTQARALPPDAKDYVMALHFNVHVDAANHPGYLARYINDNLTD
FT                   GGRHRNVRFVKDPARRSATVMATRDLRAGEELYAEYGDGYWRRRGSTETGRRDA"
FT   CDS_pept        complement(47193..49133)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638964"
FT                   /orf_name="MICPUN_86812"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70437.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199C589"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ3"
FT                   /transl_table=1
FT                   /translation="MDADDVDDIPPPPSAALVDVLPYLYRVSVAQRGTAIRLAFAVSAM
FT                   LVQKSTGLAVPILFKVAVDRLTDAAMASGVGNDAAVALALRAAAWALVASGTFKAISGL
FT                   ATELRSVAFTPVAQAAGRRVALQVFNHVLNLDLSFHLDRRTGALQRIIDRGTRSITMVF
FT                   RAVVFTFVPTMVELALVCFLLWRAFSWHVVAIVLSTFVLYVGWTVRMTGVSAELRKIAN
FT                   KMDGITTGKAVDALLNYETVTTFGNVKLESDSYDQLLRSYHEAALGSERASSALNAGQA
FT                   VILAGGMTCVLASAALGIGRGGLEFVGPISTRVGDLVMANGLLLQLWAPLQFLGFFYRE
FT                   LRQSLVDMEAMFEVMSTTSAIPDGTQTLPAKEGGARVTLRDVSFTYGGAVGGRKVVKNV
FT                   SLDISEGQSVGIVGPSGSGKSTLLRLLLRMYDVTGGSVEVDGVDVRNLRQDSLRSITAV
FT                   VPQDTVLFNDTLRHNLRYGRAAASEEEVLKAASDARLDGTLAAMPDGLQTMVGERGVKL
FT                   SGGEKQRVAIARAFLRSPRLLLADEATSALDTATEVGILQSLQEVAEGRTAVFVAHRLS
FT                   TVRSCDKIVVMEAGSIVEQGTHAQLMDGKGEGPKSGLYASMWASQQAEIEEEARVAASK
FT                   SNLGVFSEVET"
FT   CDS_pept        50688..52214
FT                   /codon_start=1
FT                   /gene_family="HOG000277902" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638965"
FT                   /orf_name="MICPUN_96701"
FT                   /product="5'-Nucleotidase"
FT                   /protein_id="ACO70179.1"
FT                   /db_xref="HOGENOM:HBG590028"
FT                   /db_xref="InterPro:IPR008380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C58A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ4"
FT                   /transl_table=1
FT                   /translation="MQHITAVGFDMDYTLAIYKPETFEVLAYTLTCEKLVNVYGYPREI
FT                   LEYRYDHEYMVRGLVVDKKRGNILKMDRHKYVKVARHGFRPMDAETRIKTYNATTSPGG
FT                   VDRFDGANYANVDTLFSLGETYLFCQLVELKERLIERGAEAGGLTEAETALTTKPFIDV
FT                   YSEIRASVDLCHRDGSLKAAVADDPEKYIHRDDALVPMLEALRSAGKKVFLLTNSLWDF
FT                   TNVVMNHLVHGASGEDKTAEWTELFDAVVTGSCKPGFFENERAAIFEVDVQTSALKNTD
FT                   DGAPMTPIGASAAASQADAFLATAGARAGTGKNDGVAMHAKAYQGGSYRHLHSMLGVSS
FT                   GAQVLYVGDHIYGDILRSKKTLGWRTMLVVPELAHEMECLERAVEEDTPGKLRDLRRRR
FT                   TALEDALQLAEFQMSVEKTMDDDAYDALVKDATEARLAHREELRRMHAEFHPIWGQMMK
FT                   AGNQNSRFAHQLERYACLYTSHARNLLAYSPAKSYRGLSDAMPHDMDENV"
FT   CDS_pept        complement(<52684..53413)
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638966"
FT                   /orf_name="MICPUN_71370"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70438.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199C58B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ5"
FT                   /transl_table=1
FT                   /translation="MPISNAEREYIVGGVVDDLRNDGRGRLDYRQITIDLGVVPQSSGS
FT                   ARVRLGIIPGETTDVIVAVKADIGTPPKDNPTHGRIQCAVELSAIADVDYMGRGGETLG
FT                   VELARALERSLTGQTTGGMGSLADAVAGERGADARVSKHGPGAALDMSTLGIQKGKTCW
FT                   LLQCDGVVLTSDGSVLDALSIATKCALADAKIPKVTAVAGPDADDPAELELDDDPAACS
FT                   KLDVSGVPLIVTCVGVGKFIL"
FT   CDS_pept        53745..54815
FT                   /codon_start=1
FT                   /gene_family="HOG000194860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638967"
FT                   /orf_name="MICPUN_63325"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70180.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG628558"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000199C58C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ6"
FT                   /transl_table=1
FT                   /translation="MSMDYGPATVRDRTKEFAAAAERAAKSSGASSIGGGEGGLSSSGI
FT                   DGAGASSSTGATSEFARMSARIGRGIHATSQKLERLAQLAKRSGTFDDPSRDIAELSAV
FT                   IKQDITALNSALAELQTFAARTQETKQGRDHSVTVVDTLKSRLMGATRSFKEVLTTRQE
FT                   VVKEQNERRARYGGTSATAVAPANMFRRADFGVGRSHFPRATHQTDGAASADGNNSGTT
FT                   GRFQHRGGVAQAGGLPTHSGRGGYATGDDQTQGQLLVAHGQDQYLSARSEALQNVERTI
FT                   TELGGIFQQLATMVAEQGELAVRIDENVNESVANVDNAQTQLLKYMNSISSNRWLIMKI
FT                   FGVLISFLVFFVVFVA"
FT   CDS_pept        complement(54942..57113)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638968"
FT                   /orf_name="MICPUN_63324"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70439.1"
FT                   /db_xref="UniParc:UPI000199C58D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ7"
FT                   /transl_table=1
FT                   /translation="MTTEPTETEALLKKEASPSPEPAAKSARVGGYVKAGLALAGVIGV
FT                   CALGAAFQGDLRVAYRMAAGDRTASLAGHAGSTHRYISHSNRPGGLFNTCEGKCPAVSV
FT                   DFDAVGNEPGHAADRKAHLYVIGDTTDRLWHDGFCNDMLTSTERCPYRCAVPEPAALPG
FT                   NVVPYMCDDPASDTCAAEIAAVDRCCESKWMPNGAKAYQCCVTTAQATTATACRPRRYA
FT                   TGGGTAGFLHVLGAAPEGVLGDSYFSARDSTDPPPLGSFQSYASPDATRDRIARGLRAF
FT                   VRWNLRDGAQPRPIVTSIQSNAQETWREAAGRARLVAREVGETRDGDDVNVFASKSEED
FT                   AFVASYADGLRAAIRQVRNILDEENVGEEKEWESGPLEELPMAGDNARLAAVGYQPSSS
FT                   REAVTAVTATQQQQPATQQIAVAPHVDKVPAPGEPIVLVSPEDPAMSQAERDAAAKKLE
FT                   EDTKYWAELQRSADAAMDPASRHILRGAVGERAPGDPVSAAAANAAAAAAAYAAANAGA
FT                   AASLGAIPTELMRSNGNMGSDTDIRAERIVLNPGADADAMQRAFANVEKAEQARLAGHY
FT                   VGTRGDEDDDAASDASAAGAGASASGAGQSAAAPAPHVAVGNSGSDCVVLRTADAKEAG
FT                   PTTIGVPSSMRESVERLRRRLNDATVGVGEEMNVPVYRWDERNEGRVIPGLGQYMEDGH
FT                   HQTFASSMAHVRLFKQFVGEKLPAHCRLA"
FT   CDS_pept        57362..58828
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638969"
FT                   /orf_name="MICPUN_63323"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70181.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR010585"
FT                   /db_xref="InterPro:IPR014751"
FT                   /db_xref="UniParc:UPI000199C58E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ8"
FT                   /transl_table=1
FT                   /translation="MAATAEREEETIVERTLKGLGVDNGPDGRGDDPPPELLVKVKWRP
FT                   ETLDFDLRVAGDVGGDGTGDGTGDGAGRDVFFTAMNVRAPPNAPGTAEEWYTRARQALT
FT                   GPKWRAHRHFSFTLDRAGAGASTEATFKWSWHEPTCRTDPMPACVTAAAKGTRRIGVAR
FT                   MRGEAFVASNRHRIFASFATKQLETRDERLAQLERECESLRNTLHTARCDLERAVEFKE
FT                   AAERDNTRRFAVLLNAQKVRLREQHELLEAARAENDDLRARVEETESPGDEGTDDGGES
FT                   EPDTDEEEATAATFIARANDRLRQPTAAVHRRGSKATSPAARAAKRVRGFADDASHQPP
FT                   RAGSSQPPSQKSARSDKGVGDARNQSQNQNQSLHPLDDIFGSFGIPPAGGDVAGSIPGA
FT                   AADDDFGVDADVSQTLTSASARLAGGGVGGGVGGVGGSAGASRRTSAAAAGGGGGGGGG
FT                   RGGRGRGRPRQAGGKNPLEDINSLLGDDGI"
FT   CDS_pept        complement(58907..59449)
FT                   /codon_start=1
FT                   /gene_family="HOG000265367" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638970"
FT                   /orf_name="MICPUN_63322"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO70440.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG412287"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="UniParc:UPI000199C58F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIJ9"
FT                   /transl_table=1
FT                   /translation="MASPCGTPAPAEPPLDPRIAWANSIRKIVTRPDAINEDGSLNQQF
FT                   FKPKKVVYAAEKAKWNDDDKENLYKGIEKFGIDPSSWKKIIEEFCPGRDVLFIRIKASR
FT                   LIGSQGLNRYHGWIGTKAEVEAEYERNKAIGLATGCWKGGILVENDHGDAMKAIRERDE
FT                   REAAEGVAPPGKRTKHN"
FT   CDS_pept        join(59594..60414,60481..61057,61100..61627)
FT                   /codon_start=1
FT                   /gene_family="HOG000162559" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638971"
FT                   /orf_name="MICPUN_87049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70182.1"
FT                   /db_xref="HOGENOM:HBG330599"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C590"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK0"
FT                   /transl_table=1
FT                   /translation="MEPPKLACTHACAPATVRGRGVLLGGHAGTSLVTYASGHRVVLRH
FT                   VSDLVPPRFYEHQYPVTVARISPNGQWVASGDASGRVRVWGLNEDMTLKAEHHPLSGAV
FT                   VDMAWSDDGQRIVCCGEGKQSFAKVFLWDSGSAVGDVSGSTKRVNSCDFKPTRPFRIAT
FT                   ASEDFAVSFYEGPPFKFVNTPHRHGNFANCVRFSPDGVKFASVGSDGVGVVYDGRTGAP
FT                   IAELPAGGKLAGGQGQGAGHVGTIYACAWSPDSAKLLTAGADKTCKLWAVPQLEKLADH
FT                   SFGQTVGDMQVGCVFVGDVAVTLSLSGNLNVIESLLVTTSGNPPGNRVVRSGHPKPIGA
FT                   LVVCKSHKGDVFAASLDAVGGGAAVLRWRDGDGCVATVRGPAHTSVVVGACVCAGKYLL
FT                   TAGLDDFIRVASIETDSYLPDLEGSRVKLQSQPRSMGVDDAGSLVAVATGDGVAAYTFD
FT                   GTLGTLGTGEPSSVCVRGDGREIAVGCKDGAVRLFSVVRAKDVGVGSESAQPFSLVPGA
FT                   VMTRHRGEVTGCAYSPDGTRLATCDANREVLVWDPTALTVVLDKMVYHRARVTCLGWSA
FT                   DGVRLATGALDGQIIVWDTTKPPLEGRCAVDGAHVGGVTCLEWRDTNTVVTGGFDACVR
FT                   TWTMAP"
FT   CDS_pept        complement(61760..62848)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638972"
FT                   /orf_name="MICPUN_63320"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70441.1"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniParc:UPI000199C591"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK1"
FT                   /transl_table=1
FT                   /translation="MAQASAGAVRAHALGRGAHQRCRHRLGQHREAPPSRRVRTHRAQT
FT                   TSSAGASSIAADDAAVERDTRAWLDTMVIGMNLCPFARAALPGTKIIVASDVTDARSLR
FT                   EVIARELAVLAEAPTTPPVTTLVVLPPAVTDRLGATTHEGFMEGAYRCAEDATRELTAA
FT                   MADDDDDDDDAGREDGDVIDIVPFHPLATFGGDVSEEDEEESRGYICTYLDVPDDDEED
FT                   EEDEEAKGGKSDGVRSPPTTEELRRMIEAHESFAGGADRRADWRAVTAVTSESDAGPAH
FT                   AGPARDGHPPAPPVDPADFTGRSPHPVLHLLRRCDVSAADEAWYGERGPGTDIRAANAA
FT                   ALRAKGERDLARMLRRCLGVAP"
FT   CDS_pept        join(<63021..63038,63145..>63648)
FT                   /codon_start=1
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638973"
FT                   /orf_name="MICPUN_76495"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70183.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG646581"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000199C592"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK2"
FT                   /transl_table=1
FT                   /translation="VYEPAEDSFLLVDTLVAEWDARLANDPPRCALEVGSGTGYVIASA
FT                   AVLMRDSGLDDFRCHATDVNPDAVACTRATADAHGVGDYVTVIQCDLLGPLRERLRGKV
FT                   DLLLFNPPYVLTPSEEVAAGGIAAAWAGGKDGREVLDRLLPDVADVLAPGGTFLLLLLH
FT                   DNKPHDVAEIL"
FT   CDS_pept        complement(63780..64217)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638974"
FT                   /orf_name="MICPUN_103606"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70442.1"
FT                   /db_xref="UniParc:UPI000199C593"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK3"
FT                   /transl_table=1
FT                   /translation="MSKKNSKKNHQKMRNTAMAREEEEAAKKAARAAKRAAQVAEAAGE
FT                   MAVDDAPGKTSASKVAKKKVSLVKALGAKGATLKRVGKKGVADKKGLQKIVRGVRVGHV
FT                   MKKVKLRKNATVRGIKIVDGDTKRAVINELKAEAAMAMALD"
FT   CDS_pept        complement(64748..65458)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638975"
FT                   /orf_name="MICPUN_52624"
FT                   /product="Predicted protein"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO70443.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199C594"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK4"
FT                   /transl_table=1
FT                   /translation="MDESRSSLDANEKLEIASALNSEAARMREDMYAVEARVSGSSEAG
FT                   SEGSAADVKDFLHNSLINPPEFHNRPSKPDAAKGWSKDLEGITVLLAEDNTMNQQMAKF
FT                   SIEKCGAKLEIAHHGRHALECVRYRMENYLSNYDCILMDMMMPVMDGEAATRAIRDLEL
FT                   KMGRGDKRHVIVGLSANVGPEYTARVKAAGMDGSLSKPFYPATLRNTLLQVRQGTYKGF
FT                   EGEMTCPGDNLPAH"
FT   CDS_pept        join(68507..68566,68700..70313)
FT                   /codon_start=1
FT                   /gene_family="HOG000197681" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638976"
FT                   /orf_name="MICPUN_106372"
FT                   /product="Predicted protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70184.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG590923"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000199C595"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK5"
FT                   /transl_table=1
FT                   /translation="MVPILRSIVALFLVCALCLAAAPGASALVESSHLPRAKVHKRALG
FT                   PPETVKKCVDVARRARYERFSARLHDEPHRDPDGPTLAGGTPECISNYMDAQYYGAVSI
FT                   GTPPQSFLVVFDTGSSNLWIPSAKCSFLQIPCDLHQKYRSGDSSTYKALGDPFAIQYGS
FT                   GSLSGFLSQDTVTWAGLEIKDQVFAEATKEPGIAFLFSKFDGILGMGWDTISVNGVKPP
FT                   FYNAVDQGLVVENVFSFWLNRDADEGGDGEGGEIVLGGVDPAHFVGEHTWLNVTREGYW
FT                   QIAMDDVLLGGVSVGQCGKKGCAAIVDTGTSLLAGPTKVVEALNKRIGAKSVLGEECRV
FT                   MIDQYGDELIRDLAEFSATDICTSVGLCGPSSETKTSTSRRRGERRRARLGSSWLEWAR
FT                   GWARVGRDAVVLGSDAAPIDADGLEGAAVCQACVYAVDYAKSLLTQNATESIILDEFKS
FT                   VCDLIPSSGGEAAVDCDAVSKMPDVEFVLGGRPFKLTPDQYVLKVDAGQGGPAQCISGF
FT                   MGLDIPPPAGPLWILGDVFIGPYHSVFDYDNARVGLADAA"
FT   CDS_pept        complement(70423..70761)
FT                   /codon_start=1
FT                   /gene_family="HOG000012810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638977"
FT                   /gene_name="LC5"
FT                   /orf_name="MICPUN_86994"
FT                   /product="Dynein light chain, flagellar outer arm "
FT                   /biological_process="cell redox homeostasis"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO70444.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557929"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199C596"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK6"
FT                   /transl_table=1
FT                   /translation="MSFQKALRSDSDWDDEIVQVAGVLQVVDVHQSWCGPCKAVASTLK
FT                   RVVMDHGDKPIKFFTADCEKIAALKKSVGGSEPRFQLWMNGKMKKEVKGVDAPEILGAI
FT                   FKELGIKT"
FT   CDS_pept        <71202..71495
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638978"
FT                   /gene_name="APC11"
FT                   /orf_name="MICPUN_86792"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70185.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C597"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK7"
FT                   /transl_table=1
FT                   /translation="KLNEQQAVGVWTWNAGDKDDVCGICRVAFDSCPPDAKFPGDDSPV
FT                   VWGQCGHAFHLQCITRWLNSQAEQRCPICRGAWEFKQLTTSEEPPPLRDQGR"
FT   CDS_pept        join(complement(74409..74527),complement(73886..74032),
FT                   complement(71657..73700))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638979"
FT                   /orf_name="MICPUN_63313"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70445.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199C627"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK8"
FT                   /transl_table=1
FT                   /translation="MPFRGYWDDEEEQALRDAVQKHGIGSWEKMRHDPDFKVLKGRTGV
FT                   QLKDKWRNLIKFQHLRRGEAESAPHRTGGRGPGPGAKRKKADDGDGKAGKKAKPGAKGT
FT                   AGKKDDKPGKPGAKGKVKGDYDDEDAFDDDKPGKASGGKTYGKKQKLGVSADAVSTKSE
FT                   PANPKKRLKAVAALAAVEEHRPPPDLDALERAMQADAMKIDELRRRRESAVGEVKDAEK
FT                   ELLAVKTSVEDAEAVYNNVRSQPPGGYHHDHHHDDHHDDAHHDDWDKFLDFGDEGAEGA
FT                   EGAGAKSPHRQPRHSQGAQTAGQPRLSENDPVARAAAAARMSDPVQSPAAAAAMRDAAN
FT                   AAVRVASEPVHNPNHRSHLPSLHEAEQFLLQELKKLEAANARLMSARAHLEVIDRQLAA
FT                   AIASAAERSEQRVAMMRRNPALGGPVKKTWGGPPGARKIKEEIKEEEDDEEEEEDDDED
FT                   DDDAEERKKTTHRRNTAASAGGAPGGKVIEDRRFGIYDSRRYRMEGEPAPPDPSSDEDD
FT                   EPKVGRGRGRAASAGAGKSVAGTKTQAGRKPPRVTPVSADAVSVGVGGRGRGRGAGAGG
FT                   GRGRGRGRPPKNQTVPAVDSGSEIVSTKAGTNLKRHQGFQFRGQNNSGAFVAPSAADAA
FT                   TYIAPSYIRGHHLRWLMKRGRTRNAVARPASGPTSWAAMCSFALWKPAELKAAIAREKE
FT                   MEKEKEANATDEEESDEDEDDDGGGGYDSEESGPIGSGHAHIDFDAFGYEMGDDGDMGM
FT                   IMDMDFGEDFHPGMSP"
FT   CDS_pept        74913..76235
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638980"
FT                   /orf_name="MICPUN_63312"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70186.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199C628"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIK9"
FT                   /transl_table=1
FT                   /translation="MEKRGSIVGESAFVSGREPCVAPLSASQLARRLGIFSNIVDREED
FT                   TMAWWGRRGFSSALRWTAVTTAGVAGIAGVQALALHARYDPLPDARGPTRGVASPVNGR
FT                   SRTDRVHGAPPLAAREALMKARDEAREFFETKVRPRLGAIPGAAGGARDAPGTSTVAMR
FT                   TSEKSDNDGDRSGRKRRPLRRVVVVGDSLVTGVGCRVDRCDGPTLPRRLGEALADAIGA
FT                   DVEWVAVGAKGADLAAIRRDVIPSLGARWRRRDDDDDDDERRSSSSSSSSSSSSSRIDA
FT                   VVLMCGVNDFKHALTGRAPSTFHADLIQCVDEIKRALGDDVWVILPGMPMQLATIFPPP
FT                   LRYLALYASDAWDAQKRKMCDAAARVRFVPSPSADAMQCKAGAGVGMVAVDGIHPNDAG
FT                   YGAWAHHIAESVAPVLLGDGAALCEEGEEGVGARTEGNTYS"
FT   CDS_pept        join(76567..76610,76973..78509)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638981"
FT                   /orf_name="MICPUN_63311"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="voltage-gated potassium channel
FT                   complex"
FT                   /protein_id="ACO70187.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0008076"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199C629"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL0"
FT                   /transl_table=1
FT                   /translation="MAAVMHNIGPYEDDGTADALAKDFGPYDHEHVKAAIIIQRLYRGW
FT                   VIRHDIATALEEQDLGPSVLLVRKGRPLKFAHEWQRTLYTYVEEGDNAVNTAVSYAVVV
FT                   LIFIATVGFILETVPEWARRKSVSDLFKTTETVCIALFTLEIACKVASQPQCGPIKGEE
FT                   SYWRGVWAWMKRPMNQVDVVAVLPWYLELAVSGGGSGLAVLRAIRLVRVFRVFKLGRYN
FT                   TSAMIFKRALERSAQPLSLLFYFMLIANILFASAIYYAEAMGPNANPSDVDNFDDPLPA
FT                   FPFDSIPRAMYWCMVTMTTVGYGDMYPITLIGRIVAVITMLSGIVVLAMPITLIGSNFV
FT                   EEYRKSQANELKEKRRKESNAKAIEEIRKEATLRVMLRDPDSSKALQRLALANVSGAVS
FT                   GADAGDASQPTTPGGARRRLAGGRVAGDDVLSPGERIVSTIARREERERRRRIREEDEA
FT                   AGLGGSAPWDTQVTPTRPQRDSDGSDGSGRGGGGGGGGLDDEAAERLREMEQRLARMEA
FT                   MLTRIMNPT"
FT   CDS_pept        join(complement(82811..82843),complement(82231..82635))
FT                   /codon_start=1
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638982"
FT                   /orf_name="MICPUN_98189"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /protein_id="ACO70446.1"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="HOGENOM:HBG445152"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniParc:UPI000199C62A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL1"
FT                   /transl_table=1
FT                   /translation="MIKPDGVQRGYMGEIISRFEKKGMVCKGLKTFMTPREVAEEHYKD
FT                   LSSKPFFGDLCDYICSGPVVCMVWEGPGVVKSARLMIGATNPLESAPGTIRGDLAVEVG
FT                   RNVIHGSDSVESAEREIALWFGGDDELLDYEMCIKPWVREE"
FT   CDS_pept        83566..84312
FT                   /codon_start=1
FT                   /gene_family="HOG000161598" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638983"
FT                   /orf_name="MICPUN_103599"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosylanthranilate isomerase activity "
FT                   /biological_process="tryptophan metabolic process "
FT                   /protein_id="ACO70188.1"
FT                   /db_xref="GO:0004640"
FT                   /db_xref="GO:0006568"
FT                   /db_xref="HOGENOM:HBG554803"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C62B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL2"
FT                   /transl_table=1
FT                   /translation="MAAKDEKKTLVKVCGVTTPEDATQAAVAGADFIGMILWPKSKRSI
FT                   PLDVAKEVADAAKAAGATPIGVFVDESAEEIVAACEAVGIDHAQLHGDNARAALTDLPM
FT                   KIKAVYVVSAAKDGAIVTPMPGDEEKLCEDRRTKLSGAGGWKAAIDWVNGPRRTIDWLL
FT                   VDGVVAGSGETYDWTNLRVPRGCSRKGWILAGGLDPENVTDAIGACKPTAVDVASGVAD
FT                   EGGVKKDPVKVDAFIANAKSASMEMA"
FT   CDS_pept        join(complement(86223..86351),complement(84479..85903))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638984"
FT                   /orf_name="MICPUN_63308"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70447.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199C62C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL3"
FT                   /transl_table=1
FT                   /translation="MTMNDFELERQRRIEANRLRMLEMGIGAMASKIQAPAPVPAPKRK
FT                   PRVKAFVPQESRRRSTRERVEVNYAERYGLEDASDDDLAAARRASRKSAQILGKRKAEL
FT                   VSMSDGDHARVRYSVGRRVYDSELGTTCHWCRQKTVETHVTVRRPDQTHPIDRTVIPPP
FT                   PLTPAHPPPLIRHAQCTAEGCGRGRMPVSFCGMCLRNRHGEDIDAAVASGAWVCPRCRG
FT                   SCGEGCVTCCNCGPCRKAKGLAPTHQVINLARASGFDNVHDYLVHGVTGATPAQLLQRK
FT                   TSFAWGRWLLNDFTPATPTESDGAPGVVRESGDDTSAGGDTSASSDDDDDALDAFDDEP
FT                   CLACAGVDRPGDFVLCDGCPRGGHYDCLGLDGVPAGDWFCAGCAREPNAAAVVAEKTTT
FT                   TTTTPATTPKRGPGRPRKRPRDGDSPGGDSPHVPATPSPTKRGPGRPRKHPATPPASSP
FT                   SPSPVPAARGTSAATTEVKRIQLDIRDAFSSASRSVRAARPKPGAMALPVREYRRRAAA
FT                   "
FT   CDS_pept        86500..86994
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638985"
FT                   /orf_name="MICPUN_63307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70189.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C62D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL4"
FT                   /transl_table=1
FT                   /translation="MPAIWRPNVSRVLPDVDVEVGVTEDASSKGTKRKRAPPTKGPCEH
FT                   GVKPRSRCKLCSACPHGKRRYHCKECGGAAFCEHGRERSKCKECGGASICEHGRERCRC
FT                   KECGGSQMCEHGRERRYCKECGGSGICEHGRERSKCKECGGSQICEHGCQRSKCKECGR
FT                   G"
FT   CDS_pept        join(89023..89354,89526..90711)
FT                   /codon_start=1
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638986"
FT                   /gene_name="LPD_B273"
FT                   /orf_name="MICPUN_104984"
FT                   /product="Also known as glycine decarboxylase l-protein "
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70190.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000199C62E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL5"
FT                   /transl_table=1
FT                   /translation="MQQALLALAPQGRRALASSTALRTIGARMFSASAATADQQDVVVI
FT                   GGGPGGYVAAIKGAQLGLKVTCVEGRGTLGGTCLNVGCIPSKALLHASHLYHDANHTMA
FT                   KHGISVGEVSIDVAKMMEQKSKSVSGLTKGIEGLFKKNKVTYAKGWGSLTSTPGEVVVA
FT                   KEDGTTQTISAKNIILATGSEPAALPGVEVDEETIVTSTGALDLKEVPKRMVVIGGGVI
FT                   GLELGSVWSRLGSQVTVIEFAKDICPPMDAQMRKTFERSLKKQGFKFMMEKKVTGATKT
FT                   QTGVTLTVEPSAGGEAVEVEADVVLVATGRKPFTSGLGLEAAGVEVNKRGQVVVDMHTY
FT                   ATSKPGVFAIGDIVEGPMLAHKAEEEGISCVEQLAGKVGHVNYDVIPSIIYTHPEVAWC
FT                   GKTEEEVKATGAEYNVGTFPFAANSRARTNDDSEGMVKFISCKHTDKILGAHIVGPNAG
FT                   ELLGECVLAMEYGGSTEDIARTCHGHPTLSEAIKEAALATGGKPIHF"
FT   CDS_pept        join(<94243..94484,94599..95079,95296..95529,95595..>95729)
FT                   /codon_start=1
FT                   /gene_family="HOG000248945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638987"
FT                   /gene_name="TIC55-6"
FT                   /orf_name="MICPUN_68852"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70191.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG613280"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199C62F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL6"
FT                   /transl_table=1
FT                   /translation="VASSATPPASWYFDPLVVPTLEREKVFAKGWTWAGRLDQVATNGS
FT                   YLVGATGTVKYVVVRGEDGVLRAFHNACRHHGMEIANCPKSTAKCFACPYHGWTYDLDG
FT                   SLVKATKIGGMRDFVVAEHGLKPIRVAEWGPFVMLRLGDPATEEEEEEEEEEEAPIEAW
FT                   MGPDVAAKISASWSDDPKSMRFVARREYRLRCNWKVFADNYLDGGYHVPFAHPALVTDG
FT                   VDMRKYETEVYGEYVSVQTHGAPAAELTRLGDSALYAFVYPNLMINRYGPWMDVNVVLP
FT                   TGPNECMVLFDYFIRADATGATDAFVNESLRASDAVQSEDKWLCEKVQGGLESPGYGTG
FT                   RYAPAMEAAMYHFHRRLWRDLTAE"
FT   CDS_pept        complement(95871..98075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638988"
FT                   /orf_name="MICPUN_63302"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70448.1"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000199C630"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL7"
FT                   /transl_table=1
FT                   /translation="MSTIAPPPMSTPTRPARPLPASVPYLPHDDVDGGSSLGDPTASAV
FT                   VALLDANLRALLRMDAGEFWRHIAHDPSVARALDTYLQHRRRPYDPTKTRASQRSAASE
FT                   DEDLDDRLARRVFMTLRRLATIERDDPLAPTRAARARTLTELGLVRAPTVLDVCAIYGP
FT                   DNPRATSALTRDLLRILGPSLEDDLAAVGAIAAVDLERRADALVEAAFAGDEAGGLGLG
FT                   APAGTAQLALEYFRDVASTIVELIRAVPALASRIDEGSRPSPAPRTSTFGEMTVVEEGG
FT                   AEGVCRGGAFAEGAVTHRGALAAAADRIASETIPMIETSAEAFAAGTAGGEGDGAGGGA
FT                   VAVACAAASSAMETLLRVMRDPPPPSSPEEDLADADGDYVVDDDDDVDASMAGKIESLR
FT                   ALFPDQYGDGYLALALDAFGGDPESAAGALLEGDLPAALRGIDPTLTPAAYSAMKMKTK
FT                   TKRGAAGQTGPAPVAAPAALRGPWASRGGIEAQPASFPSDGATNVRGGFIRRKGDHRDR
FT                   AGNRTWDLRTTADDRAATLARCAELEYDDEYDDSFDELAEVANVGSTAGEVSEGPPAGG
FT                   PSGASGRSNANANARAGGQGQGASANKAYWIADGRVYHSKKEGATRIQAGGVEEAARLA
FT                   AAQSAASRDEVHGLGAGGNRAAFDARAAPFTPGGGERGPGGGGRGEGVGGAKAGAGVGG
FT                   GRGAGGRNNRGGGALEHQRKKHFRKDAAARKMSKGAGAPQ"
FT   CDS_pept        98499..99323
FT                   /codon_start=1
FT                   /gene_family="HOG000100160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638989"
FT                   /orf_name="MICPUN_63301"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70192.1"
FT                   /db_xref="HOGENOM:HBG558016"
FT                   /db_xref="UniParc:UPI000199C631"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL8"
FT                   /transl_table=1
FT                   /translation="MRTDCRVEREKKTWKYNSYRAPTRTADMLRIALFLTLVTGASAAF
FT                   EAVVNCTVLAKDNSCNAVTASALAASTSTFCTSLVAPAKDNNCLYDGTDKKCNYQGGGM
FT                   DLKHTEWMTAEQKACYAGDSTTDTKAKCTALTGCYWIAKGGDDTAAGSSCGYPLAGLEA
FT                   TANGKSATAVQIAYLRASFMEDVCTVVSKDKATCNADARCTWNFDGKCVPSMNAQINNL
FT                   VEGSCNTEADTLAKTLGATTAAATAAVGSGAAGFSSFAVVVSALVAALSLIA"
FT   CDS_pept        join(99513..99774,99954..101242)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638990"
FT                   /orf_name="MICPUN_63300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70193.1"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniParc:UPI000199C632"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIL9"
FT                   /transl_table=1
FT                   /translation="MNCLRVIDDLRHWRYFAVSTRARTGEQSDCRHVTRSNARRIGRPH
FT                   SRRARMSTAAGRAAPSAQAGADGVSRRDIAALVYNYLRSNGFAQAAKQFRTDADPLLAP
FT                   FRNRVPTGVVGLEHIVGEYVAARTRDAARRAAMEANPLARRMYEQLDDYAMTTAGIAPP
FT                   AHARTYPGPPTRRHHLPSDDDAAFPAAAAAQRGRGPRPILPAPTREERERMAAAAAAAA
FT                   SARAHAAAGAGPNPSVQIHPNPNPNANPNANSPRRRKPTTAPPRVTTAEPPMGSLMDDV
FT                   LPEEGGGWRPYELPRELSDARVQERLAEYIVGVVRGGGGIDAGSPGGWGGSGGLGTLGG
FT                   SGAALGVGVGGVGVVDGASSSPGAARAGAAERGVHLTDRDVEELTSQLWDDAELGALLA
FT                   PLLGPAGGGERNPRVGGGTLTLGGGTTSAGPSPLGARGRTAGGTVGGGRVGVYSRGGVE
FT                   GDAFADPPAPAAVAHRVGSKRRKGIAPAKSRAVPSGGANLPPELRGVDLDNLLDGIEY"
FT   CDS_pept        <101530..>101733
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638991"
FT                   /orf_name="MICPUN_74472"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70194.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C633"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM0"
FT                   /transl_table=1
FT                   /translation="YGALNVTSSANATEIRGKYRRLALQYHPDKLSHLPKSKRRKAEEN
FT                   FKIIAEGKEVLSDPGRREEYDRV"
FT   CDS_pept        complement(<103087..>103728)
FT                   /codon_start=1
FT                   /gene_family="HOG000265366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638992"
FT                   /orf_name="MICPUN_71029"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70449.1"
FT                   /db_xref="HOGENOM:HBG748546"
FT                   /db_xref="UniParc:UPI000199C634"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM1"
FT                   /transl_table=1
FT                   /translation="QICDDFVCKSSPAVESSLRQIATDICAIREDKRSLNPFAVDVKYD
FT                   DGERKFEGREGFANHTYIKDNVDDARAAVTEMRMGDLDAATIVWRLQGRNSGGAIDVEV
FT                   TTTLRLNLITGRATEVTERWDPAGSDAGAAAVLASSRKATALPKNIADAAARLGKSIEE
FT                   KFGSSDDGEMKDVYVDPNDPMKFFTNNNTPQDDYLQIALFLAAIYLVVKLL"
FT   CDS_pept        join(complement(106545..107178),complement(105323..106485))
FT                   /codon_start=1
FT                   /gene_family="HOG000261371" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22638993"
FT                   /gene_name="PGI"
FT                   /orf_name="MICPUN_104983"
FT                   /product="Phosphoglucose isomerase "
FT                   /function="glucose-6-phosphate isomerase activity "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70450.1"
FT                   /db_xref="GO:0004347"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG352954"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniParc:UPI000199C6AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM2"
FT                   /transl_table=1
FT                   /translation="MVVAQGVPDVSVDDAPALISTTDAWKDLAAHKEEIDKTHLRDLIE
FT                   DQKRCEALTVEYNGVYCDYARQRVTEETMTKLYELADEANLKGKINAMFSGEHINSTED
FT                   RAVLHVATRAPRNKVINVDGKNVVPDVWDVLDKIKDFTEKVRNGEWLGHTGKPLTSVVA
FT                   IGIGGSFLGPLFVHTALRTCGEAAEGARGRQLRFLANVDPVDVARSLNGLDPETTLVVV
FT                   VSKTFTTAETMLNARTVRQWIIASLGQEAVKKHMVAVSTNLKLVGEFGIDPDNAFAFWD
FT                   WVGGRYSVCSAVGMLPLSLQYGFETMEKFLEGAWNIDEHFATAPFEENVPVTLGLLSVW
FT                   NVSFLDCPARAILPYTQALAKLAPHIQQVAMESNGKGVSIDGQPLPYDTGEIDFGEPGT
FT                   NGQHSFYQLIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNHDELMCNFFAQADALAVGKT
FT                   AVQLRSENCPDSLIPHKTFTGNRPSLSIMLPALNAYTTGQILAIYEHRVATQGFIWGLN
FT                   SFDQWGVELGKVLASKVRATMNEKRTKGEKMSDKDGFNPSTTAMLNRYLEGKAQLKYAE
FT                   PEDVFPCDLIDSDECRPPTSYA"
FT   CDS_pept        <108666..>109313
FT                   /codon_start=1
FT                   /gene_family="HOG000262433" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638994"
FT                   /orf_name="MICPUN_72027"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO70195.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C6AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM3"
FT                   /transl_table=1
FT                   /translation="VLVVGSTGGVGQLVVAKLLDAGYVVRAVSRNVDAARGLFGSQPNL
FT                   ELRVADLRDADALDASEICVGVDAVVSCTGTTAFPSARWKDDNGPEQTDFVGIRNLVNA
FT                   TRAQSPSCKRFVLVSSIGVERTNQMPFVILNLFGVLKHKRAGELALESSGIPYTVLRPG
FT                   RLTDGPYTSYDINTLLKATSGTRRAVDIAEGDTLTPEETSRIVVADCAVAALS"
FT   CDS_pept        complement(109632..110471)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638995"
FT                   /orf_name="MICPUN_63294"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70451.1"
FT                   /db_xref="UniParc:UPI000199C6B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM4"
FT                   /transl_table=1
FT                   /translation="MATPVKGGIPPMSPGAGNAVYPVTLNSDTMPRDVLIAIRQRRRHD
FT                   LPSRVSVCCLPIQWDDAYEFTAPKPRQWWRRLMLYLGCANNDYGGTMFDIIDGLYEEGK
FT                   INRTQMGQLEALVRVAMGCQFKAEQDIGKHIILGMVAAICGAVVPVVVGIQTTMQDQQM
FT                   AHYLSYFAIVLSLVQTVAVTLSTVGNYSQSAMSRRMTAAEIKAEIYKFEALAGEYSEPQ
FT                   SHSAQFGKLMFHLAEFRQKAVEIQYAARSGGSDKKGDEKAERKKADTEMKASGNRGV"
FT   CDS_pept        join(110678..110836,111144..112238)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638996"
FT                   /orf_name="MICPUN_63293"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70196.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C6B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM5"
FT                   /transl_table=1
FT                   /translation="MRQRNSVEKDASRRMRTDATQASNKKLKKSLTANSREYQYHYWYR
FT                   STTVGVIVDSFDLGSYDPEMDGYEPPEVSVDDVTKGVRIGEGSFAVVFSGTVAGVGDVV
FT                   LKQYRRDVRGRDWFSFYADERAMCRRLRECPGVAPFVGVAGSDLYLVWRDVGKRTLANV
FT                   MEDGAYGGGAHDGRGDALKLAAAEMGLSASATDSEIFVAVARGLIEAVVSINDANCVHR
FT                   DVKPDNVLLTSAEKGSPGGARVLMVDLGGAADYETGQGTDGSEAIFDPTYGAPEQFVRN
FT                   KSRSRGIAGMFAGFGVNPDPSGGGDLEATGAAPTAAFDAFGVGLTLLRLATPALHPAGS
FT                   MKLARSAMDEAADRVFLEGKSDEVSVLDEWASGPGSESCDFGLLDKLGAWSLLEGLTQW
FT                   DPERRMTLEEALRHPSLN"
FT   CDS_pept        117476..119737
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638997"
FT                   /orf_name="MICPUN_52616"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70197.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C6B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM6"
FT                   /transl_table=1
FT                   /translation="MTPLSKLGPAKSATGNNNRPPSRPSSAARRSLATAAAAAAAKPPG
FT                   VGESGAKGAQVTVGGENIVSAVYVRRDVIVTGFPSGALGVWTVSHHGDDGARCHPVHDA
FT                   VARWTVSMAQRIAGAHEPGPRVNLNDGTTTYGGVRAMTMRADGATMLTGGADGWVHTWE
FT                   LADGTIAVVGRPKTDGPGKPPVERRRAVLLRKLGSSGETAGPNSFRISSPYANEPPPAF
FT                   RAIDCRPQDSSQRRSREVPYEFVMGTNKCDVWEVEYKRGIDHPPTIGVQVYGHVADLYA
FT                   IASHPTDPDVFASCAEADRVFLWNANDRTLARTAPVGLVGRSICFSATPVPKSSTYFPD
FT                   WRPVNRKDGAPCDAGHHLAVGGKFGKIAILDGVTLQPLVVLKDVRSAVDDLKYCGGPRA
FT                   MLAAASHDICVDVYDVHRGYTHLSRCRGHMAAVTHLDWSLPMFPHLPARRILQATCAAC
FT                   ELLYWEPVSGEQVLENQRDARWESWTCAQGFPVMGIWEDGSDRTDVNAVDRAKSGQDVF
FT                   DEKSKEIVEADACAGGLDRAGYVVTADDFGKVKLFNYPCVFNDAPYREYKGHASHAMCV
FT                   RFSCDDRRVFTAGGHDRAVLQFTTRGVRRDETPQTYAPPPAPKRTWGPIDGGKAYGWIE
FT                   EEASAAGGGSERRNRRAPPKAIAGAAAAEEALRLKHEAEEAARVKEEKRLADLALGPKP
FT                   SNANYGQTSAGATGTVAGLSAGIAKRDKLVADVDKPLTAMAAQQQPKQQPKPRYPEQAR
FT                   "
FT   CDS_pept        join(complement(121653..123016),complement(119932..121552))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638998"
FT                   /orf_name="MICPUN_103588"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70452.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199C6B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM7"
FT                   /transl_table=1
FT                   /translation="MSGSFSSLLRCLGGAFPFGGAESAASASVASSAASVPSSSFSSIS
FT                   SSSSSSPPAAAFSTSGADLASVPVASSASIGSKMPRSSSSPPAALLARGGDAFSSAAVS
FT                   ESAGDLAGVLAGFLAASFDTAVSSSATRASMPPPPPMMGAGAVDPRRPFTPSRTSTTES
FT                   ESGESAPRALDLLASPGLSTATVVAGARVGWRLSNASSSSSSRSSSTTRTTDPSSAASR
FT                   SAGDRYAPALGCAKRDSDDPPAMRSGDPPNDDADLGRSSASSSSSSNSTSRRLECRPSP
FT                   PSAMYRYAVAPNATIASTPPQMIERRSTRDVRSHDPPDDRDADPLLAPRLSDARVRPAA
FT                   ARGTGGLGVDGPGCQLSPSSQPASSSSSPSLHPPDDFVVAGAGCDPCVDPADDEDPPAD
FT                   ARDEDERPADAAPPPDELVDVLGAMALASRQASSPSSASDASQPSVAAIVPGRSACDRD
FT                   LGRRESMKLATTAPRAAMATAWSTRPTPATATARHRAAFPRAPGERPTTKAKIPSSARG
FT                   ATRRRRSSPLARATASEDGDDEPVSSASGTISALDALLGSADEPEPEPEPEPEPARGDD
FT                   ETTTKGEGVSPDGAEAAGWPSLSLPDLPWGASSRGGGARGEDDEERAIVRRAMENARAE
FT                   RSKSSSSKSSNGSRVDYAVDEPYDPDFDPLGLGPRWEVPWGAPTLIATLVAVEASFYLA
FT                   GALAPAIVYSGARSADEIPFDDQEAFAKDLAALFDEPGAFADIVITAEVIQTVLALGVV
FT                   AAVASSASPLPPGWFQFSLTGDDVSMSDGPRVEKKRSSPDGGDSPDGDSPVARSLRTGR
FT                   PSGSPAASGADFAEKRRAQRIRAERRARSEDWLGEAARASAWVWGAVILVTALSYVTGL
FT                   RGDESGTASNSTIEKAFDAGPGGALSLFLTTVVLAPLLEETVFRGFMLPTLTRWMDTRW
FT                   ALAATTIAFALVHEHNTGDTVQLLAVGAVAGVAYCRTRNLFASMAVHASFNLGVLVLFA
FT                   LWTHS"
FT   CDS_pept        join(124253..124571,124829..125142,125246..125659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22638999"
FT                   /orf_name="MICPUN_109310"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70198.1"
FT                   /db_xref="UniParc:UPI000199C6B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM8"
FT                   /transl_table=1
FT                   /translation="MQASLSASFTRTAPLRVRTAAKPRDRVAMRAVAYDKKSKGKPSLV
FT                   GVIKVPKHFEHEMDALVVSHEAHMHDTHVVYNGQEAEEGRPRFLEYYVTKINEVEDPLD
FT                   TKVSTPTGHLLYAWNEKYVSAADVDEHMKIGDAKWDQFPKLLKLVKTNGHFMIAGHGKI
FT                   VANYNDCSEPCTARKGDTTVSLGLVVPGRLERDVDAAWRQHERWMRKTHDFGEGVHGKY
FT                   DDLTRPRITQYTVTKAYEHVDPMDPLSAKTGNVMYAVEESYVSHDGVKGHMEIAPPELD
FT                   IMKYLTNKSYVRYMDVGQGHVIAAMPRKLTSNIVSGLGKFFQQIFNPGKVAAYAGGECD
FT                   PDDCEEAF"
FT   CDS_pept        129270..129614
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639000"
FT                   /orf_name="MICPUN_103586"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70199.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199C6B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIM9"
FT                   /transl_table=1
FT                   /translation="MRERQQRRREESAALKIQAVHRGRKVRRDLDFRSIAQKKKAGVEV
FT                   GNELVEMKNRMIEMRARMKDRERKVDALKLKKIRRYESGKDASQGNYFGEERKRLERKE
FT                   TSRARRAARR"
FT   CDS_pept        join(130309..130419,131068..132217,132297..133471)
FT                   /codon_start=1
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639001"
FT                   /orf_name="MICPUN_92170"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="ACO70200.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG746961"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000199C6B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN0"
FT                   /transl_table=1
FT                   /translation="MMPGAPATGGLPGGAPPMMMRPPGGPPGGPPGGPPPGRIDPAQIP
FT                   RPAHDPHAEPIRWDSRTQHGAAAHPPAASTSFIAVDRGCCNPRYMRSTMSTIPHTGELL
FT                   ASSGMPLSIMVQPLAISSPEEDPIQVVDNGDQGPLRCSRCKAYMNPFARWLDHGRFQCN
FT                   FCQATSECPREYMCNLGADGKRMDWQQRPELCRGSVEYAAPAEYMVRRPMAPALIFCVD
FT                   VSLAAVQSGATTSAVEAIARTLDAMPEQTRTLVGICTYDSVIHFYHIHEGMAQPRMLVV
FT                   PDADEPYSPLPAGMAVPLAANREAIDAVLKQIPEMFANNRHGSPVGTAAVKACVEALKP
FT                   VGGRVLAFMGTQPTGGLGKLSNRAAQAPNVGAKEAEKEPLKYLAPADKIYTKLATEAAE
FT                   YQVAIDVFLLAPAQYVDVASLGTLPRITGGTLYRYPGFNTQLDFAQLHNDLRWNVQRPQ
FT                   GLEAVMRVRASNGLGVADYGGFYCKRTPTDVDLPALDCDKAIVCNMRYEERLNDGGEAY
FT                   VQCALLYTTVRGERRIRVHTMAMPITSVLGNVFRAADLEAQTCDMIRKVSARLLGGSAS
FT                   IQNVKDQTITTTVNTLYAYRKFCASNNSTGQLILPEGLKVLPLYCLGLHKSPGMRADAH
FT                   ADDRAAWLLNGLCAPVKMCVPSVYPRNFPVHRLVDECAAEGTEFPPLPPVTWLSAEKLE
FT                   QDGIYVLEDAREMLVWVGRQVPDAVLRETFGVDHVDHIQSNAAALKQLDTPRSKSLNAF
FT                   VNCMRRMRSGYLRTRILRRGDPAEAHFYAKLTEDRNIAGMSYVDFLCHVHRLIQNKFQ"
FT   CDS_pept        complement(<133954..>134276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639002"
FT                   /orf_name="MICPUN_76592"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70453.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C6B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN1"
FT                   /transl_table=1
FT                   /translation="LYDGLVPNLLKEGPPLALYLGIYEALKSLLLRNTELAPVFCYLAA
FT                   GAVGECVGSVVRVPAEAIKSTRQADGSVTVAGAVAKNFGDCKGRSNLIRAWSVAVVRDV
FT                   PFG"
FT   CDS_pept        135823..136566
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639003"
FT                   /orf_name="MICPUN_63284"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70201.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199C6B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN2"
FT                   /transl_table=1
FT                   /translation="MSDSDSSGGGWGDDVTRPLRIYVLRHEKRPVDDPTFDVSLTDEGL
FT                   EDAEELVCEELNELGVNAVYSSPYKRVLQTVEPYLDQVHVGMGACVEWCLSEHPEPNDT
FT                   PPTEIPDEWHDEFSIESTHVPLMTAEEAHAKNRTIEQVFNRLADFVELLSKVHDEGDVV
FT                   LLATHQTSVHALLSMASGIPVDCMDVPMGKIVELDWHGVIKYKYHGGPEPPWACYESHF
FT                   HPSKNKHGGELKFTYIAAEEDSEED"
FT   CDS_pept        136844..137839
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639004"
FT                   /orf_name="MICPUN_109309"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70202.1"
FT                   /db_xref="HOGENOM:HBG558035"
FT                   /db_xref="UniParc:UPI000199C6B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN3"
FT                   /transl_table=1
FT                   /translation="MASVTSTRALSASRAASLRGASHLKSSARAAVAAPRRRRPNHAGK
FT                   CLAYFDDSSDFGGGGSGVDPESLAILQQRLGQRIDLEGEGAERLNKTAGLLLDASGRAI
FT                   DKDERRKVLKADEAGQAQQALEISYDPEGLFPDVDETSASMLIDKKMKAKEIELQKKEE
FT                   EELRKEYEAARAELEAARDARIQPTTHDELVAYFFSTEFNEMEYEIVKQRPLLTDDFFA
FT                   YLAARRDGEGDEEEKGKLDALFTVTSNFVGFVDQTTRAMLSPLERMKKLLGAKDKRAMI
FT                   LEMVDNDELDLNLMALLKTNINTARQAGQEDAAKFMEKIYAACAKFVDGA"
FT   CDS_pept        complement(137995..138504)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639005"
FT                   /orf_name="MICPUN_63282"
FT                   /product="Predicted protein"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70454.1"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniParc:UPI000199C6BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN4"
FT                   /transl_table=1
FT                   /translation="MSAAMTAIASRVVHARASFKPPIARPGRAARARGGAAPGGGTGGR
FT                   GELRIARRAEQSGGERRVSSEDAVAESAAPEGEQPPVPDTAAPKDLGAQIQELKNKGSG
FT                   GAGGMPKEAENPFIGAFEEIGQTEWPSPISALQTTGIVIAIVMGSTFVLLTVNSALSAI
FT                   SQAVFK"
FT   CDS_pept        139041..139823
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639006"
FT                   /orf_name="MICPUN_103582"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70203.1"
FT                   /db_xref="UniParc:UPI000199C6BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN5"
FT                   /transl_table=1
FT                   /translation="MPKEYVDAKFKLQALGLEPAVIFPGGAIAPTGLKMQKEDPSVPSD
FT                   PAFSELFHHPIFDEPPREFKPDCADKISHYYNGFWQTIIKYTICLPLTIAEKTNSCGCS
FT                   EKLSDEALEIFITGMIQGIVDLNTEKPHSPARQLAVNMFAEGCWDGPTLVGVLAPVINE
FT                   AVNDNWYNIRTNTYSKQTGTAVLELIFEAPGYTPEVERATILKMKQLILQKCVLCCNGP
FT                   VTAWNNEEAKEGAKQIGKWIMGKIGGIGGAVELASSMV"
FT   CDS_pept        140099..140641
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639007"
FT                   /orf_name="MICPUN_109308"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70204.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C6BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN6"
FT                   /transl_table=1
FT                   /translation="MRKPRGPTAGASGDEAGPLAEGTPPPKKRGRRANEGAGAAMEPTT
FT                   TTKKTSASRPPCPHGLAPRGRCLKCSGCPHGRQKSKCVKCGGSEVCTHGRVRYRCKDCG
FT                   GKGMCEHRRQRALCKECGGRGICGHGRQRNKCVECGGSGICEHGRQRQHCRECGGSAFC
FT                   EHGRQKNKCATCKVKAE"
FT   CDS_pept        join(complement(144709..144720),complement(141788..144511),
FT                   complement(140784..141671))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639008"
FT                   /orf_name="MICPUN_63280"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70455.1"
FT                   /db_xref="UniParc:UPI000199C74A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN7"
FT                   /transl_table=1
FT                   /translation="MGIMETIASRMRGARRPKPISKYDLGSGGGGAGDAGDARRAGRFG
FT                   FSRRSATDERGRGGMFGRKTGAARDAGDLVRRAHAGAETREELERLPDDVLRAIVDEEY
FT                   EEALRLDAEANKKAAAEGALDLEDNARDDERARKTLAELDLDDETLARIELVKTILKER
FT                   KDRAEKATWRRCVSMARSTLGDEPVADYDDFARFVHRGLDTESVDDRELRRLYANCLQH
FT                   RPGSRAAVADVLTAERLAECVEKGQWSRHWARYVQDARRKALDRGPCGASAAVFGATCA
FT                   DPIAASPFPPLTKSLSLPRGYVRYLLAFTLLPLLWPVAGFKRLGVGGGVAEALHVWRYV
FT                   LPKPLRRVKDSRGDLAALFLCVTPVWTLAALVSAVYFAYRPEFLLVDVAIPCAVTGALV
FT                   SAAAACAAAARDAGDREHPGRGDGGQLRPSHAFPGGRTKIPDDESRIVQSHPRLDTVEE
FT                   RRLASEREAASSGVGSGAVGGAVGSGAVRRAAGVSGNGSTYHAPRPLGRDSAKESASEG
FT                   GSPEASGAPAPVRVRTETARNGSNPSPWESNGFDRGDDANDLESGPPRRLPPLGGVGSV
FT                   GGGRGRRGRAAATAVTTVTADATHRHHAQPHHSIVHVEPPAAFRNDEARDATREALARG
FT                   DRRRTAFKGEVFDVINRPISEKDVVDAICRRADEEAAKTYLIGSRVPSLELKLLMFAVA
FT                   LALASIPALHRGVHGVEIFGGRERVTVCVDQVMPESVMNLIGFSKCSKLVAEEMAAEKA
FT                   RQDALLATGNYTYAAPPSPAVGSGATVDDLVLTETASSDAGSSAGRVIVGGAVLWTTIA
FT                   TYFALNAARWTCARCYEHHLRARLFAACVDPQEAALFDVPYVNVRHAWLPWMRIRIHLQ
FT                   RMRHLERTFATCVVTHLFVVIAGLVVAAGLACARIYTSPYQDVHSAPAACLGAALVLSL
FT                   PLWLLCNVAAKTFALQEEDETLVHEERWKMTLDGVGDWRRHAAMADVADQVRRRNAKAW
FT                   PTFGGRRAGPGTAAAATVLCLFLLAAFLAVAALDAGGGPKEGTSGDQLRDYVEVNFAYS
FT                   HKYAQALMDRLLNLADNVTETRTGVADANRAISQLDNVSPRKTHELVTAMSTCMSCTTP
FT                   AGESKPRPWYADRNALAAETAAHRLYYRRVPSWNSLCTDGGMGANYTAPGWCADPVGED
FT                   PPLGKARCTAVETAVDARCNNLGDLHTPPPAPPPPMNATGR"
FT   CDS_pept        144965..145972
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639009"
FT                   /orf_name="MICPUN_63279"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70205.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C74B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN8"
FT                   /transl_table=1
FT                   /translation="MLPDVDVEVGVTEDASSKGTKRKRAPKTKGPCEHGVKRRSNCKVC
FT                   SACPHGKWRYWCKECGGAGICEHGRERRRCKECGGASICEHGRQRRYCKECGGGSICEH
FT                   GRVRYYCKECGGSGICEHGRDRSRCKECGGGSICEHGRERYYCKECGGSQICEHGRRRS
FT                   ECKECGGSQICEHGRRRSECKECGGSAICEHGRQRYYCKECGGSGICEHGRDRSRCKEC
FT                   GGGSICEHGRERYYCKECGGAGICEHGRIRSTCKECGGSRICEHDRQRHTCKDCGGSQI
FT                   CEHGRVRSKCKECGGSGICEHGRHRQYCKECGGGSFCEHGRQRRKCKECGGSQI"
FT   CDS_pept        join(complement(149038..150959),complement(146037..148749))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639010"
FT                   /orf_name="MICPUN_63278"
FT                   /product="Set domain protein"
FT                   /function="binding"
FT                   /protein_id="ACO70456.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C74C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIN9"
FT                   /transl_table=1
FT                   /translation="MIVHMCISRGADGEMSMGLLPGGGFLGGCGPSDAGDDDSLPRRLV
FT                   GCVLSSMLSSMAEHRARTLPPDVPPPEGVADMPVVRELIVRTLASRAVTDSKRFLDVTD
FT                   PDFDPYRGSLKALGRLACVCRGYRDDTRDPYIVNELLERLAEPAWREWARGWRGKTAAR
FT                   EKKDDDDVTRPHPKPAADAPNPTPRVDLGDVHRLLRAEHVAKHVIDASNSEHFASRRAR
FT                   GEDTTARDRWRPSTLRASVAFPPPLDSLQEPDNTVLEAHRARRDELEREYARHACTGES
FT                   LDRRVSRLIDALEANSNSLREEYESRADKASKGGPVRRRLLRERKRLKRGMKRVQKAMD
FT                   THDSNLDVVKAREEYVAALTEVSRLERLARCKGPQLACRDPNPDERAVSPPTQVGGVPD
FT                   WPWHDEEGVCGEHKAFPDVDDWEFVAQVNLRQVHASSSLLPEGLLPERGILYFFLDRDF
FT                   DTMDDDGQECLVRFYPDSLDSPPWPGANLDGSAEAAHQRTNLRRFQKMGHTRSIPVTYR
FT                   SAAVAPARDVLTMRPFIDGHELMPPEWAEWAELDLDEDEDHPLSELFDEDDDFQAELDY
FT                   PRNIRDAFPCPPVDVPVMLGYPIISEEAMEFWMDSVHYPETPVYFVSQKDSLLLLQIAP
FT                   HGPQGSPDGVQLSSVIFVLIDAPAAVNTAVGSGGCLGALAAAPRPPSTPERMDRASLER
FT                   DVNEYIERTVTRADELAPARAALVAATDARTAGNDSFRSGDFATAMEWYEKGARALRAD
FT                   ALREPVTMAAAERALLALLANSAQCALKLGEHARAAKLATAALGIHVCASEPALFKKVM
FT                   VRLALAKDASGDADAAVATCEEAQLRGLSASDFDAIMRKAGRTSVGTLGDGHEPRMFVM
FT                   LGLRLSDGAENLARIRGVVESGSLPHVDRRDEAGNNILWGTLHALHGAVEPSANGGKGE
FT                   AGDAAGGEGAAPGEGCVPTLAYLYAAGADPCQRYDGGKTPLMYAAGSGHVTAVRVTLDA
FT                   MRARRRAINAEARRDEGDTFETEHPADGDPESIRDWVNVADDGGWTPLMVALMMKDDAP
FT                   PKENVGAKPMGEREQLAVLAIVRELLDAGANPFAQNVDGNCPLHLAAMNGASEPAVELL
FT                   RRCSDPASLLSLRNTHGMSAAMVARRVAPNSGVVADLIAAADRCGGDAREELEEDLRVC
FT                   KWESAVATVGAANNAAIERIVDFEGEELLSTPWAEQECVFAKCDAWLSMCGFDDLPNVP
FT                   SNGEDESANKPLSVRAFDAYGDVYAAVHAKICDELLPRCVSKRMDLTDPRSTPSVADCA
FT                   RLWYVSGGERGQGTDVASRPPARFVPHMGGVVANPTFVAFHELVACVLPHSFAFAVPCD
FT                   AALAAVASLNRPVVEMGAGTGYWTALLRQKGVDVVAYDAHPPRRITKQFAKGVAKFFGV
FT                   TYVDDINECDRDASCLDAHADRVLMLCWPKSPEDVEAGDWDLRCLDRWRGDTLVHVGEW
FT                   SVNLDEDVDEHGIRSPDLWYAGARAPRVNEEFPRGTNALNVPHGMTTSAGFQRRVEKEF
FT                   ERVATVRLPNWPFARDDLTVWRRR"
FT   CDS_pept        152724..153812
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639011"
FT                   /orf_name="MICPUN_109307"
FT                   /product="Ca2+:Cation antiporter family "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70206.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI000199C74D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP0"
FT                   /transl_table=1
FT                   /translation="MDVTPPTSPTKKPLAPASSSAPTAPTGAAKAKAGWAKLRQTVVKE
FT                   HKFADAVLALKDKWKDKAEVLNQSPDDVAPGSPRESCKITPTMTLGHIRAYRAEAARAA
FT                   AALQAKSKAAELKARVAAQRLEEGASSGGDETKDGGDEKDGDGDGDDDGSPFTPPDDLK
FT                   EYPLWALSVPWYAAFKMTIPPCGENEYWRKWYLVSFFMSIAWIGFITHWMVEWCVRIGC
FT                   MLKIPAVVMGTTVLAAGTSIPDALSSIAVAKDGLADMAVANAVGSNVFDIWLGLGLPWL
FT                   FYLSWQSPSYITVNTNELVPSSLILAGVLVLYYGSVATNGFKLTMRMGWIFIATYGVYA
FT                   LYSIFLVWLLDVYDLQEGSTLK"
FT   CDS_pept        complement(153930..155516)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639012"
FT                   /orf_name="MICPUN_63276"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /protein_id="ACO70457.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="UniParc:UPI000199C74E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP1"
FT                   /transl_table=1
FT                   /translation="MSKKAAKKAAKAKAKADAKAKARLEKGLDPNPPPNPRQRLVPMME
FT                   SKRAALAGTKRAAPEPDADAPAPDGDGAGTLLPKSAIIKRTTKDNEIVAEEEEEYYDWM
FT                   PVDPDYYRNEPVDDDDDDDDDADGVDDPTLVDPRPTWMRRKQRAMEKKARAEALIREQD
FT                   PDPQPKAPPVRIEDHGPWLPMTSHRTLHACWKMQTFASDVFICSYPKSGTTWMQNIVAQ
FT                   IITQCERKKNGATGATMKFKHISDVAPFLEIDPHWNHDRLDDFGRPMHTDELYENFEKF
FT                   ERRTYNTHLPFELVPGKGKVGEIFLPWETWAHKPGVSVRPRYVYVVRDGRDCAVSFYHH
FT                   LSSQAPEDGGYAKGWNAFFDEWIEGKIAFGGWAEHLKSWQVPGDFDPAVLVVRYEDMKN
FT                   NLREVVKRVATHVLGGPCQVSEQDLYRIAARCSFDRMKKEIDRFQPKSVRWSNPDYCFL
FT                   RKGEVGDWEVTFTAEQEERFQKKIEEVFGFDRFGKPLGPPLLDRMSAMYSDIGVWEEAW
FT                   TGIPERPIARY"
FT   CDS_pept        155856..159032
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639013"
FT                   /orf_name="MICPUN_63275"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70207.1"
FT                   /db_xref="UniParc:UPI000199C74F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP2"
FT                   /transl_table=1
FT                   /translation="MEEVHAAPAPPATGGSTAPRRKILVRRPKKARDAPMQTAEAEGVK
FT                   SLPAHTTGPGSDVETLRSVGAMTRGSTPASSTAGAPTLVPTLKTTKRIDFDALRGGRET
FT                   SGPGASTGRATPTSTKFGVATAAPPRTPPKPKPASEEAVAPNGPKVSGKTGKRDEWAVL
FT                   GDVGEYEYMLARKMAEERAKLPPSPEALPDLPSHIADASARLKGGAFDDHYKRAYRVLA
FT                   ERRAEFADAAATLRDGLDAAIAEETVEDRRKVHTGWQLHVKMGEVSHGNALAKWEAQKR
FT                   EWERIKRERAIAFDKRPGDLVMERCDEHRRKLEILGHLDMAVPISEREGGEPWLWKMSL
FT                   RDNWTRWVNVGNEFSGLYYVRDEMAYVDVEQIRRPQLHGSVERDGASDSVTRGRSVLDS
FT                   KFMDVRRRKLRRRVHDILPGENGEDIDATGLEIVGEGAVNALDRLASKRITLEELEEQI
FT                   ASDSLETWAEIQKYRSDVAAAEANRAARELAAAQAEEAAREAAMGPHLELESDRVMAQM
FT                   RWGENTAHATTTMRNTGTTAIWYKWSQVPPKAAELPHASNAGPSTFFMEESTGSLLPGE
FT                   SRVAMWTFKSEKPGVYIDKWILETTPNVRAGRIEPITVRGVYHADDPNSYPRRMLAAEI
FT                   AHREMRTKVTAAMAKVFDRVKTPDVSKRVATKMSPVPRSGPAPALWNAGNAGRRPRVYY
FT                   HEESFEAFMDVRRRCIAAEKTLPPEPKEEEEEGGEEGGGAEEAGEDAEGAEEDAAAAED
FT                   EPVVELPFEGWDGSVAQVEECIRNLEAAIERKAALDAAAEAAAAEGGGEETAGAGEDAD
FT                   AADAAEVADEDAEAGPPPEEVLASCRASFAEAMRVAILPRSRADLLAAALSEAVTNRLG
FT                   PVDETFEKARAKYRPPSPPPPEPELDEEGNPIAPPAGEEGEAQEPGAGEEPGAGGGEKK
FT                   DKDAFDSVWRRKCRKVLTRSIGEMLGAAAEAFERESVAEAEAEVNAELIRRVRDMRVTA
FT                   AKLETLGEEDGEGDRGSETQPAADLGGEPQSPGRAEWTEYELLRRRKALLGREVDPSGA
FT                   SRAPTPGSRS"
FT   CDS_pept        159184..160641
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639014"
FT                   /orf_name="MICPUN_63274"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70208.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C750"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP3"
FT                   /transl_table=1
FT                   /translation="MVEGTPAATRPARGADGDDETAPSTSATPLASAMRTPLVVTKRLS
FT                   FSATTPMGRTPGSGIKVTGFDELCAVCYSPLDRAEGERDGIGDDGDGVVDDVKRELFTT
FT                   ECNHTYHRCCLVRCREADFTLCCLCKTGRIDGKGLTPEHVRERRALNAQRNAVIGAAAR
FT                   GREAVRARYVRAMVNRPSAGARVVAPLMPPVDEEGSPGTIAAATAAAPASPARSVAASS
FT                   APATPARGIPVGRGGYPSPAGRGGNSPHLRRSARSSASFDTAGTAGDDEGTPAVFTTAA
FT                   EELRARAEASAIAVAAAYSTTSAPTTPARHFGTYEPPSVPNSEMRNSATRNSTHRRLYG
FT                   RAASAADEEEDEEARGRRTGDGSHADAREGRRAIDLASVAAALGGGDDDCDDDALNSPL
FT                   NSPSRFSRPFKSAARELAELGESAHAVMRALIANGTASAPATPLAAGWGDSTVGRPAIA
FT                   AAVAAAEAGGDAEGRAARLVRRLLEDE"
FT   CDS_pept        complement(160898..162532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639015"
FT                   /orf_name="MICPUN_52609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70458.1"
FT                   /db_xref="UniParc:UPI000199C751"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP4"
FT                   /transl_table=1
FT                   /translation="MRSSILISPTLSIGKILTPASPLLPHPGRSDELSKTAPAGRIGGV
FT                   ADGPSASSPMPVASPGGFMGATAPAGSVHDAKLPAYYEYLAPSRWKDGRLTKAQAKATA
FT                   DRLFNDSLERNARKHERANRPLPRSRFCGKSSAKEERDARFDFLAEDANAWVAKKGEGC
FT                   EPPPLPTTGKVMFCVDPVSGILVPDGLEPAPAFGPKKYTAVCIKQYASPRAQRLAKKIE
FT                   RFDEYMPDLTDEERKILGLPEYGVEPEPPDDAAIAEMAAAEEKREADKANKKKALLAKQ
FT                   RKFFREKNAEFKASREKSMATLDEAMRAKLAALVEDAKALERARQTKREISVAKFKEEQ
FT                   AQLTRKMKAAKIETERRIEEARKRREDEMKKGDAVRAELEAERIAEKKADLKKMREKAA
FT                   ARKAEFEAMMNAADGAGSALAQEINHFRKLAAQRTKEADAKNAAERKKKRLEIVAMNKK
FT                   YEAKMAETFKRQDEEMKKRLAEYKAHAEKDAKAQAAHAEQTMAALKKALSGEHLKAPRR
FT                   RRGETEAAEDGEEGDAREPDGEGETVP"
FT   CDS_pept        163034..166762
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639016"
FT                   /orf_name="MICPUN_63272"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO70209.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199C7E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP5"
FT                   /transl_table=1
FT                   /translation="MGDDDDGSSRRTSPLDRSPRSPASRLGNARIANALACAPVTTESR
FT                   DASARSGPADDARETEETNRSPAHRMSVYIGTWNVGNTAPRMDAAKAWLAPARGHAIVA
FT                   VAAQEASYPHSKHNLSPKDVTAELSERKGDSTANPEVGGSTPPSRGTEGKSRGVGWRMT
FT                   RSKMTRFSGAVAGALAGAVAAGPLAPIGAVAGAAAGYYSSAKVAEELKVRDHWFDLVKA
FT                   AVGPEYVTVQTAVLLQMRLIVLARRDVADLVTETRVGYQATGILGGTVGNKGGLMVRIE
FT                   LAHGRESMAFVATHLSAHEGEKHVRSRNESLARILAGCWDGSLVRRLGEGGNGVDVDGG
FT                   SSRPSAGRDGDDAGDVRGGGGGRGGREREETRFEYGEDGTGGGTGGVGAAGTGDADADA
FT                   DVEGSIPTRSAGPETFGGGRSPTTRSMTARSALPGEETPNNASSASSAETPIRIARQLS
FT                   RKAGDFLQEAGATVTASPAMRRAREGIEKLQSASGKVLAPGKALNSRAGDATTGVVSGS
FT                   GDDKKLPPSRVFAKEPARELLACTGHVFVFGDLNYRIDPGAVVHREWGAMWKRSNDAPS
FT                   GSIAAAVAGLAAKSAKKKAVASAFQATSPSGKGGAGTAGDGEDGGSIPGSSANPGSSAA
FT                   GSSAATPSGAATPVRGGPGADDRHADRHNDAFNSAAWVEGWRAVAGLCDASDWASLRAG
FT                   DQLSREIRRGVVLHGFREGALAFRPTFKLDSSTERKGDAKANPEVGGSTPPSREDQSDV
FT                   STHRGFSRKRVPSWCDRVTFGSLPGFQNGFQNGSDRVRVEAYGACHGLTTSDHAPVYAS
FT                   LDVAIRGVEDATCGDDSGWGGGSGGWEGRLRTTPERVRRARSTGATTTTRLRAAAPPAA
FT                   ATVAVNSLRVVARGFQNGFQKGGGGGSKGGTTADLSSGDSSARLDKAKSSDKTDNQGDG
FT                   GEPDSSAAGSDVDAAAAALRRLLASVTSVPTSTSTSSPPPLPVTVHVSCEGGVEVVAPE
FT                   APADRAAGASVVRVVGEPRGRGLDSPRQLSDDEYDDDEYDDEDDEEDGSTKKTRLGAKL
FT                   EISWADGATPSIALAPRCATVDTNRQPRGSPPRRARLGTRRSTRGSKSEPVGSGKESVE
FT                   ASAEGLEPGGARTSLDETAEDALASRIEALTMSPSPSPGGADFSSPQTWSRVSRVNALG
FT                   ACHAIVTISVDGCVAGVGVVGLGEAVKIVADGIRAGDVRDEQVASSGAVRFSVPLTRCG
FT                   RLFGRVEGTVSIAVPAA"
FT   CDS_pept        complement(167011..167799)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639017"
FT                   /orf_name="MICPUN_103573"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO70459.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000199C7E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP6"
FT                   /transl_table=1
FT                   /translation="MVAERRATRASAGCGFPDANPVVKLESSSPKGKPPPTRAKTQAKP
FT                   AAPPKLPAAKANVVGPNASPPQFPCFAKEEADDLALLETVPEEEGEEEDEEEKKMRRMI
FT                   SNRESARRSRQRKQARLSELSAATQNLWQDRCQALENVRMMTQLLVKARDENSRLEQEL
FT                   AVLGRHALSMTDEGAVLLRDLDQHAKIASARQEASRELRRYAKKLSRSPSPTIAASIMT
FT                   AGGSDATAMTTAPVIVAAPTAVAASGPVRVNLGAVSCPGA"
FT   CDS_pept        168463..169209
FT                   /codon_start=1
FT                   /gene_family="HOG000265592" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639018"
FT                   /orf_name="MICPUN_109306"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70210.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199C7E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP7"
FT                   /transl_table=1
FT                   /translation="MNAPHPASVRLLRRRRRPVRTFRASSGDDEDASSVNDASSFVEFK
FT                   ESSVPGGSKPTGDKKPLPGSGVNLYDPAATASRWLTRRFGIVGGLGFVALLASVEGGEI
FT                   LRAVLENLREGEGTNEEFPLGPPELGLVASDSRVGGGATPKRGDFTGVNVVIANADTGD
FT                   VYVDTKKTKRPIAFTFERKPLIAPVCPALEEGVRTMKRGGVRKVLAPPEAGFGERGVVL
FT                   SDGTRVPPNARLALTITLEEVSSSYL"
FT   CDS_pept        169471..170025
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639019"
FT                   /orf_name="MICPUN_103571"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO70211.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000199C7E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP8"
FT                   /transl_table=1
FT                   /translation="MFRRCAFTAARAALADVPRASSAASLGCPASRDAAAAAGAGFGAR
FT                   RWMSCWVVGSMGSVGGAPGYVSTRPPVGPARIVEAARPHQRPAIPETGVTRWDVNVEHG
FT                   PFGRGGGEMELTAVPKRKVTPSRKGKRNQFKRIRFVGEAVRCADCGKVKKPHVYCDQCS
FT                   TNVFDRGVEGEGAVPPAGKAQ"
FT   CDS_pept        170266..170610
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639020"
FT                   /orf_name="MICPUN_63268"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70212.1"
FT                   /db_xref="UniParc:UPI000199C7E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIP9"
FT                   /transl_table=1
FT                   /translation="MAPLDAVMPEDLRAEHTRNTVEYMKNLAPPRITTRADGGASKTQM
FT                   EAARWREEAAAKDDATRARDALKEDETARLERERLASAWRVFKYDTQPSGAEDRGGAAS
FT                   GDGDDVMISG"
FT   CDS_pept        complement(170786..172003)
FT                   /codon_start=1
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639021"
FT                   /orf_name="MICPUN_98184"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70460.1"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000199C7E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ0"
FT                   /transl_table=1
FT                   /translation="MVKWVSNLTKESVVDIQGLVMAPESGKVESCTQQDVELVAQSIYC
FT                   VSRSEPRLPFEIDDASRPETDFDKEDTTYVRVGQDTRLNHRVIDLRTPANQAIFRIQSA
FT                   VCELFRDALRAQDFVEIHTPKLIGGASEGGASVFKLDYMGQPACLAQSPQLYKQMAVES
FT                   DLERVFEIGPVFRAENSNTHRHLCEFTGLDMEMAIKEHYFEVLDVLDNLFLHMFDGLNE
FT                   RFKHELQVVSQQFPYEPLKYLRPTLRLEFPQGIAMLKEAGVEGVDPLGDLSTEHERILG
FT                   QLVKEKYDTDFYMLTKYPAAARPFYTMPDPADPDYSNSYDIFIRGEEIISGAQRIHDPA
FT                   LLTKRAVECGIEVDTIQAYIDAFKYGALPHGGCGVGLERVVMLFLNLGNIRKTSMFPRD
FT                   PRRLAP"
FT   CDS_pept        join(complement(174107..174618),complement(173708..174013),
FT                   complement(173086..173593))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639022"
FT                   /orf_name="MICPUN_87107"
FT                   /product="D-erythro-sphingosine kinase "
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="ACO70461.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="HOGENOM:HBG558049"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI000199C7E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ1"
FT                   /transl_table=1
FT                   /translation="MPHGNLWGWGETGRRDSVSGAVAADAAPEPSKAGRLLVLVNPAAG
FT                   KGRGVAAYERDVAPVLAALSGCGVVVEMRVTALRGEAMKIANALDLDAYRAVVCVGGDG
FT                   TLAEVFNGLMTRPDAARAQSFPVGVVPAGSGNAVAKSLTHRVAQPCDNCTAALAIARGH
FT                   LVSLDRAESERLPIAMHALLSLSWGFFSDVDIESERWRFLGGARFTVGAIVRVLFMRRY
FT                   DARIRFRPLGAEDAADAAFFLEDGSSDDEEDDGAFYNKFDISRSRKRKGSTPGWREIAG
FT                   DDVQGVWALNLPWAAEDMFAAPAAQCSDGAFDLLVFKGHSRLSLLLNLLKLDAGRHVPH
FT                   SRVTYVKASELEVVPGASSTGQGGYIAVDGELVARAREVNAGGAGGGGGGGGGGGGGGT
FT                   SAVRMVTEVDRNWRVPYGPMSLRVVRGSARVFGSSRGGGEEV"
FT   CDS_pept        175125..175883
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639023"
FT                   /orf_name="MICPUN_63265"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70213.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C7E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ2"
FT                   /transl_table=1
FT                   /translation="MKTVVVTGASRGLGLELARAYIDDRVKEEKYAPRWRVVAVHRQHT
FT                   DVIDGPEGFERTRGIDVSKADASDALGIVLAKHGPVDVLINNAAVCIGRECAVGNVDYR
FT                   AWTRSFETNVFGAMRVLEAALPHLARDAVVVNVSGRMGSIGRVMAGLGASSATTQDVVY
FT                   RTTKAALNMMTVCAAAQFKAKDETKDVKVVAVDPGWMNTDMGRRGGTVTTPAPPLEPED
FT                   SAAGIVALIAGLKPEDSGKFLNWRGEELPW"
FT   CDS_pept        175965..176717
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639024"
FT                   /orf_name="MICPUN_63264"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70214.1"
FT                   /db_xref="UniParc:UPI000199C7E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ3"
FT                   /transl_table=1
FT                   /translation="MTMGSPFQSLTTLLPGGYSLRSIPPSSPQSPAASASSSSASSSIA
FT                   SSFLVFWFLVFGNTNAPAGASPNASASYVSTPTNAAPDALRGALGRTRGSCVSNDDETR
FT                   DPEESASALAMTPAASSPSASSSTMTSPEPPPDAATTRSVVSPPPPVVVVLSGGRTGTH
FT                   RTMRHTGDPSTTCGANRSPQRRWSPPGMRAKNASMSATFAKPRISIWMLDSGTPTAPVT
FT                   RETSAGSRPAATPTVWTHSPSISSALAL"
FT   CDS_pept        177230..179503
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639025"
FT                   /orf_name="MICPUN_63263"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70215.1"
FT                   /db_xref="UniParc:UPI000199C7E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ4"
FT                   /transl_table=1
FT                   /translation="MHGSGHRMPPLGTDGVGGDPPKGTIAMDDASTDEPRSVPSKTPSA
FT                   KASPARDSDGATVPLKDTIADGGDPASPIESAALRSRVIQLEAELAEAMTMAENPSSVE
FT                   LAAARSRSISLEAELESARADARKSEEAMGGMLRMQRAMSSAQKAKITQLQEQNAQLEA
FT                   RIVELNASLAEARTTADAERQSREELRREAEKFEAHVNDAIESREAQWGAANAHAVNEV
FT                   RSELKAAKELTRKMHVAHAAAKLRWAAERAHIIHSVHSVHTAGEDAGVDSAHSLGALAA
FT                   ARARSDVAGSIPPSGGGHHDPRALAAEVAASSAPGTALHALLAATTRFSTDARRTGQPS
FT                   DETAGGETAGDDSAHDDPLRELLRDAMEEEVAAAIERGYHRDGDTIVVGANEIVEAIVA
FT                   KYSERGDDGDGARGGGDGSQGGGDGESAPSGTTRDSGGERRDESRRNVDDVNSDDEERG
FT                   AWRAERASLVAELARARAAADAADTRAALLTANGANGLANGGDDSQNVDDLAAAYEAEE
FT                   AKAVAALEIAAELRANALEAELEALRRRAVSPAQLRAVLEELRTLRAKTEALKQGCVMT
FT                   QRLVRPTVESAIACLRLDAAEGARQGSLADGADGGRGGGGGGGGGGGTDGGGNTTTPGF
FT                   EPRTSTTPGARIGFVSPRTAANGLNDGTPRTPSVGQIGGYPRASSSSAAANTAVTAVTA
FT                   EDLPETFRVAMDGLGFSKSLRKSAAVLVAEAEADAARRALASAAKKALASIMDSPAGRN
FT                   RRAG"
FT   CDS_pept        join(complement(180568..180610),complement(180355..180390),
FT                   complement(180109..180209),complement(179756..179932))
FT                   /codon_start=1
FT                   /gene_family="HOG000238324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639026"
FT                   /gene_name="PSBW2"
FT                   /orf_name="MICPUN_106364"
FT                   /product="Photosystem II 13kD protein, chloroplast "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="photosystem II"
FT                   /protein_id="ACO70462.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009523"
FT                   /db_xref="HOGENOM:HBG591331"
FT                   /db_xref="InterPro:IPR009806"
FT                   /db_xref="UniParc:UPI000199C7EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ5"
FT                   /transl_table=1
FT                   /translation="MACMSLSMKCAVAAKPAARKVARKATVAKATVAKASVPKKAVLSA
FT                   AVTGLVAQTLPALAVVDERLNGDGTGLILGINDEILGFILLTIPALVFSQFFYAQKDDG
FT                   IAAGGENDDSGLSL"
FT   CDS_pept        complement(182725..183816)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639027"
FT                   /orf_name="MICPUN_109304"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70463.1"
FT                   /db_xref="UniParc:UPI000199C7EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ6"
FT                   /transl_table=1
FT                   /translation="MSGVSARRDVSGGYGGDVPHCSAWDGPCFKVEWLSGDATAFGLSG
FT                   TRTRRWGGGRQRTPVAGCGRTPADALAALLDAMGGVLKGSGGWRGFRGDDAFGFVASRV
FT                   GAPPATTKTRVRDRLDELVARACRLAPRPVRLRAPHGVGLALVRGSAYAGLGLGSVNSK
FT                   ELAGVDCSNPVRGKSIDFSIDRGLVAAAIASPDVFVSAEYPEREYPLLPGYQVSFEAAP
FT                   GVHVACRLALEAVKRERKGRGFDPYMAFRVERRDGPRVVESCCAQAGDPERCWRKVPSL
FT                   MRRCAVDAAPGRVIKGEINSKGGDRFEGLGAHLFGLESREVLELLRGHRRAMGSAGGPE
FT                   WCPKLPPAEKGEEGAGRDLQTFS"
FT   CDS_pept        join(185229..185948,185985..186443)
FT                   /codon_start=1
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639028"
FT                   /orf_name="MICPUN_98183"
FT                   /product="Predicted protein"
FT                   /biological_process="translation"
FT                   /protein_id="ACO70216.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG629960"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI000199C7EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ7"
FT                   /transl_table=1
FT                   /translation="MKLLEEAFTKGRGGHVRLVPDNPEDMWHVYNLIRVDDHVDAVTFR
FT                   KVTRGGGDEHAGAAESERVRVRLRLRVEDVAYDGEGDAVRVKGRNTTETDSVKLGAYHT
FT                   ITLEPNRPVKIEKVEWDVLDVDRVRELSDPAATADLAVLLITEGLANLALVGASVTTFK
FT                   AKVEKAMPRKSGAAQMGYAKALETFHRNVVAAVERCVDFAKVKCVVVAGPGFAKDAFMR
FT                   HVDATLARTAGGGSGGDGLASEHRGKFVECHASTAFRGALREVLENPAVMTLIADTKAA
FT                   AEVRALDDFFETLADRPDRALYGPAHVLAAHDMLAIDVLLITDAIFRTRDPNARRRWAR
FT                   TVDEVRGAGGKVHVFSAAHASGEQLGELTGVAATLRFPLPDLVDAELPPPQF"
FT   CDS_pept        186642..>187283
FT                   /codon_start=1
FT                   /gene_family="HOG000230791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639029"
FT                   /orf_name="MICPUN_72123"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="ACO70217.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG732046"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniParc:UPI000199C7ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ8"
FT                   /transl_table=1
FT                   /translation="MSTTNRLNVVPTVTVLAVIKNRLAGAQKGYKLLKKKADALTMRYR
FT                   QILRRILDAKKTMGRTMRDSAFSLTQAKYVAGEGIKYTIEDTVGTSSNVRVRSHVDNVA
FT                   GVKLPRFEHYLAGTTSEAADLTGLGRGGAQVQAAKKQYLAAITLLVELASLQTAFITLD
FT                   VAIKTTNRRVNALENVVTPRLENTVQYIKGELDELEREEFFRLKKVQAKKK"
FT   CDS_pept        join(complement(189249..189461),c
FT                   omplement(<188280..188333))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639030"
FT                   /orf_name="MICPUN_73919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70464.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C7EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIQ9"
FT                   /transl_table=1
FT                   /translation="MHDAAAMGDARAVARRLERGEHPDQGDFLSQTPLHHAAARGKTSA
FT                   VVALLDGGANADARDVNGRTPLHCAAACARGRLECVRTLLRRGA"
FT   CDS_pept        190139..191206
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639031"
FT                   /orf_name="MICPUN_95622"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70218.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199C7EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR0"
FT                   /transl_table=1
FT                   /translation="MATRSVAARCLAFVLLLALTAVASAADYYKTLGLNRGASDDQIKR
FT                   AYRKLALKYHPDKNPGNEEAASKFADIGNAYEVLSDAEKRQIYDRHGEEGVKQHAQQGG
FT                   RGGGGGFGGGDIFSQFFGHGFGGFGGGPQEPETPKGNSLVIDLDVSIRDLYLGRVIRVA
FT                   RDKSVIKPAKGTRKCNCKQRMVTRQIGPGMYQQFAKEECEECPNVKLGRESETIAVEIE
FT                   PGAPDGHEMLFFEEGEPIVDGEPGDLTFRVRTARDDRFERRGNDLHMTFRVDLVEALAG
FT                   FDKAFTHFDGREVRLKRLGITTPGLVETIAKEGMPVFNQHQKFGNLVVTYQVDFPKKLT
FT                   EKQKGEVKKLFAGTF"
FT   CDS_pept        join(193914..193916,194348..194554)
FT                   /codon_start=1
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639032"
FT                   /orf_name="MICPUN_63254"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70219.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG748692"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="UniParc:UPI000199C7F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR1"
FT                   /transl_table=1
FT                   /translation="MPKQMLEIKEFLITARRKDAKSVKIKKVGTKTKFKVRCSKYLYTL
FT                   VVDDVNKANKLKQSLPPALAQENI"
FT   CDS_pept        194940..195977
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639033"
FT                   /orf_name="MICPUN_63253"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70220.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000199C877"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR2"
FT                   /transl_table=1
FT                   /translation="MKYAAGDLYHALRGKVVETTKQGEGWRQAEQFEAAQRAKMGEGNE
FT                   RRDRDANGKILSGAQQRNLKNSEGTVDWASKFSADERYSLVDFGVAKRHKRDEGVDIDK
FT                   IAAAAKAFAAQKTAASADAGGSSSGVGAHEAGGGAPDSGSKRKRDGAPAADDDAAAKKT
FT                   PLAPHAGFEPSTSGPPPPFALPPPETTLAKRIETVAGFVRKNGQKFEEVTRAKQRGNSE
FT                   FAFLDPGGEGNEYYAWLRHAARAGIDPKKPPGVGENAAFDPVALAAAAKKIAEAAAAAA
FT                   EQQTKGGGDAQEGAQQEGAHHEGAQQEGAKGRVGPWQAVKDSSGRTYYWNRDTQATTWT
FT                   PPDGF"
FT   CDS_pept        join(complement(197454..197456),complement(197189..197293),
FT                   complement(196093..197070))
FT                   /codon_start=1
FT                   /gene_family="HOG000224566" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639034"
FT                   /orf_name="MICPUN_92159"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /protein_id="ACO70465.1"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="HOGENOM:HBG525197"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR006602"
FT                   /db_xref="UniParc:UPI000199C878"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR3"
FT                   /transl_table=1
FT                   /translation="MEDERYCFIVEWLDPHSGLTMRYQMLYGPADCSVEMYDIKNRRPF
FT                   LKKTRIPTVTMDTLHMGAVVTVYSRQLKIVEYGDAHTENAFSLARQSTLCVVKPGAAHL
FT                   AGKVINAAQRSGFAVARVKMASLSREDAADLIGSSSSISDASGLAAELATGPSVGVALV
FT                   GDNAVDSFKRLVQTEIVPALGDCVWCADSADSVDAQTSAYFAKPASCRLRDTALAIVKP
FT                   SAMANLGLVMDAVCVDAGFVMTGAASFTLDRVDAVEFLEVYKGVVPEFAAMVDELTSGA
FT                   FVAMEVARSEKDGGSVSENGVVEALREACGPADPEIARVLRPQSVRAKFGFDKVRNAVH
FT                   CTDLPEDGELETHYFFKILQA"
FT   CDS_pept        197515..198846
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639035"
FT                   /orf_name="MICPUN_63251"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70221.1"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniParc:UPI000199C879"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR4"
FT                   /transl_table=1
FT                   /translation="MAIGGLRPTGISPLDRSRRHQTARLHSPTRGRFSAFTSGPVAGGM
FT                   CVVFLYVRTPKRPGEEAIDCPYAAVVAVNRDESYTRDTARLHWWPQDATADPRECARDW
FT                   QILAGRDREGGGTWCGVSRDGRVAVLTNVAEASAKFATGEAPSRGELPVAFLEASGHLS
FT                   NLPRRIDHSPSTHPPAPEPSNRRPSSQEKHPRRPPARWLADVAAKAHAYNGFNLVVGDS
FT                   RTGEFAHLTNRGDDPGVVTRLDEDGPTRCAQGFVHGLSNAGLNTPWPKVRLGCQRMRQQ
FT                   MERVVGSGVFVEDGVEKRLLGLAAKRSALPCALITDVLQCPGGGVDAWGSKGWYSRSYW
FT                   GDGHEMNPPPALDQSERAFVKPGAAPGRPEYGTRCSTAITMRGDSPGGEINVVERSLEW
FT                   DEREWVETAVAFDRVPPPPVPADPSAGRREPDGTFLHTALDDGW"
FT   CDS_pept        complement(199002..200375)
FT                   /codon_start=1
FT                   /gene_family="HOG000265359" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639036"
FT                   /orf_name="MICPUN_63250"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70466.1"
FT                   /db_xref="HOGENOM:HBG607516"
FT                   /db_xref="UniParc:UPI000199C87A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR5"
FT                   /transl_table=1
FT                   /translation="MAHASLSTPVARVGLGARKTRAPRRVSTVARAGKTGAGDDDNADD
FT                   GAKFMGRRGTYRKEVEDDAETAAARSSVKQQGGFGKPVTAKETWQPFQRTARAGLLEAA
FT                   EGERTGSGESRDLVLTSLYISMEDDAFKSRTAVCLPIAAYVKRVDKLMDEFTARELPAL
FT                   VQAKNGAALTTPEIIEALETHLFVTNKYCAPKGWRELYSPYRTYFHNVVAQKVGIPATL
FT                   AALYIGCVDRLRAKGVIPEGEGVDVLIRPKARNGMAGVTAPVAPWGVPSGAKRPANSVV
FT                   CTHNMALKLQLAALKRAYWPWEWDDSRDSGVLLAVEAAAYGQENRMNTAAGFVGIIQPS
FT                   GRPFGDLPMAILATERLLELDGGEGYEQRDLGVLMFHDGKIKEALEHLEAFELWREGGG
FT                   DDAAPNLVSDVLNAGGTDAVLAAELQVREDEALAKLMLDLRRMALEEALEGGIKSGDV"
FT   CDS_pept        200637..>201486
FT                   /codon_start=1
FT                   /gene_family="HOG000216468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639037"
FT                   /orf_name="MICPUN_69261"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="ACO70222.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG605012"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="UniParc:UPI000199C87B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR6"
FT                   /transl_table=1
FT                   /translation="MRIAVEGCCHGELDKIYAALAHLEKVENVKVDLLICCGDFQAVRD
FT                   ARDLECMSIPDKYKTLGTFHRYFSGERRAPVPTLFIGGNHEASNYLWELYYGGFVAPDV
FT                   YYLGHSGVVRFGNLRVGGLSGIFKGNDYRRGHYERPPYKRGGEVKSAYHVRQFDVDKLR
FT                   SVREPIDVFLSHDWPRGISRYGDQADLIRKKRFLADELRENSLGSPPAEELLHALKPRY
FT                   WFSAHLHVKFAAMVRHGDGSATRFLALDKCLPRRDFMQIVDVPDRDPTGGFRLDREWLS
FT                   IL"
FT   CDS_pept        complement(202132..202983)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639038"
FT                   /orf_name="MICPUN_109301"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO70467.1"
FT                   /db_xref="UniParc:UPI000199C87C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR7"
FT                   /transl_table=1
FT                   /translation="MFGPKDSMVQGLLQAMKPHARSAKDDDDHSAEVRHAEFNALVEQI
FT                   ARESTEPENDPEKSLKSGLIRLRDALASMPSTPSARHDVAAELVHLHAHTRRYWSVRRG
FT                   DHHGAFTAEEIPVRENEVNSFGIGAEGASEQIVKQVRPEYKAGTAGGALLVWYKQEMSD
FT                   PLQWVNANRRGCVVIPDVSCAYSPRPGVAVAKCGAREREAWLAHLAEHPEDPWPQHTGP
FT                   WGPANAQRLIGSPVLDAFMAAHKAGWGTKFGGGRDEEDEPGRPRLDPDVLTWLLDRKHP
FT                   EC"
FT   CDS_pept        207710..209101
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639039"
FT                   /orf_name="MICPUN_63247"
FT                   /product="Predicted protein"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="ACO70223.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI000199C87D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR8"
FT                   /transl_table=1
FT                   /translation="MQRGASLGRAMVSLATRGAPAHLARARSGATATTSSLTRASSHNG
FT                   ARHHATWSLQPSHPTPRPPHRATRGRPSSPPVVARSSTTDSTSTSAIKGDRVTLPPPGD
FT                   VHLWIMDPADAADPALCRDYRERCLPASERDALESEAANMTEGALRQATHSKALMRWVL
FT                   ARYCGGEVAPADLRFAHGEHGKPRLVGVGGGATSSSSNPSASHDDDDDDDDAAWTRIRF
FT                   SVSHTNRLVVLAVTSAPGIEPALQQRWKPCGSPTPSASPGWGADVPANASHEVGVDCED
FT                   ERRRTSAAADKLAGRWLSALEHDALKAIGDDDARASAFMRTWTLKEAYVKALGTGIAAH
FT                   PFGGFDVTLRQSDGRSKVSSGLAPPSSPGVITLTERSGTSAVERRAWAATASRWRMALL
FT                   KPRADDSLLVAVCADGGSREGSNDASAGMNVRVRWTVPMVGDVAEGTRPPPTLIARSEG
FT                   FGALE"
FT   CDS_pept        209234..210949
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639040"
FT                   /orf_name="MICPUN_63246"
FT                   /product="Predicted protein"
FT                   /function="sialyltransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="integral to Golgi membrane "
FT                   /protein_id="ACO70224.1"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0008373"
FT                   /db_xref="GO:0030173"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="UniParc:UPI000199C87E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIR9"
FT                   /transl_table=1
FT                   /translation="MVLYRPPMNTHKVTTMIQSGRTGVTIAWAASSAQKEGRNAFRART
FT                   APAPMATKKITVLDEGAPLLGAGLPPIRTKVGAPSPGGAHASRRAHGAATNGTTRSTMG
FT                   AFAAAVLLVTGAGGAAYRYRTHQLQAGEMSVVAQRTLAKLQEKPQWCNSCAVVIPTDTY
FT                   SGKGWGQQIDAADCVVRFNDRTPNTLSPEDLGMKDSIRVISGDGPGNPAWTSPCAAADG
FT                   CEREFVTYDVSSDPNALRTLADAPEIELMSVLAGLLNTGDPHVALRNYATTNAYPSVPT
FT                   WASAGFVAINALKHPRMCGSLAIYGVNALKSMHRADAEDATGTHDYPLEHHLMREAVEA
FT                   KAPGWENVRVVDMDATANEVWSAPDDENLLAYSRVTTMYTPPTHLVPTSAEPKGLDKLR
FT                   VDPVAAGDDGIRSGDLPDPNPGSGVGGVQRSSGDADAPVAGLAMKNARANARTRASTAS
FT                   VDTRGSSSSSSSSSSSTASTFAKPWTNVESDDDAAAAFAKPWSAGSEPDWSTYDAVNHA
FT                   SAVEHERDWGDVLGAWDEANEAHRAAYVPKKVYRHRGAPTTMAQAGRGLALPGE"
FT   CDS_pept        join(<211447..211703,211758..>212139)
FT                   /codon_start=1
FT                   /gene_family="HOG000265320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639041"
FT                   /orf_name="MICPUN_72453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70225.1"
FT                   /db_xref="HOGENOM:HBG717278"
FT                   /db_xref="InterPro:IPR007051"
FT                   /db_xref="UniParc:UPI000199C87F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS0"
FT                   /transl_table=1
FT                   /translation="CQRIGCDVVYDALRGNPPGCCRHHPGAPVFHDGTKQWSCCGARSH
FT                   DFALFMEIKGCAVGRHTQVKPKVTRAAPSPNAAAPGAAPVPRGDPASKARCARCAQGFF
FT                   CSDHAASAEAQAAYVDPYAARRATCHVYDDVDDLVDDVDPLEPRTCRNAGCGARYTEAE
FT                   NADDACLHHPGPPVFHERKKGWACCDVHVYDFDEFMRVPPCAKGRHRAHP"
FT   CDS_pept        complement(212260..214719)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639042"
FT                   /orf_name="MICPUN_63244"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO70468.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C880"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS1"
FT                   /transl_table=1
FT                   /translation="MASIVEVAHATDGAPGKLAAPAPVARAMPEWSDKEKAKIRRVFDE
FT                   CDADHSGTVSFAEITRGLAKDKELARILGIPKEAATASGVEDLKAIFVGLDVDASGELD
FT                   FDEFGLFFAERVEILRYLPGADDDDKFCVMTESAAHLSPNLAASFESKLAAVEPKVDGL
FT                   AAAMLAQLPAAVKHFLEPSAILKDARARGKSLAAAGLTQVSLDAYAAAMLSALADALGD
FT                   DAFTSAHSEAYGKCVRNLCDMYRLGAEDAQKAEREIKAAAIEAAKAKLAAEKLAATEAA
FT                   AKADADAVAIEEAKTAAIEAAKAKLVAEKEAAQTALAAAKAAAEEAAKMAQAAIDAADA
FT                   AEKAAIAELTEKAEADKALAVEAKKAKEAEAKAAEVAKKEAEKAAADAAKACELANKKR
FT                   KEEDARRAKEREAAAKKAAKDKSKKTTAELQEEEAAKLERLAKALEEQARREYEAARAP
FT                   LTLQPLESYAVDGAVPDKGSTWQYPTESDGWFRIHNTIRAEMTKLAAALDACAATGEPL
FT                   PAWKVDAIKSYWSLHSALVRAHHAHEDDIFYPLLATRCALPPKLEIVHGDVLELSAAVD
FT                   LAVNALEPGADLVPLVSAFDAYKATMEPHFAEEEAVCVPLMRAYFSFKEIAEVMAPMMK
FT                   KMDPLVMGAFVHHQGSKDQFMKFMKQEKIPAIAWYADFKSMRTKYRAAQEAVAQALLTG
FT                   VEPAQGKPAKTGKKDLADAMRCGLGEWAVPIPGYAPISFDEPIEKTEKEEPEPEPEPEP
FT                   VPTVEEETAQEPVEAEGAEEAAEEEAIAEEAEPEAAEEEETPEAPAAAEEEVSAQEEKK
FT                   EEEVSFA"
FT   CDS_pept        216332..>217337
FT                   /codon_start=1
FT                   /gene_family="HOG000265323" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639043"
FT                   /orf_name="MICPUN_109300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70226.1"
FT                   /db_xref="HOGENOM:HBG607471"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI000199C881"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS2"
FT                   /transl_table=1
FT                   /translation="MEDFKEQWEPAVDKLDKAAKAFEGLDLDDLADGPEGFDITKGLWQ
FT                   QTGWQELDSLRRKLEELRELRDLVRSLGRGSGRGPLRRAPRQRDRRGMPVGLTRSPMEP
FT                   EETAGLARSDDLSRMLPGEMALIAQGSRPARLLHFARRMERTLLSYERVGWAEEPAVTT
FT                   DGMEIRPAAECGPIILCLDTSGSMMGARETVAKAMALECMRQAKSQQRACYLYSFSGPG
FT                   DCQELELKVTGQGVSKLLEFLAGSFHGGTDVDEPFIRALDRLGQEEWSNADILLVTDGE
FT                   IRPPDVDVVAKLDTAKEEMGLKVHGLLVGEPGAGADVVDALCTHTHTFKSWSAV"
FT   CDS_pept        join(complement(220574..220673),complement(217463..220452))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639044"
FT                   /orf_name="MICPUN_63242"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70469.1"
FT                   /db_xref="UniParc:UPI000199C882"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS3"
FT                   /transl_table=1
FT                   /translation="MGDEEESDSLGTVEERDYDVLSAVGLDRLRAKLDARDHETRTDGL
FT                   RSLRRALEGPPGGPRDDREIPTPDPDAPRDEPEADDPEENLGDDAPNDAGEPAKAPAGP
FT                   SARPLDAATVVRLFHTCSASLARALADPHPAVHAEACLATAALCAHCDGETMRTFSPWV
FT                   ARDAWPTLLTQLFGPRVVSDRAHMCAVACLGACRDPKLLEQVADAMERTRDGTNPLAAT
FT                   RLLDKVARILGDWPSGALLDACKPHAIRAIDAGLKHGGLAVDGARTTTNDDRDSKFHPK
FT                   SAAEEKYSPRRRTELLDPGVGGGCVDATLAKTTDSHPSTVAVRVAAKAAFDVFEAAWPK
FT                   HAEGWLRSGMEPRWRRLVTHGVLEMPEESGTYARGGYPSVPRGRTSAEVAEHEREEAFA
FT                   ERRNKGSDKGSNKGSANKDPDASEDVDARRLTIPGNFRTTPFQPPYAPLRAKPTHKVVA
FT                   SHPRPPPPKPLWVDPPSPVRRKFEAEKRAEDERRGAPLAEYYEAVRSRGGLSARECGVS
FT                   TGSFDPNDVAKTAEESALYRDLEALDARMETLRVKSVGARMYEHYAEAFYRPGGATDSS
FT                   EISAKRKVERDRETERAWRGELGDEEKLAPGDGKSAPRDGESAGVVERARRDAERLGAD
FT                   AGALPGFSLDAAGRLRRITQPSLQSLRTAGVNAKTPPKVSLATAALLGLPNDRVASPGT
FT                   KGVDERVFTPSRTTEERARNLARIRAELSEFRRDLEAAAAADVPQGAGGRKVGTRGQKV
FT                   GTLETGPWRRDRDATAKAADAFEREVTAANEERDEAKVRKAAAKSAVERHRIQHALKVK
FT                   KLARENLEFEERMFREAEDERVRKEAEHAAALKALAFKARMETEMAGTYALSAEELLAY
FT                   PGPPNPYELGATSFAKKDQKDQKDADKRTTDKKPAAGPKAGPKAGPKAGPMAWGGRDKS
FT                   PAAARAERARAAEKERHERDREARRRLSAAAAKASAGGARDREGGRGTKEGARVSWDEN
FT                   LERTEGGSSADADAGRGKPGGEAEFDSRPLREKVPIGRSY"
FT   CDS_pept        <220878..>221081
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639045"
FT                   /orf_name="MICPUN_74892"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70227.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C883"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS4"
FT                   /transl_table=1
FT                   /translation="DGEPGKETPVEPFGPWKVLGVSFGASDEEVRVAFKRLALIHHPDK
FT                   GGNQDAFVEIRQAFEELTERRER"
FT   CDS_pept        complement(221820..223211)
FT                   /codon_start=1
FT                   /gene_family="HOG000253155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639046"
FT                   /orf_name="MICPUN_86817"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70470.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199C900"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS5"
FT                   /transl_table=1
FT                   /translation="METRRNPSSKPIFGKEELDEVIALAIPALGSLLADPLMSLVDTAV
FT                   VGRHSSTSLAALGPSTAVFQIVFQLFSFLSITTTGMVARACAGGDNGTVRRALANSTIL
FT                   AVAFGTATCLGLNAFAPAVLSAMGCSPDLVATATPYLRVRAFAIPAVLFCTSAQGGCLG
FT                   LQDARTPLLIFTLAAVVNVAGDLYAVGGAWGGLGLGVKGAAWATLAAQYVSAAVFFRVL
FT                   TSRRMLPLTWGDWRLPSGAEMRQICSISGMLLLGSLCRMGVYTMMTMTALKIGALTMAA
FT                   HQVALQIFWTLTYFVDPLFVAATSFIARDHGRRPERVRRMAWLLLRLSVGVGAFIAVVC
FT                   YLVPTHAAGAFTTDATLATMIGSIAPLMGTAQLVSAVVLVAEGVLIGCGDLRYLLNVHC
FT                   VNFIALGALLWWVRHSGLGLHGIWIAVLANQLLRLTQHAAHVWRGGGPDLLDRATTRAT
FT                   AGDGG"
FT   CDS_pept        223784..224401
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639047"
FT                   /orf_name="MICPUN_63239"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70228.1"
FT                   /db_xref="UniParc:UPI000199C901"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS6"
FT                   /transl_table=1
FT                   /translation="MIEGRRPWGSRGEIWTDLPSATHALILSKCGCDRRVPIESHPPWC
FT                   SAPPQCGTGRQRHQKSCLPNGQEPIKNPDAKEDRDWSRLSRAGDVSPSKQEANFGGRRG
FT                   FGPFVHFSRKTAPCCPQRSALNMAIDWSKIDKKSLAVLIGLCILFNWLNKKLVPWMESS
FT                   WKWRAELKANADKVRADWDAAAEAEFASETKGKKKREGKKKK"
FT   CDS_pept        join(complement(235402..237081),complement(224539..235329))
FT                   /codon_start=1
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639048"
FT                   /gene_name="DHC1.2"
FT                   /orf_name="MICPUN_96693"
FT                   /product="Dynein heavy chain"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="calcium ion binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /protein_id="ACO70471.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199D595"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS7"
FT                   /transl_table=1
FT                   /translation="MAGPGEGTGESRLARGSQGGEWPARPARSESSVTASNFVKIQPSW
FT                   MSRDGGDATRGDIPRVRAMTGARPSGQTIGKSRSTAHDYYAPEDVLDLSASYDSPTVRL
FT                   PPVSPGKRSSAPNLSGSLARASKGPRASLAQSQPRRSEPAARSSSNDGRALMGSSASRG
FT                   SLGAGSWGGFDAGGSQGRSTRRSLGGDGTPEGAGIFTSTDVVEYYVKNGLGAPIKVFYC
FT                   VDAPRTEDSFTPYDLLVVPKNQVQGKNVEHYTVSSSGVVHIRPGVQSEFTPLGEWMRDS
FT                   SVFSLLRQMKYFKMYLVGKTFKIWRANVRRRLYEQVRKRIERSLFLTKPTFSSTVAELG
FT                   ALCAEVRYTPAIVVDPQTTYQVDDFREIQERQRANVVVPAMESCQERAAAALERVIKRT
FT                   VDQVQEYTKMMETNDSIDAMVSKTKSLVAMKRERQERARGYKRIVEESQMLPNLVRLAD
FT                   LMLTEALVAMVQNSMDGLLHVMRHPDPKSKGVLSTTVQFAHELTTFTPDAKGVMRCIND
FT                   AVVDKLVEAIGAMPRLVFMRAFTPLFEGLENHQGFQGTQSPMQKSVEYAKQFEDLRVVY
FT                   KFGLSWNQEEYEQKPKDLPTFRADMRVQRNWVGDLDKMRLGGTVGVVYVDAKTLRGDLH
FT                   STVTSMLEAMKALLLVAAREESTRVGDAFAKRIKTMEPRPDDLAGFMTLVDHAQAHERS
FT                   RKEYNNEHKIVEDMYGMLVNYDMRIPAMDGAKLDDLNESVSKFKGDVDEAKEFIESKTP
FT                   AMMKTLKNDAADLEEELFKVQSTLNQGVFMEANADAALVMEELAAVKTTLDAATAQVST
FT                   YKRYQQLFDLEEGSFDNLKMATKEFDTKFESWNGLRQWQLASQHWLSAPCLDLVLTEIN
FT                   NTVDETNTAAFKMLKLRRDDQVVMRLREEIDAFKRFVPLLQEVANPALLPRHWQRIMEL
FT                   MEQPYDEDKPTSLQNLVDWGIEEKMEGLENIGAAASKEYSLLQTLNKMMGEWAGMEFRC
FT                   MPYKESGTYILGGSEEVQALLDDQIVKAQGMCASPFVKPFEQDAKNWSQVLNVLQDMLD
FT                   NWLKVQSTWLYLEPIFSSEDIVKQMPEEGEKFAQVDAEWRDIMNATKEAPDVIAIGNDK
FT                   ERLNRLVDCNELLDEIQKGLAAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTKVQPHL
FT                   KKCFEGIAKLKFSDGEDGHEEHDILAMISEEKEEVPLKDIISVQQANGAVEKWLLQVEA
FT                   AMFDNIAHITGEGIKSYGAKPRDQWVLDWPGMVVLVVTAVFWTKQVTEAISDGTRAVGK
FT                   YEERCTSDLMKIVDRVRGELTSLQRKTLGALVVMDVHARDVVANLAKNKVSSPTDFDWQ
FT                   AQLRSYWEEDASGARDFTAIMRIMSAEVEYGYEYLGNSSRLVITPLTDRCYRTLMGAIH
FT                   LTMGGAPEGPAGTGKTETTKDLAKALARQCVVFNCSDSMDYIQMGKFFKGLASSGAWAC
FT                   FDEFNRIDLEVLSVVAQQVLDIQRAIAARVTSFIFEGTEIGLKYSAWCSITMNPGYAGR
FT                   SELPDNLKALFRTVAMMVPDYAMIGEIILYSFGYLEARDCATKIVQCYKLCSEQLSSQD
FT                   HYDYGMRAVMAVLRAAGNLKRRFPDEDEHVLMLRSIIDVNLCKFLSQDVPLFEGIISDL
FT                   FPGVVLPKSDYTLMEKAMREACAEMNLQEDPYFFLKTTQLYEMIVVRHGLMLVGAPFSG
FT                   KTMSYRVLARALSIMAERGEEGQVKCEYHCVNPKSITMGQLYGQNDPQTHEWQDGVLAK
FT                   VYKGCASDPSPNRKWVMLDGPVDAIWIENMNTVLDDNKKLCLNSGEIVAMSSVMNMIFE
FT                   VNDLAVASPATVSRCGMVYLEPHQLGWRPLCLSWLNTFPETIKQSFKDRVLALFDWLVP
FT                   VSIRFMKREIKEVAETTYEGTNVAVNLMRTFKSLLVEQLADPKGLIASIKRESDMEKHI
FT                   DSCFVFCLAWSIGGTANSNEGRLAFDEFVRVAYKGELDLPHGDNTVYQGPSGEKYNLPE
FT                   DIPEGHMTTSTPLPPDEVKTKDPEGNLIPTRTTIYDFRWDVTKSEWVPWENDIDKSPIP
FT                   PEMAFKQIIVPTVDTVRYLFLADLSIQYNNPILFCGPTGTGKSVYMQGHLMGMDKEKWA
FT                   PPNFVGFSAKTSSNITQYLIDAKLDKRRKGYYGPPIGKRMAIMVDDLNMPQKEVYGAQP
FT                   PIELLRQYMDHGGWYDRENNFRNMQDCLFVAAMGPPGGGRSPITQRYQRHYNLLSIVEF
FT                   DSKALEHIFGTILAWFYKTKEFPKDIQKLQKSVIAATLDVYNTSISKLLPTPAKSHYTF
FT                   NLRDVSRVVEGLTLQKAEGIKTGLGGVGEHYRLWVHETLRVFYDRLVDDEDRSWFLEYI
FT                   KELTETHFGQNFNELFAHLDEDGDGTVDAEELRHCMFGDFMGDGEPDSQGGDRLYDEIT
FT                   DMKEVVTRLEEYLVDYNGMSKSPMNLAMFLYAAEHVARIARVLKQPGAHLLAVGVGGSG
FT                   RQSLSRLAAFIMGMESFQIAISKSYTTVEWKEDLKKFCRAAGAEGRPCVFLFSDSQIKD
FT                   ESYVEDINNILNSGEVPNLFPYDERAAVMEQCRVRAKKAGQILESAEELWHYFIASCKA
FT                   NLHIILCFSPIGEAFRERLRQFPSLVNCCTIDWFREWPNDALEAVASKILADVDVPAEE
FT                   RQKLLVMCKSFHKGVGELSEEYLAKEGRHNYVTPTSYLELLNMFTSLLAKQREAVSGAK
FT                   RRYEVGLEKLAFTADAVRDMQDELTALKPNLIKTVAETEELMEKVQREKVEVVEPKKAA
FT                   VDEEVAEAAKKGEAAGAVKKECEDLLAEAIPALEAAVAALDTITDKDIKYVNSFKSPPA
FT                   MIKLVLESVCVALAVKPAKVPDPAGTGKMIEDYWPPSKKLLMDPTFIDQLRGYDKDNID
FT                   PVIMEKLRTKYIADETYTIEKAENAAAAAAGLCKWVFAMDSYDRVAKIVAPKQLALAEA
FT                   EAEYQKIMDALKEKQDNLADIMGKLAAMEQQLEDSVNEKKRLEDEVDLCTVKLERAESL
FT                   IGGLGGEGERWKESAAKLGIAYENLTGDMLIAAGMISYLGTFTMAFRDGIADSWVSMCK
FT                   ESGIPSSPKFSLQDVLGDPVAIRKWGIAGLPNDSFSIDNGIMIANARRWPLMIDPQGQA
FT                   NKWIKNMERENNVQVIKLTDGDYLRTLENAIQFGLPVLLENVKEELDPSLEPLLLKQLF
FT                   KSGGVMCIKLGESIIEFSDNFRFYITTSLRNPHYLPETAVKVTLLNFMITLDGLSDQLL
FT                   GVVVAEERPDLEAQRQKLVVESADNKKRLKDIEDRILHTLSSSEGNILDDTAGIETLKE
FT                   AKIVSDEITEKQIVAEATQVEIDAAREGYKPCGAYNSVLFFTIRDLANIDPMYQYSLSW
FT                   FIGLFVRSIHASAEESEDEDSGEPEPGEVDLDERLKIIAEHFTYSLYQNVCRSLFEKDK
FT                   LLFSFLLCTRIMTSEGRLPVEEFNFFLTGGVGVTAKSVPQPKGEEWISAKMWGEVTRLA
FT                   STCSVFENLPDHIAQDTAAWMAIYDAVQPQEMTFPGEYGTQPTAFQKLLVMRCLRPDKV
FT                   TPAVNDFVDQTMGRRFIEPPPFDLQGSYNESNAMTPLLFILSAGSDPTAALLKFADEAG
FT                   KGSDIGVISMGQGQGPKAAVLIEEGRETGKWVLLQNCHLAPSWMPSLEKICEGINAENT
FT                   DEQFRLWLTSMPSPAFPVSILQNGVKMTNEPPRGLRANMRRSFQLEPIADEEFFEGCNK
FT                   PEVFKKLCFGLAFCHGFVQERRAFGPIGWNIPYGFDDGDLKISVRQLQMYVNENEQTPF
FT                   EALKYATGECNYGGRVTDDKDRRLLNTLLRKVYAPAALKKGFRLSESGTYVIPEEGSHE
FT                   SYLDYIATLPILPLPEAFGLHENADITKDLGQTALLTETLIKTGGGSGGGGGAQDELVA
FT                   KITKDIIDRLPPNFDIEAVQRKFPVRYEESMNTVLAQEMLRYNRLLSIIRNSLLQLQKA
FT                   IAGLSVMSAELEKVFNSFAIGQVPAMWMGKSFPSLKPLGSYIEDLLARLDLFDGWYRNG
FT                   QPSIFWISGFFFTPSFTTAALQNFARGNNYAIDTVGFEMEMMEMDPGLYTEPPDSGIYI
FT                   HGLFMEGCAWDKDKKMLCESRPKVLFEPGPCIHLKPVLLSDIKDYPHYSCPVYRTAERR
FT                   GVLATTGHSTNFLMMMKMPTDVDPDHWAMRGVAMLCSLKD"
FT   CDS_pept        complement(237442..238401)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639049"
FT                   /orf_name="MICPUN_86976"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70472.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG752219"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000199C902"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS8"
FT                   /transl_table=1
FT                   /translation="MPGQWNLDRVDGPRLDGYFSPPECLCGKGVHVYVLDTGVRLSHED
FT                   FAPSTVRTESGWNFVGDCTAGGGTVEDKSGHGTHVAATAVGATSGVAKCAVLVPVRILD
FT                   ENGKGDGGAMLSALDWVADHDINGARKIVSMSVGGPRSAVIDAAVRELVHAGVVVVAAA
FT                   GNSGEDASGTSPAGEAAAITVGSTGCEDFGDSFGPSSTMSSTMSTASCGGPDAMSDFSN
FT                   RGAAVDVYAPGAGVRSAWMTGDRDFRRSSGTSMATPLVAGCVALYLEKYPDATPEDVAR
FT                   AIKSSATRMRGGGGGAEDAGVLNPVGMLSTPPAATLRR"
FT   CDS_pept        join(complement(241252..241953),complement(240304..241086))
FT                   /codon_start=1
FT                   /gene_family="HOG000239858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639050"
FT                   /orf_name="MICPUN_86997"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO70473.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG318900"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199C903"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIS9"
FT                   /transl_table=1
FT                   /translation="MGFFRRQREDDVSSAGPNGQNGSLRDPGRSVAIVTTASLPWMTGT
FT                   AVNPLLRAAYLARRGLHEVTLVVPWLTPAEQRMVHPNVIFDTPEEQGEYINKWVKERCG
FT                   FEPKMKLDFYPGRYATDKYSIIPVGDVSEYISDGKHDVAVLEEPEHLNWYHTGSRWSDK
FT                   FRHVVGVVHTNYLEYARLEEHGAVKEAAMRFVNSWVSRVHCHKIIKLSDAVQDFPRSET
FT                   VNIHGVSPVFLEPPPAPEPEKIRPSTEVFSKGCYFLGKVVWGKGFNELLRRVEEHNTSE
FT                   TGVTHPLKLDVFGNGEDFDDVTARAKQKGLPLKFKGRMDHASDAMHDYKVFINPSLSDV
FT                   VATTTAEALAMGKYVICAKHPSNEFFSTFPNCMVYETPEQFSQCVKKALSTDPAPLSAK
FT                   DRYRLSWEAATDRFLDAADIKEEQMRGPGTGLGDKLGETFFAAVHGVAAKHEKMRGVLG
FT                   AGRGTGRGPKAGELGTWGGVPPQSDQPGFTSTRKKQ"
FT   CDS_pept        244039..247989
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639051"
FT                   /orf_name="MICPUN_103551"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70229.1"
FT                   /db_xref="UniParc:UPI000199C904"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT0"
FT                   /transl_table=1
FT                   /translation="MGFLSKIYERRGAAKLRQARVEQFAASKAAGTSSPAGTTPAQRAP
FT                   GGSGGAIGSPEWASTGAFSSRGKTLGGSGGSAAKPGPDPYEFDLEDEPVAAANAGVVPS
FT                   PALAQRLFELQRRESSSPGGGGLPLPPDRLDPTRGSGSPGDADGTNDDRADETTAPKVS
FT                   RRDEKKRVPSRPAPGKRRRVTFAEVDAYDLPEDESDGDGDGDGEEDSDNESVEIPYSDE
FT                   EDEVVVGVGGGGDVASSPPRAMIPPDAPLATTPPPPERGPGGEDAGRTKAGEDDGGEPG
FT                   GGTPVWAKRSLRMTTADTPSPGAKGPAGILKSGPGTVGHGTRGDVPTEMSLSPASSPIV
FT                   VPSGTSRDVRMNPRDPHTEYAAPSNGVNLPESGDDLADLDEAQYALSGLTRNAPAVGKL
FT                   TSASTLVRLASDPRSRRVLSAQGLAPRLTLAALQLGREARATHRRGAIDRAAGAVPSRL
FT                   AKLASASLLYLANLDVRACDAAAAFASDDAALVLATVLEVTPEEEAEERVKAEEASRRE
FT                   RTNGGTNGEATRRDDAKHALSRGGFAALLTRGSDDRCERDISRALTRGLKFLPHEKVDA
FT                   CTLGLLATHRQLVVAEKLAAEAAARATVRQHRRDHRQDKTTTRAMHPEDEDDADVDASQ
FT                   REEDEEEEAMQDEDDEKTVRGWGTLKERLAASGAMLNVARLADDAAREIHRLGAAVFSR
FT                   GPDEAADEDDESIEADGGVDVESEEEDSKRAAAASRAFARLFRCLRVIESATFGSSSCA
FT                   EAVLDGDLSPAPPSVPGSVALVPMRKNPGMLSPAPKSARKSRGNEDADIADVVGDVRVG
FT                   GIDMSPPASPRPDDGGDKRKRAPNDPAADDEDEEALLKKFKTAEALLLTPSPGAKRVRG
FT                   GSAMETQPRGSAVEAPIDADDDAMGSPDPVRKTSGTCGKPEQAQTPTFNFRAVAAAVES
FT                   SIAWLDDGSSDVIAADGRGVGDKLRWTVMHSLLAALPTIAVAAASACHATEAGASICGV
FT                   TVRRRGGLGVDPRLASGTLRHALHVLTNLTNENPRGCAVLRTAPGALETAAALVPWCAA
FT                   LEGLIPNAGPSESARVAAAARSGATAAAGKKTLGKTALSARGEDAANANAASVDMLNAA
FT                   MCVLVNASEVDPEVCGALRVLEADAGALEERRVLRNVRLKGGTFGGRKARDDGQPVRPL
FT                   GLVELLAGIFVRSGGAGPVTDTPAGTVKAGDTAGDIMNKVDGANQQRVKSSEEHAVDGE
FT                   VTADMLATETDDEREGDGLITQAYSALLTAFLVEGQPALRADVVYVLPEGGLNALASVL
FT                   ERFKTFHENLESISEASHASLTRIIRWLKGGS"
FT   CDS_pept        complement(248118..248789)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639052"
FT                   /orf_name="MICPUN_63234"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70474.1"
FT                   /db_xref="UniParc:UPI000199C905"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT1"
FT                   /transl_table=1
FT                   /translation="MTTLASIAPVSIHSRAGHRETRARSLRPAVRASPRRNKGVVICEA
FT                   AADKDFACRVASLAAAIAVVAYEPLPAIAAFGQSTIELSNITYTVVECPTGKRSMTQGK
FT                   PACLLVKADSVNPSKETVYNADVFGRVTDKGGDNALDNDAASDAGRIANIAEVPPGNGT
FT                   VSFNISVAAQSAELGLNFRGFKARSYPGGAFGGNSPLLGIVEEGCDIYADLECADRYLG
FT                   K"
FT   CDS_pept        248936..249850
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639053"
FT                   /orf_name="MICPUN_103550"
FT                   /product="Predicted protein"
FT                   /function="heme oxygenase (decyclizing) activity "
FT                   /biological_process="heme oxidation"
FT                   /protein_id="ACO70230.1"
FT                   /db_xref="GO:0004392"
FT                   /db_xref="GO:0006788"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI000199C906"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT2"
FT                   /transl_table=1
FT                   /translation="MSSRVASRAASLASFAVRRHASTTATAPDLPSEIFKRSKHNKLGL
FT                   SKVLDDVTMRSGEHDMRVFGTGTLAALTSKSAYVSFTASHYHFYSELENRLDEAHRADT
FT                   PSGQVWGKFASELRRAHRLERDLEDLLGTSVGAHPPSPATSEYVAAIADAAERERGGPP
FT                   LLLAHFYTRYLADLFGGSMMGWPTRRALGLADVPAFYTHDDASINDDRFEYVERVYAAI
FT                   NAAARGADDAVVSAVADEAKLAFRCNAGVYREDGRGSSLSAALGGARVMWGYAKERVWG
FT                   AREQRDLFGRLVKRRDPVTGEFR"
FT   CDS_pept        250191..251078
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639054"
FT                   /orf_name="MICPUN_109298"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70231.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000199C907"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT3"
FT                   /transl_table=1
FT                   /translation="MAMTVGHASAAVQCAPVVAKARGARVSTSFSSRMPQPRPILRMTP
FT                   RGNDRAARLVVRAEETVGERVMNAAGSPEEEAAGLASMRAALEAKGDCPPCDDQTALWF
FT                   LRDRKMDAEAAAEKLEDFLRWRADLGVITDEDIKPSIDAGAAYVHPHLDKEGRAVIVVE
FT                   IAKHIIKNRDLEVSKKHAVHAVEQCLKMMEDAPNGSGSIYAVWDMRDFSGANADLDLAK
FT                   FCILDVFRNYYPKRLNQVAAIDSPWAFKPVWAILKPIIGKYSSVVQFVKAEDVLKNFEP
FT                   GKEPKCLTTGAGRG"
FT   CDS_pept        complement(251236..251808)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639055"
FT                   /orf_name="MICPUN_63231"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70475.1"
FT                   /db_xref="UniParc:UPI000199C908"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT4"
FT                   /transl_table=1
FT                   /translation="MNGIWRRLASVACRSGGRAAALEASTAVASLNPRTAAATLALRRG
FT                   SSGSERWLEARAAGGLGRGFAARGFRTDAALASDADATGASAGGGNVDYYSVKPAKGKN
FT                   RWRRARKKAAFIKEQARAHRENKTARAEEREAERLQRWREQAEAARAWRAMREAEAVNR
FT                   AEAALREIVGGGGDGDAGDAAPGETRA"
FT   CDS_pept        join(251992..252069,252181..253041)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639056"
FT                   /orf_name="MICPUN_103548"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70232.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C909"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT5"
FT                   /transl_table=1
FT                   /translation="MAATLDPGTQAGIGAFAGLVEVSVNQPLHTLKNFTQDGRVLPMNP
FT                   AVWYRGWSAGVLIGVPMAVVQFGGSRSLERAFGSASFGSSGGDATRDDVPARWSTRIAS
FT                   AALAGAVSGAVINPLDVCMTQQQKFGGSLRAVATRLARTHGASVATRAAWATMAREGFY
FT                   ACGYLCAAPWLRDRLDGHAVQHVGGGHGAPNGGNGAASIGGNRSSWNGFVAAASAGAAA
FT                   GVLTQPVDTVKTLMQSNLGDGRNVRAAGYLETAMALVKRDGASALWRGTAPRALRIASA
FT                   TFVLATVNERAGEYAAGASWAVDGVAEANPS"
FT   CDS_pept        join(253526..253743,253819..254224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639057"
FT                   /orf_name="MICPUN_87162"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO70233.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG320179"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="UniParc:UPI000199C90A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT6"
FT                   /transl_table=1
FT                   /translation="MEGSGRDGGVAAVAAVGEVRRVPFAGPKWDVAVACGSLKGGRADW
FT                   LVEKCSELGASSLVPLLTERSGSVGGSSEGRWERVAAAAMKQSLRNHRLVVHPALTTTQ
FT                   LCEMVRRAPVALLCAAGAPPLREVMSMAESRTGDGVEAGYSEGGGVLIVGPEGDFTPEE
FT                   VETLVAAGARPVGLGPLRLRVETAAVAIISCVSMTHPRTQPPGC"
FT   CDS_pept        254352..255254
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639058"
FT                   /orf_name="MICPUN_63228"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70234.1"
FT                   /db_xref="UniParc:UPI000199C90B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT7"
FT                   /transl_table=1
FT                   /translation="MVESPRGSDPSSRSLPPSPPPPNAVLAAVGVEPHPEPRPTSAFGA
FT                   NEVYDVLGSDDALKAEVEAATAALRADLKATSDRLAELETGAALQELDGMQGELAKTIR
FT                   AWREEMYGGTMEALSELEALKLAIEKGGSLDADVVRMVEELAATKLEANELGAVHPPEL
FT                   AAALASIGDTDTIEGVESWIEGLAARVVDAHGAEPPSPLPPAEMDVEDMDDAEIDARIA
FT                   AMELRLEEAKASRDEALRLRARVEREAAEFVSTLAEDGAAGRPGGVVATDVVRKVLEAV
FT                   GGGAELDELRGILEEDAGG"
FT   CDS_pept        complement(255324..255827)
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639059"
FT                   /orf_name="MICPUN_87385"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70476.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG518785"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniParc:UPI000199C90C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT8"
FT                   /transl_table=1
FT                   /translation="MEEIDAEESEEARLRAERRESEKEREDERRANRVAVRDATGASSA
FT                   TGRRKTSVARVTIRPGDGAVTINDRPFDAHIPDINHRAMMIRPFLVTDTMGLFDVHASV
FT                   RGGGLSGQAQAIRHGLARALELYEPDFRPALKKEGMLTRDPRKVERKKPGRKKARKAFQ
FT                   WVKR"
FT   CDS_pept        join(complement(257991..258234),complement(256613..257847))
FT                   /codon_start=1
FT                   /gene_family="HOG000042780" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639060"
FT                   /orf_name="MICPUN_63226"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ACO70477.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG566517"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199C90D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIT9"
FT                   /transl_table=1
FT                   /translation="MSVELIADAIGVPVWALVPVALAAAAVLVFILDGLSHSVLKPGKS
FT                   PPVIGTTPVFGGMLEFLKGPIGLMARAYPKYGEAFTVPVFHKRITFLIGPKVSEHFFKA
FT                   RDQEMSQKEVYEFNVPTFGKGVVFDVDHITRAEQFRFFANSLKSDRLRQYVGMMVKEAE
FT                   DYFAKWGDEGEVDLLDALSELIVLTASRCLLGREIRETLFSEVTTLVHDLDKGMVPLSV
FT                   FFPYAPIEAHRKRDKARKELAAIFDKVIQGRRESGAVEPDVLQTFIDARYKDGSRLSND
FT                   QVLGMLIAVLFAGQHTSSITSTWTGLLSIANKERIFPNLEKEQKDVMAKHGDKIDFDIL
FT                   AEMDELHFCIKEALRMHPPLIMLLRQCHVPFEVETTKGKKFVVPKGHIVATSPAFAHRM
FT                   DEVYSEPNVYKPERFKGESPEDKRAYASFIGFGSGRHGCMGETFAYMQIKTIWSHLLRN
FT                   FDFELVGKLPEPDYEGMVVGPKHPCTVRYKRRKL"
FT   CDS_pept        259112..261712
FT                   /codon_start=1
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639061"
FT                   /orf_name="MICPUN_98178"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70235.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C987"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU0"
FT                   /transl_table=1
FT                   /translation="MGPRFGGGGGGGGGGASRLNASATASFSTDDGQRGGDVNVRWLEE
FT                   VVMLDVRGMHCGGCAANVRRTLEADGSVVSASVNLANESALVRIGVDVPATDEGLTRAD
FT                   TFTNFEDKVVTAVRAVGEKLASAVTERGFPTSVREACGVAVSNVSATDAALSKREDRLR
FT                   RIRESTKRVVVAWALAATCLIGHAAHMLQGCCPPAFLKVFCSTPVHAGLSVFAMLGPGR
FT                   EIFVDGWNSLKSGGPNMNTLVSLGALASFGMSTAAVMLPKLGWPTFFEEPVMLLAFVLL
FT                   GRAVEERAKLRATSDMSALLNLLPPTARLVPKGVDEVKEGGEYYRTVPTAVIRPEDTIL
FT                   VLPGDRIPVDGVVVKGVSQVDEAAINGEPIPRAKRVGDEVSAGTVNCDGAITVRVLSSG
FT                   EETQVAGIVRMVEAAQQREAPVQRLADEVSGKFTYGVMGVSAATFAFWSTIGTKIFPKV
FT                   LASAAATGANAPLLLGLQMAASVLVVACPCALGLATPTAVLVGTSLGARHGLLIRGGDV
FT                   LERTHELDTVVFDKTGTLTVGRPVVRKVAVRDGLKEADVIASAAAVEKNSRHPLALAVV
FT                   AAAPGAVPDVDDGSFRQEPGAGAVGAVRGRTVKVGTLAFVTGGESAGVTIPPEVASIAS
FT                   NSNPGRTPVFVAIDGIVAGVLEMEDEVRADAASAVARLQRRGLRTVLLSGDRQETAESV
FT                   GMSLGIAREDIYGDVRPEGKAQLVEKLQKGGATVAMVGDGINDAAALAQADVGVAMAGG
FT                   VGAASEVASIVLLGDSPSQVVDSIELSKATFAKIKQNLGWAFAYNAVGIPIAAGALLPF
FT                   TGLALTPSVAGGLMGFSSIGVMANSLLLQLTGKKLSKMPESNKVEDDEGGDENV"
FT   CDS_pept        complement(261748..262398)
FT                   /codon_start=1
FT                   /gene_family="HOG000100804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639062"
FT                   /gene_name="RSP11"
FT                   /orf_name="MICPUN_98177"
FT                   /product="Radial spoke protein 11 "
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="signal transduction"
FT                   /protein_id="ACO70478.1"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="HOGENOM:HBG557772"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="UniParc:UPI000199C988"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU1"
FT                   /transl_table=1
FT                   /translation="MDVEPLYCAEQINVPPELADVLKSYTKEVVRRQPHDLYEFSAKYF
FT                   AELAAVARTAVVDIVPPTVDQIKVAFEGSEGVGTLSDLKAKCVGAGIMGSTVDQAFQLG
FT                   EFEENIADPRTPLVMLLTMTDATFVGIVASLFDVFGAVKDGADDPSLRAGTFLETFITL
FT                   TEKDPSMTAERLNALKEQLPKGEGDEGKDDDVEITFADVMKTEAFQAILEASE"
FT   CDS_pept        262904..265258
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639063"
FT                   /gene_name="IC140"
FT                   /orf_name="MICPUN_113460"
FT                   /product="Flagellar inner arm intermediate chain "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO70236.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C989"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU2"
FT                   /transl_table=1
FT                   /translation="MKAVSKELITGDIQFRGALSCFEPAREAIEAADYDPIVLRYNPDD
FT                   TYGDGANFEVACTKETADRFEFEAQEALALEAAAAEAAAAEAAAEAERNKKPPRARAGP
FT                   QTIRPWVTDGTTEAEIDAMTIKPDSEPPVVISFSRPRSEFGRAINFGNADALDLFDSSR
FT                   CEVRPKKEQLEFVTLTHLDAGVQAVPTVSEIEVQATPGPPKPMTTQTEPRLMDPEEARA
FT                   HTRNGGELATFLKRIQNDLEGMLLENSVFNYYEDDLEILAQYDDDDADEGTGTEEIKET
FT                   MSFSSLTHSKGRKASCVDWKPSDKLALAVSCVEPHSFEERVEAGGQARPGSVLVWHFTD
FT                   PINPQYVLEAPVDVHSFAFNPEDSSVIAGGLADGRIVIWDTSEIRDEILAYQLRRSKGG
FT                   EGNSSIGPPVCRPKQLSEAAMSHVLPVTDIKWLGPVAVNRKGEVTKTEAWNFFATTSAD
FT                   GRVLFWPTELTKNPKTKVMEWTPSHECKMTRGEVPGILQAVSLDFIDLAGGKSTFWATG
FT                   MAGEVAQCDFKMQEGDETVPMDASRTVSHFHEGPVRSIERSPFFPDVALSVGNWTFKLF
FT                   KEGSQKPIFSAPTSDVYLSVGAFSPSRPGVVYIAKSNGEIDVWDFTSKSDRPLQTVRVC
FT                   SGDIGCVKFWPHPEEKKGQLLAVGDAAGVLHVMELPRSLRRAVNGEKDRMEGFLQRETD
FT                   RVKDVDGRLEGREAQIEELERRLAEEEAEAARRKKEEEAAAAAEEKKKKSSRKTHTEED
FT                   KAEEEFDKMERKFLIKLGLVEPNEDELEEGA"
FT   CDS_pept        join(complement(266501..266576),complement(265309..266348))
FT                   /codon_start=1
FT                   /gene_family="HOG000265356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639064"
FT                   /orf_name="MICPUN_52590"
FT                   /product="Adhesion regulating molecule "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70479.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG410218"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="UniParc:UPI000199C98A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU3"
FT                   /transl_table=1
FT                   /translation="MSFDFFNQNAVQPGGGPELGPNGEEILIDVQCGRINVEGKTMKPD
FT                   DRKGKLRICKATDGLTHLMWGTRAEGMPYNPEDDFIIFPQEAEMKFIPKPGCFVIKFPD
FT                   DASRNMFFWSQEPAGKIEDDKLVADVNAALNGESPESANEQAQLMQMLGDAGGAGLAAR
FT                   DPSGGPVAARAQAVRAAHEAANSALSSGADETPAVNANAVPETPAAPAKGPDPSAGTAV
FT                   PPSVVNAEALRAALGSVGATPSSTPGAGAIDAAAMAAALAGANRRAAGPGLSDVLTPDA
FT                   VGELLRSEDVRQRLMEHLPEEHRSTQDLEELLRTPQFQSQLERFSHALQSGQMDLAQFG
FT                   LSPGAGFSVADFLSAIQKQVEEKEGGDAMQE"
FT   CDS_pept        266985..268592
FT                   /codon_start=1
FT                   /gene_family="HOG000243301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639065"
FT                   /orf_name="MICPUN_87045"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70237.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG748662"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C98B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU4"
FT                   /transl_table=1
FT                   /translation="MSQGAGTQDTDDSDPDEGDADYGNAILSGVEAHVVKREEYRCLDA
FT                   EQVLERQREAVRGVTQVLQVTQDDATQLLRAFKWNVNRVNDEWFGDEEGIREKVGLESS
FT                   SSAPDEASGMVDDGAEVTCSVCYDEFPASKHTHVGCGHNFCATCWSGYLENAVSDGPSV
FT                   LDLRCPQEGCKRRVPEPMAKRYLKGESAERLDVFKWRSWVDDNPRVKWCTGAGCEVAVL
FT                   CHGDRGEGPVDVHCGCGASFCWSCQEDAHRPVDCETVKKWLVKNSAESENMNWILANTK
FT                   PCPACKRPIEKNLGCMHMVCSQCKFEFCWMCCGKWSEHGERTGGYYACNKYSQSREKEG
FT                   ASEEEKRRAAAKQSLERYTHYYERWAAHGASQTKAAKDLAEMREAKILRLGDLQNTPVS
FT                   QLKFVLEAMEQIAECRRVLKWTYGYGYYWMEEDGLRKKFFEFIQGDAESTLELLTEAVE
FT                   KDLEEFFTEEKSLADFADFRGRLTGLTTTVKKYFTTMVTELEEGLPGVGSEVVRAVSLE
FT                   ATPAAEEPPKLRRSARLA"
FT   CDS_pept        join(268941..268998,269322..269437)
FT                   /codon_start=1
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639066"
FT                   /orf_name="MICPUN_87366"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70238.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI000199C98C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU5"
FT                   /transl_table=1
FT                   /translation="MAKSTNHTAHNQSYKNHRNGIKKPKKQAKRSTKGMDPKFLRNQRY
FT                   CKKGSKLAAAKA"
FT   CDS_pept        join(complement(270729..270815),complement(269790..270134))
FT                   /codon_start=1
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639067"
FT                   /orf_name="MICPUN_107171"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70480.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594417"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="UniParc:UPI000199C98D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU6"
FT                   /transl_table=1
FT                   /translation="MPNAPRTVKDVPAQEFVIALAQYFRSTGKMEVPTWVDIVKTASYK
FT                   ELAPYDPDWFYIRAASMARKLYVSGNMGVGAFRKNYGGARNDGVCRFHHAIGSGSVARA
FT                   ILKQLEAVGVVEKGPKGRRITPSGQRDLDRIAGRVAVSA"
FT   CDS_pept        271170..>272916
FT                   /codon_start=1
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639068"
FT                   /gene_name="TOC64-1"
FT                   /orf_name="MICPUN_52588"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="binding"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="ACO70239.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI000199C98E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU7"
FT                   /transl_table=1
FT                   /translation="MVLKVLILASAASIGALVFSRRGKGGGKARGWRKRSDALNAFQEL
FT                   LRLKGNAKGPLRGIRFSIQDVFDVQGRVTSLGSPAWAATHAPATRDAPAVASLRAAGAD
FT                   CIGVTRMDELGCSITGCDAVDGAPINPVARDKIPGGSSSGAAVSVAGAPKEVDMALAVD
FT                   SSGGVRVSAAHCGLYAIRTTHGTVALDGASSTTGSLAAAGWMSRDPDVIAATATALIPL
FT                   PKDQISVSRVMVLEDAIDLCDDIASCGVATACMLLKDAFKNGGISRLNLGKHLLMACPS
FT                   LREMQNKDCATGLDVLRNCLRLIEGEEVWSQIGGWYSAEKPETGAKAKEYLLGASKIAT
FT                   DSLRVIKQAREEVRAAVDLLLDGVTVFLLPTTPCAPPPMNAGAEATATWERKVLQLTCL
FT                   SSLTGTPQLTIPLTYEQAEGPYGLSVVAGRKQDYMCIEFARMFGAQLREAFPDVVQAEL
FT                   TRLKDEENGGKDDSDAVPSMCEELKAQGNKEFKAGNFNEAIVKYTEALTALGPPPNMRP
FT                   DPHRAWKSVVLSNRAMTNLKLGVYNDAEDDCTAALKLNEKNVKAYLRRGAARSVSGNYL
FT                   EAIDDF"
FT   CDS_pept        join(275338..275431,275511..276097)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639069"
FT                   /orf_name="MICPUN_63216"
FT                   /product="Predicted protein"
FT                   /function="5S rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70240.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0008097"
FT                   /db_xref="HOGENOM:HBG557774"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="UniParc:UPI000199C98F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU8"
FT                   /transl_table=1
FT                   /translation="MARWGEAPRVLGCGCDLTFARGMSGTFVKPPDLKGDNIDVMPRTG
FT                   TGKTVTKRLRRDGLVPGVLFGPGDQTGELLQMPKQDVERLVRIYGLSGIGARILTLNFP
FT                   DGVRKQDVLAKQVIYDATNINVENVNFMPCGPETEVKVKVPVRVEGDDACPGIKKGGFA
FT                   WKLHKTLTVTCKGKDIPSEIVSNISAMDVGDKVFLRDLDIPEGVRVHMTDDKVPIIKIA
FT                   GKAR"
FT   CDS_pept        complement(<276188..>276435)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639070"
FT                   /orf_name="MICPUN_73864"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70481.1"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199C990"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIU9"
FT                   /transl_table=1
FT                   /translation="TTRREALSLYRAVWRASFLFVWKNEKGEEWRDIIRESARKEFEAA
FT                   RHEKDPEMITRLLVTGRDYLDQAMEKFMTKRQSIIDG"
FT   CDS_pept        276948..277682
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639071"
FT                   /orf_name="MICPUN_63214"
FT                   /product="Predicted protein"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /protein_id="ACO70241.1"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="HOGENOM:HBG557775"
FT                   /db_xref="InterPro:IPR013110"
FT                   /db_xref="UniParc:UPI000199C991"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV0"
FT                   /transl_table=1
FT                   /translation="MSAACPAILPGHLRGLRRTTGSVRVRYFRCNATDDLLARRGSVYE
FT                   SIYQDMDRDVGLEIAEKSHKDAPRVPGDGWFYGELSWEGMYDLISLAQPEEGDVFLDMG
FT                   SGLGKMVLSTAMTRCFKECRGVEILPELAQKASAALERLAQELDPEEFASLPRISLVEG
FT                   DMFGADVSDADIVYCFATCLTAEVLQGFIWKVEAEMKSGARLLIISKQVESDYFDPWIV
FT                   PYKSVEQAHSKWNLDCFLYVHK"
FT   CDS_pept        complement(277761..278762)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639072"
FT                   /orf_name="MICPUN_63213"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70482.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C992"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV1"
FT                   /transl_table=1
FT                   /translation="MSGDSLERRVAGISKERREAIIVRSGARAVEEAKRLSGGDPQEFD
FT                   GGSNWGFARTTLNIATSARAHQNAHDAPGPSQENSERRDPLHTARESFVSVLGRDDDFH
FT                   SPYSYAAMRDAYGVMDGWSVVEGGNLRTPDHEARSRAFVDEVKAVVRASWAEESVRRGV
FT                   DFAKRGDYTTAIKCYEQALELDPRNAVAFVAKGAALANQGKFKDAAMDLEKALKINPQV
FT                   ENAQKYLDDIKMKHPEALKGPPSIGYGAGRQVPPPRPSEAGRSAPINPTHPDQRRAVSP
FT                   SSEYKAALQRELAAAVEEKKRKKRERSKSKSKRRKRKTLKKRSSSSSGSDSD"
FT   CDS_pept        278876..280573
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639073"
FT                   /orf_name="MICPUN_63212"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70242.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG557777"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C993"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV2"
FT                   /transl_table=1
FT                   /translation="MAPKTSFSMVRKKTPFEKHKEEEELKRKRDAEEAANLFAEFEADF
FT                   ASEKKPKAMSFVSAGVQSAGSRPGDEIDKSGRGKVYVPAMAPPGFFGAEEEPETKPAST
FT                   SDHYARSGRSSGFSSTTGGRKPRAIDAVMEEMMDKQQRREEARREGRELAEDKGPNPHP
FT                   SELATSDKTTTNVFVGNLPLTVVEEDVLMEFAQFGPIGSVKIMWPRGEEVHTATSLNGF
FT                   VSFMGRASAERMVAESDGKMFRGCVLKVGWGKAVPLPSKPIWPRESDDITGRPAVGVSG
FT                   TMASTAQTRFGGYAEEVAVQYPSNSRVMYVIDRLAKYVVDNGKAFEEKVMEKERGNEEF
FT                   GFLFDYKSPNHQYYKWRVFSLTNGDTLEDWRTEPFVMNDARWTPPNPKRRPVYTGKESE
FT                   AAKEPAAPDSLKPDDREEFEGLLQALTLERSDIEEGMMFALEHAESAKEVANILTDALT
FT                   VSDTPVTMKVARLFLMSDILHNCGAPVKNASAYRTEFQQKLPRIFESLEKTLMGVESRI
FT                   TREAFKKRVAAVLTAWGDWFLFGEEFLKGLELTFLRGQNQMNSSVNSV"
FT   CDS_pept        complement(<280735..281229)
FT                   /codon_start=1
FT                   /gene_family="HOG000200891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639074"
FT                   /orf_name="MICPUN_76124"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="ACO70483.1"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG607461"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI000199C994"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV3"
FT                   /transl_table=1
FT                   /translation="MMDPPWQLATANPTRGVSLGYSQLTDQSIADLPIPKLQKNGFLFV
FT                   WVINAKYQWTLEQFKKWGYEFVDEIVWVKVTNSRRLAKSHGFYLQHAKEVCLVGRRGEK
FT                   PPGMSDKAVGSDIIFAPRRGQSQKPTEIYELIEEMVPGGKYLEIFARKNNLRDYWVSVG
FT                   NE"
FT   CDS_pept        <282482..>284263
FT                   /codon_start=1
FT                   /gene_family="HOG000212368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639075"
FT                   /orf_name="MICPUN_65751"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ACO70243.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG525721"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C995"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV4"
FT                   /transl_table=1
FT                   /translation="PIERKPLPPGRAGGTYIPPFKLAQMMAEQTDKTGPEYQRMTWDAL
FT                   KKSINGLVNKVNASNIKNILPELFTENMIRGRGLFARAVMKSQMASPQFSPVFAALVAV
FT                   VNTKFPELGELVLKRVILQFRRAFKRNDKPVCVAATRFLAHLINQQVVHELTALELLTV
FT                   LLASPTDDSVEVAIEFVKECGYTLNELTPQGLHGIFERFRGILHEGEIDKRVQFMIEGL
FT                   FAVRKAGFEGKQGVPPELDLVEEDDQIVHELSLDDQLQAEATLDIFKVDPEYEANERKY
FT                   ADVRKEILGESSSDEDDSEDDSDEDESSDEEDGGGGAMNAEQQAIEDQTETNLVNLRRT
FT                   IYLTIMSSLDFEEAGHKLMKIHLQPGQEVEICTMLTECCSQERTFLRYYGLLAQRFCFI
FT                   DQMYAQLFDEVFLKQYSTIHRLETNKLRNVAKFFAHLLSTDAISWTCLAYLQLTEEATT
FT                   SSSRIFIKILFQELSEALGLRKLNQRLQDPGMAEYFQGIMPRDTPKNTRFAINFFTSIG
FT                   LGGLTDELREHLKNMPKMIMAQKPADSDSDSDSSSSSSSSSSSSSSSSDSDSSSSSSSS
FT                   SSSSSSSSDSKPAKKKRK"
FT   CDS_pept        286813..287808
FT                   /codon_start=1
FT                   /gene_family="HOG000005791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639076"
FT                   /orf_name="MICPUN_103532"
FT                   /product="Predicted protein"
FT                   /biological_process="phosphatidylserine biosynthetic
FT                   process"
FT                   /protein_id="ACO70244.1"
FT                   /db_xref="GO:0006659"
FT                   /db_xref="HOGENOM:HBG557778"
FT                   /db_xref="InterPro:IPR004277"
FT                   /db_xref="UniParc:UPI000199CA15"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV5"
FT                   /transl_table=1
FT                   /translation="MVRPHPAVWKVMHGLFVLYLLFLVFLLCQETNDARSVLQFLSLDL
FT                   GVELPERAYGEDCRIHTPEDPDSRFRVLRDTVFDEFFVGHILGWYGKAIALRNMKLLWA
FT                   YSVLFELMELTFQHWLRNFNECWWDSWVLDVAFCNFIGIHFGMMTVRYMEGRMYDWTGT
FT                   GKKKRRRGLADRIKPFLAVFTPKTWDTYSWSPTSSPLRFLQCAFVIILCLVFELNAFFL
FT                   KYVLWIPPPHVLNHIRLALWFGMANVATREYYVFITSRQGMALTKMGANAWLTIAVALV
FT                   EIMITIKHGRGMFEAPWPTHVLVFWFIFLVCTAVWLVRWQLQLRTLPKRE"
FT   CDS_pept        complement(287863..288693)
FT                   /codon_start=1
FT                   /gene_family="HOG000049437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639077"
FT                   /orf_name="MICPUN_63208"
FT                   /product="Predicted protein"
FT                   /function="serine O-acetyltransferase activity "
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70484.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0009001"
FT                   /db_xref="HOGENOM:HBG754554"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI000199CA16"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV6"
FT                   /transl_table=1
FT                   /translation="MASVRKDDVWDSMRKGAQELVEKEPLLGGFVYSKILNQPTFERSL
FT                   AFMLATKLASSTVLASQWNDLIIDALTSTAEEEKSMGGRGSPAPGTGSIADAARADLRA
FT                   ILSRDPACPSYTHAFLFFKGFQGLQAQRVSHWLWSKGRTVIACFVQSSISEVFGMDLHP
FT                   GAKFGRGILVDHATGIVVGETAVVDDDCTLFHGVTLGGTGKVSGDRHPKLQKRVVVGAH
FT                   ASVIGNISIGHDSKIGASASILHDLPPNSVVVGHKGIVIQKRGHKGKHSLLSKL"
FT   CDS_pept        complement(<288989..>289609)
FT                   /codon_start=1
FT                   /gene_family="HOG000019084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639078"
FT                   /orf_name="MICPUN_76499"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70485.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG716038"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="UniParc:UPI000199CA17"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV7"
FT                   /transl_table=1
FT                   /translation="AKGGRGGRGNKTMPKGPRAGTSEPGGKGEDATIVLELKSVADIGL
FT                   VGFPNAGKSTLLRAISSAQPKVAEYAFTTISPQLGAVSTDGGISSFVVADIPGLIEGAH
FT                   ENRGLGHNFLRHVERCAAFVYVVDLGAGAGGRPGVRPWNALQTLMAELEAYLPGLSARP
FT                   AIVVGTKADLPNSSRAAETLRRRTTLPVVMVSAHESRGIQDMLS"
FT   CDS_pept        <290773..>291477
FT                   /codon_start=1
FT                   /gene_family="HOG000200892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639079"
FT                   /orf_name="MICPUN_76150"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70245.1"
FT                   /db_xref="UniParc:UPI000199CA18"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV8"
FT                   /transl_table=1
FT                   /translation="RDIAALFKLFDADENTRSAILIDLYFNTLAYATKSGFNTEKSSTW
FT                   LAIVKAVHEKATGELQTIGNSFEFFKLLMLQSSVHRPPYSLGIFTYAEMKDLTEYMLST
FT                   YFRHYKLYQYAFTKLVRMDVKLASPVLETAPTPFELLGVAFPDSEWAEKQAEIKAKIEE
FT                   ERRKAEEEAAAKEEAEREARIKAEYDAAIPEEVSTRVSEALAQSMKEMKEQLEARFKEQ
FT                   EEALLAKIAELEA"
FT   CDS_pept        join(complement(293390..>293447),
FT                   complement(293198..293262),complement(<291869..293107))
FT                   /codon_start=1
FT                   /gene_family="HOG000200893" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639080"
FT                   /orf_name="MICPUN_65976"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70486.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG633504"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199CA19"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIV9"
FT                   /transl_table=1
FT                   /translation="PDRRRLSSVEDFFRYTEEEGRRFFDEMDRDHDGKLKLDDLKVAMR
FT                   RRKMPEWYAKAFYEKAKPTFFARSLSWEDFESAMNERESTMLRAYNSLGLSRSGRMTQE
FT                   DVKKSLKRLGLPATDENATAMLKHLDLEGDGFVTYGQFRNFMMLLPKRVATSSDPSVLW
FT                   FESSTMVQINQPKSERSATVKLAIQAALAGALASGTSTAAMHPLDTLKTRVQSTVGKGP
FT                   GMKAFLKTIPEIGAKGLYRGIIPAVVGAASGHGFRTATYEVVCKLLVPLTALPLITEIQ
FT                   IQGFGSGLGTLVGTSVRIPCEVLKQRLQTGQHDNAVEAFKAITKNGTKGLFAGTAATLS
FT                   REIPFYVIGLVTYEKLKQAAAAAKRKELTAWETIALGGMSGAIAAAATTPADVLKTRAM
FT                   TGQTAAGEAMWVSVQNIVKKEGAPALFKGVIPRMLWIAPLGAMNFAGYELAKRAM"
FT   CDS_pept        294444..294839
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639081"
FT                   /orf_name="MICPUN_109293"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70246.1"
FT                   /db_xref="UniParc:UPI000199CA1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW0"
FT                   /transl_table=1
FT                   /translation="MSKKMEGAEVDERMLNTVYAWIRKSDEDKLDGMVHILQHLLQCYA
FT                   ARELDAGKTPLDSVIAAPAAEWPEKFEEIIAGGFGEEAFNKDLQQRMEKVVLNLPNGSY
FT                   AQRVQAEYLKEVEDRGKDIYKAKEAAP"
FT   CDS_pept        complement(294882..295349)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639082"
FT                   /orf_name="MICPUN_87094"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /protein_id="ACO70487.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000199CA1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW1"
FT                   /transl_table=1
FT                   /translation="MLALHKTANLDPHVDADVVPSVGVDINTFPIDKNRNMVCKEVGGA
FT                   MMPLWPMYLKDCAGIVYVVDASDSFQLGASAAALRHILSLPAIRGKPVLLVLNKSDAPC
FT                   LVSMEDLEATFDIDSLREETGDTMVVIKTSALSGENIEKVLGWMKSIYRLG"
FT   CDS_pept        join(295722..296912,296959..296967)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639083"
FT                   /orf_name="MICPUN_63202"
FT                   /product="Auxin efflux carrier family "
FT                   /protein_id="ACO70247.1"
FT                   /db_xref="UniParc:UPI000199CA1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW2"
FT                   /transl_table=1
FT                   /translation="MPIGDANARLLLAVTTIAFGNFLRRIGLVDVDVGKSLLKVLFNAT
FT                   LPSVLLMSIFSVTFDAQSAAVSACALGQAIVLLIAHLAFRGQGRPPKELALLAGSCVGV
FT                   NLGTFCYPLVESVWGSEGLTRVVLFDAVNQWSLLIVAPLIYASSIAGASFSPVKALANV
FT                   KKQLTSPCLLAMFTAIALRLAGLSLPEPVAAFTSSLALANKPLALLALGILFDPQLNKS
FT                   QLKDIGTLLALRYGACLLLGAAVMATLSVSMGPECTAVVLAALISPVPLLTVTYAMEYD
FT                   CDIKLSASAVNAGNFCSFGLLLAVANTNLTNATALAPAVAAAGTALALVGVLGARGKSA
FT                   SRDQVTPVQANAARFSRRRCAQVHDRRQLEVRKGHDVGFAGSLGAVNVRVQIAKGHANA
FT                   "
FT   CDS_pept        complement(297077..300166)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639084"
FT                   /orf_name="MICPUN_63201"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO70488.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199CA1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW3"
FT                   /transl_table=1
FT                   /translation="MGSAAFKGSRVNPDGSVDSGTPRTPRTARRSNRPDRVTKDTKNGA
FT                   GGRLTTPRGRIERNQGVNGEQATPGGKRLDFVLADTRALPKEKQHNGGVHFSDKVAERV
FT                   SELAHRGEEALQTKAPTRQLRRSAGAKQPYASGGGSSWRDRVEKAKMNAAATISVAGLL
FT                   SSGLGDMRKTRNYFDTMPPALEESLDVDYEGFIAEYTKVEKVFEEARRATGKDKKRRNH
FT                   SKTQEEANTEDAAVDSAQALHDAREGVEVIDARISSSLTAMQAYLGRANEDVVIQNVQI
FT                   RFPNADSQEMWMSAPENKPEIMRMLSEVRSGGGYGTIALLVFAGDLGPMREGGKRRPLY
FT                   SIDPFDLLGELHQEQREHDLAATSATQADADGVEERQTTWLPSTTHFEGMCVGARMMTQ
FT                   LQLNISEQFGANALEAIKLIMVVSDATQSTVVKDMRSNNFYGFAKQHVLFINQHSYPGF
FT                   RYVPELKVFCEDPSARSARYGSGFVMEQLTYPGEAFLFKQGRERSHLVESVLDYLLSVG
FT                   VEWIYKTNIRTVGEDAFDTKFAAHAFALREKYDANMVIETVETTAQTSCKWGNVAMTST
FT                   SNSQFARILGVDTISPSDRINTLNAMMAAQPENRKTLYSATGRWMVELSALQEALETAR
FT                   FTPSFCLEHLLEAEPNLRRLRAAPAVYPQVHAHDLTCVAAIRAVCVSRSQENAPRDLGT
FT                   PIIDDPIQTYQYMAKVQDRTIAFQTMVKQSYMNTMSTGVKGPSMVMMSSSGRSRHVIVV
FT                   AIVDSEACGRILDVVNALLIPGVDEFHLVHVCKNAEAFRQAGTMLSQYDVDNVVHLVRH
FT                   VIPQKQGVSTAEAITNKAVQLNATLIVVASEKLDRSREAKVGSVALALCKAQIASGQKD
FT                   KELPCSILVVKNHSKTPNVVKSPAGSLSFVIGVDVDSSELFEFTCNLGRRGKDKLYLAH
FT                   CTGPMGVHRKASRDEDNIITKFKERAIANGFVAVGRSLDGKPSLELPKFQSQVQGDIIA
FT                   VSASRDTGEVSKGVVAMLKDPLAAAVLVYKPKLMNSSQLL"
FT   CDS_pept        301099..301449
FT                   /codon_start=1
FT                   /gene_family="HOG000198587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639085"
FT                   /orf_name="MICPUN_87262"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70248.1"
FT                   /db_xref="HOGENOM:HBG557784"
FT                   /db_xref="InterPro:IPR009269"
FT                   /db_xref="UniParc:UPI000199CA1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW4"
FT                   /transl_table=1
FT                   /translation="MAAHAKPGDYGGALRPGEGDAMAAFVQSGKRIPRRGEVGLSADEI
FT                   SRFEDLGYVMSGSRHSRMNAIRIRKENQVYSAEEKAALAMINYEEKALREQKVMADLKQ
FT                   LVKQATGEDPGN"
FT   CDS_pept        join(complement(303310..303606),c
FT                   omplement(<302539..303225))
FT                   /codon_start=1
FT                   /gene_family="HOG000106336" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639086"
FT                   /orf_name="MICPUN_87285"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="iron ion transmembrane transporter activity "
FT                   /biological_process="high-affinity iron ion transport "
FT                   /protein_id="ACO70489.1"
FT                   /db_xref="GO:0005381"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006827"
FT                   /db_xref="HOGENOM:HBG708630"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniParc:UPI000199CA1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW5"
FT                   /transl_table=1
FT                   /translation="MHVVKPARRLSHDGRPSGWGNTSDIEDVPADLRVVSLLPSATEII
FT                   GALGIRERLVGCTHECDACPDESGMQAALAAGVRRVTSSAIDPHITTQRDIDAAGDPPP
FT                   LYSVHNELVAELKPTVILTQSLCKVCAVSEDDLKGAAASCGLHSDAPSTLTEVGASIEN
FT                   IAAACGVPQRGKRARERFEAQLAEVAGAVAGARSSGKCGVRPSVLLLEWLDPVFDGGHW
FT                   VPGMMRVAGCEPSLNSKEGSRSSRREWGDVTAVDPDVVLVACCGFDLRRNAADAAAALA
FT                   VNNGDNAFARLRAVRMGRCFVLDGNKYFARPAPALAVGAALVARCAH"
FT   CDS_pept        304164..304778
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639087"
FT                   /orf_name="MICPUN_63198"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70249.1"
FT                   /db_xref="UniParc:UPI000199CA20"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW6"
FT                   /transl_table=1
FT                   /translation="MSSRGHRQPLRIGIRAVASTYTDIEALWQKVDFGRERAKTSMEWE
FT                   TLKESCWYAAYDAPFHGVPSGPYMGGRVADMNAHITRRHHDFLVRSRRALCGHTVTPEE
FT                   FADTLARVSSVLGVGLRVAVQCVFEEPTILAMDTSELIRTMVELRRQHEDEDLVTLVIS
FT                   QPALLGRAVECEPDGHEAAAADDVFGYPTRVDNYMLYGGQW"
FT   CDS_pept        join(complement(306301..306309),complement(304857..306185))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639088"
FT                   /orf_name="MICPUN_103527"
FT                   /product="Predicted protein"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70490.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR019007"
FT                   /db_xref="UniParc:UPI000199CA21"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW7"
FT                   /transl_table=1
FT                   /translation="MGKGSKTLAPGDAYRREQKKKQLAKNKAARKEAREDALQKSDIGS
FT                   LRAELKRLQAEKSMNTEMARDKEQRMKQLENGIKWHEEQRKANAGKTPAPAPAVPKVKG
FT                   IGALKGLEVVVAGSTGSRGLGLGTFRPQDSVYYHPTLNPTGRPPAGKPQKYKAASEYHD
FT                   EEEAGADEEEEYEYQELDLVVQGEGPLLPPPGAPATLPPPPGPPPGAPPGPPPGPPPGP
FT                   PPGPPPGPPPGGAPGPPPGPPPGPPPGPPPGPPPGSPPSDDEVPLPPPPGPPPGVEDEM
FT                   PPVPPPPPASAHLLPTPGPPGMAPQPQMVQMVPVRMVPVPVAPQSPPPPRFRQVTSAPP
FT                   IPNPNNPVRSALPRSVAAAAFTRAAAPTVQKLVPAQHNPALKALVPASVRIQRQKEVVP
FT                   PSKRQRVLNAAPAKQPAPEEKSGKAAEDDQYLGFLDEVAHLGAFEG"
FT   CDS_pept        306659..307108
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639089"
FT                   /orf_name="MICPUN_63196"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70250.1"
FT                   /db_xref="UniParc:UPI000199CA22"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW8"
FT                   /transl_table=1
FT                   /translation="MISRFPKGGEEIDTDIVRRQEFEKLHIKVANEKFGRREDAKELLT
FT                   RMMQACIAAFAPDPLEFMIEFLTKEIEGRAEPAHTGPGKHPMGEEADLHEEVTNYADSP
FT                   EFHTIVSKMSAYMIQFKPDDPAPFALEFLRTLKKEGIFGPMGADH"
FT   CDS_pept        complement(307169..308728)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639090"
FT                   /orf_name="MICPUN_63195"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70491.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199CA23"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIW9"
FT                   /transl_table=1
FT                   /translation="MNSTFEIEEVSSDFFSALEDAELCHGVKRNLALEISREAGVHVSA
FT                   VSPPFMPKVRRDVPPDDAKIGDPGGGKENVCVSQEGKTTARKRRLPASLSPAVALPLPE
FT                   GCHDLPNSLPDLHFPGSVVLCETPQEVDSAVARIRRLTAIPSAPRTFGWDIEWLVSFKA
FT                   GTEPRLTSLMQFCYRPRPPAKAVCFLLRLCLTGVTESLRELLVDPTIVKVGLNARGDAH
FT                   KIRRDFNVAVEGVLELRDFARERAARPGHPGSAPESYSLAALVEWQLSHRLPKHASSRM
FT                   SDWEAPKLTEDQVTYAALDGWASLLVFETLQTLPPVTDSFVEPSPAAAEEKEDVEMTAE
FT                   TVCVDDPWDINQITPAAPAFWQGQLSPAKTEVHYLHLDRGWSGAQIAAIKGVQVSTADG
FT                   YIADAIRAGKAYRFGVLGVTRRTLSLVENAWHRHRRTIDAEAQQTVTPPLALRENTDAD
FT                   SAVHRRTIRAVKDILMEQAPGSNISWAECDFSLCHLQRLELLAAGDAASRLQLISPLPP
FT                   KR"
FT   CDS_pept        308937..310550
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639091"
FT                   /orf_name="MICPUN_63194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70251.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199CA24"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX0"
FT                   /transl_table=1
FT                   /translation="MPRVDEESALLGGSDAGVKSRRVGTSAIRYALAGSAALCFALVAV
FT                   LTFGGEVREYKSQESEPEPAPILQGAQESDKPLPPSPFVAMQGMFAYETWTESEVKRQG
FT                   DPDDDARPLLQSMPNFGASVESWETIRTAVQTGLGATGQRKLFIFLRHAQAMHNQWGLH
FT                   AHKTKSVNDIPCDYKGKGNLVDPDLTGFGRLNARKFVRDVLESGLGKEIGGEARVFSSP
FT                   LSRTLETTEIGFGNQTVLKIKGGRVTVSELLRERIDTRVPFEVRRPVSYKKGVDQQNLD
FT                   ELFRFDDVEPSKLQNGDTVGSVTVDFDGDKGIMDHSVKQLWEGEQNVLNTKQYATLGAS
FT                   EPRANPTPNTMTKTKADQTADTSELMAPQCFVPSRGLGLAVSERGWCCVENGLKQKFGP
FT                   DNLFDFNVTIPNKDLSEAERSARDKTNETYVCKLMEAGRLGNKLCYGPAMLGLLAQDDV
FT                   NLTPGREEGENELVGRVRTWIASVFDEVEDQVIVAVTHSDWIKLAMHDLGVDKSWLVPR
FT                   NNEMLPVIVEDTRPKPIEKR"
FT   CDS_pept        complement(310624..312162)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639092"
FT                   /orf_name="MICPUN_52583"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70492.1"
FT                   /db_xref="UniParc:UPI000199CAA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX1"
FT                   /transl_table=1
FT                   /translation="MGCLFSKSDDKVDKLPKDDQAPEEDHGSLSGDGGRGLTGAKSPRK
FT                   PPTVFTSDGPKPVPKARTFIEEDDDSPARPSGPSKVLKKRVPARLAEQPSNSAPEVDEV
FT                   QDDLEAELARAKPKKGGQTASAPTVDPDAEAIAAEVEKLKRRKKDKSRLTDLDSDEDLD
FT                   PSEEGTREELLRRRAAQRTSTVGMSSGVRKKVFGKLDDLSDDENSGQLMAPALSSAPVL
FT                   GGHRPLLAGSGRGRPGLAPLKPLGGISNGPALGSFLAPVRRPAGKSVPAEQEKPVSLYQ
FT                   QRQQEERQPSPVQVSAPPEKVDDEEDFVWKDDEEETLAAPRGHVQEIEPAAPSVSQLED
FT                   DDEADLVWRDDEEEPPQAAQPLVPPEAPDDEEVERVWRDDEASTPGRDEYEHDVFETDE
FT                   TKPETPEATMLEEMIGETEQYVVEEDDDFEPEELPESSPESQGAVTPAASAKLEDSLVL
FT                   EDATPVPFTPSSEPRPPEDDWGGDDMDDGFEAGGEIDYEDAAVVDEDESEDDVW"
FT   CDS_pept        join(complement(317702..318600),complement(312346..317665))
FT                   /codon_start=1
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639093"
FT                   /orf_name="MICPUN_98172"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70493.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199CAA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX2"
FT                   /transl_table=1
FT                   /translation="MSSVLTADADGSYRPKTRETRAAYEALLGMIQGQFGDQPQDVLRG
FT                   AADEVLEVLKDDHKTDPERKKDVEALMGATSSEKFAQFVAVGKLITDFNPGGGPGEGDV
FT                   VPGDTLDDDIGVAVEFEEEEEDNDEDNELDEVLEASDVEEDDEGAGEEAEFGRGVQGMD
FT                   VGGDDGEEYDEDIVKPSDIDAYWLQRQVAAAFGYTDSDAAESSKMAEEVLAALGCETDD
FT                   ERACENRLVLLLDYDKFDLIKKLLKSRARVVWCTRLARAQDDDEKAHIMEQMSARPEAA
FT                   AVLDLMRQTGERASAKARQRLRGEVAADVADTGVGAVAAGRKLLELDALAFAAGSHFMS
FT                   NKRCELPPGSYRSAKKGYEEVHIPALKPKAFADGEVLRTIEELPKWAQPAFAGMKSLNR
FT                   VQSQVYNTAMLSPENMLLCAPTGAGKTNVAMLTILHEIGLHRKPDGTIDTSAFKIVYVA
FT                   PMKALVAEMVGNLGNRLKPYGINVRELTGDVSLSRSQIDDTQVIVTTPEKWDIITRKSG
FT                   DRTYTQLVRLLIIDEIHLLHDSRGPVLESIVARTVRQVETTQEMVRLVGLSATLPNFED
FT                   VAAFLRINPSKGLFVFDNSFRPCPLQQQFIGVTVKKPLQRFQVMNEICYEKVLENAGKS
FT                   QTIIFVHSRKETAKTAKAMRDTALETDQLARFLKEDSASREILITEAEQCRSADLRDLL
FT                   PYGFAIHHAGMTRADRTLVEELFADGHVQVLVSTATLAWGVNLPAHTVIIKGTQMYNPE
FT                   KGGWDELSFQDVMQMMGRAGRPQFDTFGEGIIITQHSELQYYLSLLNQQLPIESQFVNN
FT                   LADALNAEVVLGTVQDSRDAVNWLGYTYLYVRMLRNPNLYGVGIDALEDDPTLEMRRAD
FT                   LIHTAATQLDKAGLCRYDRRSGHLQATDLGRIASHYYISHGTVKAFNEHLKPTMGDIEL
FT                   CRLFALAEEFKYVSVREEEKLELAKLAERVPIPVKESIEEPTAKINILLQAYISGMKLE
FT                   GFALMADMVYVTQSAGRILRCIFEIVLKRGWAQLADKALALCKMAARRTWGSQTPLRQF
FT                   KGIPHDILIKVERKDLAWERYYDLSSQEIGELIRFPKMGKAIHKFVHQFPRLELSAHVQ
FT                   PITRSVLKVDLTLTPDFQWDEKVHGYVQGFWIIVEDNDGEMILHHEFFLLKQVNAEEDH
FT                   AVSFTITLLDPLPPQYFVRVVSDSWLGSETIIPVSFKHLLLPDKHPPPTELLDLQPLPA
FT                   SALKQDGFDVLYAPRIKHFNPVQTQVFQCLYNTDDNALIGAPTGSGKTVCAEFAILRML
FT                   NKLNKNEADVVRCVYMAPTPELARERVQDWSARLGDKLGLRVVSLTGETATDLKLLEKG
FT                   QVVIATPQQWDVISRRWKQRKNVQNVSLFIADELHLIGGAVGPTMEVVTSRMRYISSQL
FT                   EKPIRIVGLCTSLANARDLGEWIGASSHGLFNFAPGVRPVPLDIRVTGIDIVNFEARMQ
FT                   AMARPVYSAICQHAPGGEPSIVFVPTRKHAKLASLDLLTFAAADGKPQKFLACDPEDLA
FT                   PHIGKISDSAVRHALGFGVALLHESMDSDERELVERVFSSGAATVLVVTAPLAWGLTAS
FT                   CKLSVIMGTQYYDAGGAASADYPVTDLLAMMGRAARPLHDDHSVCVLLCHAPRKEYYKK
FT                   FLYEPFPVESHLDHFLHDHMAAEIVTRTIETKQDAVDYLTWSFYYRRLSQNPNYYNLTG
FT                   VTHRHLSDALSELVESTLGDLEASKCISIEDDMDVAPLNLGMIGSYYYISYTTIELFAA
FT                   SLTAKTKLKGLLEIVAGATEFEKFAVRPGESNILRHVLNHSAVTLDNRRTTDPHVKVAA
FT                   LMQAHFGRMKLNGDLTNDLKAILPEAARLLQAIVDVISSSGWLAPALAAMELSQMLVQG
FT                   MWDKDSPLLQLPHVDKDCAARCAEAGIESVYDLVDIEDDDKRAELLQMTDAQMGEVAEA
FT                   CNRYPNIEVNYEVVNADEVEAGDSVEMVVSLEREMDDDGELGAVVAPRYPKKKDSESWW
FT                   LVVGDAKKGTLSAIKRVNLGRKQKVKLEFQAPSEPGNVDYTLFFMCDSYLGCDQEYEFT
FT                   LNVQEAQSGSESGSEEDAMDE"
FT   CDS_pept        join(319715..319874,320165..>338225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639094"
FT                   /orf_name="MICPUN_63191"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70252.1"
FT                   /db_xref="UniParc:UPI000199D596"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX3"
FT                   /transl_table=1
FT                   /translation="MIAGPGEDRPGSPKGVRRQVKALRYTRYAASRFASSWRTVIILIM
FT                   ALIGTARAGTLLEKLVSRSGMVGLGNYKYYKLHLRCTEAAQAVTFRLHALDGNPDLYIS
FT                   KTLRNPTRSHGYHSWKSEETGLKEDVIVIERPEAGTYYIAVYGAATATFKVTAFTKMWT
FT                   GKHPCTGFRIEDNDTEEENTDGSFLLENKMTVTGGVNFESNMNVLQDVTLGDSQTDTIS
FT                   IKGQVQLGTASPGEYIIHKADTVNVTGGTLVLRGANTMGANAGNVTLMAGLGTQGRGGS
FT                   MNLFAGAANYADAGDLTIGTGRALEGRAGNLTIFVSRGDVGVGGNVTVKAGLTSDEDMP
FT                   GGSVNIAAGIGANSTGGRGGVIKIDGGLAQGNKSCDLTDYVCSGIAVNVAVYEAVLHGC
FT                   TSDFSTMTSVENVTYLCGTMQVSSEQYFAVLGGCTQKCLGGAVEVSGGLSSGGVGGAVV
FT                   VTGGATSSTDPYARGGNVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETSGNDG
FT                   VSGEISVETGASAVGDSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVVIKAGESHA
FT                   DSKKGGGVFITSGAGTSAQEGSGGELVMMAGNAEGSLAGDGGRVEIRGGKAVGGRGGDV
FT                   AVSGGNSYSGDGGALILQGGSSETGTGGDVILDAGESGTHEESKEGMIRIAPTSASYVR
FT                   IGRSGSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRVPKIT
FT                   GLDSEDVSATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQSALLL
FT                   RQGYDEADKRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDTGHGG
FT                   NMTLTSGDTVDARHRGGFLTLTAGGNNNTVGGRGGVVKVTGGFAGGTTDCDLDYYECGG
FT                   LNITAAMHEAVLHSCSTINATHFLCNSTFVSSDQRTAVLGGCTQKCLGGAVEVSGGLSS
FT                   GGVGGAVVVTGGATSSTDSQGRGGNVEIRGGSSSAGEGGSLLLTGGFSDLSTGGDVIVD
FT                   AGFSGTSNTTKEGLIRVAPTRATIVTVGSFENIVPTEFYGDVTVYGRLASTPPGGGDLT
FT                   LTAGNNDDTVNGKGGSAKIAGGYSMATLDCDLTIYDCDGLNITVAMYEAVLHGCTADAG
FT                   TAASSAFLCGTMEVTAAQRTAVLGGCTQKCLGGAVELSGGAAQGGVGGAVVVTGGATNS
FT                   TNPYARGGHVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETSGNDGVSGEISVE
FT                   TGASAVGDSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVVIKAGESHADSKKGGGV
FT                   FITSGAGTSAQEGSGGELVMMAGNAEGSLAGDGGRVEIRGGKAVGGRGGDVAVSGGNSY
FT                   SGDGGALILQGGSSETGTGGDVILDAGESGTHEESKEGMIRIAPTSASYVRIGRSGSKT
FT                   VRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRVPKITGLDSEDVS
FT                   ATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQSALLLRQGYDEAD
FT                   KRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDTGHGGNMTLTSGD
FT                   TVDARHRGGFLTLTAGGNNNTVGGRGGVVKVTGGFAGGTTDCDLDYYECGGLNITVAMY
FT                   EAVLHGCTADAGTAASSAFLCGTMEVTAAQRTAVLGGCTQKCLGGAVEVSGGLSSGGVG
FT                   GAVVVTGGATSSTDPYARGGNVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETS
FT                   GNDGVSGEISVETGASAVGDSGGITLATGSAMTGAGGDVNLLVGCGDTENGGAVVIKAG
FT                   ESHADSKKGGGVFITSGAGTSAQEGSGGELVMMAGNAEGSSAGDGGRVEIRGGKAVGGR
FT                   GGDVAVSGGNSYSGDGGALILQGGSSETGTGGDVILDAGESGTHEESKEGMIRIAPTSA
FT                   SYVRIGRSGSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRV
FT                   PKITGLDSEDVSATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQS
FT                   ALLLRQGYDEADKRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDT
FT                   GHGGNMTLTSGDTVDARHRGGFLTLTAGGNNNTVGGRGGVVKVTGGFAGGTTDCDLDYY
FT                   ECGGLNVTVAMYEAVLHGCTTKNSTHFLCSSLDVSSDQRTAVLGGCTQKCLGGAVEVSG
FT                   GLSSGGVGGAVVVTGGATSSTDSQGRGGNVEIRGGSSSAGEGGSLLLTGGFSDLSTGGD
FT                   VIVDAGFSGTANTSMEGLIRVAPTRATIVTIGSTEHIVPTEFFGDVTVYGRLTSTPPAG
FT                   GDLTLTAGDNDDTVNGKGGSAKIAGGYSMATSDCDLTIYDCGGLNITVAMYEAVLHGCT
FT                   ADAGTAASSAFLCGTMEVTAAQRTAVLGGCTQKCLGGAVELSGGAAQGGVGGAVVVTGG
FT                   ATNSTNPYARGGHVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETSGNDGVSGE
FT                   ISVETGASAVGDSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVVIKAGESHADSKK
FT                   GGGVFITSGAGTSAQEGSGGELVMMAGNAEGSLAGDGGRVEIRGGKAVGGRGGDVAVSG
FT                   GNSYSGDGGALILQGGSSETGTGGDVILDAGESGTHEESKEGMIRIAPTSASYVRIGRS
FT                   GSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRVPKITGLDS
FT                   EDASATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQSALLLRQGY
FT                   DEADKRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDTGHGGNMTL
FT                   TSGDTVDARHRGGFLTLTAGGNNNTVGGQGGVVKVTGGFAGGTTDCDLDYYECGGLNIT
FT                   VAMYEAVLHGCTADAGTAASSAFLCGTMEVTAAQRTAVLGGCTQKCLGGAVEVSGGLSS
FT                   GGVGGAVVVTGGATSSTDPYARGGNVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVR
FT                   TETSGNDGVSGEISVETGASAVGDSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVV
FT                   IKAGESHADSKKGGGVFITSGAGTSAQEGSGGELVMMAGNAEGSLAGDGGRVEIRGGKA
FT                   VGGRGGDVAVSGGNSYSGDGGALILQGGSSETGTGGDVILDAGESGTHEESKEGMIRIA
FT                   PTSASYVRIGRSGSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQE
FT                   ETRVPKITGLDSEDVSATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGA
FT                   RDQSALLLRQGYDEADKRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVG
FT                   SGDTGHGGNMTLTSGDTVDARHRGGFLTLTAGGNNNTVGGRGGVVKVTGGFAGGTTDCD
FT                   LDYYECGGLNITVAMYEAVLHGCTADAGTAASSAFLCGTMEVTAAQRTAVLGGCTQKCL
FT                   GGAVEVSGGLSSGGVGGAVVVTGGATSSTDPYARGGNVEVRGGTAALGSGGAVLLSSGR
FT                   SAQRSSGEVLVRTETSGNDGVSGEISVETGASAVGDSGGITLATGSAMTGAGGDVNLLV
FT                   GSGDTENGGAVVIKAGESHADSKKGGGVFITSGAGTSAQEGSGGELVMMAGNAEGSLAG
FT                   DGGRVEIRGGKAVGGRGGDVAVSGGNSYSGDGGALILQGGSSETGTGGDVILDAGESGT
FT                   HEESKEGMIRIAPTSASYVRIGRSGSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERV
FT                   HVSQEQDLVIQEETRVPKITGLDSEDVSATPTSTLTLDAGQGGSDQWIEIGPWEAEYIT
FT                   IGGKNNNASHGARDQSALLLRQGYDEADKRLQMNRTGAILMQAAASMPILIHTNPTRGT
FT                   NNTGGDINMLVGSGDTGHGGNMTLTSGDTVDARHRGGFLTLTAGGNNNTVGGRGGVVKV
FT                   TGGFAGGTTDCDLDYYECGGLNITVAMYEAVLHGCTADAGTAASSAFLCGTMEVTAAQR
FT                   TAVLGGCTQKCLGGAVEVSGGLSSGGVGGAVVVTGGATSSTDPYARGGNVEVRGGTAAL
FT                   GSGGAVLLSSGRSAQRSSGEVLVRTETSGNDGVSGEISVETGASAVGDSGGITLATGSA
FT                   MTGAGGDVNLLVGSGDTENGGAVVIKAGESHADSKKGGGVFITSGAGTSAQEGSGGELV
FT                   MMAGNAEGSLAGDGGRVEIRGGKAVGGRGGDVAVSGGNSYSGDGGALILQGGSSETGTG
FT                   GDVILDAGESGTHEESKEGMIRIAPTSASYVRIGRSGSKTVRTDVFGDLTVHGSFVSTN
FT                   SMVFQDTYAERVHVSQEQDLVIQEETRVPKITGLDSEDVSATPTSTLTLDAGQGGSDQW
FT                   IEIGPWEAEYITIGGKNNNASHGARDQSALLLRQGYDEADKRLQMNRTGAILMQAAASM
FT                   PILIHTNPTRGTNNTGGDINMLVGSGDTGHGGNMTLTSGDTVDARHRGGFLTLTAGGNN
FT                   NTVGGRGGVVKVTGGFAGGTTDCDLDYYECGGLNITVAMYEAVLHGCTADAGTAASSAF
FT                   LCGTMEVTAAQRTAVLGGCTQKCLGGAVEVSGGAAQGGVGGAVVVTGGATSSTDPYARG
FT                   GNVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETSGNDGVSGEISVETGASAVG
FT                   DSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVVIKAGESHADSKKGGGVFITSGAG
FT                   TSAQEGSGGELVMMAGNAEGSSAGDGGRVEIRGGKAVGGRGGDVAVSGGNSYSGDGGAL
FT                   ILQGGSSETGTGGDLILDAGESGTHEESKEGMIRIAPTSASYVRIGRSGSKTVRTDVFG
FT                   DLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRVPKITGLDSEDASATPTSTL
FT                   TLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQSALLLRQGYDEADKRLQMNR
FT                   TGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDTGHGGNMTLTSGDTVDARHR
FT                   GGFLTLMAGGNNNTVGGRGGVVKVTGGFAGGTTDCDLDYYECGGLNVTVAMYEAVLHGC
FT                   TADAGTAASSAFLCGTMEVTTAQRTAVLGGCTQKCLGGAVEVSGGAAQGGVGGAVVVTG
FT                   GATSSTDPYARGGNVEVRGGTAALGSGGAVLLSSGRSAQRSSGEVLVRTETSGNDGVSG
FT                   EISVETGASAVGDSGGITLATGSAMTGAGGDVNLLVGSGDTENGGAVVIKAGESHADSK
FT                   KGGGVFITSGAGTSAQEGSGGELVMMAGNAEGSSAGDGGRVEIRGGKAVGGRGGDVAVS
FT                   GGNSYSGDGGALILQGGSSETGTGGDLILDAGESGTHEESKEGMIRIAPTSASYVRIGR
FT                   SGSKTVRTDVFGDLTVHGSFVSTNSMVFQDTYAERVHVSQEQDLVIQEETRVPKITGLD
FT                   SEDASATPTSTLTLDAGQGGSDQWIEIGPWEAEYITIGGKNNNASHGARDQSALLLRQG
FT                   YDEADKRLQMNRTGAILMQAAASMPILIHTNPTRGTNNTGGDINMLVGSGDTGHGGNMT
FT                   LTSGDTVDARHRGGFLTLMAGGNNNTVGGRGGVVKVTGGFAGGTTDCDLDYYECGGLNV
FT                   TVAMYEAVLHGCTTKNSTHFLCSSLDVSSDQRTAVLGGCTQKCLGGAVEVSGGLSSGGV
FT                   GGAVVVTGGATSSTDSQGRGGNVEIRGGSSSAGEGGSVILLTGRSDDATSGALVMRTEN
FT                   SGTAGASGTVDIETGKATGGAGGAITVTVGDGDTGTGGAMTLTAGKTTAASAVGGAMSL
FT                   TAGEGAGTGGAVTITTGVGTATNSGTMTLATAAAGTNGNSGAMSIKTGAGGGTTGNSGS
FT                   IELATGDSATAGATGDVSITTGAATGGNGGDISLLVGEGDTGNGGAMTLTAGKATAVNA
FT                   SGGAVAITAGAANNTGGAGGAMSLTAGAGASTGGEVTITTGVGTATNSGAMTLATAAGG
FT                   VSGNSGSVSM"
FT   CDS_pept        342699..344147
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639095"
FT                   /orf_name="MICPUN_109290"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70253.1"
FT                   /db_xref="UniParc:UPI000199CAAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX4"
FT                   /transl_table=1
FT                   /translation="MSLQTANAGTSGVSGGMTLGTGTSTNGASGSIAMSTGAATSGAGG
FT                   AITLTVGDGDTGAGGAMNLTAGKSVTGGALRMTAGQGTGGSGGHIVMTSGEGTTASGAV
FT                   SISSGEASGVTGEMIVATGSGANASGAMTLGTGTSTNGATGSISMTTGAATGGAGGAIT
FT                   VTVGDGDTGTGGAMTLTAGRTTAASAVGGAMSLTAGEGAGTGGAVTITTGVGTATNSGT
FT                   MTLATAAAGTNGNSGAMSIKTGAGGGTTGNSGSIELATGDSATAGATGDVSITTGAATG
FT                   GNGGDISLLVGEGDTGNGGAMTLTAGKTTASGATGGDLTVKAGQGDTGGDLILDAGQGT
FT                   SVGVAYTGNITVGVDNAAAVLVGRSANDGRVLLSGMVEAFTFKIGRQDHSGLMDKHLKV
FT                   DTSSFTVPLLYPSSKYGFSVNVPGAALGDIVQVSFSSSIGELYLTAHVSAADTVRVTVH
FT                   NPGHNVEAEQLPAGVFTVVCTSYA"
FT   CDS_pept        complement(345485..346693)
FT                   /codon_start=1
FT                   /gene_family="HOG000135008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639096"
FT                   /orf_name="MICPUN_103521"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70494.1"
FT                   /db_xref="HOGENOM:HBG615234"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI000199CAAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX5"
FT                   /transl_table=1
FT                   /translation="MADTSNDSKLGRYLAVGVAAAGAACAATSLYWNLHFRGTSWLIGS
FT                   FDLGPSLYGMSSAPSTPAAGKGGKKGKKKKKGGSSGHLNGMDTREPSTASTGPSAGGGP
FT                   AVYETKRAVNEYLQFHFGDPNDVLPYRDGPHDALRFTQRCADLCAKHTKSVKTSRTEPA
FT                   GLALDIGCAVGGATFELAKHFAIVEGLDYSRAFITAARLMKERGSLRYTCFREGEVTRK
FT                   LTGAVNDRVDRARVSFREGDACVLPRSLLGGGGSGSDFDAFGRHDAVLAANLLCRLPDP
FT                   AAFLAQCARLLRPGGVLVLVSPYSWLEAWTPKDRWLGGYYESASASEDGGSAEGSGSAS
FT                   PAPNAPYRRSFDAIEAALTSAEGGFDLVEQSDLPFLIKEHDRKFQWGVSHCTVWRRRRV
FT                   PNA"
FT   CDS_pept        347335..>347727
FT                   /codon_start=1
FT                   /gene_family="HOG000234441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639097"
FT                   /orf_name="MICPUN_73619"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70254.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CAAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX6"
FT                   /transl_table=1
FT                   /translation="MCVRSLAWETTDQALREYFERFGEVTTCTVKTGPDGRSRGFGFVN
FT                   FADKSAIAAVLEEEHVVDGRRLEILPPRLTDLAHTTKVFVGRLEPSVPVETIREHFAQF
FT                   GEVLDVYMPHPHKGFCFVTYADNASAL"
FT   CDS_pept        <348238..>348463
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639098"
FT                   /orf_name="MICPUN_74800"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70255.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CAAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX7"
FT                   /transl_table=1
FT                   /translation="NGEFALYVSNIAWEAGWQDLKDHFKQFGRVVFVDIARDAQTGKSM
FT                   GRGIVRFDDADSAARAVQFGNGSIFMGRDL"
FT   CDS_pept        348781..350049
FT                   /codon_start=1
FT                   /gene_family="HOG000100805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639099"
FT                   /orf_name="MICPUN_103519"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70256.1"
FT                   /db_xref="HOGENOM:HBG557793"
FT                   /db_xref="UniParc:UPI000199CAAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX8"
FT                   /transl_table=1
FT                   /translation="MGGPKGVIRPGFNLIPRAKRDEGANGAKTRREKAVTAADSDSEDA
FT                   ADDFLRNNAVAVGEDIPSTSGVDGESVEKRKKNKDKDVDAFEPVAAEEADGRVKGKKNK
FT                   KERQKHLLQHLSLRAETTTPAASVDHPFEVDAADHCETPFQAYQDIEPFLFRMALALKK
FT                   PKDKLRIYDPYFCEGSVAKHLARLGFTSVYNKNEDFYKCIEEKRIPEHDVLLTNPPYSG
FT                   DHFRRILSFCAKNKKPWLLLLPNFVCRKQYYQPCVGEDVKALFLIPDPTKPYRYWAPGR
FT                   RGFEDRNQAKGTTPFETFWYVNYAGLAPHEEVRAWWMKKFAPHSTCTLPAPDEALPQQQ
FT                   RLQKRANPRARKIAAMKERKQGGPANDGKDGKGSGGIYYDQERAKAAKQRMMQQQGGDG
FT                   DFRKDKRKREKGGKGDRKRSKQA"
FT   CDS_pept        complement(350089..350574)
FT                   /codon_start=1
FT                   /gene_family="HOG000261970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639100"
FT                   /orf_name="MICPUN_86979"
FT                   /product="Predicted protein"
FT                   /function="8-oxo-7,8-dihydroguanosine triphosphate
FT                   pyrophosphatase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO70495.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008413"
FT                   /db_xref="HOGENOM:HBG322338"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000199CAAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIX9"
FT                   /transl_table=1
FT                   /translation="MASSAVEPKILTLLMVVQDGKVLLGYKKRGFGEGMWNGFGGKVEP
FT                   GETPTEGALRELREEACIDATDATERGVVTFVYDDKPRPMQVHIFHASQFTGVPTETDE
FT                   MRPAWFDLEAVPFDKMWPDDELWYPMFLAGKKFSGTFWFTNTTTIVRHELREVESLE"
FT   CDS_pept        join(350734..350838,350909..351604)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639101"
FT                   /orf_name="MICPUN_63185"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70257.1"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="UniParc:UPI000199CAB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY0"
FT                   /transl_table=1
FT                   /translation="MAELLDKPLDEIIKMDTGGGNRRRGGGNRGGRGGKAPHGKNDGSR
FT                   RRSRENSTPYGVTHRSGESVADIANAPSGERTLKCSATTNPKKLAGSIALVCEGGCGEA
FT                   PLILALGASCVNQAVKAIAICRKDMLEHADPTYLSCFPSFRQHREQKHGALSLQCDKET
FT                   KGPWSSSDVDLTVASGTNPSSTAGAIAGKIREGCKVAVRACGADAVNNAVASVAFARQY
FT                   LKDEGIDVYFVPEFEKEPVGDGGERTVVLFRVCKAAGSAATGVK"
FT   CDS_pept        <352215..>352947
FT                   /codon_start=1
FT                   /gene_family="HOG000251820" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639102"
FT                   /orf_name="MICPUN_76323"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70258.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG755338"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniParc:UPI000199CAB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY1"
FT                   /transl_table=1
FT                   /translation="RIISGEEVNPPGKYPWMLGVVAVSSSGSESFRCGATLITSRYALS
FT                   ASHCFFSSGTDSNLGSSTISLKVGAHDIDNPSKTVEVTDIIGHPDYDGNKWENDITVLR
FT                   LAEDLDTSTYPPVRLEWDPEKYAEGTPARVIGWGTTAQGSGQASQVLLQANVPVVSQET
FT                   CSGPGSYPPGGAGLTVTDAMLCAGFENGGTDACQGDSGGPLVAIDANGDLSQIGIVSWG
FT                   EGCAQAQKYGVYAHVNNLRGFL"
FT   CDS_pept        complement(353348..354778)
FT                   /codon_start=1
FT                   /gene_family="HOG000100806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639103"
FT                   /orf_name="MICPUN_103517"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70496.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG557795"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniParc:UPI000199CAB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY2"
FT                   /transl_table=1
FT                   /translation="MASVAVRTTSVAVRARRVTPVAFVDRSPSTTVTRGAGTLAVFTQR
FT                   SGSRTAARNGRVAVRVHAAKGETAADPNAPLGPNKSAADAVNNGLACFEKRRYDAAVRN
FT                   FSAALKDFGSPSEDESRAALYNRACAYVKLQKYDEAKVDLKSAINDYNLKFSVVLKDPD
FT                   MEVFRGTPQYEEMAAEEVKGFRSNKSVQKLKAEAQEPFRFFKLYAFGGLGAGAFIGLII
FT                   ILARLSAAIKGGDDAPELGETIKNLLINIVAVSAFAYLFSNELKQREKTEFKVAREEEL
FT                   GRLRMAIEESKEDVLVSQLRGNYRLFIIAGSDEHIDNAMGQLVKYKAKLKEQNVVIATV
FT                   DMLNGGGKKKAKKAPGAAMAALKAEFAAERGGAVDGEDGSAPAVAEPMEFGKRSKRADV
FT                   AVSAARVTEKKWRVAPLDEDAWRTWIVNEIERNGFDPSVRDVFFSVGKDGTLWKSGAGT
FT                   PNWMKIIEELPTSGLTGV"
FT   CDS_pept        join(complement(355938..356172),complement(355214..355809))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639104"
FT                   /orf_name="MICPUN_103516"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70497.1"
FT                   /db_xref="UniParc:UPI000199CAB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY3"
FT                   /transl_table=1
FT                   /translation="MAWAILVAILLLGPSPWSGGLPGAEAKLSNQMKMPVTKEDIKRRA
FT                   EKKQKGQPLTEDVENSLPDWEDDPVMKSKLKCNACAVVVSELVSALKKKREQRKFKLTP
FT                   DENMGALERGCFQVRRDYGLQMRNNKVTPVYSNDHSIAKTEGAWISTFLVSTCGSVVGD
FT                   YDDYIIANYATTPVHELAATVCQRAPGFEDDDDDDWRDDDDDDGGGVPKGLGVCPVGLD
FT                   MSKANTHDDGWTVEEAIRKVEEKSRKDKKMLDRQQKRAGMKKRKKARKQKVDEL"
FT   CDS_pept        356806..357480
FT                   /codon_start=1
FT                   /gene_family="HOG000265350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639105"
FT                   /orf_name="MICPUN_103515"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO70259.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG557797"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="UniParc:UPI000199CAB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY4"
FT                   /transl_table=1
FT                   /translation="MEKFEVSKAVEVFGTMRQVVVTGAGADTRGFRVPWPRGTAVFELA
FT                   HEDAHAFAHETLKAVGAKPAKGSSHRRVRCDPTSSDYRYGDMEEALVRAGYAPDVPSVW
FT                   VLQDVGSVDIRKWNDLVEEIGDLMCAGSEIVAHAPSSGLGAQGASFGAALVRGLAAAGT
FT                   LARAYTAGELGCEEVDGGALVGQVGVVHGVKQRPSRQETEFYREQVWQIENEDGDEEGF
FT                   SF"
FT   CDS_pept        join(complement(357881..358642),complement(357855..357860))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639106"
FT                   /orf_name="MICPUN_103514"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70498.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199CAB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY5"
FT                   /transl_table=1
FT                   /translation="MNARQNFHLNFYAGDPSTADATPVSTRPIGTLYDQRMAHRFMDED
FT                   SLMTDGLAFLEAKVGKDHPYVAELCAELGMIHMEDENFKKASFLLERAWRIFREKLGKF
FT                   DAQTLLAQEGLSMTLHMLGEHARADALFDAAMAGIEDIYKKHHQKKAAEEAARREETRH
FT                   ANFLSRYERRNSPPSAPVGAGHAGKWGKVAATRTALRNLTNAKGAGTKVDGRGGHAGAD
FT                   DGAEGPRDDRRRAEPENGARDNWRKAKLKTAAD"
FT   CDS_pept        358977..359600
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639107"
FT                   /orf_name="MICPUN_109289"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="protein complex"
FT                   /protein_id="ACO70260.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0043234"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="InterPro:IPR011719"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="UniParc:UPI000199CB29"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY6"
FT                   /transl_table=1
FT                   /translation="MLAQRYSSVVATTRAAVSASGARSGARQTAFKPACVPARNPKPAD
FT                   LFSGLSGNSLSADPARRGQRVTTGVGPRFDAVVSRPPPTEGMGMNHVLFVEIGMGADQH
FT                   GQDATKAAVRACRNAIEFNSIPSIRQIVPGGYDNMKLHIQIGVPKGAVLDLEKIRRVFP
FT                   YGQICEPIEVVEGGLMARSGIKIPEMGDKSDEFVIAVAAITIGY"
FT   CDS_pept        <359953..>361134
FT                   /codon_start=1
FT                   /gene_family="HOG000217186" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639108"
FT                   /orf_name="MICPUN_75476"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70261.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG288723"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199CB2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY7"
FT                   /transl_table=1
FT                   /translation="SELPDEIGTLSSLEFLNLGKNPLSTLPSTFAGLTSLKILFFLGCE
FT                   FTKVPEVLGEMKSLYMLSFKANKVEEVPAASIPHRTLGWLILSDNNIQSLPDTVGKCEN
FT                   MRKLLLAGNKLTNAGLPDNMAHMTRLELIRLADNNLTEVPAWIASHPSLAWVALAANPA
FT                   TEAWAEDANARAMTSDDVSSSEGASKVDVPVVDWSELGVDEDEPPLGSGASGAVYAATD
FT                   RNGSRTAVKVYNLGGKTSDGRPRDEMAASVLASRTGCRSIVRTTARFVKNEESQAEGAL
FT                   LEGLVMEYLDPGEWRSLGSPPSFDTVTRDVYPPELKLDAAEVVAVARGLAAAGAALHTC
FT                   GCIHGDMYAHNVLFRSSKFNGVPAAKLGDFGAAFFYPPGSTIGREFERTEARAW"
FT   CDS_pept        361413..362153
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639109"
FT                   /orf_name="MICPUN_63177"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70262.1"
FT                   /db_xref="HOGENOM:HBG607506"
FT                   /db_xref="InterPro:IPR019331"
FT                   /db_xref="UniParc:UPI000199CB2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY8"
FT                   /transl_table=1
FT                   /translation="MSVPPPPPGGHVMGADDPNSVPMMRIEEPERVFDREKVLGRDAAS
FT                   VFPTMAQENADKVVSATQAVVGSMSFVTESELAEIKAKRGGALRPEDGTMEPEKPLWQV
FT                   LQEAKDAKEEAFQEGWKTMKQGIYKPVDEEEVEFLDEVADRRREEEQRLKQREQDEAEA
FT                   FRLMRENRVVKKAVAPTTEAIKRGADPLAQSVAKKLKSPGPAVVVVKRAKPAPKKGEEP
FT                   KKEEDSDDEGGGLGLLGDYGSDSD"
FT   CDS_pept        join(complement(364450..364565),complement(362217..364341))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639110"
FT                   /orf_name="MICPUN_63176"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70499.1"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR010441"
FT                   /db_xref="UniParc:UPI000199CB2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIY9"
FT                   /transl_table=1
FT                   /translation="MPGQRVLGGSREAGAALPRIQLKWILSLDLESQVKNAKRDLANGY
FT                   VFAEIISRYHPEEISLHSFDPAASSVAKKRDNWGQLVKFFKRKKWDIRAREWEQVSAME
FT                   SGAAQELMDKIFKYLGGTLGTPVVSPTSSARPSDNYEAGPSGMAPGAARAHSHHSHQQA
FT                   VPQRAPAPVSYGQPGAQQPSYGQQVAHGGGRPSVMDIMEAGPSQPSADPINDLFGRFAG
FT                   DDDDDHDNENDDPGPGPPLAARVVNPGRVPVSDAPARPASIGNSRGSRSRKPIASDRRD
FT                   AVDTGGGFGFGDGGFRPYEPKPGGFDWEAYQREYMQPRLRTPSPEPEPEPEPEYEPEIP
FT                   EYHHEPEPELEPARRRGGRRMQPLPRSNRGPAPRVTPARESPHHGGAGGGYESGYSRGE
FT                   YESGPGPVRGGGNGGFDPGASLLDWGAPLPGDDTYYGGGEGDPYASQYAGYENDYHDDR
FT                   NPYANDPFGDGNGGRSPYNDRGGSQMMSINNHASPGMKRSPVSKKPPVPKRSAMKQHSA
FT                   YGGGGGGGGYDDYDGYGYDDPYGGGARGPGYHDPHAYRPDRRAGHGMDYEPRRPDDYRR
FT                   MLGENGKYLMLGSLGVDTDTEEHRKARARAEAIKEFDRQAREQNKIQAEKARAKKAKQP
FT                   LVYRERLQQKFDINRSSDKPLDPNAPPSKRDVMLKYGKTVPKPKPAAPREEKVQQSVHE
FT                   HGKGRGYSSRANDFVDYMNHPAVPDESQMAELERLEIEYRIHQEKLAALNIF"
FT   CDS_pept        <364875..>365165
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639111"
FT                   /orf_name="MICPUN_73517"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70263.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199CB2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ0"
FT                   /transl_table=1
FT                   /translation="VRHGKGKNTVDGKWTYEGDWVQDKMEGKGTFTYKSGASYDGDWVA
FT                   NKYHGQGTYTWPDGTKYVGTWVDNAMHGQGTYTDKDGREWVGEFYNNDGPGL"
FT   CDS_pept        complement(365419..366501)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639112"
FT                   /orf_name="MICPUN_109288"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70500.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199CB2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ1"
FT                   /transl_table=1
FT                   /translation="MSRAVMDRVGRALAQRLFLVQRRDISRGPAGVGGAASTEAGGTST
FT                   GPDDKWHAVFAVFGTTGNVYECHVCANPSCTCPDFAGDLRSGGGASAGGRGGRHGGHIC
FT                   KHLLWVYMRVLGVQRDDRVLCQVALLQSELAKMLATPTRAQRAELAAAAVREAYLAATG
FT                   GARGTEELAPPPVTRQPVRSADGDGEIEPVTCPVCFDPLEDPADVAPNLAGVDVGASCS
FT                   GAREPIGSKGAKVWWCRGGCGGNVHSACMRRWIDRSGMAPACPLCRATWVPQDEDDGGG
FT                   DDATGDAVVALPTPAPDADGTTAKTDPDTSAPFTSPGGSSYVNLRAYQGGTAARRDLSQ
FT                   YNDFARKAIEKREREQREGK"
FT   CDS_pept        complement(369077..369250)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639113"
FT                   /orf_name="MICPUN_63173"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70501.1"
FT                   /db_xref="UniParc:UPI000199CB2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ2"
FT                   /transl_table=1
FT                   /translation="MDPKKEERLESEKRVRERKEAGLTPDIRDVPPEEYTDSKGGYRDF
FT                   QGYPGEQPKKTE"
FT   CDS_pept        370159..370569
FT                   /codon_start=1
FT                   /gene_family="HOG000265349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639114"
FT                   /orf_name="MICPUN_103509"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70264.1"
FT                   /db_xref="HOGENOM:HBG607504"
FT                   /db_xref="UniParc:UPI000199CB30"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ3"
FT                   /transl_table=1
FT                   /translation="MADPGAPRVKLPDGREVPPATARGGTQVPDHVLRAIYGDSLPAPE
FT                   PSTPSRPHGDEDAQRAGEPQRLKLMSKAERYDESLKTWWKEYADRKNDEEEEHVSDSLL
FT                   YDYTHLPRMTPAPNLTEDRLKHVEPMHGDGKK"
FT   CDS_pept        370745..371479
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639115"
FT                   /orf_name="MICPUN_63170"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70265.1"
FT                   /db_xref="UniParc:UPI000199CB31"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ4"
FT                   /transl_table=1
FT                   /translation="MKRSVSWALALLVVVIVSPACDVGAIDSIDAIPLGAGASRDAPCA
FT                   GTRSDPSPCQELRPRESLNAQTLAIGGAPRLYRLTGLHPESAYEVRVSYPATNPADVRV
FT                   RIVDPGVQISKSGSRGGGLRRLLNVEKMVASARELAEAVHPKPGGGHPPGVVVAVWAEP
FT                   SAWHRDGPAGAPRELVFNVVLEPMSLAGLVPFQALPVGLIALGCAYAALSMEPMLRELV
FT                   WGDLVRRRGGQPLNSPPRARKR"
FT   CDS_pept        complement(371541..372512)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639116"
FT                   /orf_name="MICPUN_103508"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70502.1"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199CB32"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ5"
FT                   /transl_table=1
FT                   /translation="MSAEGSSSGSTTRNIVLGVAVGAAAYYAYRSYCMKPIPSSAEPGE
FT                   PEATKERSLSEEGTAQFGDEIDGLRSVAQEVFEQAQRKVVLVPNDKENGETTRAKEIEA
FT                   VSLAEELESVLREQQMNGGDDAKNDQTFGQSPEEMFEMQRKATIEMARLQAGGNVGQDG
FT                   KGGMKNLTADECGGTTQRYTWKQTEEEIVVEFPIDRAVRAKQIAVSFKAKHLSVKVKPG
FT                   APGEEERVILEGATLRDIKPDDCVWEIDDEDGSKKVVVTVVKRHATLAMHHWECVVEGD
FT                   EKIDTSRFGPAVVGINGNDPQALKRMLEEHGHMNPKPVPLEG"
FT   CDS_pept        372806..373216
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639117"
FT                   /orf_name="MICPUN_86780"
FT                   /product="Histone H3"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70266.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199B4D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6T7"
FT                   /transl_table=1
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
FT                   TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAILALQEASEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   CDS_pept        complement(373530..374726)
FT                   /codon_start=1
FT                   /gene_family="HOG000230811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639118"
FT                   /orf_name="MICPUN_98168"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO70503.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561587"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199CB33"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ7"
FT                   /transl_table=1
FT                   /translation="MSVAGVPLAQAHGWGERAIGLVQSSFLWGYMLTPLLGGVLADRYG
FT                   GKAVLGGGILVWSLATMATPLAAATSLPALLLTRAVMGLGEGVALPCMNNLTARWVPKA
FT                   ERSRAVAACMGGFQSGSMVGLLAAPAMLAWGGVSGPFAVFGLSGVLWAVVWAFAATTYP
FT                   RDSPSVSRRELALIEDGGSVADSTGKDGFVPEPTPFRLLLSKAPVWACIVANFVNNWGY
FT                   FILLAWMPLYFKQVMGLELARSSYFSALPWATMAASGVFAGTLADSLIGRGVSVTTVRK
FT                   FIQGVGFIGPALMLVLLTFQTTANGALAVLTVAVGCTAFTQAGFLVNFQEIGPRYVGAL
FT                   HGMANTAGSFAGIVGTYMTGVILESTGSWRAVLFITAGVYAFGAATWLAFSTGERVFD"
FT   CDS_pept        join(375699..375961,376113..376179,376301..376639)
FT                   /codon_start=1
FT                   /gene_family="HOG000238304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639119"
FT                   /orf_name="MICPUN_106354"
FT                   /product="Histone ubiquitination protein group a "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70267.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG714892"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199CB34"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ8"
FT                   /transl_table=1
FT                   /translation="MAGTTSTRVPTRSHAGRQAGGPAVSGSAGFSQGPEPSAPQVDVAK
FT                   EGGKEGYVDPANSYFECNICLELAQEPVVTQCGHLYCWSCIYKWLQVFPEAQQCPVCKA
FT                   AVSENLVIPLYGRGSCEHPRGKQMLGMDVPTRPPGLRLLARNTNANEVGGGEWGLAGAG
FT                   VAENVGLMSTLLGFGIQFGTGVRSSLLIDNMSPEQQQQAFLSQLLLLLGSFVILCLLIF
FT                   "
FT   CDS_pept        join(complement(379513..379532),complement(376773..378159))
FT                   /codon_start=1
FT                   /gene_family="HOG000242861" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639120"
FT                   /orf_name="MICPUN_98167"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70504.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG592135"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="UniParc:UPI000199CB35"
FT                   /db_xref="UniProtKB/TrEMBL:C1FIZ9"
FT                   /transl_table=1
FT                   /translation="MNTPLRTPNVGKSALFNRLTGTKRAIVYDQPGVTRDRMYIRAFWG
FT                   DTEFMMVDTGGLESLPGSPEDAPSVDTVGGFEILPGMVESQAALAVNEAAALIMVCDGQ
FT                   KGLTNADEEIYGWIRKYHSKKPLLLAVNKCESTTKGEEQVLDFWSLGGPTPLAVSAISG
FT                   TGTGELLDGLVAALPPPSPEDLDPSWKDEEGDGPLKVAIIGRPNVGKSSLLNQLAGDAR
FT                   SIVSDYSGTTRDTIDSDVIGADGKKYTLIDTAGIRRRTSVAASKDAPESLAVGRALQAM
FT                   RRADVVVLVIDAEEGPSQQDFVLSERAAVQEGCALVLCVNKWDRIDKDTYSMNEYTKTL
FT                   RSKLRVFEWASVVYTSALTGQRVQKVLQAAAEASVHHRKRLSTATLNSVIQEATLWKSP
FT                   PSKAGRKGRVYYVTQASTRPPTFVFFVNDPKLFPDTYKRYMERSLRDNIGFPGSPIRIL
FT                   WRGKGAKGKK"
FT   CDS_pept        join(379405..379542,379736..380107,380168..380454,
FT                   380728..382599,382789..383047)
FT                   /codon_start=1
FT                   /gene_family="HOG000291097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639121"
FT                   /gene_name="DPE2"
FT                   /orf_name="MICPUN_86873"
FT                   /product="Glycoside hydrolase family 77 protein "
FT                   /function="4-alpha-glucanotransferase activity "
FT                   /function="carbohydrate binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO70268.1"
FT                   /db_xref="GO:0004134"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG557805"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199CB36"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ00"
FT                   /transl_table=1
FT                   /translation="MSVIPKTTVGFRIKYWTEWGQNLVVCGNDPRLGSWDVRKGVFMRC
FT                   QHLGEDQLLWTGSVTGHFVGSFDYRYAVVDRDMNVVRWDAIVRHAHFAPAMPEGRGGGS
FT                   DDNSSEASGSAVGYGRDKVEIQDTWEFQSHPENLFARESFRDVALDDGSGKNVERALDA
FT                   LPEPSTHSRDFIHIRLEVRTLRLLPGQRLTATGDCAALGGWERDAAPVMNLDAVTRTWW
FT                   LDFDVAPEDLPVRYKYALRGATRAADAMEKGVDRVVAPLGWIGESPSRIVARDGHFRYP
FT                   GAWRGSGLAAPVFSLRSCDSVGAGDFVDLRTLVDVAHAGGMNVVQVLPVNDTTVHNMWW
FT                   DSYPYSSVSVFALHPLYLRIQQVVSEAARIAGPEHTNRFASLQAEVNKAKAALDLKEVD
FT                   YEATVKVKMSVARRCFEAVKTPFLNSTEFSEFLAENAAWLKPYAVFCALRDLFGTAQHW
FT                   RWGSLGSDNSAGTVTRLSQPGSEVYNTVALHYFVQFHLDAQLRAAAAHAKRVGVILKGD
FT                   LPIGVDKASVDTWMYPNLFRMHTSTGAPPDDFDPNGQNWGFPTYNWEEMSKDGYGWWRA
FT                   RMSHLERYFSAMRIDHVLGFFRIWELPAHTRVGRMGRFRPSVPIRRHELEQRGLWFVDR
FT                   LCEPRVTSSILREIFGDRDGEVAGRFMEETGHDGHLPDGRAINTYRFKAEFSTEEGLLG
FT                   SDAFKIRDGSPDWLVEETEAMRKGLLHLQHNVCLLRDPEDPDAFYPRIEMQKTSSFNEL
FT                   EGWSKDALNWLYDDYFGARQDTLWRENARRTLPALMTCTGQLVCGEDLGMVPPCVPPVL
FT                   DELGILGLRIQRMPHDEGEFGRPNRYPYATVCSPSCHDTTTTRAWYEADRHRRARYAHQ
FT                   VLGMQGDGQLASCFPPPMAAIVRQHMASPSALAIFPAQDLLALESSYAQRPAEEETIND
FT                   PTNNRHYWRFRLHVRLEDMLANSEWLADIREMVNESGRVDGKMTT"
FT   CDS_pept        complement(383169..384878)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639122"
FT                   /orf_name="MICPUN_63163"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70505.1"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000199CB37"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ01"
FT                   /transl_table=1
FT                   /translation="MNAAAIISRRVAFAAVANRPDGVNGAARVRGIPSTAVPTAWPGHG
FT                   TGRAMRSHRGVALGRPTRGARLAVITDPKDTANSFDEQLMGEDEVFLPAREEYHHESPV
FT                   VDANDGSTAGSAAQRQQSRATAAPSARGFSTSATAEFPPPPTTIEYEDLGPNVELARVV
FT                   RTDSADATRADTRDVDSRLSVTREALPVLVGWFGCKRSHLRKYAKMYADIGYDNVVCVI
FT                   PPTASTLFPALGDAFAASALESVVKAKARIAELNDEDAADVDDDSNTDDVSTSGVVLHI
FT                   FSNGGYLFAGNIAHAQTGFVADTEMPLGDVSTALRRKLGFAPDPKLARDFTQNVVALVV
FT                   DSAPGELEPGMVAASFEAVLEGKAAPEPEGGAAPSVTLQQTAAAMLAWPPIAKRLRYVD
FT                   AAWGGFPAVTGNRWSGDARGKQGNAAEVAFASAERKLQRLRLANEDGARTKAKIARNLC
FT                   DERPGGRGLLWCPAMFMYSRADPIIPCEQVEAFATARAMRLGRTASAATGGEGAGGGLV
FT                   TMKAWDDAPHCEMGRVDPEGYQRALKEFLAPPELEECEASFSNNIIKPWNRD"
FT   CDS_pept        join(<385216..385321,385454..>385986)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639123"
FT                   /orf_name="MICPUN_106353"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70269.1"
FT                   /db_xref="UniParc:UPI000199CB38"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ02"
FT                   /transl_table=1
FT                   /translation="PQVSALPQTSNNGSPCDQPGLRRSSRCPAPLVRVHAPLRPRRGHH
FT                   SDDQRQGWHGHRQALRRGHRRLPRGPRLPLRHVRQGQVRGRPQVLPRHLGIRVPAPVHL
FT                   RPVRVPPQRQGPHRYAPHGHALPLALLLRRVRRPRVCANQALQVQVQGRQEVRLRQDSL
FT                   HRDQEVHQDQEDQVRSPRGRVPKTKGLARRAVQGCSAKINLRHFFSLRIY"
FT   CDS_pept        complement(386020..387201)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639124"
FT                   /orf_name="MICPUN_103500"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70506.1"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI000199CBAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ03"
FT                   /transl_table=1
FT                   /translation="MVGQRRIDAWWIALAFVALIGSSMCAALAIASSSLTPDSERLRSP
FT                   RQYLSAALTTEPARSVGGLLLSTGAFAFLLAALARKLELDLRRVQLPRKEAPIGVAPTV
FT                   CDDWIKTENLALCLHAVASVGALGASAVSFETHPRAHRASLAVFFVGGSMSAALHAIVD
FT                   HGLGNTCSERVRRARAVFAGVALIFSSAFIVETPTFGSVASAQLAFEFAQLACVAALCA
FT                   HYATWVRSFRSFTVVASAEDVRTGMSRDSSWAWGLRDDGAFNGGGESDDDDGEYSVAEL
FT                   GEAGNRSSGASLVSKISDMLGGSGRSSPKRERGDSQRGRVDPFTHTGANVVAPYSPARV
FT                   SGLRSSPMTPGVPRVDSSDRIYRQLHEPFMRAHMEHQEQRQSNLGKKLPTFVP"
FT   CDS_pept        complement(387583..393420)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639125"
FT                   /orf_name="MICPUN_63160"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70507.1"
FT                   /db_xref="UniParc:UPI000199CBAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ04"
FT                   /transl_table=1
FT                   /translation="MAPSEAEAPGDGPFGGPGGASDDEWLADDSPGPTTGPILGARVGS
FT                   AEGTASMGDEPPRARVEGEGSTHATAGDSSAAGSTNGEVDRPFTPPPPAPADDWLGGAP
FT                   TPSDYAPENEAGWSSLDNSFASKPPPSPLGPDTGAAATDPNASWIEHRASPFGGNDSPR
FT                   ESPSKHKPPAIATTTFAQQPAQTFVVKKASSLGDLFGGGGEDLDADAYVSPVAAQTNPF
FT                   ASIVDDDDAFFDQLAGAPRQATPPPFGAPPPPNPTPPAVLPPAVPPPNPTPPAVPPTSQ
FT                   PDPQMAPVEPVADGADANRADVADGLAERFDGLATTEALSLDADQTTEARSAGDGVVRP
FT                   VVEATGETVEGIATSATGSSGEPRRTAGEEVQQQQQPAYSGGDYGAYTQQQQQPQPAYS
FT                   GGDYGAYTQQQQPQPAYSGDDYGAYHHQQHQQQQPAYSGGDYAHDAAAWRAQQPQQPVS
FT                   SLLPQAPTHGAPMQFMIPGRVPAEPDPQQPAAHLDPQPQADHQDPASAANGAQEPAYAP
FT                   PPEAAAYGAPPEMPAYGAPPEMPAYGAPPPTAAAPQFMIPGAPAQFEAPVEYAPPAPVY
FT                   QDSAPVYQDSAPAYSAYGSQDAAHSAYGELNPTEPGYAAYGTPPTQFMMPSAPAPFQDG
FT                   PTSSLARDTGGDGAMGAPTMGAPTMGAPTMGAPTMGAPTMGASHGGDAGAVHSSPFEGG
FT                   YSAYAAAGSSHAAGDAGTARSPHGRPPCLTIGFGVGGTLAIAAPGYPTPGAPPARPGGA
FT                   PPGYVTVHALANLVESFDPNGTGVGATYLASLGAVCGPFTRSHSSQHLQKMVDDRMAEA
FT                   RMGRGLLDERIRDGSAERGDDPEDQALLWGLLHAMVKHRGKMTQNVTGADPSGADPKGP
FT                   GPDLHALLLGSDADLNGSRRSERPGPASAATTGFSEDPVANSQALAEYERLLLGGKRGD
FT                   ALQLATSRGLWAHAMLLARHMGEQHFAATAAAMARAACTPGSPLHTLEVMFAGVPQDLI
FT                   GGGAGGIGVGQKVGGHSRTGSFGAAAASLVGVGDSSFGENVGPGTAGGDVRTLLPRWRE
FT                   NLAILAANRAPGDARVMGALGDALWSASSGPDGTGGVFAAHVAYALAGATPQPFHPSSR
FT                   LCLVGADHRRNPRTYATPAAIQRTELLEHSMALANSQYVLAPFQAYKLHYAGMLAEFGR
FT                   VKEALGYAEAVGRAVKNLDRSSPECNVPALAALAVELEHRLKGHSGGKNQFLQKAASSI
FT                   FGGFSKILDKGVHSLFGDEGGPGAGRTPGHSRQSSQSSSNAPPPQQPQQQPYQQMSQQQ
FT                   QQQPVQPAYGQQINGAPPSAPAPGPEPTPTSSGDDGSDFGGKSAPSRTNSLWRSVSGVM
FT                   GAVASAVPLPKPKNQAKLGEEMSMYYNEKLGRWVEPGKEDEVDSAPPPPPPKSFGSAAA
FT                   APVAADRTGGGAAASPGGAAPPNNFSMRAPTAGGVRSRYVDTFSLSGSPAQQQQQQQQQ
FT                   QQQQQGASPLLPGAAGLLPPGLMPPGSPLMPSPLGASLAQPMIPMVPAGGGFMIPDAVK
FT                   VPETVPEDVAGERGTTPASMESSRAPTPALQPEPEPEPAAEREPDPAAEPEPEPEPVPT
FT                   MATGTVDDPEGTAFFDRADDEGLGYHAPPSPPAIAAPPTTSDALSAYAAGPGDEPPPPP
FT                   PPPPPVDVSSLVPPPPATAAALQPDPPPLPPPPTRFGSAGVDDDADEWESVPDGEEEPG
FT                   AAFPDQPSSSDQPPAAPVPGSFFVPSPAGGSRAGDPDDDAGFDTLNDPGTNVNPANNAG
FT                   AATTAEADAAYDYGDVAASVASHQPAGAPESGGMVFDAVLETSGSKKEGYYDERGEWIE
FT                   GQFPGGFYDENGVFNRGYYDQAGAFHPGYVDANGEWVAAGDRPAGFYNEAGEWQDGPFP
FT                   GGFVDAASGAFRHGYYTELGEFVEGFYDTSGNWVSGQPPSVLTGEGGIGPTGGLEEKWG
FT                   DVDEGEMTDIAL"
FT   CDS_pept        393572..394978
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639126"
FT                   /orf_name="MICPUN_63159"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70270.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG607496"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199CBAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ05"
FT                   /transl_table=1
FT                   /translation="MGFDDAAIAADPRRRRDDRDDPPSARDDRDRDRDRDSDRKRSHRD
FT                   RDESSDERRERKRRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDRRDRDRDR
FT                   SRERDRKKSRRHRSRSHSRSDSRRRERSDRRRSSRSRSPERSRDRDRDRGRERRRPSGF
FT                   DTEVTPAMRELQKKLLEEQQRQSLAQQWLLQNPGAAATAAGASAQKKQREIYVGNLMAG
FT                   VTTIEVLKDLFNALMAQALPHCVEHGEPVINVNMDASQKFGFVEFRTEEIATCALNLDK
FT                   MDVAGRQMNIGRPKGYVEPPPGYKPSREPVSIALVPYKPQLPQNVGGLRPETIAAQRQT
FT                   LAAAQDAKRQLDGIAANGTTQMTANVPSNVLCLENTLPLEQLGAAEHLEDAELDVREEC
FT                   GRHGSVLGVCIPTTPPAGASGSRVYVKFAAALQAEAAMRALDGRLFDNHAVRARTVTSS
FT                   EYDRAKAGGW"
FT   CDS_pept        complement(395043..396131)
FT                   /codon_start=1
FT                   /gene_family="HOG000265345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639127"
FT                   /orf_name="MICPUN_63158"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70508.1"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199CBAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ06"
FT                   /transl_table=1
FT                   /translation="MAPLTQVFVRTLDGRTRCLNFERDDASHEDALTLRHLRRALESSE
FT                   GVPASEQLIRVGGLVLGDGDDDRALRSLSDAPSIDADLLLRINGGKGGFGSLLRGSKSA
FT                   QTTTNFDACRDLSGRRMRHVNAEKKMIEWAKHAEERELEKIALKHVNSRSSQIKRKFEQ
FT                   IEEQEKERFKVETLAQRESTEEAVAAGIRIEAQRRAAEAAAEAERKREQARKQRALDGM
FT                   YGMGGISDSDSDEDEPTMPNADDAPKMDPKMPEKMDPPEPARPETPKEDAEAQKEENAG
FT                   SPDTGDTAAVLPAEIVLKDHGSAEELEAFGMDRLKEELMKNGLKCGGTLAERAQRLFLL
FT                   RDKTIDEIDAKYKPPVRKEKRR"
FT   CDS_pept        join(<397385..398014,398144..>399364)
FT                   /codon_start=1
FT                   /gene_family="HOG000282025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639128"
FT                   /orf_name="MICPUN_75222"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70271.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI000199CBAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ07"
FT                   /transl_table=1
FT                   /translation="VKFLFGSQTGNAAEICKEMAAEAPAKGFPNVHCNAMNEVDVKDVL
FT                   KPGAVVVYVVSSTGDGDAPDNCDSFFTKLKRVAKKEAGVCGAGVQYAVLGLGDQNYSAF
FT                   MAVPRSFTAAMEKAGAKAFYPRGEADETLGLYEYCEKWQDGLWEPLRTASERAPALAKD
FT                   PTGGVAKDSTGGVAKDPTGGVAPAAPAPVPAPVPAAAADAAEADLVGPYLAKVAKSELM
FT                   TDPKSDRRVLHVEFDTRGARGLDFEPGDSLGVLPQNDPALVDALAARLGLDPNAVFELG
FT                   WAEGQAPSGPTSAPPLRHIRCPASVGAALTHAVDVTAPPRKSLLRVLAEACTDAGERRD
FT                   LLTLCSRGGRDEYKVRCGDECPTLLDLLESHPSCAPGWAELLDALQPLQPRMYSITSAP
FT                   EAHGGVPAVAFSVVEFSTPLGAIRRGVATNWLDRRASDQTFRVPLYVKKSTHFAPPTDV
FT                   SHPVIMIGPGTGVAPFRGFLERRRAMIAAADAASPPPGPAWLFFGCRRRDEDYLYRGDL
FT                   ESFAADGTLTELVTAFSRESSTTKTYVQHRIAERAAEVAAIVAAPEARVYVCGDGANMA
FT                   KDVHGALVDALAVHVDGMDEKRASEMLMAMTKEGRYVRDIW"
FT   CDS_pept        complement(399463..400368)
FT                   /codon_start=1
FT                   /gene_family="HOG000278332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639129"
FT                   /orf_name="MICPUN_103496"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70509.1"
FT                   /db_xref="HOGENOM:HBG296632"
FT                   /db_xref="UniParc:UPI000199CBAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ08"
FT                   /transl_table=1
FT                   /translation="MEAAANFHPGWGGEGCFGLGVAGNVAGHMAQAGMTQDSGKTPANI
FT                   FAFYCPDPPDSHSDAAGQGKILDKIHTFPVTTNIVEYPRDAGASKVQVEPEMAVFVDVQ
FT                   YAEPGSDGKRLVTGLVPRKVAAFNDCSIRALEGSDKLSEKKNWGAESKGISSRVIDVDS
FT                   FAPGTLVDRLVMVSYVMRDGVVEKYSQDAPARNYTMFHEPLLAWIVDRINNQRNEDKWD
FT                   DVGELVRAAGYPPHAWIALGAGTYTAWGEKNYLKQRDEAVVIVYDDAKFPNGPDAAQVE
FT                   ALFHDKTAADGIVCVHQTFV"
FT   CDS_pept        join(400783..400836,400988..402022)
FT                   /codon_start=1
FT                   /gene_family="HOG000265346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639130"
FT                   /orf_name="MICPUN_63155"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70272.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG557811"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000199CBB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ09"
FT                   /transl_table=1
FT                   /translation="MSTEVNAKGYGGTDSSPALEPLLKSDAKEGVEPVGAGSDGSGPPK
FT                   DDPGDVIFGLKLGFDGVFAVLALLTVVLISASCYFEEWMYKRLPNFNYFWTVACAELAV
FT                   FTVASVAGAVATGTIAQPRRAPFLKYLLQATVMAVYAAIAKIAYKYLNYATGTVLRSTK
FT                   LVFVMAISVAWLGRRYSAWDYAAAIGMIVSVACFGLGEAHADKGQDHTWGYVLSVLGLG
FT                   LAALQTNMADNAMRDHGATSLENMLYVNGLGFWIVLVFAAVVDGEAAIDYMLHTENALT
FT                   LLIARSLTFYLGAFAFTELTRHSGATPATSVATARKALTVMLSFVAFPDDKPFSGWFLA
FT                   GILTFIAAIGLELKSRIEKKRR"
FT   CDS_pept        402325..403317
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639131"
FT                   /orf_name="MICPUN_109286"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70273.1"
FT                   /db_xref="UniParc:UPI000199CBB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ10"
FT                   /transl_table=1
FT                   /translation="MMLSSRHTRLALALLAMLIAALAHPAAAQSVAKIPTRHVEGGDAV
FT                   AALALPRRPIAPLVNDPTIVDQDAIPVAASTATDGPAPRAAMGEAQETPALHPMRPMRP
FT                   ADATTTAAGEAAPALTPIRPAVVDPTPAQTERVAAKPDPSQLHPMRPLRPMRPVATTSS
FT                   DVANVGLDESRVSKVDAVQAVAAAEVALEKAEEATDGVKRDPEAQGLLHEAERVLAKAE
FT                   MEAEMEDGDVQADMGGREIGKDGEGAGGSGAGMENNREYDRWYSTTPPWVLATCAGVGA
FT                   GLVLIVFQTVCQGVNRGCEGAPEVRSLVSDDYAKPPPPSKYGAAGTTPV"
FT   CDS_pept        complement(403406..404887)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639132"
FT                   /orf_name="MICPUN_63153"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO70510.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG609830"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199CBB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ11"
FT                   /transl_table=1
FT                   /translation="MPPRKHARSQKQVDRDVGHSTARMWPALAAAARAHGIATSTLASV
FT                   RLSNRRLVSPRFAAASASAARSNSNSSSADQITDDELKGASVAVRLASHVYKVGDIEPW
FT                   VRREGFTLMAEGETNCTRWYVCDKRAGEATTHRWVIVRGAAWNNEKVDRVRLSTQIGKA
FT                   WPSPLHEGKGAPPVVVHTGVKEMADEFWPDVSPWITSTPNGAQLCFAGHSLGGSMAMLL
FT                   MAWSKLRLGVDPRAMDPCWTFGSPPVLASDGWEMRKRRGADLSESVARAAADGGDWVGE
FT                   LMRGVGMGNATGGVTAFGADAGEGLGASTPSSTDEARDDAPRDDALRMAGFEPDSVRAF
FT                   VLSNDPVPRMWLAADPLYAGAAANETVASLMSAREWLFGRGMLSRGRFLYDAAGTLYWM
FT                   RWAPEAGTAVTVHRGDPDALCEELSRDGASFDWGRSATEGGSGGGSGGGTGERSWFDAG
FT                   LRSVVGAMDHNAQNYVDSIQYLNVRRFTGSSSKAL"
FT   CDS_pept        join(<404979..405934,406061..406280,406479..>406619)
FT                   /codon_start=1
FT                   /gene_family="HOG000248233" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639133"
FT                   /orf_name="MICPUN_68188"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70274.1"
FT                   /db_xref="HOGENOM:HBG713499"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199CBB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ12"
FT                   /transl_table=1
FT                   /translation="LRARESGTRRPLSFRASVSRRQCDAAALSGDKTIAHRWSGGVNCL
FT                   ELDETERRYLLAGTVDAVVAVYDTEQPTKTDRTTGHATHEPLIRVAKGSAEGAEGGATN
FT                   GGARGTGGHLFSVSCAAWYPIDTGMFFTGSFDQTVAAWDTNTASRVLTFHFDAKVYHIS
FT                   MAPNANSHCLVAVGTGHPQVRLCDPNSGNVTHTLTGHREAVWATRWMRGSEWILATGGG
FT                   DGDVRLWDIRRAGSFMRLDASNVRVGEVDALEEALEAPDRGFIPAGPAPLTRRNVDSVP
FT                   AHLFSDDAVRCGGSGWGGTSGGTLSRRRYRGGAYGDAAGAHDGRVTALQITPDGLYLAS
FT                   AGTDGRVRVWDLSDGRNMEMDFGYVPNDARKATQLGVSPDGSRLYCPSSDGDEGKKRLT
FT                   PRPFRTLKGHITAACAVAVNGHTSEVYTGGADRHVLVWRP"
FT   CDS_pept        407054..407803
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639134"
FT                   /orf_name="MICPUN_63151"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70275.1"
FT                   /db_xref="UniParc:UPI000199CBB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ13"
FT                   /transl_table=1
FT                   /translation="MAGVSTAVARTPVARAPTAALAGQRRSVAARALPQTSTRGDPVQL
FT                   ASAVARLDAHVARVGGADLYAATEDATAAVDVMVRSKNIGGTLEECLARSDGVWEVCVM
FT                   PHMLRLSAPLGITFRPVRYSLKDGKIRSDVRFRLPGGIVRGWLSSSGSVKATARSDHDG
FT                   AAIDLVFDRFWIDLNDGDVPKDFVDCVSAVDKAVDAVGKAGFLPSFAFFPVHFFDAKSG
FT                   TCVFEFPPLRSNIAAKRVGDVEETLKF"
FT   CDS_pept        join(complement(409885..409911),complement(407964..409811))
FT                   /codon_start=1
FT                   /gene_family="HOG000226033" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639135"
FT                   /orf_name="MICPUN_63150"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70511.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR000738"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000199CC30"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ14"
FT                   /transl_table=1
FT                   /translation="MALQMHIWIVFAGVLLNERGAVITTPLDAHSKAQKSIERTMTLAD
FT                   MDLSDLKAQLASVQAAVDAKEAAADGAGVLAAKIVNPYSKLYNRVSVAAIHACPGDGAS
FT                   LIGSTVVVGGWVKTGRVADKGALVFLEVNDGTGPKNLQVVVKAEVHAIDELKSTGTCVV
FT                   VEGELKAPPEGATQVVEMHATKILHVGPCDAAKYPIAKKKISLEFLREKIHLRTRTNTI
FT                   AAIARIRSALSYATHSFFNKNGFLYVHTPLITQSDCEGAGEMFQVTTLLGAADAAADAG
FT                   EKPPSAEDVEAMRAKVTEAGDVVKQLKEAGDKAAVKPAVDAMLKLKGELAEMETASRKV
FT                   GGLFRDEKGKIDYSHDFFSEPTFLTVSGQLNVETYACAMTSVYTFGPTFRAENSNTTRH
FT                   LAEFWMIEPEIAFADLQDDMQCAEDYVKYCLNYVLEHCPEDLAFISKMYDKEALDRVKH
FT                   VAASPFGRVSYTEAIELLKKAVADGKEFVYPVEWGIDLATEHERYLAEEIFKKPVIVYN
FT                   YPKDIKAFYMRLNEDGKTVAAMDVLVPKVGELIGGSQREERLEVMEGRMHEMGLEPEEY
FT                   EWYMDLRRYGSVVHSGFGLGFERLILFCTGMDNIRDVIPYPRWPGNCT"
FT   CDS_pept        410419..>412188
FT                   /codon_start=1
FT                   /gene_family="HOG000115829" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639136"
FT                   /orf_name="MICPUN_87350"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO70276.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199CC31"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ15"
FT                   /transl_table=1
FT                   /translation="MTATTNDRQNENFKVVIRVRPPLEREVASGKRYQHAVHVDERHRT
FT                   CTISENLEAWRGGSGPVGADGVLYNTHQFTFDHVYDQDASQESVYERSAKDAVLSTLAG
FT                   YNAAMLAYGQTGTGKTFTMEGDPRARHGNSAIGILPGDLPPVGDDRGAERGIIPRAIED
FT                   IFNRIKADTSTRSKYLVRASYVQIYNEVISDLLKPERVNLHIREDKKRGVFVEGLSEWV
FT                   VRTPDEIYGLMDRGASQRTTGATRMNELSSRSHAVFIIIVENSKLTEEAGATELRQSFK
FT                   VGKLNLVDLAGSERVRLSGATGTRLEESKKINQSLSALGNVIKALTEPKGRPHIPYRDS
FT                   KLTRILEDSLGGNCKTTMMAMISPALESFTESLSTLKFANRAKHIKNTARINEDLDQKS
FT                   LLRKYERELKRLRQELDERTKNLVDKRALLQIEEQRRKAEADKMRAITELEQRSKEFLK
FT                   EKKERSELEQRINEMQSQLLGGGGVAPDRNSDEFKAVLREEQERVKAEYEGKIRELEAD
FT                   RQEAEEGRAQVGRYKAVLLKQRDIMIALTARLNERDETIIRMQEELKAYDSEYRRVEDA
FT                   LDAKTAELIALRRA"
FT   CDS_pept        413153..>414274
FT                   /codon_start=1
FT                   /gene_family="HOG000198123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639137"
FT                   /orf_name="MICPUN_86917"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO70277.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG747744"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199CC32"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ16"
FT                   /transl_table=1
FT                   /translation="MGREDRDRASDEEPEVEDVEADGLLPPLKHVHDYGRVAHELCAAR
FT                   REDAKRLRDLPAGLCNSGNTCFAASALQCLYHTRLLTAHFADEPHPHDSCKNPGFCVTC
FT                   EYQKHVLKALDAEPRGSFSIGKLTNAIGSIAKHFVRGRQEDSHEYIRGLLDGIHVQALK
FT                   EFAGEKAEKELDARTQETTIVHHIFGGYTCGQVECIQCGHVSRNYQSMIDIPVEVTAKS
FT                   SSGIEASLKSNFLDTEILDGSNKYKCARCRAYVRAEKGGKIHVSPNVLVVPLKRYTMGR
FT                   FSKITKFVEFPATLDLTPYMSRDAPYEGKSPPTYTLYGVVVHLDWGGSAHSGHYVSYVR
FT                   LLDGRWCKCDDGRIEETDEATVLKQKAYLLFYER"
FT   CDS_pept        416150..>417412
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639138"
FT                   /orf_name="MICPUN_87320"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70278.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI000199CC33"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ17"
FT                   /transl_table=1
FT                   /translation="MQSIQYLGSAIGGFVFLTGSIYLGIKRKHSIPTDAIQAMEFAQSR
FT                   ADARKDAQVEVTLEDVGGLENIVEDLNEVIAFLKNPEKFKRLGAKPPKGLLMEGGPGVG
FT                   KTLIAKAIAGEAQVPFYSMSGAEFVEIIVGVGAARIRDLFKRARMNAPCLVFVDEIDAL
FT                   GTRRAAAGTKGTEEHEQTLNQLLTEMDGFTPDTGVVFVGATNRADLLDPALMRPGRFDR
FT                   KVTVPQPGLDARAKILQIHLAKRNVDPEIDTLQFAKNLPGLSGAELANICNEAAAISVR
FT                   RGSDIIETVDVMEAVDRVTNGLRQPLFDKDDETVHRLTRHELGHAVVATVLYKSTGLIE
FT                   AVERVSIIPRGRDPTQTSYNRKRDEDYMFPTRARLLERVQVLMAGRAAEEVYYGNDITE
FT                   YSFADIRDANDLTRNVVVNYGL"
FT   CDS_pept        join(<419290..419450,419502..>419709)
FT                   /codon_start=1
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639139"
FT                   /orf_name="MICPUN_76806"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ACO70279.1"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG609879"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI000199CC34"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ18"
FT                   /transl_table=1
FT                   /translation="EKVQITASLQGLAPGLHAINIHENGNVECADGSCTGASWNPQDRP
FT                   HGGPNSLKKHIGDLGNVTANDSGAVEDTFKDQYIALRDGKNMFNVAGRSIVVRQGADDF
FT                   TTQSDDGGAGKILAYGTIK"
FT   CDS_pept        complement(419790..420554)
FT                   /codon_start=1
FT                   /gene_family="HOG000222847" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639140"
FT                   /orf_name="MICPUN_63145"
FT                   /product="Predicted protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO70512.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="HOGENOM:HBG582718"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI000199CC35"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ19"
FT                   /transl_table=1
FT                   /translation="MSKPAARWEGRNVTKDQVRARVWGALESSGAAVGSPWSAIPNYKG
FT                   ADDAARILAGLPEFREAQVVKSNPDPAQGPFRLAALRAGKKLYTPVPELVQDTPFVLLD
FT                   PEVLAHNGVAFEEVENASGFLQHGLRVEFRDIEPIDFFVVGCVAVTRAGGRTGKGAGFA
FT                   DLELGIMRHYGSVTPTTPIATTVHDLQVVDDGDVVMEAHDTPLDYVATPGGLITTKTTM
FT                   PRPGKLDWNAVREDQYRDIPFLRNLRGELAGY"
FT   CDS_pept        join(complement(422399..422658),complement(421971..422243),
FT                   complement(421055..421934),complement(420683..420859))
FT                   /codon_start=1
FT                   /gene_family="HOG000223743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639141"
FT                   /orf_name="MICPUN_87214"
FT                   /product="Predicted protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="ACO70513.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG395951"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniParc:UPI000199CC36"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ20"
FT                   /transl_table=1
FT                   /translation="MLRRALASRSSEAAIISTRVSLPRGSIPPPPTSSSSSSSSSREGR
FT                   RPRFFSTTTTSAERPVDDDEWETVVGLELHVQIGAKTKLFSGAERLYGAEANANVAPFD
FT                   AALPGSLPAVNARAVELAARLGFALGADVQSRSSFDRKHYHYPDLPHGYQITQQRSPIA
FT                   LGGSLDVFVRDGVSGTLRVERLQLEMDTGKSSKAKSSTLVDLNRAGSTLVEIVTAPDLR
FT                   GAEEASAAAETFQKVVRFLGVGDANMEEGSMRVDVNVSHRTRDGAVAGERCEVKNLNSF
FT                   RSIARAVAHERTRQIALLKRGQRVRRQTRSFDPATGATAVLRDKEALLDYRFAPEPDLP
FT                   PVVIEPAALRAIKAAVPELPSTAAARLTNTAGLAPKLAQTIASKPSTVAYFDACAEAAD
FT                   AWSTRNGTVTVDKQDVANWVTGVLVGAVKRAGVTHKGGAGGEPLRGLPESAGAARVGEL
FT                   LARVAASTSMDSGALEATCAAVVASMPEQLAAYRGGRTRAMGSFVGEVMKRTKGRADPR
FT                   RAAEIIKTLVDQ"
FT   CDS_pept        422951..425773
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639142"
FT                   /orf_name="MICPUN_63143"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70280.1"
FT                   /db_xref="UniParc:UPI000199CC37"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ21"
FT                   /transl_table=1
FT                   /translation="MVANAAAASLGAMQTNAALRRGSFVPSVRGVATFAPPRRLTRARF
FT                   PVVRAAQGPAESNEDYEARLHAEATAAVERRILKVVPADLLGSIAIPQKLVEIRSYVRW
FT                   EEAGKPEDTSREWQAREYQAALIDLKLEMLAGGNLNDVRRRYQLDTEFGEDSPMHSPSK
FT                   EELEMLKKALAISKEPEYYSDEKAQEEIDAEATALAARVAAASAISAPGPAMPPPPVAA
FT                   AAAAAAAPAPGDAKKAEKLRLKAEAEAQMKKLQEQMKALEEEEEEEDAELAKRVAAAAT
FT                   AVVPPPPPVPAPPAPAPAPAAQSSEAKPVFKPAGAAAPDTSKARALSAAKAAAEAELKA
FT                   AEAEMRAAQAALKAAAAKREADAKKSATVLGDELRMGHVPADVAKSTYGVKAKAADLEA
FT                   KAKAKKDAQKKVDALFIEPGVENPTQIKAEAKRLIEMELAKEEEILAAKRSTEPAKPVA
FT                   VTPTPPASPVPRSPTAASIKSDIPELVDEVAGEVANIEDFQPKYVTGAAVDERLAKIEA
FT                   LHAAQLKAIKKEHEEELLKAKLSVETDGASSSAEKQLRAKLGELVRALEVSNKQCKGLK
FT                   EKLAATSEELATEKKISGKAGEVLAAHKTNEMMIKTLKKELSVALEVQATAEKRAQAAE
FT                   KEAAAAKVDMDVNTGKSESLEERVKELEAELSEAQEVIAEFKASWEADRKVIAVLSKMK
FT                   DAPEAQAKIAAAAAEESSSSSVFSKWAAGVTRVLVGEPAADRDVAAEKLKASAIKWSPK
FT                   YDAIEAEKAKAEKAKPYARQGGSATIAMLRARKETAERAVDENARARQANWLEAAEQAT
FT                   EAAAAFEEEKEEEEEPEPVKAPAPVKSNAVPAVPKARKIPLPGDKLPPAAPAKATAPSV
FT                   PPPGANAVVKTAEDAVDIQKPPTATGKAAAPVAMPKPTAMPKFIPAASKAADDKKGPGG
FT                   WSSSHLPPTR"
FT   CDS_pept        join(complement(426671..426726),complement(426010..426571))
FT                   /codon_start=1
FT                   /gene_family="HOG000265341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639143"
FT                   /orf_name="MICPUN_63142"
FT                   /product="Predicted protein"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70514.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG607490"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="UniParc:UPI000199CC38"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ22"
FT                   /transl_table=1
FT                   /translation="MAALTLGREVQVRARIKSIYNKRQMDFNELREYNDYLEQVEDIIF
FT                   NLCEGIDVKATEAKVDAYRKENAGEIARLNKRNEEEDRRIAEAKGSEWAPRRMSLDGSD
FT                   VGDTPGPTGGAGGFGGMFGHTPGTGGGGGGGPPRPVMAVPKPTAMPQSGGKAAHGAWDH
FT                   GLDQSAEGRAKREAAIAKACGVDMHALGMARARQEALQSIFC"
FT   CDS_pept        join(426825..426893,427008..427598)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639144"
FT                   /orf_name="MICPUN_63141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70281.1"
FT                   /db_xref="UniParc:UPI000199CC39"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ23"
FT                   /transl_table=1
FT                   /translation="MRDDDIDNSRTITVLYGGPIAKEVADVVVGRMKDQSVFQHVKLGD
FT                   IAKYQEYGIETVDQRDMLDAATIAVLPEPGWEGPDPKTVDEVFLLVMETGEMEEAVGGG
FT                   ITFLRDTMTSARTNREQRTDWVRCMHIARDDKTTRVAYAVLAVGDTDAMPERAMYRSKQ
FT                   NTAADCNQAGQLADKVMEQLGGVRLCPRGEIDVARDEVDRDVAAFIDTRLLPALVP"
FT   CDS_pept        join(complement(429602..430321),complement(428406..429499),
FT                   complement(428156..428327),complement(427649..428092))
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639145"
FT                   /orf_name="MICPUN_98164"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70515.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199CC3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ24"
FT                   /transl_table=1
FT                   /translation="MRREVLECIENGRASVVSGATGCGKTTQVPQYVFENAVRAGRGGE
FT                   CSVIITQPRRLSAIAVAERVAQERCERIGDTVGYSIRLESRQSSNTRLLFCTTGILLRR
FT                   LQSDPDLRGVSHVIVDEVHERDLLSDFLLVILRRLAARREDFRLVAMSATVNAELFKGY
FT                   FERVVPGECGCVEIPGRTFPVAEYRLEDAIEATGYVCEPDSEFALGADGKPQGGGGGGR
FT                   TFNPLSGGGARRSKAMAATVDEEKINMELIEMLVQLIADEYEDGAILIFLPGMAEIRGL
FT                   HERLASSLDDVEKRFILIPLHSTLSSEEQRLTFSKPLPGVRKVVMATNIAETSITIDDV
FT                   VFVIDSGRVRETQYDPTSRMSSLVTAWCSRASSRQRRGRAGRVREGYCFHLYSSARESK
FT                   LADFTTPEILRTPLDALCLQIKILRLGDVREFLAQAIEPPPEGAIASALRSLAELDAID
FT                   ASDELTPLGHHLAELPVDARLGKMMLYGAMFSCLDPVLTIAAGVGFRSPFVSPMDKRDE
FT                   ADEAKRKIAGAGATSDHLTLVRAYAGWIRAKARGRGFERDFLAKTFLSAQTLRQISEMR
FT                   QQYVELLDQIGFLRSGTGLLGGKKDEDDGPEQTPRGGNARGVKRGGGFKASAERALAAA
FT                   SVNAGNEPLVRAVICAGLFPNVAVVESGDGDAYLHPTSVVFGLSKFEHRFLLFHEKVKT
FT                   AKVYIRDATMIGPYPLLLFGGKVAVDHGRSQATCDGWIRFRAAPRVAVLFKALRKELDG
FT                   LLMQKIATPELNMAKKSGDLVRTIVELLDTESEVAAEARRAMRDAEAAATRDDKEV"
FT   CDS_pept        complement(433099..433791)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639146"
FT                   /orf_name="MICPUN_63139"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70516.1"
FT                   /db_xref="UniParc:UPI000199CC3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ25"
FT                   /transl_table=1
FT                   /translation="MFATNRIERAITTSPRVSSPAKRRSASRRAPPVSNAIPTDEMRTH
FT                   RSRVGAGVAAAAASLALAALNPHAALAVGPVSVPFDDVRYEEVPCEKGTMSSVGGAVNV
FT                   RAGVTCVKFTARATNPSAKWLNNADVYGRVYDDTGSAVTDVAENNRIAYVDVVPAGTGD
FT                   VTFVLTMGKNQFDAGPLHWQGLKASGFAGKILPGQTGATGLLGENECDLAPDPAECEEE
FT                   RALMANIR"
FT   CDS_pept        434135..434728
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639147"
FT                   /orf_name="MICPUN_109284"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70282.1"
FT                   /db_xref="UniParc:UPI000199CC3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ26"
FT                   /transl_table=1
FT                   /translation="MGQKQKIREAKKASGDLKVDKTTRAGYDRNNVAEVIKRLKQMAKE
FT                   DTDRFDKMDLAETLERLEQSERVAATIGAAYDVEMARKRALLRCFVEHGITPPAPETRE
FT                   SAAGFNEGVLVNPSNATASVAAPDATATDATTEVSEVSVDDAKRQLAYSQFEARRKLAV
FT                   AKETREHNDAMVRELRERGLEAPETGASTATGAD"
FT   CDS_pept        join(complement(435591..435693),complement(434875..435446))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639148"
FT                   /orf_name="MICPUN_63137"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70517.1"
FT                   /db_xref="UniParc:UPI000199CC3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ27"
FT                   /transl_table=1
FT                   /translation="MPKEFTGWDNNSTNARPGFSRAVGRSLVPGRSGSDYPKYTFEGAV
FT                   EITSQRNTRGTLQYWEGVKAGTEDPEANFRIAKETRARQRSSAVGAALKFPPEILGDVY
FT                   GDPVEAKKRAQLQRALSHDQRAALQKELLDGWAQVAGDDKAMKSAFSAMKEPSEAAPPA
FT                   PDTPVKVDLVVTESPTKDEPANAPPPSAFKRSMPTVPYSQCYTDVVSYGGVKNEAFTSI
FT                   SA"
FT   CDS_pept        complement(435823..436803)
FT                   /codon_start=1
FT                   /gene_family="HOG000265338" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639149"
FT                   /orf_name="MICPUN_109283"
FT                   /product="Predicted protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="ACO70518.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG557820"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199CCB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ28"
FT                   /transl_table=1
FT                   /translation="MAETEASVEAPPAAVDPRPEPPLGDASIAEVSNGAMRDDSADGPG
FT                   TPAPATPKKQTILEASPAAAVDESEREKDDESPGAVALFDLDHTIIDTNSSWHWVQHEV
FT                   NNGKVGFGMLMTALYWFSRYALGLGAGAERAGAEAAELYAGEMEDDLNERVVTFFRKEL
FT                   SHRVRPGCKEAMARHKADGVRCVMCTSSWQHPARAAAELYGLESAHADVISSVMEVDQS
FT                   TGRLTGRIQKVAYGDGKHLVTKEWATRANVDLAKCWFYTDSFSDVALMEAVGFPVAVNP
FT                   DARLRKHAQEKGWPVEDWGLAEDKSKKPRYAYACLTMKGSSQGPG"
FT   CDS_pept        437112..438881
FT                   /codon_start=1
FT                   /gene_family="HOG000265337" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639150"
FT                   /orf_name="MICPUN_103484"
FT                   /product="Major facilitator superfamily "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70283.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG557822"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199CCB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ29"
FT                   /transl_table=1
FT                   /translation="MASRALVGTLRRGLSRARRAPPAAVGSSDVARDARDPFEPLGSRS
FT                   VRWRELELVRRDWAHRRPTTSRGDESGFGAGWEARRAFSSSSAAFTSGRDARKDIDDES
FT                   STSSSSSSSPPVAEAGAPTGPRANSDSSMWDLAGFLGENRRVAGICVTTALLMAGHSCV
FT                   APVLPMFAEEFGASAAQVGATLSAFALARLVLNVPFGSLADSLGRKPLMVAGPLITAAG
FT                   MLGSAQCQSGLPELFFWRFIAGAGSAAYAAGAQATLADLSDRSNRARVLGANQAAVLAG
FT                   AAFGPCVGGFISEGAPMELGVRAPFVAVGVTCALAGWHAARSAPETLKDANFGPYLYGA
FT                   GTKTRPKTSAMEDGEAEREAAAATTGDVNVASSAGDEEAESNGEMRGENAQTTMRRLLR
FT                   RRDFLAVSGLNAALFFSGAGGRATLLPLLAVQEHGYTPAGLGALFTAMAATSALGIGPG
FT                   AFLSDFFGRTKVIAPCVVASAVAVAVVGTATDPNVFLGAAIAWALAHSLMGPAPAAYAT
FT                   EVSPERGRAVALSAYRTFGDFGLLVGPVALGALADCVGVGPALAANGGVLAASALAFTA
FT                   AARGEGAGTRDNR"
FT   CDS_pept        complement(438945..439673)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639151"
FT                   /orf_name="MICPUN_63134"
FT                   /product="Predicted protein"
FT                   /biological_process="regulation of translational fidelity "
FT                   /protein_id="ACO70519.1"
FT                   /db_xref="GO:0006450"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniParc:UPI000199CCB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ30"
FT                   /transl_table=1
FT                   /translation="MSSATIRRLSRVAASATASVSGRFGSEARVIDARASTAVVRRGYR
FT                   GQASDIAGWRSRGGLHPAMSPTPSWSTSELLNPPEGTVESVPIDEEKLRKVARQANIAI
FT                   PDEDAADDEEADDDHPTLAAVESPAEGALRGVNEVLRFVQALDKVDVEGVEPMWTVLDD
FT                   EHAAPLRADEVAGARRRRRASSPNASPPTGTWVLDGTSAEEGEEGWAASDRDELVNLAP
FT                   DSSRAPFYVAAGTTAGTDDE"
FT   CDS_pept        <439898..>440431
FT                   /codon_start=1
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639152"
FT                   /orf_name="MICPUN_76559"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="ACO70284.1"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG332834"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI000199CCB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ31"
FT                   /transl_table=1
FT                   /translation="RLSKNLSQILRHGVVDEGLADCLDAEGFVPLARVLALPRFRGVGA
FT                   DEIRALVAADRKGRFELRDRTDGIVHVRATQGHTLRGDVLDDDAMATRLTRTSGIREAV
FT                   HGTSMRAWKRIRTHGLSRMRRRHVHMATGLPGDGEVKSGVRNDCEVAVWVDVERGVAEG
FT                   VPFFVSANGVVLSPG"
FT   CDS_pept        join(complement(440744..441278),complement(440690..440712))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639153"
FT                   /orf_name="MICPUN_63132"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70520.1"
FT                   /db_xref="HOGENOM:HBG557824"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199CCB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ32"
FT                   /transl_table=1
FT                   /translation="MEEAESNTLASLRSGAMSILEAIAVELPDVFTAVILAKLDIKDTL
FT                   SLAQVSKRYRDAVWSVDGVRSLQAKITRLPRSWFGGDAMACAIASNNLPAIRALLKSGR
FT                   EVEEEVKYDDKKTWGTPLMFAAFLGHLGAVRVLIEAGADINKHATFLGSAYKNSALWMA
FT                   CDHNHPDVVMQLIEAAAPPPSW"
FT   CDS_pept        441449..442972
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639154"
FT                   /orf_name="MICPUN_103482"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70285.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199CCB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ33"
FT                   /transl_table=1
FT                   /translation="MDGAQPGPPKIRVVAARSAPRQAPGAPGAPAPAPTPAHAQHVFTP
FT                   PQLPATHPGNVDAAGSVHGSVAACSNVTTRASSSRTASLGSSDAPPDELLSTHRALVLA
FT                   SRLRALLERTSVGELLRAKRENERATCPDDDQQPGVLTLWPDTKIVDALRQLSRRRVLS
FT                   APVVDASSGQLVHKGFLSLSDIVLDLCSRDTVELEALLRELGESTLGDESHYPPGTEWQ
FT                   NLPVSEVMATPNWQDGHSVWRCDDPEYERLTVLELCREYFFHGSPDGPICHRVAVFRRD
FT                   GDALRVAAVISAADIVRHSLLAATEQPGPSIDDQSIDEDSIAADEIAALAARTTLAELG
FT                   MAVKTVFTVDADDAALHAFQRMTRLGLTSAAAVSGFREDGSFDGEVVCDVTAGDIRGVW
FT                   PDQFRALTSPLREYIERVRGVERGGGGNGIGGVFWRPRLARPRFFRRSTTFAEAVERLS
FT                   EDAVHHGFVSEDRAGTRVTSKDLIGIVTQTDVLRRICFEDEYLSECLSG"
FT   CDS_pept        join(complement(444727..>444900),
FT                   complement(444435..444588),complement(<443323..444389))
FT                   /codon_start=1
FT                   /gene_family="HOG000218329" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639155"
FT                   /orf_name="MICPUN_75587"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="damaged DNA binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70521.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG286573"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199CCB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ34"
FT                   /transl_table=1
FT                   /translation="SKKAQAYVCTECGYDANQWYGQCPGCKVWDSMKVMRGVSEPSTAS
FT                   SGKSSGGGAGARAAKGSTMPRMRLSQELGKEIERVLGGGVVPGGMTLVGGDPGVGKSTI
FT                   LLQLADGAPSSVGVLYASGEESVEQVAGRAERMGIDPDGVFLYSATRLENILEAVSRLK
FT                   PAALVVDSIQTVFLEDATGSPGSVSQVRECATALLHAAKTTGMPVFIVGHVTKSGDIAG
FT                   PRVLEHIVDVVLYLEGDSDRAVRILRGHKNRYGSTDEVGVFQMSDEGMKPVASPSALFL
FT                   GERVLSPDVSAAPTVTVQGSRPFMLEVQALTNERADAGDSNPQAPPIRTAVGLRFERMQ
FT                   LLLAVLAKFVLGRGVLKNDVFINIVGGMKLDDPSTDVAVALAIASSFVEKPLPPDMCFF
FT                   GEVGLGGELRPVMQSERRIAEAATMGFRRVLLPEAGSDESTEKAAKKNGVELVRCKTMA
FT                   DALQAAL"
FT   CDS_pept        445273..447123
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639156"
FT                   /orf_name="MICPUN_106350"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO70286.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199CCB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ35"
FT                   /transl_table=1
FT                   /translation="MSMISKVSGYAPGWMEDYGTVASALHSNYQSVRGFSVGDLTVGMA
FT                   YLWDDERNQRKASQPGSAHQPYPGDCGAVHKDEADDFRRLCIAVDASYLTDRNELAAAL
FT                   KTIGHEIHDAVQKSTFQEPAFFISESQARNEVFFVIRGTASMKDALTDGDCAAEDLNSA
FT                   LPEFAGVKAHRGMAKSAHALLDKHASKILKCVEMFELKKKKPRFVVLGHSLGAGTAAIA
FT                   SILLKERLSKTPVECVAFATPPCLDVKGCGASAQHLRSIVCHDDVVVRASRQNVDDLFS
FT                   RIQDINWKEDFSKDVNKLHTVQAAKAASVTLASMQKSASAAAASFAEQAKRRMASSAKA
FT                   GGGNKNVEAAKAAAGAAASVAAAGAAKAAAGASALAGKFSSMMSKKSSDAKDGASEPAL
FT                   SEPADLVDLFVPGKIYHFRRSPRGAGTYASVIRHDAPTLKRIELSSSNVEDHTLVEYKE
FT                   ALDTFSCQMNNVGVKMAPEVEGALEIYDGYAPDYGVGSWKEAPGCFIMPHELCLKRPDK
FT                   EGELMPLKTDLGGGGYVAEKYEFKSKGPWGIKIEVKSDDKKAKTLRLYIPGGEAEHAKW
FT                   LAAIQRCCDGVLGTPAPPDVTEKEVAKPKKSFVFGGHSFF"
FT   CDS_pept        complement(447211..447840)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639157"
FT                   /orf_name="MICPUN_63128"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70522.1"
FT                   /db_xref="UniParc:UPI000199CCBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ36"
FT                   /transl_table=1
FT                   /translation="MASLESIHLQDDHDGSPRFATMRPVLGALLVPGRGIKTHKLDASF
FT                   GGTGALLSADMAYGLASRDPTRQLTVMSAHRSGEHRRDAEGREVFSPEHRPKRNLVVSG
FT                   ITPQELEGAIGGKLMIGLDAEVVVHGRVEAKDGAGGVRCEVIRGGSVRVGDSVYVGDLS
FT                   KEDTDWRIERGIKDEIWHKRMQAGWAEPPECRFLRPELGPVTRLRQ"
FT   CDS_pept        448411..449550
FT                   /codon_start=1
FT                   /gene_family="HOG000264969" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639158"
FT                   /orf_name="MICPUN_103479"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70287.1"
FT                   /db_xref="HOGENOM:HBG607822"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniParc:UPI000199CCBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ37"
FT                   /transl_table=1
FT                   /translation="MSTLGATALQFTPLDALCGGMILGVAAIAKLMLTGRLLGVSASVK
FT                   RPAQGEFFSWDFAFLGGLLAAGAFHVATAGPLPAEPMVGVGRALLSGALVGAGSAMGNG
FT                   CTSGHGICGNARLSPRSMAYTGVFMLVGFIAATAFDTAGALNIAPVSAVAATTIPPLSA
FT                   LQTWLAFAVASVGAFVGLGALATSGKNTASAQGAYAVDELSGGLVSGVQSELWPPWTPA
FT                   VGPRKKMVNVVADAVVGFVFGTGLIISGMTRPVKVAGFLSALHPAWDPSLALVMGGALA
FT                   LCAPGFYFVQKYQRAPVCSLEFGFTSNSKLDARLMAGGALFGAGWGLAGICPGPSIVAL
FT                   AMVPSPSVAAWVAGMVLGMVANKNLLSTRRQSSMSAASL"
FT   CDS_pept        complement(449664..450656)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639159"
FT                   /orf_name="MICPUN_106349"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70523.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CCBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ38"
FT                   /transl_table=1
FT                   /translation="MGRADGDETSVAGKTCVVTGASPGGIGLEVARALARGGARVVLAC
FT                   RSRSKAAAAARDIIASTGNDNVECRTLDLASLASVREFADGFNGPEELVDILVNNAGAM
FT                   FKEYGVAEQGRERTWQVNTLGPTYLARLMMPALARAAAANGNAPGSARYVYVTSKLELK
FT                   GVVAGELRSGASDLRMFNAIADVTKFDTFKRYATAKQAGTALTFELARRVKSAPKFAGI
FT                   AVHCVSPGMVNTNLGRFAGAAFVLAAPLRWALTKTRAQGAEPVLFACRSNAPEVANETG
FT                   GYFGTSSSFKSGPVAGLEASETARDPGVGARLWAIAEAQHGACGEWDRS"
FT   CDS_pept        450890..451750
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639160"
FT                   /orf_name="MICPUN_52564"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70288.1"
FT                   /db_xref="UniParc:UPI000199CCBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ39"
FT                   /transl_table=1
FT                   /translation="MGEIEELRDDGVESPSEPAFRMHRVSSLDSLAGLAIKYGVTIIDI
FT                   QRANGGALTDQTMFARSTVRIPRAHLGPGAPLPGGGGATGPMEPSPAQRAAMTPALAAL
FT                   RDHYGTNPKSELGSEGRAGGDGDAARRAFGSSSSRKTLSRASSSSGGEIAMTDRPSSGR
FT                   ANSSAGPSVADNEERMRALGLGGSGFQHGRSKPLMSPPAKAKASQSGPASSSSGSGSVM
FT                   GFFDKMKRLANTPAMASSAASAGVGMKAAAAVASQRIDTGLREIGGPGLRKSSSLPAGR
FT                   KGKGD"
FT   CDS_pept        join(complement(453009..453417),complement(451946..452778))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639161"
FT                   /orf_name="MICPUN_63124"
FT                   /product="WRKY family transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO70524.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="UniParc:UPI000199CCBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ40"
FT                   /transl_table=1
FT                   /translation="MDNEFVSEKWAPERRALFRLSTLHETPAHSARSKVRAPTAPDALS
FT                   KPPPPIALAFDAFPPSLHRPFTPAMPPSEDGYRWRKYGQKIIKGAAFPRSYYRCTAPNC
FT                   PARKHVEGDPKDPGSIAYEGTHNHEPPTGSNRGKKRKSVDQNSKPPLSPNSKAMKMKTT
FT                   KKSSSHRSSELQNVTPRFWERAEALAMETLGSLSPGSRKRAAKLTSSRNKRKSGNGLAV
FT                   QVPDLISGGAPTSITAALVRVDSGDVTNISGDVTNISGFTNMEIPASARTGNTRVSPRS
FT                   KKNVGESDRGANGELKSVRSKPGNHVPVGGAGYGDLASTTGAKKIKRPRPLIIDAEAAA
FT                   AIEDAGTPLLTIGNGRAAGEVPGLLSARRRDGTSLRKAAAMGWASQTPRSPLVTPGSAG
FT                   NALMESLAYITTPK"
FT   CDS_pept        454002..454382
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639162"
FT                   /orf_name="MICPUN_52561"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70289.1"
FT                   /db_xref="UniParc:UPI000199CCBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ41"
FT                   /transl_table=1
FT                   /translation="MKPNPRRFNPPHRLTQTLTRSPETHLTLRQRRQRGVRRRAQAPAL
FT                   QAQVHHGRQSRRRQRWGVRQEHRLLHQHQRVHRQGVQAFQQGRPGLGRERAAQDRLRAL
FT                   RPRHASARRRRRCDEVTRPHRR"
FT   CDS_pept        join(complement(457933..458172),complement(457466..457795))
FT                   /codon_start=1
FT                   /gene_family="HOG000264985" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639163"
FT                   /orf_name="MICPUN_113509"
FT                   /product="Rhodanese-like domain protein "
FT                   /protein_id="ACO70525.1"
FT                   /db_xref="HOGENOM:HBG609654"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199CCC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ42"
FT                   /transl_table=1
FT                   /translation="MAAMSASFVTFKTAVAPRMRGRAAKLTRATRGSVATRASVVKISV
FT                   NEVKDHLDRGFVLVDIRDPDEARETGYKSSWKNIVLAAMDEDGRIHMNPNFLAQIRQEF
FT                   PNTMSRILIACDDGTTRSEKAAAAIVEKCGYTQCKVIDGGIDAYLKAYPLTQADKVKWK
FT                   MRPEIGEDLSVLVSGVDTRQAGQKYY"
FT   CDS_pept        458401..459597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639164"
FT                   /orf_name="MICPUN_63121"
FT                   /product="PGAM phosphoglycerate mutase "
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70290.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199CCC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ43"
FT                   /transl_table=1
FT                   /translation="MGKRYFKMLAQRAQRGDLGAGAMDSAGADTDRVSSGSLATTAARV
FT                   VVVVAGACAVAGGGYLAHRAWNSHRRRVAEEGGGRKVVYLIRHGQSTFNAAYEQTGVDP
FT                   MLFDAPLSALGVRQVAELGRSLRASADGSVYNDDDDGGGDDGSGESGGGNGRAHDRFNP
FT                   MPQVVLTSPLTRALQTATGAFEGLGIKVEVLPDLRERLTESCDVGRPTDELRRDFPNVD
FT                   FSALLVHSRGTPASTPTRERLAAAAADTAGVGTAGVDVNAPGIQTASLKEAAAADELER
FT                   EAERARMRDGIWWYVDPDTDHSAVTPEACRRDFATYGYVEPEHAAKARAARVLRAIRQR
FT                   PERCVALVGHADLFNLLAARIDPRGEELWLENCGVASYAVAPLAVPFRSPSAKGSAAA"
FT   CDS_pept        complement(459663..461720)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639165"
FT                   /gene_name="IFT81"
FT                   /orf_name="MICPUN_103474"
FT                   /product="Intraflagellar transport protein 81 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO70526.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="UniParc:UPI000199C48C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ44"
FT                   /transl_table=1
FT                   /translation="MLGSDVAHLVALLKEPPFELHHLTGPRLGELGGEETRRLAVDVFS
FT                   KLSPPGAFQGSATGGTLAEEGERTTAKLLEFLRHVKYRPESGDESAQRKAWQLGDHDVV
FT                   LPALKWVLDNRDRCEKRAYVGHFMADYAVPGEYAMDPEIQDLMNNTHELQRAFVEAHKE
FT                   CEQARREAKDPVKLKSQIADLEREREQVRRRIDVTKGKVAQRVTDPRELDELVALAQSL
FT                   REEQEQEHELARQTRDQTERRDLADRRRNRAATRIRELRTSLASGSPAALLQQLADEVN
FT                   ARKQLVEEKLPADLAKKRARLAAVREILTSDVRTDSDIATQTSEVNKLSAEVRELEDEL
FT                   SEAMAKRDDDVQLRQQAQVAKTIAAKRASAVAKRDRLAQRRNQVVGEYESASARQEGDG
FT                   SAPGDAPGGRAATDPDEMKARFESVKAKLAKYKSLKRELDELNMEAAVLARTEAILEED
FT                   ARGVMGDVAEEERRAGVAGFAQAQETLEQVSKAKGDVDAAKGAALEEINAFVAEITRKI
FT                   KERKGALQPKIKELRDLRQHFGALESKHADAKKRYDVEAAKHQKKRDALESEVNQLRAQ
FT                   VLGDETKYHRMNIESALVEAHAKRATGGDARRYDAMYRAAVDETDNETKRLNERTEEVR
FT                   NNFSQGVEAVEALKDLYRILDVKLRVTRRDMAGESLGQTTTYGGANVLSM"
FT   CDS_pept        complement(461943..463484)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639166"
FT                   /orf_name="MICPUN_103473"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70527.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C48D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ45"
FT                   /transl_table=1
FT                   /translation="MTSTWLPVVGERIRPVMTAAEAVSPGGDPIPAPGEGPHWARLRWP
FT                   PPSDGDDRREAMVSDAERTATLDPESMESGERRSVSVVWEDGGEDDGLDPATFGPCVDR
FT                   STPGMADEDPDARARAFAADARARGASRFRAGDDAAAAAEYVEACAMLASTLPAHALPA
FT                   TEGGWNVPGYPTPTGGGGGDAQTMRINSSATGAASSAASSAAPPTVGTRVRVTSANGSS
FT                   RAGMVAYVEEEEGVCDVMFDEANNGEDDEEVGVPFSRLFGYDPSAATDAAFDATNEDAD
FT                   EDDDARRRTRREAAAAAARDRDAVCDELASRLLDVARCHLRLARGGYIATERIVGKDGK
FT                   RRDAWVPARVDAASARACVSACDAALLMRRTRAGYYLRGKARTQLCQFRGAEDDLRTAL
FT                   ATRETSIGGESNPVGDVASEREVKLALRALKAAARHRRASDRKLASAVVSNAYKARVDF
FT                   GLDPGSELERTGRVPGGPYLRPAHERKHDAVDVRGLGDVIKERVAERVKRGCVLM"
FT   CDS_pept        463586..464602
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639167"
FT                   /orf_name="MICPUN_63119"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70291.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199C48E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ46"
FT                   /transl_table=1
FT                   /translation="MADRDDEVDAFDAMMGIDADEFATLLDDAEDSSDGGQDADDAPKL
FT                   HRGGVPVLDLPDVTPSEFRRRFLATRSPVVLRDVRRECAPAHLGCRHFRERYGDVVVPL
FT                   DITDTNRRDVRLADFLDAVASTSGSGGDEGADDLRSRYLRNLQMHEHFPAEAAQLSLPR
FT                   CFGENMLSDEGKVPRCPENWRRWFELFVCHPRCAGFPFLHKDTCHVHAASFQLEGRKRF
FT                   TLFHPDDSPFLYPTGNTGCRSRIDPEAFGSGGTSSEILGRFPALASARRIVCDVGAGEI
FT                   LFVPADWWHTARAIGTCASVSVAASFVDAQGLEAFLDAYGEFEAMRSLVEHGAGVIT"
FT   CDS_pept        join(complement(465332..466620),complement(465097..465256),
FT                   complement(464710..465020),complement(464669..464675))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639168"
FT                   /orf_name="MICPUN_63118"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70528.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001298"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniParc:UPI000199C48F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ47"
FT                   /transl_table=1
FT                   /translation="MSEQPAPFAMKCSATGPGLGGGAAGVEAQFTITSADGDGARIRAG
FT                   GANVQISVLRVGLHATGGDAIPTRVVDNGDGTYTCGYTVDGRGDYSVSVELNGAPIAGS
FT                   PYPVFFSGTIMRPSAVPVPGVVPGAVPQSGAAPTDVPSPAQTPELNPEEAASVSTQVHV
FT                   GNLTHNVTTTQLAQLFSHCGEVRGARIAHGKQFGFVEMATPEQAKKALGLNGMPLDGRV
FT                   LRVEACNSVRKTAVNSSNSTHPGGPADGGPGHHRPTAAQLAESPAEVAARAHRERLAKA
FT                   AMLQANLNAQRAAEMAAKRAAQISKRIVGGGEQIGDGDGDEKSAPGEGEAGNGDAGAGT
FT                   GAGERRRGLSASRSRSRTLSPSRDGARSRRTRSRSRSRSRSRSRSRSRDRDASRDRGRN
FT                   RYKPYNRGRRRGGKNRSGAPRKMNPNGVGQEIGAKTVSNHRASPFEMVVNRAKNALKRA
FT                   ATVSMKQAALMAFIATMPPMWLTYTGLEEYEIYNPLKWASARIMISFGTMLFMVAMAYR
FT                   QLPLDLVPDWVPMIGKMDDLIAGLVAGVGITIAFIGWHFGMGPKPVEAVLVVNAFSYAW
FT                   TALYPVRVGAMG"
FT   CDS_pept        join(467903..468414,468493..468842,468945..469417)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639169"
FT                   /orf_name="MICPUN_98162"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70292.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199C490"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ48"
FT                   /transl_table=1
FT                   /translation="MCFMLALSWPLTAVTLASVPPTIAISKIYGNYFKKISKRTQKALA
FT                   EATEVAEESLGGVRTIRAFAGEPFASADFSAKLGEFCRQNSIEARYVIGYTFLYTFLPM
FT                   VITVLVLWYGGMLVLHGSLNPGALVSFMLYQQQLTSCFGAIGDVFTSITTALGAADKVF
FT                   ELIDTEPGLAPATCDGHLALVNVNFSYPARPERQVLFGFNLDVKPGETVALVGPSGGGK
FT                   SSVINLIERFYVPSDGAVTLDGFDLGDLCPRWLKRRVSLVAQEPTLFNRTLRRNIVFGL
FT                   EKTRGDAAVAANAHAFISQLPHAYEETVGERGSTLSGGQKQRVAIARALVRKPKVLLLD
FT                   EATSALDAESEAIVQDALGALMASYTVVVIAHRLSTIQNATRICVIEKGVVREVGTHDE
FT                   LLRRKGAYAGLVRHQLSAMSASSASLLGLEDETAASTPTVGSFGG"
FT   CDS_pept        complement(469565..471634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639170"
FT                   /orf_name="MICPUN_63116"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70529.1"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="UniParc:UPI000199C491"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ49"
FT                   /transl_table=1
FT                   /translation="MLVDSWASTGVVAVLAAPFSRLALSPRPAGASAGSCSAASCSGRT
FT                   HQGTPARFRNMEGQFFNGGRRRAPHALAALEDDAQEPSRRRGRRAKATGSSSAASTPAA
FT                   SSSSGSSSDSDTKSVPESDGDDDDDDGADPARRMASLVALVAMSTDQNPSAVAKHLRDD
FT                   AETYRALEREAKGSAGVRAAEGPERRIARNLEVLVNELGCAPADLAAIVRAFPGVLALD
FT                   ADDDVRSVVQFLTGPIPLGGVGMTTAAAKECVRRDPKMLGQSVKDALRPKFEYLVEHAG
FT                   LRPGNVGDMLWLDLETQIKPRVEFLALECGMGSTAAAAAIRNFPPSQSHVLYRHFENPE
FT                   NMARKALKCLREEVGMSADQVSFAIGRFPKILDYSPEKIAGCFEFLRSTCALTEEECRR
FT                   VIAATPQVVGLSVEENMAPKHRLLVHELGLGEDGAREVIACFPNLWTVANDNIRARFTF
FT                   FLETVGCSREDLTAMLASHPHGVLSLSTDNILESMNFIENVFATLPADDTQRRTLGDGG
FT                   PRELAVAVLAKVPMLLGYSVERKMRPTVDYIRETHPDVCAFRALKMCTNSLGGTIMPRC
FT                   YFKERAGWNVLLVTAVHMSKSRFCEKVGITVAEYDEKAAEFIELTERMHPPPAKPRTPA
FT                   FAIRSAIKAQTKRTTLDKAEKAEKGTTTERRRATRREAAEARRRAAAKDAPDGE"
FT   CDS_pept        complement(471803..472918)
FT                   /codon_start=1
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639171"
FT                   /orf_name="MICPUN_103469"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70530.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG728500"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C492"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ50"
FT                   /transl_table=1
FT                   /translation="MSRVEDELLGLLSDLDGTEKRAGLVGSSLSGARRPGGKGESSDAR
FT                   GIEPGSSEPRSSDPTVATVARSANAYGAGAGGSGSRKADCLVLDLDGTLLNRECVITPR
FT                   TAEALRECAAAGVVVFIATGKARPAAIRAAATAGLDGDDGVVSRKSPGVFIQGLDVYGR
FT                   EGDPIYKAEMPHDVVREAFGLVYGQGLSTKVALTAFCGDECATLASHPLLDELSSLYHE
FT                   PKSVAWDDVDQLVHAANAAFGGNATASGVQKLLLMAETAEEIDDARPRWEALFGSRAEV
FT                   TQAVPNMLEILPLGNDKARGVRTLLTHLDVDVSRVVAVGDGENDLGMLRLVGRGVAMGN
FT                   AGAKVKAAARETLAATNDEDGVAEAIQRFVL"
FT   CDS_pept        join(474172..474549,474712..475446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639172"
FT                   /orf_name="MICPUN_103468"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70293.1"
FT                   /db_xref="UniParc:UPI000199C493"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ51"
FT                   /transl_table=1
FT                   /translation="MGAGEERDKYNSQAKEDDARQYGVWGVDGIRQRSASFAKMEEDWE
FT                   QTVRASPQRPSQSKHDRDRDVVDIRHLGGADAQVAKRSDRFWKREWFHDPARDGTRMGY
FT                   HADGIRQKSASFAAMTADWEDAVSQVWINAGATEVATQRLLILGAKWQKGALGEIYRDP
FT                   EAVSVMVRSLESLLPGANPAAVFHGCPEAALVCVDRNALSAQLVALRTGVGIARFDLAR
FT                   VVTHSPSLLLVRDAERECAESAAALRATFLGTLLGDEGVAAAIEVCPALLEAPAEDVVG
FT                   AFEGFRDDVGEKLANVGGASFRLALDRHDAGAGCVGPSSVGGLIGEMADGDKKEAARET
FT                   GMRHAVDYAGRVAEPYLRRAKVAREKARPR"
FT   CDS_pept        complement(475565..477181)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639173"
FT                   /gene_name="HEMH"
FT                   /orf_name="MICPUN_96687"
FT                   /product="Ferrochelatase II chloroplast "
FT                   /function="ferrochelatase activity"
FT                   /biological_process="heme biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70531.1"
FT                   /db_xref="GO:0004325"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="HOGENOM:HBG697135"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="UniParc:UPI000199C494"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ52"
FT                   /transl_table=1
FT                   /translation="MGASSAIIRGDLGVVGTSTRRVAATRVAGSGARAGGARRAAKSSS
FT                   SESKGSRGSSLVGTNPGRRLRVAARAVSDPSMTGWDAGRIDEKEDVVGVLLLNLGGPET
FT                   LDDVQPFLYNLFADPDIIRLPGALQFLQSPLAALLSNSRAPKSREAYESIGGGSPLRRI
FT                   TDEQANALQSALVAKGLKNAKCYVGMRYWKPFTEEAVEQIKADGVTKLVVLPLYPQFSI
FT                   STSGSSLRLLEQIFGEDEYLATRMSHTVIPSWYERPGYVQAMADLIKAELNRPDSQFDS
FT                   PDEPIVFFSAHGVPVSYVETAGDPYKEEMEECVALIMARLKEMGVANEHVLAYQSRVGP
FT                   VEWLKPYTDDVIRELGEKKTKAMVAVPISFVSEHIETLEEIDMEYRELAEESGVEQWGR
FT                   VPALDTNPVFIDDLADAVVESLDGMSKAASMSEGDLAAAVATSSVLRGSLDESSPTTKR
FT                   KVRGDLAATPPVPMMPTGTGSRVRNVPSTDDVTDLLGVKPEPWEWGPVEFSMVALSILL
FT                   STMLLMDSSGGAGLNDIIFHK"
FT   CDS_pept        479235..479561
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639174"
FT                   /orf_name="MICPUN_109280"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70294.1"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniParc:UPI000199C495"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ53"
FT                   /transl_table=1
FT                   /translation="MCTVGYGDVNPATILGKTFGMIVVVVGVLVIALPVTVIGSNFSVG
FT                   FNKEEADREMAEKKLLVDERRRLAEEAALMRESVSGSETSSPNFSRLQSLNDDGDSPAV
FT                   PNRA"
FT   CDS_pept        complement(479669..480439)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639175"
FT                   /orf_name="MICPUN_63111"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70532.1"
FT                   /db_xref="UniParc:UPI000199C496"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ54"
FT                   /transl_table=1
FT                   /translation="MSKSPIDAALDRAGGSSYYYAHERRTTDDIAAPLPPTCGTKIDPS
FT                   PIGSRVDESERASLAKKSDYYYAHGVSDAAATEPRAPMPPDGGTLLAVSRRAGHVSAPA
FT                   PEPLREYYFEDADRSDYVTVTFPLRRVGATHGRGAAARERAAADALVLAAPGRISSEDT
FT                   DARGDGVYVTFGKRNSRSFEVEVIGHVDEEHDPDNPYEPEPVGRHLRFRCERTFDEFIA
FT                   ERCDWKVLKNAIKVRLCKNPEGPNKYRAWKRVIY"
FT   CDS_pept        480677..484381
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639176"
FT                   /orf_name="MICPUN_103465"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70295.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C497"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ55"
FT                   /transl_table=1
FT                   /translation="MAPRADNDNLHVAHVAELPNASQCGISGPRAGVVYTGSADGPVLS
FT                   WSPSDGKASICVERPRDKPASCVCIVNGTDLWVGGVGGDLTAYTVRGADGKPKKAVAKV
FT                   KGFVAHAKGVLCIKEIAGKFNPFVVTGGADKHVRVWTFDGRPRAASAHHDGAVTALVVF
FT                   PEKGAQPAAIWSGGADGKVYAWKDEKGDAAIEGKSGKFLTGMGKGGVTAMCAHPDDTEA
FT                   WVGYEDGRIRVFDRTNGSVRSDSSMHSKAVTCLVPMGDHVWSASLDHLVVAWDARTKST
FT                   VFILPDQGGSVRDMCRVGWSMWVMNDKCINIWAAASNERDLRMRVKAINEELESEKKAR
FT                   EADNERAADEKERLETQLRETRERAEKDREDARKELENTRAKANFQLATAKATAQRVKE
FT                   GLENELKELGESKERALADAKRAAEEEEARLKEQMAREKSLADEYAQGIKDRAAADIKQ
FT                   LQEELDEERARRSGMEADSDAATKLLAQERDELRKDLAEARKKLNDEEERAALLAKQKD
FT                   ELQLAKDASEAEMRADAEEAARRAADAIAALERRAGNAEARGDELQKNLDQSQADKADL
FT                   EKRLAAEKAEHAAARDAAAEAAARAAAEKAALENSLADADAARRAAEEAENAARLAAEE
FT                   ADARAAQSSTDAADANARADAADAESEAAREAAAAAEAARLAALKAMEDALSDAERARL
FT                   KAEAEEAARKEADERRRAEEDALQKMLDEKQRELNELRRLHENAHHDAGRELERHLREI
FT                   EHLKRQLEEAEARAKLGLNNPAPPNEIFELQRRIMNIEAERQLEQIEKEKARQLREAAE
FT                   SRRMECEAKLRQAEVELARSRTTIERVGSLEADLNRLVAEKAEQKRRFDAELRAATTEA
FT                   DRRGNKLEAELRFVQNLLERKRDKKRAHKRRGEELARRLEEAVSISKSISADAEREMHK
FT                   AKALATVEANAEIAKRAKEYEANAATAAAAAENAAQLSEMLERKRSKKRAYKLAATEAK
FT                   EELIKLREQFTRASLDRDRTQKALKISVANAESADKAYTQRVTELEDALKQAMRDYKNQ
FT                   SAEIKNLKAAKLNAERGYEHVRVENEGLAQALTKAEEAARYYEQSAADSAMEASREKVR
FT                   AEGEIARREYLQRYAAAEQESRHMKRSFDQRRQEARGGGFGGGGGVVPDDDALPVGEND
FT                   ENADRVGERSRDGSKGVAVSGLDPASDPNYVRPAGMSSEHVEHRRRYERRIKENRYGDF
FT                   DVIPQWHER"
FT   CDS_pept        join(complement(484961..485228),complement(484437..484783))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639177"
FT                   /orf_name="MICPUN_63109"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70533.1"
FT                   /db_xref="UniParc:UPI000199C510"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ56"
FT                   /transl_table=1
FT                   /translation="MACVTVSLASATPAVAPSLRRAAHVRRGGSVVVRGKKAAFFKEFD
FT                   EQYQKDNEVKEMDENVMNGWPGLASEYPRTRRESCRHATVPSMCQDIGDDIATYNVLTK
FT                   KTGPLNVTWNGVAMLQVPKGKTDKESNAIAKTVLIQRKEIVLQEVDRLYPKMKGQPKDY
FT                   VIQMFEDPFADPVDMTQEAPNDVETAPAEFKFLEKGRRYPY"
FT   CDS_pept        join(<485721..486048,486154..486295,486341..486620,
FT                   486768..488420)
FT                   /codon_start=1
FT                   /gene_family="HOG000287360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639178"
FT                   /orf_name="MICPUN_86889"
FT                   /product="Predicted protein"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70296.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG351121"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="UniParc:UPI000199C511"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ57"
FT                   /transl_table=1
FT                   /translation="IEDVFGYPAPGSLHPIGFQWSPDGALLGNLFSPNGTLVRNLYAYD
FT                   VRAGAQRLLATPAREAYADEARLPDEEKLRRERTRELGLGVTRFEWASRRAKGEARRLL
FT                   VPQSDAGGDKLAASEPRLVVDSGDNGAAVLDAKLSPDGKWVAFVREKEIRVAPDVVSDA
FT                   LPSARVTFGAYGRDATTHGLAEFIAAEEMDRPEGYWWSPDGRKIAFARVDAGTVTPYLI
FT                   ERADGSSERHRYPFAGGTNARVTLGVVDNPLDFDVVWLDVDCGPGNARGDEEEYLARVA
FT                   WSADSERVFAQVQRRDQRSASLIRVDARTGERCDPAPLVIEYPPAGCGWVNLAPPSATF
FT                   RELRGEIADPSGVIRAGDFLWGSWRTGHLHLYVHCGSTGVCKRAVSAGDWSVDELIGVD
FT                   ELSGHVYFTGAADGPLEKHLYRAPLWGPSADDGSSTSASMARLTPRAGWNLCSMDEACT
FT                   RFVCVHSAADKTPTVTVHETKATATTTTVEFGDERAACSSKVPFLSPLLGERFRRLAPP
FT                   TPFEVTAADGATKLHGVAYVPDERVHGPPPYPCVVSVYGGPHAQTVQNAWHLTTDIRAQ
FT                   SYRSRGICVLKLDNRGSARRGQRFERAICGNLGAVEVEDQARGVDHLVRCGVVDPTRVG
FT                   IFGWSYGGFLAATALARRPDVFACAVAGAPVTAWEWYDAHYTERYMGTPDANPDGYANA
FT                   SVIGRCGDVMGKVLVVHGVVDENVHFRHSTAYVAGLERCGKTAGDGYVFMPFPNERHVP
FT                   RGAADRMYMERSMQAFFEANLIQVDGGRRGAKSEDGDGMPVTNTAPA"
FT   CDS_pept        complement(488507..488890)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639179"
FT                   /orf_name="MICPUN_63107"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70534.1"
FT                   /db_xref="UniParc:UPI000199C512"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ58"
FT                   /transl_table=1
FT                   /translation="MHAVAASIASFAPVATSTARAPRRKSTGVAAARPTMPPPADKKRN
FT                   VASVGVALVAAVSLNLAPAPALANVKYANDCDPICHVLDDGAAKSAKMEEDMKKGGADM
FT                   GSALERLMAERKAEEAAAKGAKK"
FT   CDS_pept        join(<489787..490398,490516..>491442)
FT                   /codon_start=1
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639180"
FT                   /orf_name="MICPUN_66348"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70297.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C513"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ59"
FT                   /transl_table=1
FT                   /translation="TRVQQRAIPHILRGEDVLIRAETGSGKTLAYMCPILAALGGIVPR
FT                   ITREDGTRALVMVPTRELAAQVLDTAARLGKCYHWVVCGGVMGGENKQKEKARLRKGVS
FT                   VLVATPGRLLDHLRHTTAFRADLLRWLVLDEADRMLDVGFEEDLNAILADLNRRTENAG
FT                   ERGTRCTALLSATLTAGTSRLADLAMVDPVTIEIDPEEPEYELALADAKQMIVRMPEQL
FT                   RHTAVEVPAKCRLAALAGLLAGWMQGAVPKVMVFLSSCESVEFHYRVLSWLASGGKAKK
FT                   GAKGPRGAGDVDAGGYSVFRLHGVLSQTDRRAVYQGFSKATAGVLLCTDVGARGLDFVG
FT                   VGATVQVDPPSDPTTYVHRVGRTARLGAEGEAVLFLQPREVEYATVLGDLGVNFCAASV
FT                   PAMLDVLDGAAGGGGGGGDFERNPHLHPAAQKLQRKLHAEVSGDKELLTLAKDAFRSYV
FT                   RSYATFPSDMKHIFHVKRLHLGHVASAFGLKEAPGLIGKSATRERLQAAKDAKRK"
FT   CDS_pept        complement(492054..492803)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639181"
FT                   /orf_name="MICPUN_63105"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70535.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C514"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ60"
FT                   /transl_table=1
FT                   /translation="MVWRRDRSNGAPSVDAGRDGDEVELGEIIVEPTPNGGKATRVVEP
FT                   SKEEEPAEDAEEDADEERFCRICLEPVSLDSIRDGKSLRLGCACKSGYMHKACAWEYVQ
FT                   VKKTKPVTCEVCLEDMTALDPIAELQGEEYRAMRRARAALLRVNGEDDHDPREDPTFDD
FT                   ADPRGARLCWGSRNPVVWLIWLVSRPVIAVVWVSLPDRHPSPISILFRGEYRADTALAA
FT                   FDPALPSRSFGILFPWRWRTGASSSRF"
FT   CDS_pept        join(<493642..493782,493840..494175)
FT                   /codon_start=1
FT                   /gene_family="HOG000187909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639182"
FT                   /orf_name="MICPUN_87345"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70298.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG739441"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C515"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ61"
FT                   /transl_table=1
FT                   /translation="GLEKYTVGDLLLTKSLEDRGTWLWCDENVPALEAVRTMTKANVGA
FT                   LLLVRGRWEDAVAGVLTERDYLRKVVAQNKDASTTAVGTIMTDKKLYDVAQTDTPVLEA
FT                   LRRMTEGRHRHMPVVNANRTMAGMLCIGDVTRMVVDAHRAEVLRLRDYLAGASY"
FT   CDS_pept        <495039..495686
FT                   /codon_start=1
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639183"
FT                   /orf_name="MICPUN_98159"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70299.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000199C516"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ62"
FT                   /transl_table=1
FT                   /translation="ALAKTGFTAAFALIFVSELGDKTFFIAALLAMRLGRFTVLTGAVC
FT                   ALSLMSFISVAIGKFFQQIPAAMTTTLPVGEYLAVALLLFFGVRTLKEALDIDEDGDDE
FT                   DGELADAQEAVSKSAGAGNKKTGFIAGFWETFTLVFIAEWGDRSMLATIALGAAQSPLG
FT                   VALGASVGHLVATLIAVVGGALLSEKISERQVGITGGILFIVFAVATLAGVF"
FT   CDS_pept        join(496616..496696,502157..503602)
FT                   /codon_start=1
FT                   /gene_family="HOG000219145" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639184"
FT                   /orf_name="MICPUN_107170"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="ACO70300.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG724623"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="UniParc:UPI000199C517"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ63"
FT                   /transl_table=1
FT                   /translation="MGPRGCASRRLAARGVTRRALARGARRGGVVVTHDEEKLADVLCV
FT                   DGRIAAVGANLDVPSDARVIDADGLLIMPGGIDPHTHMELPFMGTVASEDFFTGTSAAA
FT                   AGGTTTIIDFVIPAPQQNLLEAYHTWRGWAEKSACDYSFHVAVTWWDDTVHADMGTLTR
FT                   EHGVNSFKHFMAYKNAIMCDDETLVNSFARCNELGAIPTVHAENGELVFRLQKEMYERG
FT                   YVGPEGHPLSRPPEVEGEAANSAIRIAEVLGVPLYLVHTSCEDALEAVRRARSEGQRVF
FT                   AEVLAQHLVIDDSVYRNPDWSFAAHHVMSPPFRSKRHQGLLWKGLQSGLIHTTATDHCC
FT                   FCTPQKAMGKDDFRKIPNGTGGVEDRMSVLWSEGVETGMLTPSEFVAVTSTNAAKIFNI
FT                   FPRKGSVSVGADADLVLWDPKGTRTISAKTHHQKIDFNVYEGMEVTGIPAYTLSQGDVV
FT                   WENGELKTQRGKGRYIDRPCYPTYWKNQQRRNEVAVPEKVVRAAYTGPVA"
FT   CDS_pept        complement(503725..505401)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639185"
FT                   /orf_name="MICPUN_63098"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70536.1"
FT                   /db_xref="UniParc:UPI000199C518"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ64"
FT                   /transl_table=1
FT                   /translation="MRWPVVVASVALHNPGRRLLDHCWDSLGGAHVDVDPLASNATSTG
FT                   ADDSGGTHMDPLVTRLLFWLVYTLAAAILLVSMLRIFPPPDRVFPRKRPVAGVVPWCCA
FT                   GRMLGYGVIDWREGKLTPFWRYFRERHDFVSLWLGDHEFITFRMRLVHFMTDICCTMSL
FT                   SMGLVDLQSGSVQGDFWLYQVWVFGALFVYQIVLGIALRVSAVGASERAMHAPGKPATR
FT                   RVERNYFIMCFSFSAVSMLCAISYVHVMDEAGGCGDGFQTFLAYMYIFALYEFFGWFVL
FT                   HPSIITFRWVLGGALIRLSTDADTDEETMACCWKKLPCCCCCGCPPQPSARVDHWGYAK
FT                   AEPALDRGESSKGGSVWSADVENGGASPTPSYRSRHTSERDLVLEWKKNKAQTSLVVAK
FT                   ELLRRASRAKERARIARTETAIATAAAAEAEARAAEAKAKSEEAKAAEAEARALRDALP
FT                   PPRPGAPMVDPPTPQSMMATPPPSMALPPLDEAAFEVDEVHLDLPEVHLDLPGDLPPLD
FT                   TEFSAVSSAMGTAGDEGSVGSRTPLREDEFRGFSLPPMPER"
FT   CDS_pept        506324..>507040
FT                   /codon_start=1
FT                   /gene_family="HOG000293205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639186"
FT                   /orf_name="MICPUN_87252"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO70301.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniParc:UPI000199C519"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ65"
FT                   /transl_table=1
FT                   /translation="MSSRPTGRGGGFFAPRTAAAAAALDLAQTPWPSHVREPIDASRVC
FT                   VYVDPLDGTNEFAAGNLVAVTCLLGVAVDGRPAAGVIGQPFHTKTAGRIVWGGRGVGVR
FT                   GLEDIGDARRVWNAGLGGGGDSPGINSSDAASSRFGGFTVCVNRVTRDDRIDAVLDATN
FT                   ATIGEKVSATGYHFLRVLEGAAHCGVLLRAGTKKWDTCGGEALLREAGGVVSDAAGRRY
FT                   DYSHSHAGAMNPSGLVI"
FT   CDS_pept        <507185..>507805
FT                   /codon_start=1
FT                   /gene_family="HOG000006300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639187"
FT                   /orf_name="MICPUN_72362"
FT                   /product="Predicted protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="ACO70302.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="HOGENOM:HBG319440"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C51A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ66"
FT                   /transl_table=1
FT                   /translation="RALTVDVGGCLLSPVEPVTETYLRLAAVHGVRGITRDSVKAAIRA
FT                   GFAAPPPPEQRGVRYVGDGRGFWRPLVAAAMGGLADDDPTLDAVLDDLYAHYENPAAWC
FT                   VAPGAKEAFKQLRAGGVKVAVISNWDTRLPKLLRDCGFDESLIDTVVVSAEQMSDKPDA
FT                   RIFEAAMERLGEVGNEAACVHVGDSSVNDVEGSARAGFGASLLW"
FT   CDS_pept        complement(507948..508658)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639188"
FT                   /orf_name="MICPUN_63096"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70537.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C51B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ67"
FT                   /transl_table=1
FT                   /translation="MNAMVSPRGTWTGRGVWMPAIWRPNVSGPLPDVYVEVEVTEDASS
FT                   KGTKRKRAPPTKGPCEHGVKYRSNCKVCSACPHGKWRRRCKECGGSGICEHGRHRFSCK
FT                   ECGGASICVHGRERSRCKECGGGSICEHGRQRSRCKECGGSQICEHGRERSRCKECGGA
FT                   SICEHGRQRSHCKECGGASICEHGRVRSRCKECGGGSICEHGRQRSRCKECGGSQICEH
FT                   GRERSKCKECRAAH"
FT   CDS_pept        join(508924..509172,509399..516586)
FT                   /codon_start=1
FT                   /gene_family="HOG000196287" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639189"
FT                   /orf_name="MICPUN_63095"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70303.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG314239"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="UniParc:UPI000199C598"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ68"
FT                   /transl_table=1
FT                   /translation="MGGAPAFSGNASGRSKGNMYGEAGRGKGHHAARGRGGQGDGDWKN
FT                   QKSRLQMAQEEDALEAGLGFVNFTEGDERLGWLVNVSSTTVQEAETGKEFSAVNCYFMQ
FT                   QDGDTFKAQVRYAPYFLIATKPNCEHDVEAFLRRRYEGKIHDVTVLDKEDLDLKNHLSG
FT                   LKQKYLKVTFATVQDLMDVRREVLPMVKKNQSRSEAAEAYEALHQMEASAVTHQGRAHH
FT                   GVSRGGEQKSTKGKRAIANYADAMMDIREYDVPYHMRFLIDTETRCGWWYQVKVKQGEV
FT                   TMTHRKDMLARGEVKICAFDIETTKLPLKFPDAEYDQVFMISYMLDGQGYLIINREVVS
FT                   ADIEDFEYSPKPEYPGPFIVWNEPDEAALLRRWFDHMREVQPSVYVTYNGDFFDWPFVE
FT                   TRAEKNGMSMYLELGMRCDRKTGECRSRSALHLDAFAWVKRDSYLPAGSHGLKAVTKAK
FT                   LGYNPVEVDPEDMLPFAQEQPHHMAAYSVSDAVSTYYLYMTYVHPFIFSLATIIPLSPD
FT                   EVLRKGSGTLCEALLMVEAYRANIVCPNKTQSAGEKHYKGHLLESETYIGGHVECLEAG
FT                   VFRADIPTKFRMNPKGYQGLLDSLDEDLKYALYHEGKKMTPEDVENYDEVRAAIAEKLV
FT                   DLRDNPVQMAKPLIYHLDVAAMYPNIILTNRLQPPAMVTEDVCAACDFNRPGKTCLREM
FT                   EWLWRGEHYAATSSDYAAIKAQLEAEKFPPKADGTGDGRPRYWADLSYEEQAAAKKNRL
FT                   KMYSQKVYKRVLDKPITESKMAGICQRENGFYVDTVKNFRDRRYEYKGLNKTWKGKLGD
FT                   AKKSGNPIAVQEAKDMVTLFDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGA
FT                   KIIQMAKRLVDDIGKPLELDTDGIWCCLPGTFPEEFTLKPKEGVNKKKLTISYPCSVLN
FT                   RLTALQCTNDQYQTLTDKEKRTYESSSEMTIEFEVDGPYKAMILPASKEEGILIKKRYA
FT                   VFNFDGSLEELKGFEVKRRGELKLIKMFQTEVFDEFLKGTTLEEVYEAVGKVANKWLDM
FT                   LDSKGRDLTDEDLVDYISEATTMSKSLEEYGDRKSCATTTAKRLGAFIGGDIANDKGLK
FT                   AQYIITKKPAGAPTSQRAVPVTIFQAEPAVARSFLRDWTKDSPPGDADEVPDMRELLDW
FT                   DYYKTRLASAIQKIISIPAALQHVPNPCPRVTHPDWLHKMVREKDDKFKQRKLADLFGA
FT                   HDAKRELLAAKDPNAPEHDAAHTPGKKARGDELDMEDAAGAAPGTLIGKTSGPRVQRFF
FT                   RGVEDSAPGGGVPTTPETGAVAARTLPGSGPSPADGGNVTGNVRRRNALDPVEIAREAF
FT                   ESLGACPDKRQDFDGWLRHHKAKWRLQRAERKRRRVQEADALAAAGGVTPGFGRSMTRP
FT                   RTLGPGGLGAFVESRERTLATSAWQLVQIEPAAAGPGHFTAWVLAAGTIHSVPIKVSRR
FT                   LAVAMRSPDREGDLGLGGKKRVSAILPRGAKAEHVYEVKMEESEYASGLEVMDLLANPN
FT                   VVGVFERHVPLLEAAVQKIGCVASLRRDESRADGQVLEYDLDQLEMRTTAECGYVPLAK
FT                   PDASQAVRGMMRHVSLYRAGDKGKGVYALHTPATGSGVLVVVEPGAVGNGRRNQGVREV
FT                   SVPAMDRAWRAARAEVSSADGDDAATQSADGAIDWTVEYVKDDESAGAAVSRHLQAYLE
FT                   DPKGPAVCVVEAPGDSGVDVVDGSSIRREGVAGRLGAIIPALARLPVVHVPANAADTAS
FT                   MPAIGWQVNAAKTACTRLAAHGDWLAERVAISRYAHIPVGNLGQDWCLHTADTFFARAL
FT                   RDSSQLLWTGPGGVPDLGGGSGDGALSGLDDTLQTTRAEVNNPGAYRCVCVELKAHHLA
FT                   VCAIANAHLLNDLEQGALLGYEQNTVGSGKDNGDSGVRGGHEAAAAFRTLRTLVNNWLV
FT                   DATERRNPYADALLGQLRRWLLSAFSTLREPALRHLVELCMKKVFTLLLAEVKKLGATV
FT                   VHADMQTITIATGKHRLASAAAFVDGLRASLRRRELFSWLELEPSRQWHSLLFRGPYDY
FT                   GGLLASALPGAKQWSGHDTLGPDDFELDPVATRAAGVAEAAEALDMHWNIASFLPESIR
FT                   EHFEVVVSEFIFRPWKRDFGGGLDDERSDDVEYVDGLDDGEGDDAEAAVPPPLDTEGLE
FT                   HEGDEALDECLLDATPPQAREAASQPGQGGQEENEPLQNARTPLVGGREAAEAAEEERA
FT                   AWLAGQVGGYFSQRILRLVGEINRVLGPGTARHLGPQHKFPTPPGAHLPKDLRGSPALA
FT                   FVKTLCAALSLDVSVEGPVSLLRKNALKLLRVPEYSPQAEFREPCVTFVMRDAVCNYCS
FT                   ACADLDLCRDERLVEDANWDCASCGNPYDPQWIEGTLVAHVNERVRQAQLQDLRCTRDR
FT                   RIKVSHLAARCACGGMYGCVEDASATADDLRVMHDIARHHDFKVLRDVVEWVVRASPNL
FT                   SHARAVLDVDTDGK"
FT   CDS_pept        517168..518112
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639190"
FT                   /orf_name="MICPUN_87061"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO70304.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C599"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ69"
FT                   /transl_table=1
FT                   /translation="MYALTDPQVSHALAGSGAGAIAATIVCPLDVLKTRLQVSTLRVGG
FT                   DAYVSTLQSLSAIARTEGFVGLYRGLTPTIVALLPNWAVYFTVYEGLKEFMEPVGAAGS
FT                   QSWSSPHLRHMVSAAGAGVATVLVTNPLWVVKTRLQVQHSEALRASMPTRVPYSGAFSA
FT                   LGRVAAEEGARGLYSGLAPSLAGISHVVIQFPVYEQLKLELASRRGKATGDLTPTELVV
FT                   ASAVAKMVASSVTYPHEVIRSHMHVQGLGPFEGLFGLIGRIYKDGGGWRAFYRGVGTNL
FT                   VRTTPAAAITFTSYELISRQLRDIGAFYRDSQG"
FT   CDS_pept        join(complement(519861..520226),complement(518718..519248),
FT                   complement(518193..518606))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639191"
FT                   /orf_name="MICPUN_87088"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70538.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG407205"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C59A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ70"
FT                   /transl_table=1
FT                   /translation="MLEHAKVDNLPSFLSCIRENAIDLMSINSRNTSGTTALHVAAANG
FT                   CMKVLAHLVTEVCVDINAADNWTRTALDEATKAGHEDAVRYLLAAGARHGTNIDWNRHR
FT                   GEPIETPPRTSASPEPDEWELLPWDVKVDDVVGEGAFGEIRCGRWRGSPVAIKTLKSDC
FT                   MTDAIALKEFNCEMSIWCRLVHPNIVQFLGVGYKAGQPPIMVCELMGGGSLQQKLLELQ
FT                   SWGKKMDFDRAFKIASNVAAALNYMHSRRPYAVIHRDLKPANILLTSNGVAKVADFGLS
FT                   KMFDITTPREPAREENDDTGAYKYMAPEVFKHEFYGLKCDVYSYAMVVYEVFEGLLAFG
FT                   DPITWAHRAASSEKARPGWNFMAAYESRRCEEMCKLVEQCWHSDPKERPTFMRIANVLR
FT                   SIGYISKFEKRPELTAKGKKGGAAGAAEAAGCNCVVM"
FT   CDS_pept        join(<523285..523812,523927..>524323)
FT                   /codon_start=1
FT                   /gene_family="HOG000200895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639192"
FT                   /orf_name="MICPUN_68713"
FT                   /product="Predicted protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO70305.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG717246"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI000199C59B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ71"
FT                   /transl_table=1
FT                   /translation="RHLTDILTDTITGGQNNSVLLVGARGSGKTLVLDSALRQLREAHG
FT                   DGVLPVRLNGMLHADERVAMREIAEQLCLGFKAEELEFSRAAGFAENVAFMREVLRVLE
FT                   NGRRGVVFVLEEFDLFAHRPKQTLLYAVMDLLQQTQVQAAVVGVTCRHDAAELLEKRVK
FT                   SRFSSRRILLAPPRGKGAAASPTGIEPALVYPPDPGFAARWNDAVDAAVSQVGVDHTLR
FT                   AYEALECTPRAASDLALFALACMDRNKGTIAAKDIMVASQRLLGDTYVRALSGVSALEL
FT                   CMVVAMSRLHRFRRKAVFNFNHVEDEL"
FT   CDS_pept        525111..526547
FT                   /codon_start=1
FT                   /gene_family="HOG000218046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639193"
FT                   /orf_name="MICPUN_87017"
FT                   /product="Predicted protein"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70306.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG288422"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C59C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ72"
FT                   /transl_table=1
FT                   /translation="MLRFCEPPALNGGRKLKVAVLLSGGVDSSVALTLLKAAGHDCVAF
FT                   YLQIWFVEDFRNTWDACPWEDDLNVARGVCEHLDVPLEVVPLTNQYWDLVVKHSIEQIS
FT                   RGRTPNPDMLCNSRVKFGAFTDWLETNRAGEFHRVASGHYAAMDRVQGILADTLHGDDG
FT                   MNGTSRRHPCRLIMSGDARKDQTYFLAHLSQRQLAALTFPIGGLPKTQIREIARSAGLP
FT                   NAERKDSQGICFLGKVKFSEFVAEHLGERPGAIVELETGTRLGTHSGFWFHTIGQRSGL
FT                   GLSGGPWYVAAKDVPGNVVYVTRDYYSVDKERNTFRVGEFSWLSGTAPASDADGYALGH
FT                   GGEGARLAWACDGDGCDDDGATSRETTSSRGVNGGASASEVDATKTSELYCKVRHGENR
FT                   YRCTLRFDIDGDAGTVVIEADDQGLAAGQFAVFYDRRVCLGCGVILEQPVREDLAERDV
FT                   AHRTFANTEGEVLELESAGA"
FT   CDS_pept        complement(526644..526910)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639194"
FT                   /orf_name="MICPUN_63090"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70539.1"
FT                   /db_xref="UniParc:UPI000199C59D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ73"
FT                   /transl_table=1
FT                   /translation="MSSALLNLARRAVAQAPARVAARRGVSTSAPKFGGADEPAYIHAE
FT                   KMYDVGATKARPLVFGVATAAVVLIGGYIPVYACQFQNRKASG"
FT   CDS_pept        join(527211..527244,527474..528414)
FT                   /codon_start=1
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639195"
FT                   /orf_name="MICPUN_63089"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70307.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000199C59E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ74"
FT                   /transl_table=1
FT                   /translation="MGTEKKECLMPDAMPFVTAEMLFLPQGRDVEAVCLTVFAVIVALI
FT                   YLVDALAPKAKKALDPSKKVALKLVKRTELSHDTHMFRFGLPTPEHILGLPIGQHIALS
FT                   YTDKDGKEQGRPYTPTSSDVDKGHVDFVIKVYFPNERFPEGGKVSQHMHSLKIGDTLDF
FT                   SGPKGRYEYRGKGTFAIKRLKSQGGGFEIRKAKKIGMIAGGTGITPMLQVMRAVFRDKG
FT                   DKTDMSLIFANQTEEDILLRDELDKCERDHDNFKLHYTVDRPPAKGWRYDTGFVTAEMI
FT                   KKHMPPPSKDTQILLCGPPPMIKFAIMPAFEQLGYTKDMFLQW"
FT   CDS_pept        join(complement(528927..>529339),
FT                   complement(<528662..528818))
FT                   /codon_start=1
FT                   /gene_family="HOG000248767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639196"
FT                   /orf_name="MICPUN_76320"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70540.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG545479"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR015498"
FT                   /db_xref="UniParc:UPI000199C59F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ75"
FT                   /transl_table=1
FT                   /translation="ETVTLPGRHFDVPLRVDIAHRVVVWQRSKRRGNYAKTLTRSEVSG
FT                   TTRKARAQKGAGRARVGTLRAPQMRGGGVAHGPSGMRNWNTKLQRRVRRAGLQVALSAK
FT                   AAEGRIVVLDSLHRGVEPKTQWLDGALDTLLGAQKLPTTHSNAKRASLNLPHVQVMDQF
FT                   GLNVYDVLRHRSLAITRDALDALVARL"
FT   CDS_pept        join(complement(531119..531127),complement(530113..530943))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639197"
FT                   /orf_name="MICPUN_109278"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70541.1"
FT                   /db_xref="UniParc:UPI000199C5A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ76"
FT                   /transl_table=1
FT                   /translation="MEQAIKQIADDFGQPVEELLSVVLDNMCQSQNVVGLDGLAACEEL
FT                   SVQGCGIASLDNFPNLQALRKLLLADNRIGGGLENLAKLTNLEELSIGGNKIASLDELK
FT                   PLEGLKLTAIDLEGCPCADGSDTYRHALFAMFPTLIFLDGTDVDGNERLIDDDDDEDDE
FT                   DEDEEEDFDDDDDEDEDDFDEDEDDEDDDEDEDDQVARLSAGIDDFDEDDDEEDDDDED
FT                   DDDDLGTANLVGPPMDDDEDEDDFEGGEDPESEDFDDEEDDDDEDEEEAPAKKARVD"
FT   CDS_pept        complement(531672..533276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639198"
FT                   /orf_name="MICPUN_109277"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70542.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C5A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ77"
FT                   /transl_table=1
FT                   /translation="MKCWGRNDNGQLGYGDTNTRGNSPGSMGDNLPAVDLGPGQSAKFI
FT                   ALGADHTCVILGDGGVKCWGGNGYGQLGYGNTNNYNSGGSLAAVHFSPTVKTVAAGNSR
FT                   MCVMLYGGSVKCWGRNDNGQLGYGDTNTRGNSPGSMGDNLPAVDFGSGRSAKFIATANH
FT                   HTCAILDDGSTKCWGANPYGQLGYGDITNRGNSPESMGDGLPAVDFGSGRSAKFIAVGF
FT                   EHTCAQLDDGSMKCWGRNAYGELGYGDTQYRGDGPGSMGDDLPSVFLGDFAVAEPWPYA
FT                   IHPWVKMKKYGFNVDPNRCAARDYRSHCPRPMNVKTNADDWPSYVNPTPVNPNSCARDL
FT                   YRTGGRVVFSLVDDNSVKDLPSSAAEIAAGFQNPNAFYIGNAELEAINIKSAKMCLERS
FT                   KARGDSECNTNCLDIVDSHWSSCDAHAIFSSGTKNVIMAMTGQLAMGSCSSFYDGQTGC
FT                   DSTTGDYCWSCGRNGKVGQASSIQNNWHAHNYGMNLRRDGGTDELYHYTTTASGKCAMV
FT                   YENGDTYWDSFYIVVQE"
FT   CDS_pept        join(complement(537121..537464),complement(536514..536700),
FT                   complement(535908..536231),complement(<534588..534971))
FT                   /codon_start=1
FT                   /gene_family="HOG000280352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639199"
FT                   /orf_name="MICPUN_87356"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70543.1"
FT                   /db_xref="HOGENOM:HBG743299"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199C5A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ78"
FT                   /transl_table=1
FT                   /translation="MADWDVSLVTDMNDLFNYKESFNADISRWDVSSVTSMYLMFYYAA
FT                   AFNADISRWDVSSVTNMRAMFYQAYAFNADISLWDVSSVTNMNEMFVNAAAFNADITRW
FT                   DTSSATNMVGIYLFQDMTGFNVDISRWAVSQVTDARGMFQGASSFYQDLAGWTFAQGAE
FT                   TTGMFSGADAWLSRMTDWDVSLVTDMLSLFNGKSQFNADISRWDVSSVTNMQSMFYGAN
FT                   AFDADISRWDVSSVTSMKSMFFRANAFNADISRWDVSSVTNMERMFYQAYAFDADITRW
FT                   DTSMVTDMNSLFRDKGSFNADISRWDVSLVMDMLMMFYGASQFNADISGWDVSSVTNMR
FT                   TMFQNAAAFNADISRWDVSSVTNMYYMFYQAGQFDADISRWDVSSVTNMEGMFQWAPVF
FT                   NADISRWDVSSVTN"
FT   CDS_pept        join(complement(539572..539701),complement(538610..539487))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639200"
FT                   /orf_name="MICPUN_103448"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70544.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG557850"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C5A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ79"
FT                   /transl_table=1
FT                   /translation="MEEVAAGAWAGLVGTVLGYPLDVVKGRMQTGKGVAGSGAKANFAR
FT                   TLVSIARAEGVTGMYRGLGPPVCMMMVMNSMNFGAFYHMRDKLAGANPVGWGTERPWID
FT                   WRVVCAAASVGPLCAMVSTPFELVKLQVQLDAANHSRTQLAATKPATDRNASPIGYVRK
FT                   YSGSAHAARQLLKTHGPRVFFLGHGVNTARECVFNAVFFSAFEHTAHGFETEAGLSPAM
FT                   ATAAAGGVAGAAGWLTNLPLDCVKSGIQGQCLGDGRGGWDAGRGARVGFVEAARAVGGR
FT                   GGIAGFFAGAAPSLARSFVVSGSRFTAFTGAMGAFRAVRERAGASLTESEIGRD"
FT   CDS_pept        join(540159..540305,540442..541113)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639201"
FT                   /orf_name="MICPUN_95598"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70308.1"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="UniParc:UPI000199C635"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ80"
FT                   /transl_table=1
FT                   /translation="MAPRKKPLVKPEDAANLRVLQREDPEVEAILGSASHVTLYGFNLE
FT                   EQAWHRKDCEGSLFVVQRRSVPRFQFVVLNRLNTENVRENLLGEFEFELSPPYLLYRSS
FT                   TEVNGIWFFQQEECDDMSALFDSITSAHAKEDQQQPQLTAEGLMAAMNLGSAAAQPAQQ
FT                   PQPTGSVEAFFAGQLGRGGASAAPAPIPEPLAVPVPAPTMADEPKQKREKKKEKPAAAV
FT                   ESGRDSPVAERGGGGGGGGLNREVVRAAMYKLVANDNFIDLMVKELKRSM"
FT   CDS_pept        join(541323..541487,541599..541778,541851..541954,
FT                   542031..542661)
FT                   /codon_start=1
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639202"
FT                   /gene_name="DMC1"
FT                   /orf_name="MICPUN_112647"
FT                   /product="DMC1 DNA recombinase"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="ACO70309.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG413235"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199C636"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ81"
FT                   /transl_table=1
FT                   /translation="MSAAAVEDECAVAEAQLQRAETELAEEEETFEQLPQSFILIDELQ
FT                   QCGVSATDIKKVKDAGFATVKSLLTVPKKTLIDVKGLSDAKVDKMLEAANKLLPKDQAG
FT                   SFVTAKEWMSMRKDTINIRTGADTIDAILGGGVPTRSITEMYGEWRCGKTQICHTLAVT
FT                   TQLPLDEGGGCAKVAFIDTEGTFRAERIVQIAERFNLDSDAVLDNILVARTFTHEMMDN
FT                   ALTLLAGKFSEEPFKILIIDSIMAHFRVDFIGRGELSERQQRLGQFLAKLNKIADEFNI
FT                   AVVYTNQVQADPSGMSFAGMDPKKAIGGHVLAHASHVRLSVRKGRGDARVIKVVDAPNL
FT                   KEAEGEFIITDGGVVSSDA"
FT   CDS_pept        complement(542744..544480)
FT                   /codon_start=1
FT                   /gene_family="HOG000223062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639203"
FT                   /orf_name="MICPUN_86848"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO70545.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C637"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ82"
FT                   /transl_table=1
FT                   /translation="MTASAIAIPARILLSRRPRVSRAPVGRGGASRVVSVRAAAGNRLR
FT                   GKKEYVPTDRVASLQNEGAYAVLAAANALEAKGKDIVHLEIGQPGFPSPAHVVDAGVEA
FT                   ITGGKTKYSNPSGIPNLKRAIAEYVTRTRGVATSPAQVVVGPGAKPGLFFPTLALVQPG
FT                   DEVMYPDPGFPTYRAMIEVAGATPVPVPLRPDGASFDMAAFRSKVSDRTKLIVLNSPAN
FT                   PTGGVMPREDVEEVAAIATSADAWVLSDEIYSRLTYDQSEGATSAYSLPDMKERTVLVD
FT                   GFSKTYCMTGWRLGWAVMPEALAARTELLAVHSYGCVATFTQEAGVAALEGPQDQVDEM
FT                   VAEYKKRRDFVVSALNAIDGVECPIPAGAFYAFPDVSSFGMTSKQIANLLLNEGGVAVL
FT                   PGTDFGANGEGKIRLSYVGDMDTLKEGCARIAKVLGKLSSEKKDDDSSKEKKSNDNSSY
FT                   IITPDSSKGNVGNAMPVIGGGGGGLGANMTWEELDEKVNTYPMDRKFQAIGEGGQSFID
FT                   EVVALIEKALGRSVPSGNVTTRPSKKGKYVAVNVTVRLENGNEVLEVYGALKSCERVKW
FT                   FL"
FT   CDS_pept        544789..>545307
FT                   /codon_start=1
FT                   /gene_family="HOG000200896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639204"
FT                   /orf_name="MICPUN_87326"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70310.1"
FT                   /db_xref="HOGENOM:HBG622247"
FT                   /db_xref="UniParc:UPI000199C638"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ83"
FT                   /transl_table=1
FT                   /translation="MAATAALTLAPGHPADAAEFLPEIVASFNLATFTPQVFWFAMILA
FT                   PRNPVVKTVMGSWLPVLIASGIHFYVDYVGFNQPGALEEAAKFGAVFDPTIAPWDWANG
FT                   AVTGPLLGFQSMLENPNFVTEEWAHVLAWDLFVGRWMWLDAIERDVPFLWACLLTTNFT
FT                   GPPGLLQYFV"
FT   CDS_pept        join(complement(547600..>548022),
FT                   complement(<546874..547320))
FT                   /codon_start=1
FT                   /gene_family="HOG000264497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639205"
FT                   /orf_name="MICPUN_69978"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70546.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG597124"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000199C639"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ84"
FT                   /transl_table=1
FT                   /translation="GVLVSLCIYGVLQERLMTIPYGGGSGDDSPPPEFFRSSIFLVLMN
FT                   RLVTVSVSATGIFLTGERFSPKGTPLELYAMIAFGNLVTTVCQYEVLKYLSFAASTLAK
FT                   CAKIIPVMCWGRLILNKRYSAADFVSAFVVTAGCFIFFVDSLLPRGQLHQLALGVVIMV
FT                   VYLGFDGFTSTFQQMLYRRYSTSILNQIFFTTCFSSCMSTAWLLTTDQVPGVIQFIKVH
FT                   PECVQDIFTLSVSSAVSQFAISYTIFCFGAVTLASVMTFRQFISVVISCFLFGSPLTLA
FT                   QWFGVCLVL"
FT   CDS_pept        548855..549268
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639206"
FT                   /orf_name="MICPUN_103443"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70311.1"
FT                   /db_xref="UniParc:UPI000199C63A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ85"
FT                   /transl_table=1
FT                   /translation="MGGDFLNELEKKKRAVYTDVRKTLLRIWRSMDDPNGKMGITVRVF
FT                   GENVTLLGGMSPKKAMVAAMLMGSTAFWLGTAIGLCIFELMFDVPPDVKERVLHASYVG
FT                   LAAMYISVMAGIVHVVFFRDRHLWSVDALDRAL"
FT   CDS_pept        join(complement(549910..550001),complement(549453..549786))
FT                   /codon_start=1
FT                   /gene_family="HOG000242351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639207"
FT                   /orf_name="MICPUN_63079"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70547.1"
FT                   /db_xref="HOGENOM:HBG557853"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI000199C63B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ86"
FT                   /transl_table=1
FT                   /translation="MGDLGSIDDAFDAALNLEESHIDEGWEDGLREGEKLGLIDGREVG
FT                   FAKGFEIGQEIGFYSGCHAVWSRCVGEDPGCFSERARRGIAAFGDMLRSFPIDDPLNEE
FT                   ILETLNQVRGKFKTVVALLGMHHEYNDAVGDQPTVTF"
FT   CDS_pept        join(complement(550754..550827),complement(550300..550624))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639208"
FT                   /orf_name="MICPUN_63078"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70548.1"
FT                   /db_xref="UniParc:UPI000199C63C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ87"
FT                   /transl_table=1
FT                   /translation="MNNLDKIVIGFNAPYAVMNTLAPKQAWEPIMPGLFDGGKTGDGAE
FT                   KLCRFCGVISAASTAATYVVAKSGNDELKKQMRVINGATMIGSAACLSQFDEDKDFNNS
FT                   SFAKPFKYGNMALQIGIGAALLKDGLGK"
FT   CDS_pept        join(complement(556834..556921),complement(551068..556670))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639209"
FT                   /orf_name="MICPUN_106342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70549.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR013989"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C63D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ88"
FT                   /transl_table=1
FT                   /translation="MRIVAEGVEALAAACAGGHLEKVEELIAAGVDLNAEDSIFGTPLV
FT                   AAARGGHTEVVAALLRKEEVLLDQHSQRDTPLTAAVNGGHMECARMLLERGSAADKALA
FT                   RIPQLPDDGKCAHGHRMPSDDPLTLACKRGDVELVRLLLRHGSDATGGGEGTCDTPLTA
FT                   AAANGHAHCLREVMAAGADVDAVARWAGRTALVAAAESDSQSALECCEILLEGGADPNF
FT                   VSSGVVGRRLGYGAVHAAAARMDAAMVKMLIARGADPNRRAKNTDTKEVKSRRAAAAQA
FT                   LWGPDIAGQRLDNTPLHLAVAAYINEAAKRRVAENAKKRAEGGDSDEGDDAAEDDSALD
FT                   ENERFDTPAERRRRRNLHARAMDQGEPGPGEMAAMRVIEALLDCGADHGAFVVDSTPMH
FT                   MAALGGALDVVDLLVKHGADVNACAPNGCTTPIEAAARYAADIVVDFGEERDELSKPVA
FT                   GKSGAGSNKRNKTDSSRHSPGSDDSAETTEPTTKRRARSDVASDDEEVFSDDDELRTFV
FT                   DDAAAMEALRDAAGPLRAVKHLAGKGANVTPAVMVGACRVGDEDCVATLLGHVPGGHDP
FT                   NVEAAEGLKPFGGITDTLLLWKELVSAHARNTTPLHAAAESGNVAIARMLIERGAQVDT
FT                   RRSEDDATPLFLAARCGRPGMISYLFSKGADIEALGRTSDRREGHDTNVTPLVEAVMSD
FT                   HAAAAARLIALGADVEAPTSWMPPLLTATLRSNPTIARMLLDEGADPRVGVGGMTPLGL
FT                   AVMTRQSDLVKALLEWRAGPEQEGNLARMMLDDDDEEEQTRGRKKKKNETGAATKAGTR
FT                   APDKVNPDETIDAAVLDDGDPDGPGACQCPVCQRRSGSGLDPLSSPTCLPSGDKAPWPP
FT                   YSGERHLTPLAAAAKLDDAETVTALIKAGADTERMSGGMPPLAHAAGKGSCSAIEALLD
FT                   GGAILESAASLPLVRGDQRMLTPLGVAAEAGELAAVKLLLARGADPNGPPGAGIEPPLC
FT                   CAVTDPPDDDEGNPVVGVVRALIAAGADPNASKEDAQSPYSPLMVAAGAGSVAVVRELL
FT                   AGGADLEHVVRVTVGDSGGPRGGPDRKCQITALLHAAYCNELDAVRFLLLQGAKLGSAD
FT                   REAMSLVCDHLRSKAQHGVPDAGATLSLLRHQADDEAFEEEEKAEQRLREERARAAELK
FT                   EERKRLRQEAAKEAEVEAVKKAEEAERLKEEEEKAEAERLAARAAKQEAYKKEQEARKA
FT                   AKKEKEAKAKAAKAAAKAAAEAQAKAEEEENRRVMEEVQAMVSDLEIKRKAEDAEREAR
FT                   ERAEREAAIKEEEERERKEKEAEAAELERKAKQIAKDAALVRGKTGKDPKGSKVDLSTA
FT                   AGAKAHLLARDEAEGFVGPPTKVTKEDAAEAATWAQPGGFFVFLCNDSTEEECYERAMF
FT                   GAPAKFWDQTVDSVKPGTTLILYNFAARTLTGPYEALDAPKWNDVPDAWQGGRGAPPGR
FT                   RLISAFPVQVAIGASPLMEAVTATLGGDFRPSMGGLPLGSPDQSRRDIIVTKLRLAAKE
FT                   QGVDCPTAAERRRRPNRPAASSGLAPRLVSAAGGAADKADNAAGEQPERRWPGDASSDD
FT                   LTSMAGLSSDDGVARAKSSVAPNSPGASPGKVIPAPISPGGSASPTAKAPGTSKKAEKK
FT                   KKERERQSTMKTVPAPIGLVQNGGGSPAPAESRVVAPSKASIAPAAAAPIGAATVVPIG
FT                   AGLGVGSGAIGGVSDPFASAAAGTGKSPATVGVVGGGGLGGDYGGAFGGGWGGLGGVST
FT                   NPTGVSASSAAHATQGANDSWNPLFGGGGGLGGGLGGGLGSGSGLGSGGALGGGALGGG
FT                   VGGVSSAGAGGLFGGSGLFGAPAPNPFAQRSPSPAAAAPAPPGFAPNPYARTASVDRGL
FT                   GGGDDAPQFSQAEQSKLFPWLS"
FT   CDS_pept        complement(557230..562080)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639210"
FT                   /orf_name="MICPUN_63076"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO70550.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199C63E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ89"
FT                   /transl_table=1
FT                   /translation="MGSYVRNYERSVPRAPQPGVSKALDTLRHRPRAPLADAALNAPST
FT                   VPMPPTTSHLEAAVELTEEDQGTEDPTVEDLAVRVAVRARPLVAKERLERNRECLAYPS
FT                   PTTVVLGKNRAFHFDEVFGPDSEQTRVYDNLVAPLVDACFDGYNATVLAYGQTGSGKTY
FT                   TMGSAALSAGADDEIGVIPRVIQDIFAGIRKRQGVSECTVRCAFLEVHNEEVRDLLHPD
FT                   VTTKKISVRERADGAIVVSGIRECEARTSGEMVRLLENGAVSRTTGGTKMNEQSSRSHA
FT                   IFTVILEQRHLTREARRRHRGAFSSAKFHLVDLAGSERNKRTGASGRRFKESININSGL
FT                   LALGNVINAIADDQERRKQDLGPRHLHVPYRDSKLTRLLQDSLGGNSRTCMIACISPAD
FT                   ANLEETLNTLKYAARARNIRNKPVVNRDVQQLAAVVDPSSSSGDDAFATGGTPSGVDDD
FT                   EVRALRLAAEGAELELAAARSELAAVSLAANVAEEEAIAARAERDAATVAVERMEHELV
FT                   GALVVASRLADAGQLTRPGLARIAATAPESARDAAGAAGARIPPVTAADKAAAAVALAS
FT                   PSLRTVVAGDGDDGCESSSFVVVGGDVANDDGPFIANNLRDSSHPTPGRSVIEGYLREL
FT                   RDLRQTLASRDEDVAEKDAKLSEAREDLERDEAIFAEKMREIKQLRRAVKDAERERADQ
FT                   EERHQREVAALMAAHAAASETLTGLAGPLPPAPPVLPKTPPKTLSAGSRLPHADTHDGA
FT                   DVHGPSFAVPPAAGFPEPNVEELHAMNEKFAREDAEKERLLREKEQIEREKAKVEEEAT
FT                   QRARQYQAEKRSLERQLRELECNIVSKEELIADLERNEQEAKSLTQRYESRMRALEEEK
FT                   KAKESEIERLRVELENIDGNVAKGDEEKRRMRDEYEQKVALVQTQLQKLKSERTAGETL
FT                   RLEKEATKSTAKVRELEGEVTRMKGLQEQLKRRLREREDRHVSAQEQQTNEIAGLRKQS
FT                   ESQNKRIRELEGVKERQRAALKKKTEELAAAQRKLHALGLDEGSQGVINPAHHPGDHSP
FT                   RSPGHASPFQGSDTPTGGRMGSARGRAHAYSERVRLGKGGPRLRNGTTNTSEGHASTPS
FT                   SRPTSAVGSTSADVEALRELIDAETSRALRRREGEEELARLEAKRAALARDRDECVKER
FT                   DQLALKRERARAQMDAERAALTRVLDSLDDAVDAGDISPGKAAELRDRRHAAANRLVTL
FT                   EAALETNRVLPVDDERLLRELDDRIDGVEADLEYVAEAQAEAAADGGSVASTSRSETTN
FT                   GNQSSMAPPTNLTTTRGGDAGLTKLIDRIAGMDGREARTALQVALDKVVELRVQERAGQ
FT                   SRVAELEIQLGDAQSAIEEMESGLRMKEMDYDRRVTELQREHSRKEAYLMRLTEAAAAA
FT                   TTTTTTHSKHVESTNEPSPGGVAATLFPEPLTPDFGLGTPVAPGSRSLFELKEQQIAVL
FT                   SNQGEELKEQNRDLRRRVKALLAEREEMEAAGAALERRLESAGRANRSLSEQVERLSDA
FT                   HRRDGRAFRASPTPSPAGQAGDVARGVGSDVVSSHTTPRLPERPGLPRTPGGSAARARR
FT                   AASPVEVEAARMFPGGYPGAGGSAAGRKKAAGVADKR"
FT   CDS_pept        562446..563300
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639229"
FT                   /orf_name="MICPUN_63075"
FT                   /product="Type II secretory pathway family "
FT                   /protein_id="ACO70312.1"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="UniParc:UPI000199C63F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ90"
FT                   /transl_table=1
FT                   /translation="MDADTVDAVGQAAEVLVKTSNEFNVPGILLAIGDATGQPVNLVVF
FT                   ALTIATLFAFWVLTRCLGFGGGGGGGSSNTGSSSGDCVLITGACGGGKTAMFQTLRSGE
FT                   VFLDRTVTSMDVNEARIEVRSEKLGKSKRARLVDLPGHPRLRAKLDRYANGAKAIIFVV
FT                   DAVDFTSQRRAVAEHLFEILSHPVVQKRRCPIMIACNKSEKITAHPADFVRKRLEKEIE
FT                   ALRTTRGTLEDTGGGESVTGSVGLDGAEFAFEHQRSNKVEAAGCAVAGNDLESVREFIV
FT                   RRG"
FT   CDS_pept        complement(563441..578866)
FT                   /codon_start=1
FT                   /gene_family="HOG000215158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639230"
FT                   /gene_name="HYDIN"
FT                   /orf_name="MICPUN_63074"
FT                   /product="Hydrocephalus 3-like protein "
FT                   /protein_id="ACO70551.1"
FT                   /db_xref="HOGENOM:HBG557858"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniParc:UPI000199D597"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ91"
FT                   /transl_table=1
FT                   /translation="MGGGAGRGEKGDGPGSPRPPTLRNPSHVKYKAYASGDGPGATSRT
FT                   QTLTRKTATQHLKDLRDPPDNLEQPRQRPEIVEFLNMCDYTHQVVSKVDVDEPLFQPFP
FT                   PSIEYHKYEPFRTYEALLWFRNNDYVPRRIKIEDPKNRHFTVRRMRGAKGERLVEEKGG
FT                   PGGRPGDGVGKIAPGMEVAFKVVFAPSDKGDYAVDLVVATEREKFIVPVRCVGNKPALD
FT                   FPDFVRFDPTPVKQWGHVVKTVRNVGAKTARFRLFAPEPFTVSPAEGILDVGECAQVRL
FT                   GFRPEACGIYEGELEVELGDGLAPISVGLKGEGCEILAGLAQGEVEMLPTFIHKSSQRT
FT                   FRVVNHSDVPVKFEVKKLADSFLEEEARTRVVSQFGETLTRSLGGSHDDLRRAMIAGRR
FT                   TRGEGDEGCELSSEDEDEILGAKAVEFATRTRGLDRALLADNLHFEHPDFTCTPLHGEV
FT                   VPGGECEVTVRFHPKSSGRRMATAYVDVEGREDRLPLVLKGHAVGPIAVFTYDALEVGD
FT                   VFIGAVHQYEVELVNRGEVAAEFRLVPPEPGSRAAVDFSFEPSAGVIPVGEIQTVIVTL
FT                   CSDTLGEFDESFEWEIMDGEIPTTLDFKGKVVGPAFTVDAQSLDFGVVGYGFRYTKDFT
FT                   VHNGCEIPMRFSLRVPGDAKGEFTCLPSAGTILPFGKQKVELELISETETRYTTTLDVD
FT                   VPGVGKSLHRIPLAAHSKVPTLELPAGTLDFGPCFIRHKYTRTITMKNGSRIPAKFVVE
FT                   PQDAQSRGLCAWDCEPASGSVDAQGSLELTFTVVAERLGLINLPATITTVGSSKPPMQL
FT                   LISAHSRGPTLGFSQKPDDPDSVWVPELKWGKVPVLRDESKVIYVTNKSLIPADIRAFV
FT                   QDPDSAFFVDAREKTLEPGEEYALTVTVHMDQLMVHRDELNVMVIEGAPFMIPLTAEGI
FT                   GSLTTCADLDGPNAINFGPQLKDRPFHREIVVTNNARKLQQLVWHNITAEEKIKEAIKK
FT                   RAAEEDAQESYLQQIGVKKKEKKPLPTDGELGITFSVTPQQITVAPKSSVVFTLSGISE
FT                   YEGDVIETLVCKNTAGSHREAKEVMTIHASASVAIPLMNFSKDTLAFEFSHDPDFENEV
FT                   QEQPVTMRNVSEVTLRFTIQMNPPFDVEPKPDWELEPNEAATIRVSFDPDYRGDCQSHE
FT                   VRDKLLVCYDDNPHVDSIDLGAELSFPNLDLSHSFIDFGSVLNDTTKREYVTVRNTGSV
FT                   PARFEWVFETYDDADVDEDEPTVVEKMMHEGLNKAKRVKARRSKRDSNTPLKNADPEQV
FT                   FDVLPIRGYLQPGEEERVEISYFAQAHSKVRAVAVCEVEGGPAYDVELTADAHLIKYEL
FT                   NTTSIDFGRQTFDKTINKEIVLTNTGRVKIPFRVNTKSLSRQALLSVTPKEGEVGGDDA
FT                   CHINFAIRPGIPEKIDECVTLEVAHFEPIRIPITGEGIYGCVAMSLPRAMSDEYAVYVE
FT                   EARILLLTRGYPNPNLPPMCRDGVPEPDPMLETFVPEDTKGATLGKVTGTIVGGTLKKT
FT                   GAGTQLALSKRQPTPTGRSRFLSKAPFNSSRPRGLGEIWMKPRTYKEDDEEDPDLVPMM
FT                   GTMATVEDEEIDDVSLLGAGAKRRKKKKYVPTRAEIWHEADRLWMMAELLEREREREER
FT                   RAQRLALTGSELEPVPPPGSPPAAADGGLTPFYRHVPRQKPLTPEFYPEKPAFSQTGVL
FT                   YPPLGTRTGPPIPGGRGARLVTPRATSRATMSRATSRGASRGGAEPVKPVTVARYVVDF
FT                   GDVVKGAALSKRFTVQNLGDGDMMFAFDKKDLEKRGFRVYPEYMPKLSGQPYCQTTEVT
FT                   LTLNTAMEHVEEGAMEFTLPLNVTGGPQALVTIKAVVQVPGLSANVETLDFGNVQVGHC
FT                   KWAYVQLHNDRSVACDWSVKKPPARIKRDGEPEKPPDVFAFTPSRGTLKPGERKNVKVR
FT                   YMPNGEIPKGGFRKQTCIVVEHNPVMTVITTVGQAHELLVRCDPGPSLDCGSVMPKDEN
FT                   DGEEEPEPDAPAEESVEPEVDEDGNPVEKPKVFRKPKKFTEQAVWLVNDSEVDVCVYLQ
FT                   NFDTQHLVDEEIIRHAAGLKESPMLLLPPRVGALAAEEEWAKLVEADTARKAEEEAAAA
FT                   AENAENVEPELDEDGNPIPKPEGEEGGEAAAEPEPEPEAAAEDENADEAEPKAAELDLY
FT                   VPPDDSTCILVTGPAYSLASETALELAAKYRVPKLDINECVRAAAEAIGDLGLRVRTEL
FT                   GLPRILEDDSDDEDEEDADEAEAIDAPLAEEGDDKPEGETAAPEAEAPAEGEEGEAAAE
FT                   PETPEELVHEDGKLTIKTLADVLERVIFADYVDGFVVDGVHCEFAASPLATVKALTRAL
FT                   GMEKSEPRPPAKPDDAGDDWEPPEPEEGAFVLHGRKKLMIVSLEVDDGVAAKRETLETR
FT                   GDEPEPEPDAAAAADDTPAEPEEAEKPPDGEDGDEAPPEEKFELSEETAAAIAKHREFV
FT                   QTLLPLFGASHVTYPDNCARVYEVVTDECEDSGAVVDVATGGGDENPNPMPIPPKPLDY
FT                   IPPAEVFQVITRPKEREAKPPPTKFKVLTPSVQPKYPHARKPPTPEPAEGEEGADGAEG
FT                   AEAEPPTEEEPKENEMLSNTRWNIPAGDAVQVIVRFESPEVGDFTEYLAFECVGGKKVE
FT                   TLECRGRCDYPTISDDFRNVYAAKKTKASQRPPDHLISHQFIIAKPVPELKAPGKFEFG
FT                   PLLNNWPVPEPPPPWEEGMQDAKGDPIPDPGPVDPHGHHRRANIERLRITNNGLHDVKV
FT                   KFRLKRPVDDDGNELEEPGDLPIPGVDVFKFEPEEMTLFAEETRELIVTAYPKGEHEWP
FT                   PEPEPEPEDEAEAAPAEGEEPPADGEAPAEGDPPADGEAAEGEPEPQDGDTAKATAKNV
FT                   QVSAFPKGPCPFTIHDCVIVAEVEDNPGKFEFPMSCVGVTPTAVMSVDVDEETGISFDR
FT                   VIAGAKEERKFRIKNTSLLPFRWKLELPAEDCPTQFKFSELEGELWPSREHELSVTFTS
FT                   EEATEAIEMNTKLVVFDMQGPKDKDLQPTPLFRDEEGNPKPITERELKISAEAFVIAVD
FT                   IKYPGDPPDGEEKVSALDFGLIRANEEDDAQLKQSFTLHNTGKYPVTFSLSNKAKATKD
FT                   LFAVEPAEGEIEPGAEVPIELHFNKAVEVEEGVPGKRKIKREVHLTNNGDLHLSVVDST
FT                   GVRHDKIPVKVSIRTSYAKYALTPSRGVNFGPTMYNTESEPRIFEISNVGDFPFDYNLF
FT                   DYGSRGSADAELEKDEDGNPLPPPKTEGGELELGAFVLKPPAGTIEPGEKATIEVVFKA
FT                   EDDRTFSELCGVDISGRDPSDKPLGVVYPIAGESVIPGIAAEDFRGIFEEHKLVVSLDP
FT                   SMLETNAFDTTSKVFSFGPVLANLSGDEEAEAEAEPVLDENGEPLPKLPTGGVKANFRI
FT                   SNPKKVPCSVDLTLAPKEEDGGGDGGKFPIEVHPASLDIPPHEHRYVTVYFDPRAISSY
FT                   SATLDAVVRDGADPKTKQFTCEVRGDGTLPHVTVEEPADIAEEDGLPLVKFPKMLLGRK
FT                   MTRPIVLRNNGILPAVLRAEMMTHKHFSIEGGGVTTTLEPGCSRTLRVTFDAGKTKGEH
FT                   AHSVRLAVKQNAYETQTVKFVGVGYMDDVMFADLPRDLDDELRFDDGPVGEPKSVTFKL
FT                   VNTSSFHYRFEWPEPLAEGEPAQTDFSFAPRVGHVHAGKTKAVTCTFTRSTAVAHDAVE
FT                   LAATLARIEYREPKPTPAEGADPLPEDYVPPLRAPEDWDSDVRVAKEVEVGGPEDPDVE
FT                   RDEEGNPVNPPPEPPELAEGEAPPPREMKTVMVPAPEVSHELVPAPEPVEGSEEGSVEE
FT                   VQSTATLKVFAVADDARFSCETSNVAFKATMMLQRRVHVFPLKNEGTARLDFKFTIEPD
FT                   AGPYVVEPAAGTVPAGEESQIKVIFAPQEVVDCKRTLRCEFLGTKLDEGMEPLAIPLNG
FT                   KVLRPWCHFELGESDYLSGGRRMPNLPGPSTGAIAAGTKTVECTSLGTHVRNTKRFLVL
FT                   NPTSVAYAFRWAPVPAAGAAPPVPAFRCLTPEGVIAPGKRYDMVFEFVPEVEGTSEAFF
FT                   DFKIDEQSISVPFLFAGTVVEPAVQFEVSSVNFGKILTGTKNREIVALSNHENTPFAFN
FT                   FDQSSWVLPDGSNPRALTFEPMSGTVPANGILPIHVTFAPDTEKAVNYNVVANVKRKPT
FT                   RLTLNVKGEGYGIHEVMEMEPVSTTDGNKAQTLVAAPGKNVCDLGQVLIREQVIRKISF
FT                   RNEGEIKFDFAWDTGTNPRVKVSPEFGTLAKGEKANITLTYSPINPEQLRGYQVTCGIV
FT                   NGRKYVFSLDADGHKPSLKFSQHSHDFGACLVHQPGLPPRRHTLTVTNMDTKEYSIDCI
FT                   FDSTEFPFLHVGDSPASLAPGQSADVDVEFFPDQPKHYKALVPFSVNGLYTVNVVYTGE
FT                   GVPMRLELVKPEQNSVHFGHVREGHSETREIRMVNKSRLPVTCVVDKQCLEDLAALGVT
FT                   PADGWNGQTPVMFPPRQANGISFKYKPSRRGPSFDEELKLLINGATMPISLTRLRGGSI
FT                   GTEVRLATDTMSFGTVTLGSRVSKKLAMQNTGDVGVKFAFDAKAAEPNFSIKPAEGFVP
FT                   ANQDVQLEVWFHPTEEGADVRADKIKCQIGSKGAGSAEPLDLTLTGACVPQEAQEGKVE
FT                   FKTTVRQTAEGAVSVTNGSNRTWNLRPAVTGDEWSGPEFFEVKPGATAEYTLTYRPLSM
FT                   ATEEEPHVGSVLFALPDGSCLLHALQGVAEEPDSMGSVEAEIPARKPGSVRVKVNNWLN
FT                   RRQRFKVTVEIEGADPEKPDPTVTLKGPDYFDCPASAEREYKLGFFAHKEGTTKAKVTF
FT                   TNEDTKEFAHYDVTVTATTADVQGTLRLHGACRQKATATVKVVNPLPEPVVFTSKCDHP
FT                   CVTVPETLTVPANGSALCEVAYRPVVCEPETTLPFVLSSAELGDVAHTVSLSSAPAPPE
FT                   RGVSFVVPLGQREVKSFKFTHYAEPESQTEYACEFQRAAAGGSSEAPFACAATHVAHGA
FT                   GDDGMEQSLEISFEPSAVGSHYRDVLVVKSDAGHEYVCPVTAKCVPPKPQGPFKLSGAG
FT                   GSVNFKNVFDVETEFTMTTDNPWFTVDRVATVGAKAETQVAVKYGAPEGWEEGKDAPTT
FT                   GKLLVTCKGSPAPWVYYLKATP"
FT   CDS_pept        join(579475..579576,579928..580296)
FT                   /codon_start=1
FT                   /gene_family="HOG000039891" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639231"
FT                   /orf_name="MICPUN_109273"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO70313.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG588578"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI000199C640"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ92"
FT                   /transl_table=1
FT                   /translation="MAGLTLTGSFAGAQLRVPTPAARVSAAPAFNVVAKKKWEKQELNS
FT                   NGNPVRAKLHVKTNDKVVVIAGADKGKVTEVVEVFTKSGEVLCKDVNIKTKHVKPKGEG
FT                   ETGQIIQREFPIASSNVMHWSEAQKVRSRVGHKMEGGKKVRYLKKTGEVLAN"
FT   CDS_pept        complement(580644..582506)
FT                   /codon_start=1
FT                   /gene_family="HOG000239611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639232"
FT                   /orf_name="MICPUN_86858"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70552.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319376"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021940"
FT                   /db_xref="UniParc:UPI000199C6BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ93"
FT                   /transl_table=1
FT                   /translation="MALRPGPAYKFPWEDMGSFKYLLFVPFVATAALGLDDADNWAYHM
FT                   LVIAAIRYVHAQFWISLSRIHAVTQHTKIQAKGIDYKQVDREDHWDDYIILQAIIMTLV
FT                   HKMPYLGYNNFPQYNAMGMWQLLLLHAGPTEFIYYWLHRALHHHTLYSWYHSHHHASFV
FT                   TEPITGSVHPFMEHIMYTANFAIPLVGTWAFGGASIAMFYAYLIGFDLLNNIGHCNFEF
FT                   MPQWFMNIPGVKYLIYTPTYHSLHHSKVHVNFCLFMPIYDYAYGTNDPSSDELYRKAIN
FT                   GEAAPNKAPDVVFVAHGTELLSLFHLPFALRSFSSKPFKSVWWLQPFLPLCIPFVALLR
FT                   IFGKPFTADRHRLLHLNTATWVTPAWGFQFFIKSEFNHINRQIERAILEADATGTKVIG
FT                   LGALNKNEALNGGGQLFVDKHPNLRVRVVHGNTLTAAAILKKIPADVKEIFLTGSTSKL
FT                   GRAIALYLSARGVRVVMYTTAKDRFEKIKAEAREEHRELLVQATTLEEGSGIKDWVVGK
FT                   FCSARDQAKAPKHATFHQFVVPPLEESRRDCAYTDLPAFKLPKEAKDFRSCEMTMERGH
FT                   VHACHAGALVHALEGWTYNEVGAIDHTKIDVTWDAAVKHGFALA"
FT   CDS_pept        584196..585203
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639233"
FT                   /orf_name="MICPUN_109272"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70314.1"
FT                   /db_xref="UniParc:UPI000199C6BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ94"
FT                   /transl_table=1
FT                   /translation="MVGLTKAAKNQQLYRATFDNDDRKRVNSTKRKLNKKKRDDLKAQI
FT                   EAGDPAAALKREAIRDQLRQRKTRSRERAKERQQLERQGAGASQQPEGASDQDARTVPA
FT                   PVPPRDGLSVAVREPQRVFGDLEAKVYDGVKVDEAWVTAARYMLEKHVVTTGHNREVEG
FT                   RRTRYAYVYNRNLKPQWNGRKGCEHIEKLKFLERVLAKRATMHVGNVEVELEMMIAREY
FT                   TGGPSEDEVVHIHTDMVYDGEKPDRREVVSVVFVLEGGFKESGYDVRIHGEDAKGKIEL
FT                   YPQLETGDQLFMAGGEFGVAHDVGFFGNPRRQEWKKRLTIVAFYAVGRRSLTPG"
FT   CDS_pept        join(complement(585876..585927),complement(585605..585671),
FT                   complement(585327..585447))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639234"
FT                   /orf_name="MICPUN_63070"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70553.1"
FT                   /db_xref="UniParc:UPI000199C6BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ95"
FT                   /transl_table=1
FT                   /translation="MTYGRISGKTPTHVLYRSSALMSRGYIHGHDVNCLPECFRHYFII
FT                   WVQVCVGIGEVHNLDVRVTARVLCAGAGADYGDI"
FT   CDS_pept        588302..588931
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639235"
FT                   /orf_name="MICPUN_109271"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70315.1"
FT                   /db_xref="UniParc:UPI000199C6C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ96"
FT                   /transl_table=1
FT                   /translation="MGITEGEIKAAAPGTYKTHIDQISAKGNKTVKDAFAAVFRAKVEG
FT                   AKPASAADRGRVDKIMVGASKGGLANIKNEQVTVAVVTNSDGQVLTTFQGSVVSHPPGT
FT                   FSIVVGLTRQDNQNARQELRGWIEKANEDLEKEEETSELKADPISTNFPKLLWRFYAAT
FT                   FDDEGKKQPSLQDVDWNGVPQGIKLIGREGMEGVLSFKALPPMQPR"
FT   CDS_pept        590324..590728
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639236"
FT                   /orf_name="MICPUN_63066"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70316.1"
FT                   /db_xref="UniParc:UPI000199C6C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ97"
FT                   /transl_table=1
FT                   /translation="MDDYLADDERIGRLICVAIDPAGKPLTSVPNKSRVCTSPRRLWKA
FT                   GIITQCTIVRGRKVYFVHKGDFADWETAHEVLERNDRKGIENPHFSDYLDIIKLEKLGL
FT                   VKYLDEEEWPGYSSQEMGTTRHTEGACAIC"
FT   CDS_pept        join(complement(592192..592244),complement(590793..592047))
FT                   /codon_start=1
FT                   /gene_family="HOG000265304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639237"
FT                   /orf_name="MICPUN_106336"
FT                   /product="PAF1 complex protein"
FT                   /protein_id="ACO70554.1"
FT                   /db_xref="HOGENOM:HBG594818"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="UniParc:UPI000199C6C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ98"
FT                   /transl_table=1
FT                   /translation="MDPIKIIRDHVVNGTIAKSTNDDTFIYVDDQSFYRKGQTNYKTTR
FT                   GYLTVEAVWRFARVFAADPDKKHAEYMKETIADKFANVSTLDRKDLWAYLSGEKDSSAK
FT                   IDITMPAYVVPEEERRDDATMAEADDEPAVHPLHTRNSILQCDKDFSAVLGFFGAKQVD
FT                   KKKREREQQVVPLPTNRFGDVKEEQFYREAMGKDMLEMGIDPNMSFLDNKRQRLPQMSE
FT                   ADRLRGEALLGGGTRTGTQRKVSSSNKQQRKDPVAGQRPIIIVPAGYGSKVMFNMYNAP
FT                   EFLAKEKLVTWESMHKAGEKKHSSITLKRKYKRPKSKQYPEGHVKYEITDKPPDKKDSK
FT                   SWARVVAVFVSGKEWQFKDWPFKGAEEGDLVETFNKVRGFYAKYDVDTPAEVIKKWNVR
FT                   TLSFQKNVRHGDRAQFEAFWDEVDKHLELKRSQLKY"
FT   CDS_pept        complement(594482..595315)
FT                   /codon_start=1
FT                   /gene_family="HOG000063194" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639238"
FT                   /orf_name="MICPUN_109269"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70555.1"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="UniParc:UPI000199C6C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJ99"
FT                   /transl_table=1
FT                   /translation="MTCTALNGCVPAFAKRVPLKRLDRRAVGSAVSKSLFFSAPIRSPR
FT                   QMSSPAANAATADGAPKKKVLVPVADGTEEIEAVTVIDVLRRAGAEVVVCSVEDEGRVE
FT                   VTCSRGVKLVADVNVKDVAGRNAPNDWDLIAVPGGMPGAERIADHIKFDAVLKKHFMAG
FT                   KLMAAICAAPAICFEPKGFLEGYAATAHPAFVDELGGSLLEKNIYADSRVVVDKTVVTS
FT                   RGPGTALEWALCLVEQLYGQEHCKKIAAPMVVQPANARIRGKLEWRLDEAPLPAE"
FT   CDS_pept        595549..596370
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639239"
FT                   /orf_name="MICPUN_109268"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70317.1"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniParc:UPI000199C6C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA0"
FT                   /transl_table=1
FT                   /translation="MNMINALVAPQAVRAPLALRRSAKTGSKTRAAAVAPKIVTASSNA
FT                   PIGGDKKKGARGEEAFRLQALGKNPIVNAAAGAMDVIPGDYRIGGVLLGVATFLGPVCH
FT                   LWTQFGIHGFLGAFLAFQASRVRFRFSDTDLDVVFIEPGADDSTALDVDTESSGDNKLQ
FT                   GGGANKWSFDSVTNWEFWFPGFPVLVYYKENQTRPEGQPHFFPIIMDGKKLYETMLAKM
FT                   PESVNKKPLVSEWNLDTAFESTALGRKIKESLSEEQLKQLKDTTGFPGLDK"
FT   CDS_pept        complement(596492..599116)
FT                   /codon_start=1
FT                   /gene_family="HOG000265303" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639240"
FT                   /gene_name="APC2"
FT                   /orf_name="MICPUN_96683"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="ACO70556.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG557865"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI000199C6C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA1"
FT                   /transl_table=1
FT                   /translation="MAADAVASWKAYVAAADADRGGYGDECALLVRRGLGDVVVAHFLE
FT                   SAEREFAAVHLPRLKALLENHGAANISRTLSTAAEKVGNAGDDENEWSWVDEAVPRGVA
FT                   ELAAAVDERRRRAARLAAAMHPSNKNDADDATQTLDRRLCAAVGAATATVGPREMTGVC
FT                   AAYYARALKEFSRRARRARGLGDDDDSEEDDDDRIVIDDDAMEPTRRRPMPAWHPSCED
FT                   VMGVAWSRALASVAGGLRAVGGGEGGASDVAEAALHRALETAARVKVRDVAAGDFDKKA
FT                   LPSLLRWLDATPLQFARCALGLDEAGTAEWRGRLEYAIYERLGSLRIDEFFNVIVEFPD
FT                   SLPAVDDLRRCLRRTTLHDRLTSSLRGALQRRLLIPGAPTSDIIEQYRLTIRALRALDP
FT                   SGVVLSVVSAPLKEYLRERKDTIRCVVTMLMGARDGADELLGADEDDAMDVGDGDGSRL
FT                   IAAPPEEWEGDPEFEADEDGRDGGAGRPDGGGGGDGGADGGADGGTDGNAPRRRAATGR
FT                   GWDAWEPEPVESEAASSRGRRRPVEDELGHLINIYGSKELFINEYRNMLAERLLSKVGY
FT                   DVTREMHTLELLKIRFGEASLHKCEVMLKDVLDSKRINGNVKAPPAPGTPAARDTASTN
FT                   ILQNSPLDATIVSALFWPPFANEAPDFKLPAEMKNMIDAYSKRYHHLKAPRQLMWRPTL
FT                   GTVEVEVMRGELELQLSVSTMEAAVLSHFQRKDRWGQDELAAEMGINRATLRRKAVVWI
FT                   NQGLLVEEKNEGPDGSSYRLTTGDDGRVAFGAAAADDEGGGGGAVASAEDQAAAGMKVY
FT                   EQYVIGMLTNFPSLPPDRIHNMLKMFVQDPPYDRSLDQLEAFLGQLVAEDKLALEGNQY
FT                   SKR"
FT   CDS_pept        join(599420..599536,599567..599905)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639241"
FT                   /gene_name="SELM"
FT                   /orf_name="MICPUN_112677"
FT                   /product="Selenoprotein M"
FT                   /protein_id="ACO70318.1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014912"
FT                   /db_xref="UniParc:UPI000199C6C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA2"
FT                   /transl_table=1
FT                   /translation="MRLLALALALLAASTAPSVDAARHLRSSDTAEHIGRAEFYPELKR
FT                   FLKVEVEKERAYPGVGVKWERGHPVTLVLYDELDKEVERHNMEGWEVDKVRDMLHARGF
FT                   HKKAADKLPGVKIGFNWLGSKSGEADRSNHRTQPLATAGLATALKVG"
FT   CDS_pept        complement(600137..604024)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639242"
FT                   /orf_name="MICPUN_63059"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="ACO70557.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C6C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA3"
FT                   /transl_table=1
FT                   /translation="MEIDPGHHFGADLTNQTQQVRETALEPSGEDPFPERFQNKPRVPT
FT                   PAPTSRDLTRPSPTPPIRSQHLQAVSDAKGGTDAMAGRMDVARLAALLHETTAADASRI
FT                   AAAERELSAAADHAGYAGALLQCIGAANAPEAHAAAVAIPAAAALHNFVRNRWPNRLPS
FT                   QQERESTRMAILQALVVAPQGPIVKLLAESFRIIVTEDVTRAKCWPDLLPALCQAMQES
FT                   NLMVGKEQSPVKTANALVAVHTLLKPYKYFQNPGSEKEAAPPELEAIVKALLEPLLGML
FT                   GILATGTLTAAAAENGDPTAAAAQHNAANQPGNDALLHTLLKCFHHTVAAYMPAAMVPS
FT                   LQRWLEVLTKILEQAPTFRFEDERVHAPRGKAVKRVIQAMQSLVTRHRRHVDKFLPAVC
FT                   THAAALASALASRRLSSGGDSPTPAVQSRQCALCFDLLARVSETAPGYKLLAPNFGRLL
FT                   ESAVYPALCAGAEDEADWEEDEEEYLQKNLPADSDDPTGFNEELYAPRQSAANLLGLLA
FT                   ERGSAGVSSGGGGNDGGKRKKGGGGAAKAKGKKGVSSTPGDVALRYFERFQPPGAPGAP
FT                   NDPAAQSSYFGVLVAYGALSKWMANHGGKASTSTLARQRILPVLAPGAVDSSTIAGCAV
FT                   RAAACWALGELSNTGALPEEPTHAALLAQLVDPVGKTQPALRSAAASAIAASLHASCWP
FT                   KNWEPLLTAAAAAVNDATSEEEENDASSLRALRLITVAAEVAPEHCGAANLANPLAAAL
FT                   ARAASSRTPAPPATLPPVVETALEALIAVAQAAEETAEEDEEENDMDDDAASGGGGPPH
FT                   PSLVSLVPHLCAALRRAWLPTAWGFDAWNRGGQTDMEGEPTGAPVACCMGDCSRLLSRA
FT                   LRWCPDAASGDQVQLAQLVAAHASLLPEWDAWEEEEEEAALEVLDDVSASFKRGALVVR
FT                   DVNAMRPLFESYGQFIGTAIDQAPALGCARACRRSHALMALAANVGGDASAGVARKILG
FT                   AATDRLRGLVSPDLPVARPLVLAASGALARGVGPAPGSLSPNVASDWASGVARTLVTSK
FT                   DDLSASELIVLASSSLRALGAAGAGAAEAVADASARASAAESALRAVLGLRDLRASGGE
FT                   LGAGRRNAEEEDTDDSDDDSDDDSDDGSDDSEDFERDSDVDSDSDQEGSSPPVDEETEA
FT                   QFLARYAAEARKLAGADDVDPDSGDVEDADDGSELELDGVMMGPPGSEARALLNWLQSR
FT                   ATAADLGALAATLQAHPVDGLSNGVSNLQTVLSSIPQAAGAGAGGGNGSGGPSASSGSA
FT                   GVSMDFGGLAL"
FT   CDS_pept        604238..605830
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639243"
FT                   /orf_name="MICPUN_63058"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70319.1"
FT                   /db_xref="UniParc:UPI000199C6C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA4"
FT                   /transl_table=1
FT                   /translation="MEVQEASPARSPRAAVLSILRSKCIKHFDFVHEYLALLAWNRCIL
FT                   TLVCLSKGGKCTVRTTIDTLMTRGFSRLHLVWVWIYVVIITSLAAAAVRWSVKAAINQE
FT                   RANAERRFAQGTNANVSSSQTSLHDSATAAATAYRGKFRHNLYKKIAAAFTYVCMWAWA
FT                   VAVLGTLPNDSLWEDAVSVVALSLIFAWAMKAGERGAGPLRGLLRRERPRYDAPEGTHP
FT                   PGPYDDAGEDVSDVVRLGVARCCEWILAIAWVGTMRHAVDVAVASAAGTTTTSASAAWN
FT                   LSAAWITAAVAVGGRAAFVVSRFSVGGGDEASGGDSSKATYAALLPEGATSDANHNNPT
FT                   NPNNPNNPTNITRLGSHAVFRLEPGLRVAAGARDMLSGAFAFTTGVALNAAAQYTWLGL
FT                   SDNLSMGATGSAMMYASAWSLGTIAAASYGAVCRIEGEEFNGLAGGCFAPPAGTRAKGL
FT                   VTRLCDEEEKVGAFVAGFVWNTAMMLWIGFENEERYRWTLALAITMFSAAVNLFAERAE
FT                   EAEEDAGDGDEES"
FT   CDS_pept        complement(606201..607463)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639244"
FT                   /orf_name="MICPUN_63057"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70558.1"
FT                   /db_xref="UniParc:UPI000199C6C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA5"
FT                   /transl_table=1
FT                   /translation="MSITAAQASEGASPVPASAPLVPARDKRSLGPSQDGCAPPCCSLW
FT                   TLNAIAAAVHGAWFVVFILLWRFDTREDGERRDITYPLWVSHATWGELPQPPIPPLLAT
FT                   AIDRLAADDLALSRFDSNAGYPTCEPPRSAKVGSMPVSPAAEDTGLVLSLHWLVVSFFA
FT                   LSFAFQFAAAVFDLAARARRRRHRRIVIGDTSADVARADDTNDSETRESVSAWLRFVEY
FT                   GFSAAVMIVAIALQVGLMDAWMLFALATLTWATMMLGLAGERILVVERRIRRVVIGLER
FT                   RDGALDPEACPGLEMSVERSLPMARWATHLTGWVTQGVVFVVIIAHFFQSQGTCEFDGT
FT                   GEDNVAPDFVYAIVFGELGLFALFGLTQMCQFLSHDYGWCVDDDGTSTACCSVEAAYIV
FT                   QSLVSKTLLGWLVYGGNFAPN"
FT   CDS_pept        complement(607626..608777)
FT                   /codon_start=1
FT                   /gene_family="HOG000021224" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639245"
FT                   /orf_name="MICPUN_96682"
FT                   /product="Predicted protein"
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70559.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="HOGENOM:HBG649489"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI000199C6CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA6"
FT                   /transl_table=1
FT                   /translation="MADCAHLLLRGTLPTRKQRRDFQREVRGHRLVHEHLIRFFQGFNH
FT                   DAHPMAILVSVVGALSAFYNDDHDYRDPAKRDLAGMRCVGKMATLAAYSYKTAHGQPIV
FT                   YPRDDLNLAQNFMYMMFALPTRPYDLDPVACRCLEVILMLHADHEQNASTSTVRIAGSS
FT                   QANPFACVAAGVASLWGPAHGGANEAVLAMLEEIGTVDRIPKCVARAKSKTDPFRLMGF
FT                   GHRVYKQMDPRARLMRDMCHKLLDHLKIKDPLLDLAMELEKVALSDDYFISRKLYPNVD
FT                   FYSGICFRALGIPREMFTVIFAVGRSVGWIAQWIEMAGEEVSRISRPRQMYEGAPERPF
FT                   VPLSERRREDGDEETDDSRPDSADDLHHLGRMLSVRIANSHGA"
FT   CDS_pept        join(609483..610123,610264..610764,610838..611032,
FT                   611176..613183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639246"
FT                   /orf_name="MICPUN_63055"
FT                   /product="Predicted protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70320.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000199C752"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA7"
FT                   /transl_table=1
FT                   /translation="MGNKQSHPPNVCASPVSANPTQPKLSERDVTNLSRLYGHDNELLQ
FT                   LMYAAELLRDCAKCVRDDARSYFLHAQHACDKQREFGARLRTLAERAERSTKGIIHVPS
FT                   GNNATPGSSSAPVPEAAVVAASPPSATSLEQPFLEDDADSHPLDLAQPGVTEPLLEEVL
FT                   GTTRIVSRLANAQMDGAERYAQFVAMFTHKLDEMARKVEKAHSMKLERHAPSALAHEKA
FT                   FNHITAPESRLRHLMHLPENKRNDDVEKKIDMAEVDLEKRRAQLEATSRMLKRRAKVFL
FT                   NKFTPHVTDAVRAFTLCQHRARLENAELLENVVAADPVERLRTVEHSRERCAWFIDTED
FT                   SDCPYVALDASVSSPDVTPPGSGGDAMNGGGASRTERSLAAEQTAGDAPQMSFFKCLEY
FT                   QTTLMVLTHLLFGVCVQIRQFHRVAVQCVSCRNIQSTATRRFRRDKHLGFINLVPTKRT
FT                   IHNNRRHPATHAPPPGLVPSPPSTFTVAMEKSSTRATLSDAPWHPHLVWWCRMGVRYGS
FT                   LLPLFFLGVLPLARVGVTCVYAAFVGLTCAMPFMVTLAWLTWREFDHPAPATRREPRAG
FT                   EPHPPRDPSAPRSEEEEEEEEEEEEEENDVGDATAPVRTVAVIGGGAAGLAALRQMLAH
FT                   GMDAVLFERTDDVGGLWDYASPERSKVFRNVLQNVTKTHNRFAGHHPPEDWPIYLGHEH
FT                   TLQYLRSFAEKFGLMDRVRLRSEVTSCVETANGFELVIETEDTQPATQKTSPRAEKRSR
FT                   SIRAAQSAAATTTIPSTVRVSRTEVFDAVCVCTGQLAEPSVPDDLINLKEAFTGAVVHS
FT                   SEYRDPRDLAEARVLVVGTGAASGSDIAQDACALAESVTVSVRTHRWMIHRGLTQGAPT
FT                   LLARTCSAMPAWFGSLLALYADWVPFFFTPGMTDSRDFLNAVALGRITLKPTISEVNGS
FT                   TVTFTDGTSKDFDAIVLATGFKRAVPFIHHALRPTHRGLYKGTLHPRRPRVAYVLFVMP
FT                   FGSHFQCAELQASWIAKVWSGICPTPSIEDMERHADPFDVDASHAKLGEHFRMRYLVLM
FT                   FREMFPLVEWARAGQWARAWRALWARYADPIGEWDPASAEGGGRGNEGHYLRAKMAPIV
FT                   WRNIKFI"
FT   CDS_pept        join(613324..613396,613520..613614,613743..614243)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639247"
FT                   /orf_name="MICPUN_63054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70321.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C753"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA8"
FT                   /transl_table=1
FT                   /translation="MGCLSSKPAESEPTRGAVKVQEAALTPEQEALMELHSAVRWNKID
FT                   EVSAILSKGQDDDFAKATANKKDGKNGNTALHIAAQNGHLDLCKLLVSKGADVNAQNAG
FT                   GNTPLHMVTSYDIDDVKAYLEEQGANGGVKNQEGFQAKFGLNGEKDPTSLAGILDSFRS
FT                   AREEKSLLNALDALRKIKGQLDKGTFPGIGLKVKKANKESDAWTEKVQKKFTELVQSLE
FT                   "
FT   CDS_pept        join(complement(614888..614977),complement(614457..614789))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639248"
FT                   /orf_name="MICPUN_52528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70560.1"
FT                   /db_xref="UniParc:UPI000199C754"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJA9"
FT                   /transl_table=1
FT                   /translation="MGRVEDVTLPARFITTAAHLIATLTIVYDSSETVKRALGSDLSDY
FT                   STELTSLEGMAYTSIFFFCVEFLGMFTGVSLFMPSANVFYIFAHFFGALFTGLFVTLQW
FT                   DLQAYPWMFTLFSFFPAFTESVIAFLVLRLNIMQFK"
FT   CDS_pept        615125..615892
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639249"
FT                   /orf_name="MICPUN_52527"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70322.1"
FT                   /db_xref="InterPro:IPR007914"
FT                   /db_xref="UniParc:UPI000199C755"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB0"
FT                   /transl_table=1
FT                   /translation="MPRRYIYADEDKDDDELIWDALGRGSAAGRHLYNLYNGNTDGKRF
FT                   GNMQSAYNGEVESRKTAEERRLPMDVEEAIKRDEAFLRSTTLKRWQVNVPGGFTGARKP
FT                   TEDEELRLKFEAQRRAGQSRKPEATIRREMRADPDFNGTSRAPKPSKPLLGEAEKRRLQ
FT                   RLREFNGRPPEVVRPQKLSERSKVKEQPRRKTQREQLEELFEAVVGEIEEREAFLHEMR
FT                   AHGRGDRYEHAIRAEIAERVNQLRGLDERLNAA"
FT   CDS_pept        join(complement(632234..632365),complement(616130..632137))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639250"
FT                   /orf_name="MICPUN_103424"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO70561.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199D598"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB1"
FT                   /transl_table=1
FT                   /translation="MDDPVDGDVWDDFGQKVDLTARLREILLNYPEGTSILKELVQNAD
FT                   DAGARTVKVCLDERSHGTETLAYDGLAQFQGPSLLVFNDSTFKESDFESISRIGDSVKR
FT                   TQVGKTGRFGVGFNSVYHLTDMPSFVSGRHAVFFDPHCEFLPNVTAANPGKRVDFVAND
FT                   VFSRHPDQWAPFVAFGCDVRGEFAGTMFRFPLRTEAQARRSRLSKAHYTPESVRALLLA
FT                   FAREKTLDMLYLKNVETVEVLEWGPGDEAPRVMARSSLRVGDAVEASEIRRNRSAFSRA
FT                   SAACAQGVAGEPPKVFTVSFDSIGAGAYAETTGGAVGDGDQTGTRTFVVSHALGADLAP
FT                   LVASGREKFGMKLVPWASVAAELGTDPSSTAKTVGRAFTFLPLPVRTGLPVHVNAYFEL
FT                   SSNRRDIWFGGDMAGGGAARSEWNQALLTKVCAPCYARLIAAVATMLGPTPAFYALFPD
FT                   VNVPEPWNGVVRELYATIAFEGSKVLHTPADDGGWIALADAVHPDHELAHDDALRDALV
FT                   AEGMRLTDAPSTVLERIEEHAVPNPERVSPERVRRMLRESGRSERSHRPRDRVLVLLRY
FT                   VMSDVIDDDPASAASLEGVPLFPLADGTAAVIRPGGVGAPPLYVPGAEEARLVARASSR
FT                   CVDRACDETIVARLETLAGTRALNVSPIDDDAIVDLMPDVLPTAWARVGDAGESSSRRA
FT                   YQPVPWDWDDDDDTAGGGISAAGISDEYLALVWRVLGSVASDTRALGKLEGFPLLPVVC
FT                   DGAKGSKKYVVPLGAPLIDATGVSADVAASMRAAGVHVLDVGTLAGSTAGVHPAMRDHP
FT                   AMAGYLAPASAAGFADAFARAVGCAASEGTPPWSPTFTREEAANLRGFVLRRRWFGRGA
FT                   GSEGPDFDAANPERIASLASLRIYEAFPEPTAGDDDDDDDDAPGKRDPPLLDLVSAPLQ
FT                   LAPRRGTDPALLGTDFLNPSSDEESAVLVERFGVERLTDQKFLRQRVLSRLDRIRPARA
FT                   RNDAMLDALRRLPSLCAGDGSLSRAVAISPFVPTASGTLAAPTHLYDPRIPELVALLDR
FT                   NTSFPTAPFDDDATLGILASLGMRSTVTQTAVLDAAMTAERLGDVESDAYDFAAANERG
FT                   WAILRYLETPDGTRMLAPDPVKDVKSFFGSMFGKEDEKDGGKKEGAELPREAFVAQLSS
FT                   VAWVPVATEPPESEPGLPWPKNLSPVAAPNNARPPNDAWLCSATMRVLAREPQSSALAD
FT                   ILGWRRGVPAATLASQLLALGEAHPSVEDPAVGRALAAAVPRVYALLTTSLNSRGFADA
FT                   IARLPGEARVVWVGTGFARAESVAFSGALDLKPYLHVLPADLTCFRPLLTAMGVRDAFG
FT                   ASDYVRLLRGLAKDAGGGGLDGSRLDLALWVLGTLADYPPATLRTALVDEDDAVGSAGS
FT                   SDDAVGSEGSSLPVPDASGALVPASEVRFNDAPWLAPPEGVRLSHPKLPSQTAEAVGVR
FT                   SLRLALLAEASEDIDVQLHGSAEAFGQHEALTTRLKHILDAYADGPGVVSELVQNADDA
FT                   GATEVRLLLDQTRGGDKSLLGPKMARWQGPALVAWNDAVFSPEDFHNIARIGQDSKIDR
FT                   PAAAGRFGLGFNAVYHFTDLPSFVSGDYLVMFDPHATHLPGATPARPGLKIAFGASPLL
FT                   SQFPDQFAGYIDTFGCDLTASYPATMFRFPLRTDEAARASEIKPEAYTPAQVRALFEQF
FT                   RERATQTLLFLKNVRKIGVYERGGDSRAPKLVYEVSIPAFQDDKDPRAATLQWVAGNSA
FT                   FSRGVAPVAAVKKQQFVEKLRTMPEKSLPTSVGWMDVQMRAAETAESLGEEDDDAKVIV
FT                   GTTIRRERWLVCSSLAGGKARALALSDTGVSRGLVPWVGIAARVPHPDDGESFIGHCDG
FT                   RAFCFLPLPVRTGLPVHVNAYFELSSNRRDIWFGGDMAGGGAARSEWNQALLEDACAPA
FT                   YAKTLEAAAEQLGPTSAFYALFPTAPSHNAPWSLILPPLYSNLSRIPCLRATDPFSSPG
FT                   SEVIARWVAPAAAMFPDADKPTPPALADALRAEGIWLVEGAPKDVCESFARHCEPDAVR
FT                   RLSPGAVRAILRRRDVPHPALDSRKRVLALLEYVLSDVNPADPMGAADLEGVPLVPLVD
FT                   GTLGRFAFLGSTEGEPKRRDGEPKRPPSQASKAKRDRGPTYLIPHESEMELLREWAGDV
FT                   LVDRTLLCGGEPWDGGDSLTCLARLERISLGPAGAELNVRNFDGDALASMMPRIMPRQW
FT                   AAHPSQRVNGYVGCGRVVEWRPNAKEGHPSPEMLVLLWRRLAALCGENLSAFQGWPMLP
FT                   IGGGGSLAPLIPHGPVVRGEGWTENTRDALLAMRVQSLDEGDVSGAIVSHPKIGDYVRP
FT                   ATAAGVLDSAVAAAALDPDVAASVPADASPEERWRAAARAVPEALASNATLGAAPNRRA
FT                   LRAFLIQKRWFARGAPGGTVEGARLDLVRSLPIFETYQSAASHHKDADSTEGFVCLASV
FT                   PPPLLAPAGADEDLLHPPFLRLDGESEASILETHAGVVRVTNAAMLSDGVLPALARGQL
FT                   HPSTAPRALDAVLAALSDAKASWTGAGDVERLTRSVCANACVPTPSGALRRPDELFDPR
FT                   VRSLRELLDPREHFPAHPFDVGARVEALASLGVRRMLGGEGLVASALSVEKMAASNFDV
FT                   AAAVARGRALLAHLNALAAATAKGGSELPPPGAVFQRKDDDDGDGDGAGSNSVWRELSS
FT                   IAWCPALTQPPHPAMPWPNKGSSRALPPLAAPRATRPPSDAWAASSCMRVLDLTPPASE
FT                   ATSRKAETETETETVKEIPEAVADQTTSSDADQTAPSSADRATSEEAFLEEERESAERA
FT                   TETTLREHESLKPMVLEPLLIDRLGWNRLSSTVVAAQLLELGKSNPSVQPDSDLARVIG
FT                   EELPWAYAKLAETAANGGADLDAAGTILGDSRWLWTGAGFVASADVAVDCPGDLRPYLH
FT                   GVPTELAAHSALLAALGVRRRFSPEDFARAASALAKDAGGAALTEEKVELAAALAEAAS
FT                   EALAPPPNVDGNVDGAVDGAGSTYPSVPNAARVANTVAGLFALPDHVGVMAPAAELVNN
FT                   DADWLLEGARGTIRLVHPSVSQATAEVLGARSLRDMFAVDKRSTDRLPCPSAQTLRRLL
FT                   PMYNDSAFFLADVAEVADAAGARGIEVALDANTYPARSLLLPQLAAFQGPAVTVKFTGA
FT                   PLQPEEIAQLLSAAAPFKLRRRVVRFGNGLVTACHVTDAVFAVSAGRLCVFDPTGQALG
FT                   GSKEGGSDGSAKSYSLDGGELAARFIDQFAPFIAAGADPAGCGNCTVIRFPLRTEDQAS
FT                   NPKALAPVASANDAESMRDVLATFAADAHRILLFASSLTDIRAVCRRETPLETGDTPTG
FT                   PTAEGDGGEGDEVLVGEEVLVDVRLTSPPPRRSSSSGAEKPTPRSIIDDKEWRRATLTT
FT                   LFGGGNSTRTAHVVTLTETAGNSPPVTDTWVVGAAIGVGKARDIALDRKSSSQMLLPLA
FT                   AAASHVARDGAHVDPASPPPPPALARLEALAARRFAAGGARVATPKPGRGVCAPLPTHA
FT                   SKRSSGDDDGGYGADGLLSVARTLERLPAVVMAHFALERGGGRGLAEFLDDPAASVGGG
FT                   SNASRPPAPDATRREWNRALCQCLAAAYGAMVGHARVAPSPELPADTFYSMWPLAERVG
FT                   LPAPPDLDPDGRPVTGRASAGAGVVGQGKGHPVAELVLYPVYKELVDQPLFRSLGSRAL
FT                   VKASDGYFLPAGFAVNEGVDGATWAPGFNGSSRIVARPLAAGFIARHFPVLDAPAWLRP
FT                   ELAAAGAVTAARELTASALRRLLRAKPPPADVRTHVELVECACSDIDPGPVPGPGTSAP
FT                   PSPSRQGTIPAMFGHARRPAGDGPPGGDAIDGIMSVVNEMFGQAGIAPPSNAASNAANA
FT                   GPPLDLSAVRDLSGIPVPTASGAPAALGHQGLYSGSENMVALVPTLRGKFLHPALTTSP
FT                   TIGALVRHAQFRSELRVSVFTPAQLATELPNVLPRRLTPAGCGAAPVVTWSDGSLAQGE
FT                   RVPSARWLRAFWDEIAPQGPVAVDAFAAWPLVPIRGGELVRVGHRAAVIVPPAPTIHAH
FT                   PLSPDPLDSSVLSHETLDDTVDERDVDVDVNERDDDVTFARPGSNQPRASPIRDVLFGS
FT                   PSRAGLGSPARRTDVTAAKKAVEDEWTWLEPMFRTVGAPVLDWDAAGEACARMLDQSVE
FT                   TVRGASIRTASDVIAFKAQQIRACLGAGRPSFALVDEETRGAVFSLFAASHVVSGFAAS
FT                   EEGLEVIRSFPIFATVAGDRTDLTSGEYVTCPPGVAFAETLRSFGGLLEFKDDAREFYK
FT                   ALGVPELADADVLARFIAPSLEKLNVPGRTAALTYLKRHWPRLKESEPLCDALRAARFV
FT                   EANGTDALMSPGNLYDPEVELLHAVFRGQTGAFPAGAWLDADWLNLLRDVGLRSTVDAT
FT                   LFQLCATRVAARAIGLGIAYPTEAGARRYPPVPPAPTSADLALAQTTTADSDDSDDDFN
FT                   DEAALDKEAGLVIAAGAMLANHLVDNIAHLYTANVCEVVLGVPFVPAALGVPGEPGPGC
FT                   AGCNVLTSFSHAMLPEHWASVFMHLPVLPPDFVPPQFARSRLRVKSEPGASAVAAHLVS
FT                   LGASPNEGGGVAALGRWTPAAGDPCVAVAAALAVLGDLGGVDALEAREIEALSDASFVP
FT                   VAGGASTEAPRRLWLRAPAQLAPLAFELPSSLTEHAGFLRKLGLRDELTPADADAALRV
FT                   AAKKANGRALGPNELRAAVAALRHAAGQVDGGGFEISSSSSSVAAQKGVAAPRRREGTT
FT                   PVPDSFGVLAPSTSLFHAWGAPRSLLQRLDRRKLRLAHDLVPANACAAAGIRAVRDAVF
FT                   ERRVVDGSDVPDDVPDDVPDDVPDDVPDDVPDEHVGPDQSPNESRVPTTRARWTSEGGA
FT                   EWPEAFAFAAALARDDLADALHAVLRARGCAVSTREALREKLRDVSGSFRVVDSLRTGL
FT                   YAESDGGGCFDVTLGPPATTHAFLDASTGTVYVSPPDNPTARGSLASPLLARAVASALG
FT                   VGDDGTATAALVALVQAAASTGEDPKAMESTTAAFGGNVRDDSSSRDSDVPVDTAHGDD
FT                   ASAASARGDPGAVVLTRDARLLAARPLRPLVAGETCAIKSVRRFGSPGEAAAAAAESRA
FT                   SSSGGVATNEDRYVYARVVSATRPVKGAALTRVLLESGPGGETREALSSEVFTFRLVSE
FT                   LGPDETGAGAGGGSGRGGPEATPTASRDPPQTDAVTPADPGVESASPTSHRADSGLEDA
FT                   SLGTNPVSSDDLVRAVRDLLTAAGAPPSMAQADLLAANQRLRGELEDVSGAVQAAEKEI
FT                   AEKESHATRVEKAFLCPITQGIMTDPVVATDGHTYERRAIEQWFSQGRLTSPVTNLRLN
FT                   TTTLVPNHALRGAITAHASRSGGE"
FT   CDS_pept        complement(632730..633659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639251"
FT                   /orf_name="MICPUN_52526"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70562.1"
FT                   /db_xref="UniParc:UPI000199C756"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB2"
FT                   /transl_table=1
FT                   /translation="MNESQNNGDVYFLVAALSPRRGSRHPGGPRPPVVSALPSARFRPD
FT                   ADRIARRVVPAHPHRERVGALPHRRHALGEGRILGVVPRGLQRPAKLNRGRLHEHVSDE
FT                   HLPVRVAVDVDAHHTRPAIGPGRERDARGAHAARHVQAHLEASNLLAVTDKHRRARLGR
FT                   RGLLFLDARVLFELVVRVYNRDELHVLDGIRENFGRVLVPIVHRVAVHVHAVAREEQLT
FT                   LLRARVVVMERVEGISGGGFLVGHDARDVDARALSSHLGDDACAGSRRCASARGANARR
FT                   RGGQGPHGAHLYPKPRLTSPVPLARFPS"
FT   CDS_pept        complement(633694..634341)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639252"
FT                   /orf_name="MICPUN_109266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70563.1"
FT                   /db_xref="UniParc:UPI000199C757"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB3"
FT                   /transl_table=1
FT                   /translation="MRAALAIATGVSPDDVAITPHQRDDWRANEMGFQIGIVRYPAGYV
FT                   ASDDPKVLAPDTLLERLREARRDETDAGFLCDGADGFDAYGSMNILAEGRAEESKDAPG
FT                   TYEVKIDDFGTDPEFMPLGQRYRECERAQKRKYSRLKTKAFRSLHQHVEGEFEPFVKED
FT                   RKLIPQSLLDRIRDINHLDVRLHAFATELFEERMKESVNELEREKLPARLPI"
FT   CDS_pept        join(636336..637288,637403..637736)
FT                   /codon_start=1
FT                   /gene_family="HOG000281219" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639253"
FT                   /gene_name="CNX5"
FT                   /orf_name="MICPUN_113992"
FT                   /product="Molybdate synthesis cofactor 5 "
FT                   /function="ATP binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO70323.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG535305"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C758"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB4"
FT                   /transl_table=1
FT                   /translation="MREAGQDGAASQKRKREDGLKWCSPGQDSLGLNDQLSTHELERYA
FT                   RHMSLPGFGIEGQAKLKNASVLIVGVGGLGSPAALYLAAAGVGSITLCDGDTVEVTNLQ
FT                   RQIIHAENRVGVAKAQSGFWSCKALNPCVNVKVELRGFTKDNAFDLLSNQTVVLDCTDN
FT                   VPTRYMLSDACAALAIPLVSAAAVGLEGQLTVYNLHPDTPCYRCVWPKPPAAGDCTNCA
FT                   RGGVLGPVPGVMGILQALEAVKVIAGLGETYAGRMLIFDACSAARPFTVMKLRERDTDK
FT                   CTACKPFGSAYSDVTQFNYEKFTAGTCAVAPKSKLQDDQLYRMDTHTFSTYQKKTVIDV
FT                   RPRHLSQTAMLEGALQIPLSEMEERFAEIKGHTKKNDEEWVIVCVCSRGNDSQLAASWL
FT                   RSKGLNTTDLIGGMEKWKKDCDPTFPRLV"
FT   CDS_pept        complement(637820..639076)
FT                   /codon_start=1
FT                   /gene_family="HOG000241005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639254"
FT                   /orf_name="MICPUN_86885"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO70564.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG664737"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C759"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB5"
FT                   /transl_table=1
FT                   /translation="MVSRERTEALARSFAHPEFFFHEGGHGVPLSKEFRDALRSFALNP
FT                   AVNAATTTQLATSVTDERCHRSPLAIVHPPLSKPRHSLAPTRFLFVNGVGPCVGVSTEA
FT                   VRESFGEYGDVDGVDMFDPSMARCVVTMSRVEDAIAAQAATHETCRPDLGDRRLWVRFS
FT                   SDPNATGGEPESRAKQEETWCAATRDSATLGVPGVTLITDFVTEEEEREMLACVDSDER
FT                   WQGLAKRRVLHYGYAFDYGTRDARDKTSPMPAFVAGLLGRAASCGAPGACESVHCDQLT
FT                   VNEYVAGVGIAPHVDTHSAFGPTILSLSLAGRAVMEFRLHEGGEKEPRERRAISMPPRS
FT                   LLVLHGEARYRWLHYIPHRKRDAIVGEDECEAREERRVSFTFRRRREGACGCEWPEACD
FT                   SREGAAQRLKDREGRGLAS"
FT   CDS_pept        639810..641261
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639255"
FT                   /orf_name="MICPUN_103420"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70324.1"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="UniParc:UPI000199C75A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB6"
FT                   /transl_table=1
FT                   /translation="MEDAQELDAREYADADALVAAAATAASSSRDGTVTLTNLRVTHRK
FT                   RRGQRQFWVTAAPPAGGLEVHMSFRRADLDDGRREEDAAMLWETDAHAAAFEAATPGAI
FT                   IARASGTLEAPRRQILEDGHVEGTRRCMWCGAASCAGSSPGRRCPAAAPVLRCGRIEWA
FT                   RTSPDGDDDDSGADAWLVFDMAFDRDMNAAEHGALSRQVSMCVAANRRARRPFRIAAIS
FT                   PNEADDDLAAVAPSSSSTTIESDSPSFVVSRDDAADPAMGRNAWRRLPWARWGATCGGP
FT                   RTWRRFDPDRVIYLSADAADTLDEIADGDVLVLGGLVDHREKPGMALDRALDDVNAPIR
FT                   WRTARLPLGGHVRLLKNAHLPCLAVCQLLLLARELAGDAVALNDGLAAAERGGGGREGR
FT                   DGRRKTRSGGDERDVHEKDGEMEGGSMRGVWNVAISSCPAFRCAPLHKYVVWLPPHDAL
FT                   NGERRGGARNRPSGVTDVRALVALS"
FT   CDS_pept        641488..642684
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639256"
FT                   /orf_name="MICPUN_63043"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70325.1"
FT                   /db_xref="UniParc:UPI000199C75B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB7"
FT                   /transl_table=1
FT                   /translation="MEHHHVHETAAWRSESTKELSHLWDLRMAAAFALGSATVVTHGVV
FT                   TRRRRRALQAEDDGGDDSAYEADRVERASLVSGGSSLALKDLGVPEGARSDEKVPPSAP
FT                   RTLASRARGAMFAIVSALSTTPHVVKLVDIALFASIAWGIMYVGHDKLCGVVMRCECNF
FT                   PWAGGWSRCNAHNSVGGPRCPWCTAPYWVSVLTQKSCAIVMILAYAVGFGAASNTPNRA
FT                   ASSCASCVDASRASCVATSRSGSCVDGCVDGCGSSAPLLFAVARCCEGLTTSRDLRRRE
FT                   EGREAIVGDSSDKDTGSGSGEDTGSGSGSGEASGKRRSATSALVRRIVVAFAVWFCVEM
FT                   FWQALFWLWLGAAQDPVYPCFLICWDSPSRPGNNPPSPLSMADAPPMRRFYDDVMSLG"
FT   CDS_pept        join(643295..643393,643543..644598)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639257"
FT                   /orf_name="MICPUN_92132"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70326.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199C75C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB8"
FT                   /transl_table=1
FT                   /translation="MPRASEAQKADRRGDVLPMRASSDDGYALDNTQELTFVDKAKRWI
FT                   DDNSVEVNAALNVLIVGSVAFGAIFQIVEVDSDISTGWTAWEILRNIPRDNLEAYQQSV
FT                   FDNPLPTKALTSGVAYTLGDFTCQLSQGKKITTVDLKRSLRSGIAGFLIHGPLCHYWLM
FT                   WTEENLSFDGALWAIPVKVFADQTAWSLFLNSAYTTCIMSLQGMGPERIKGEIQATWWN
FT                   AITAGWRFWPFVHMLTFSPIIPQDFKLLFVDCVEVVWVTILSAAVNRDSEKALQVPLNA
FT                   EAERPGVQLTEQMDSQFASVVDGVETQFDPAKLPSNVSGSFEELPAGDTCLIGVASFDD
FT                   NPRSAWPRRSAWPARSAWPRVPESFDSGDFIEAAVEEREKADVV"
FT   CDS_pept        join(complement(645475..646002),complement(644719..645390))
FT                   /codon_start=1
FT                   /gene_family="HOG000245066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639258"
FT                   /orf_name="MICPUN_87372"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70565.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG322402"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C75D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJB9"
FT                   /transl_table=1
FT                   /translation="MLNIPRQCYVCKCRYRRLHSFYGSMCPECAGVNWRKRTQTADLRG
FT                   RVALVTGARVKIGYRIALKLLRCGAAVVATTRFPVDARGRFEKEPDAKDWLHRLTVVAM
FT                   DLRDLPGLERLCAHLASALPRLDVIVNNACQTVRRPPAYYRHLLEAEAEGARRYLGSSR
FT                   WRASGLLAGVGAGGAGWMAPSAAASQLELIETDSIAGAKQFPAGVLDVNGQQVDLRDKH
FT                   SWTMRLGEVETPELLEVLAVNAAAPFVLNGKLRALMEQTAAMGPGENADGAPGRAFVIN
FT                   VSAMEGKFYRYKTANHPHTNMAKAALNMMTATAAADYAASGIYMNAVDTGWINDENPLG
FT                   TAARIAKQHSFQTPIDEEDAAARCVAPVLEGIDEMLRLGKDAPVPPFGKFFKDYRESEW
FT                   "
FT   CDS_pept        646988..647260
FT                   /codon_start=1
FT                   /gene_family="HOG000100807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639259"
FT                   /orf_name="MICPUN_63040"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70327.1"
FT                   /db_xref="HOGENOM:HBG557881"
FT                   /db_xref="UniParc:UPI000199C75E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC0"
FT                   /transl_table=1
FT                   /translation="MPASFVYQKRTKIREGADICEQKCKRLACEIQVCISRLPVNKSRV
FT                   SGATIDHSRCQPDIDRYNKCCEFAKKALAEQEAKSASSTEPNDSA"
FT   CDS_pept        join(647331..648118,648370..649102)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639260"
FT                   /orf_name="MICPUN_103416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70328.1"
FT                   /db_xref="InterPro:IPR014953"
FT                   /db_xref="UniParc:UPI000199C75F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC1"
FT                   /transl_table=1
FT                   /translation="MMATASASVASAARAQPSRSSRKQGRRAIRVYATSDDDSKVETKE
FT                   KFTNAGAFKALDTLGADAKSKSKSPFGGGGGVASSSSSDPFATRLGFVPAVPAGPPAGF
FT                   IADGVDRASLPPKNDADRLLNRFDRDQRSGSLAPESTPEGSPWCTHPPLRASCRALAAS
FT                   SSRVMMGICAPDAENGLLALKAWTADLGLPRGRLHGLDVDGAPVDPPPGPVFIKYNSDS
FT                   GDAFLSGYGGEYRGVLFTPELGDGAFRQYGYLPLDLPKGGESLPNSRKIVEGVPLYLFF
FT                   VAMLFQLFVYPHFAWSAWRFTGYDERWFSQGWGSDPMGEAKQHERVWLYAMFGFMMKDM
FT                   WIFRNDVLFFLHHGIALAGVLVFFTVPAGLGQFLVGGTVLEMGNLTYNIVLLRGKDSGP
FT                   HVSPTVKHLAEVLYAVGMGVSNYVGMRMFLTFTQYEGLKGTNWPWGLGVMWFALIAGRS
FT                   HVHLSRSWPYFAERLGGKGKGTVDQAPAVAEVRVTRASNKLRVNPARG"
FT   CDS_pept        join(complement(650789..651817),complement(649253..650575))
FT                   /codon_start=1
FT                   /gene_family="HOG000265661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639261"
FT                   /gene_name="GWD3"
FT                   /orf_name="MICPUN_86905"
FT                   /product="Alpha glucan water dikinase "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="ACO70566.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG557883"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199C7F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC2"
FT                   /transl_table=1
FT                   /translation="MAHMQEMVASRVAEASKSAESGMARQLFRIALSTLPRGGGNGDDI
FT                   RLGILQIMRENGIKEGHRPGIEDAFIQQWHQKLHSNTTVDDIYICEAYLHFLHTGVWED
FT                   FWTYLWDNHGLTKDDLAEMKAGWRTEGIHGPAEHLPHMIDPMKHFLWILKITHGGGSMD
FT                   SAMDFAHGVLPGDLQYEIRDMLDNRDAPWVPNKIVELRERLAGVWKYGPDCNRDVVLLD
FT                   IAMEKFYRQRIEAMNTAGMTADDKLGALEAAVRNVCIGGDFDRMQMALEFLRKANGPAE
FT                   ANGGLVRWSAEWGKAMDAALDNVALAMEHHMDELCSYAQRPAYSIGLNAEVDFAYLDNF
FT                   GEELGGLEDIPPGVTAVITASPVDLLSHIAIRARQMKVLLAAMPDPGGWAELMSMSSEG
FT                   VKIDIVGEEVIVKKSELGPAAAATVAGPPTGQYIEGLTITPSANCPVWLVEPKDYADGI
FT                   VGGKSKSLSNLGFSTTLSTYAMMSETMRGGDLTVPTSNALPFGSFEKTLRADEDTLEKV
FT                   AVATAAVAAADDAGDADLRRDALDVLRDIIVYRLKMPADLKPVLEQAIVSYGGMATVEG
FT                   VWRAIKKVWASKWNERAYLSRKACGVEEEELCMATLLMELVPAEYSFVLHTANPVTGNQ
FT                   NEVYGEICVGLGEALVGNEPGNALSFTAQKVKGFPHDVRSLPSKPVAHVAQANTRTIIA
FT                   RSDSNGEDLEGFAGAGLYDSVVVDEPELKPVAYADEPLIWDAEKRSAMIRKLAELAVAI
FT                   EVEMKSPQDIEGCIVGENFYILQSRPQVLH"
FT   CDS_pept        complement(655170..656540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639262"
FT                   /orf_name="MICPUN_109264"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO70567.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199C7F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC3"
FT                   /transl_table=1
FT                   /translation="MSALKEEDARLKARVAETAGDVERSERQAAADAEVARLRSEMSEL
FT                   SAKAEQLEDALAAKEDLVAKIQGEIPAPAPAEPPAAEPRLFEQPEDERFVVVSANAARL
FT                   EVLLRRRERALAELQRLETDGATVSPVLQSYRHEIQQLDAEAAEVRAELAARDEAVLEL
FT                   RGRLDVELNLLARESANVRKRLLESAPSTGMPAMEPEKEQRLSDTLDKLQTDLQTAEAA
FT                   STAAFERLDRSIGAAAEVSTGGGKLMPCKFDIEFVTKPGQTVHVVGTWCDWDVKRGLEL
FT                   KWSEGHRWVGTMPLKPGFNYEYKYCVLERVERKQPGDAPPYWPDYGFTEPTCITYKPGE
FT                   VAMVVWQKGNNKAVALDSNVVNEGIKHVYCKDEWIPDPMNSPIQLIGEDGEVVQTVGST
FT                   KLLAQCVNRADEALAEARATMEEVMRIASETLGAASMFGRIDDDEDDDDEDDGIDRV"
FT   CDS_pept        complement(670515..671183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639263"
FT                   /orf_name="MICPUN_63034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70568.1"
FT                   /db_xref="UniParc:UPI000199C7F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC4"
FT                   /transl_table=1
FT                   /translation="MAVRPARAPWLAASSSSPALHVRPRPVRVGPVAGALPGSSAPRSP
FT                   AALGSTVKMSRSLAARIVAVGGMTKPDHARSTLRMFASARDDAVRARLVRANRRAAWTR
FT                   RRAPTIVTAALPRDDEGERREISRRGPDGSRAGGYPNPAPGTLRKKQNAKDVTRDGIAA
FT                   TAVMYAFAAWQWLQWPAGTPHPSFVPAPFHAACIAAAATGLIAPALAAAAHPGANYGVK
FT                   "
FT   CDS_pept        complement(671658..672956)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639264"
FT                   /orf_name="MICPUN_63033"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70569.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI000199C7F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC5"
FT                   /transl_table=1
FT                   /translation="MGGVTEAEYARYKAAKAYPGYRKMRKRIEAQLRRTSTARMGWPTA
FT                   QRSFVFVLRVCVATLLLPFDILTGNAMESGDYARPAMGVFGLSLAYGTFRYVTRGGPNG
FT                   STLQQRATPDRRRVHRPVEIPHWANPCNLEGLPGAAAVCPQHAEARGRKRLYVDVDEGA
FT                   ANGASTRSPAVYEVHEAPDGQRVLTVDGEVYTSYDTRNGRVGHEYARAAVRIASTWERR
FT                   TAGGATQTRVLVLGLGGGGMVSGIHHRCHARSRSRHRRGHDGQSGCIITAVEIDPRVVR
FT                   IARGLFLGKKEDDGVTPDDKNIHESVAFVEQDAVEYVRTRARFGAFDVVIDDVFDSSGA
FT                   RPEDMKRRDFYADVYRRLSHGGVYVVVVPAPAWGPGRGWRDLATSAGNMRAVFGKGNVR
FT                   VVKTGPYVPLFPQRQLVVGTKVVDQRLLDSKYG"
FT   CDS_pept        673158..>673703
FT                   /codon_start=1
FT                   /gene_family="HOG000247843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639265"
FT                   /orf_name="MICPUN_87244"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70329.1"
FT                   /db_xref="HOGENOM:HBG622381"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="UniParc:UPI000199C7F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC6"
FT                   /transl_table=1
FT                   /translation="MTPASGCLVIMCGVPCSGKSTAAAELASALREKGIRVTVVDEPSL
FT                   HLHRNAGYANGHVEKNTRGLLKATVDRSLHRDGPVVIVDACNGIKGYRYELWCIARQVG
FT                   ARSCVVHCDTPEEDARAWNEARRGSGGSSDDDRAAASTPTSAAEWGGWDAKIFDDLAFR
FT                   FERPDGKNRWDAPLFTLRP"
FT   CDS_pept        complement(674313..675407)
FT                   /codon_start=1
FT                   /gene_family="HOG000265643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639266"
FT                   /orf_name="MICPUN_63031"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70570.1"
FT                   /db_xref="HOGENOM:HBG635664"
FT                   /db_xref="UniParc:UPI000199C7F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC7"
FT                   /transl_table=1
FT                   /translation="MHASARPNLAAPPGPAASPRRRAHRLRTTPSTTIRAVAAESLTRV
FT                   APEQEWPAGDRLAFSRPPGVNRQLAPPGACPVVVCPGFGNNSTDYLAPFGDPSSSLAAS
FT                   LRARGFDVFVVDVERKDWAKILGGLLSVGFWTQKSTSDPAYTWYIERLDATVREALAAH
FT                   PGATQVDLVCHSAGGWLARAYLGGALNEVNWNSAARRLKGNAKEGDAVPPKHPTPHPSV
FT                   RRIVTLGSPHLAPPPGANDATRGVLRWVNDEWPGAFYESAGVRYHCVTGRAVRGVAGPD
FT                   AKGTLPGYACGSYAQVCGEGGGVEGDAVVPNEFAVLEGASSNLVIDGCFHSMSRVGTYD
FT                   EPAKDAWYGSEEVVDLWLEYLVRI"
FT   CDS_pept        675541..677382
FT                   /codon_start=1
FT                   /gene_family="HOG000216680" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639267"
FT                   /orf_name="MICPUN_106333"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70330.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG524073"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI000199C7F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC8"
FT                   /transl_table=1
FT                   /translation="MRRVLVALCVAALIGAASADEYDHKYLVGDAVTLWVNKVGPFNNP
FT                   QETYNYHELPFCKVEGVDGKRPKHKWGGLGEILEGNELIDSNMEFRFRHDQPKKTMCVT
FT                   SLDANDVKKFKRAIRHHYWYEFVMDDLPIWGFVGEHVDERSTLTGSKSATTTAEAADLM
FT                   ADDVVEHRGGTVYIYTHKTFDISYNGDRIIGVNLTAENPKPLVPGTDLEFTYSVNWKPT
FT                   ETKFGKRFERYLDYNFFEHQIHWFSIFNSFMMVIFLTGLVSMILMRTLRKDYAKYSRDD
FT                   DDIEAMDQGASMEESGWKLVHGDVFRAPRYLPALSALIGTGVQMALLILLVILITIFGM
FT                   LYEGRGTIITVFITCYALTSFVGGYVSGGYNARNEGKSWIKAMLLTAGLFPGLCFGIAF
FT                   ALNTVAIFYHSLAAVPFGTMVVIFVMWSCISFPLVLFGTVIGRNWNGAPDNPCRVKAIP
FT                   RPIPEAPWFLTPNWISVAGGLLPFGSIFIETYFVFTSIWSYKVYYVYGFFLLVFCILVI
FT                   VTLCITIVGTYFLLNAENHKWQWTAFNSAASVAGYVYLYSIYYFAFKTKMTGFFQTCFY
FT                   FGYTAMFCLALGITTGAIGYCGASAFVRKIYRNIKVD"
FT   CDS_pept        complement(<677620..678237)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639268"
FT                   /orf_name="MICPUN_76066"
FT                   /product="Predicted protein"
FT                   /function="specific transcriptional repressor activity "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="ACO70571.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016566"
FT                   /db_xref="HOGENOM:HBG750909"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniParc:UPI000199C7F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJC9"
FT                   /transl_table=1
FT                   /translation="MRQKILNESMKHVASHGFTVRAIQRAVTEMGYSAALATLVPRGAG
FT                   SLVEHFVDECDSRLSLRIATTGEDDLKDLTPEEKMVKVIGWRLDMLKEHAEHWGAALAV
FT                   MGLPENLPTTLRQRAMLADELVGATGPTMTGLDSSKGGNITAAAKAAGFYGDRAAAGAL
FT                   YAACELFLVTDTSPGFADTDDFVRQRTREMFDLASGVEQVGGF"
FT   CDS_pept        join(679074..680021,680194..680205)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639269"
FT                   /orf_name="MICPUN_103408"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70331.1"
FT                   /db_xref="UniParc:UPI000199C7F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD0"
FT                   /transl_table=1
FT                   /translation="MIVACPHASPAARALASPRHRASSDKVRKPAWTKVIARASPDDAP
FT                   PAGGSGSSAQDAIAARLAKAKEYQAKAKEASKNQGTRAELEETLRQAQERLEEAKKAPT
FT                   PPPGQKQQVRVKIVTKDNNYNPFDDDERIVGYEEGQTVYKPDTGGWGGDNEFAPSEEQK
FT                   SMLTSGRRRERGLGVDNDSGVGSLEEQGAQLSNDVIGQVVGRDTKNADGTKKAYQPKVS
FT                   TWGVFERPDNISKEFGGGRKISMGGEEETEEQIAERRKRVQDKLNKYRKEQGIDVDEGT
FT                   KSRWYVALKDAKASLSKGNFQEGIELLQDIVLVEKRRR"
FT   CDS_pept        join(complement(682756..682855),complement(680454..682597))
FT                   /codon_start=1
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639270"
FT                   /orf_name="MICPUN_63027"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70572.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199C7FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD1"
FT                   /transl_table=1
FT                   /translation="MESMKRRDVGLVSGLITVAQALKRHAHDGFTTNLRVVSQDRMYLA
FT                   FLAVSCAGFSSLAAREFIALGTRDRMSATSAIKESLTMLDLHRAEGPKPEASSASDSST
FT                   KSGKGRGKGRGKGRGKGGKGGKVGADFWRELEYLVKVAMPTPHCQMAQLLAAQFTLLVM
FT                   RTLLTVRANKVNTFYLTKAISTASWKFWVRWFFNFGGWMGSAVVVNSGLRYTETLIQIE
FT                   LRNALTRHAHKKYMTANNFYRTAVLRDGGLDNVDQRIVADIDAFSREAAFLYGHSFKPI
FT                   LEFTLSLTEAAKELGYSRPLALFGAQIFITTVLRQMAPSLGKMVAREQALEGGFRHTHA
FT                   RLIAHAEEVALLGGAPREIGILDDGLKNLVVTQRWHALQRIRKSVADNVSKFQGLLVGS
FT                   IFVHVPFMLKSTSEGERISLFRATEELMLRCGSAFTEVLLLGRNLDELAGYTYRLGQLF
FT                   HTMDRSIEDADAKRKTEESAGEVDLFTGPKDAISFDGVTVGAPEQTGYRLLVKNVSLVV
FT                   GPGEHLLITGPNGAGKTSLLRVLAGLWEPIEGHVSTPKAENYDGGKVMMWLPQRPYLLQ
FT                   GSLRDQVVYPNIALAERARRGKTKRVDANAVADEDERVKQCLRAAGLGKFVDGGVPGVS
FT                   LDTRHLEWNDVLSGGERQRIGFARLFYHSPPFAILDEATSAINPDEEGQLYERVIEQGT
FT                   TVVSIAHRLELRKFHRKELKLAGDGSGGWELHKNEAKPGSRGGDDKWKLVDKK"
FT   CDS_pept        join(complement(683671..683946),complement(683079..683522))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639271"
FT                   /orf_name="MICPUN_63026"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70573.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199C7FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD2"
FT                   /transl_table=1
FT                   /translation="MATRTFSTSKSYGKPRTRVRGLTILGAIVTFVLFTALSLTTGWPM
FT                   GPRTKRRMGEAMHNAYQWEEAHFHIGSSLQRPHALSKRPLRPDERDQFSKRGEGLVLLP
FT                   GDDDPRSDGEDHWMTSVLDAVDEAGLKGPSRCLDLHVGTIRPGGARGNHRHKTRDESLI
FT                   VWGASGRIRVERPGMGYHDYVIDRDDVVVLAAPAGSAHAIRADDGEGNVMMLAACSDAP
FT                   PTDGPDPNTDYRVWKDW"
FT   CDS_pept        join(684222..684252,684405..685229,685615..685736)
FT                   /codon_start=1
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639272"
FT                   /orf_name="MICPUN_106331"
FT                   /product="Predicted protein"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="ACO70332.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI000199C7FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD3"
FT                   /transl_table=1
FT                   /translation="MSQRENMIAAEQTSNDACVDGTMNGWFSEISDEMWPGQAMSLKMT
FT                   EVLYKGKSDFQDVMVFQSQSYGKVLILDGVIQATERDEFSYQEMIAHLPLCSIHDPPKK
FT                   VLVVGGGDGGVLREIIRHPTVEHLDIAEIDGMVIEVSKKFFPGMSCGFDDPRVHVNVCD
FT                   GIKFVGDAPEGSYDAIIVDSSDPVGPASVLFEKPFFEKIYRALKPGGVLTTQGECIWLH
FT                   AELIKDVLEMCKGIFVGGSVQYGYCSIPTYPSGQIGFVMCSKPTAEGKTVDFSKPVRPP
FT                   PVAPANTKLPPLRYYNSAIHEAASVLPEFARAAVEPYVVKGTGP"
FT   CDS_pept        complement(685919..687727)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639273"
FT                   /orf_name="MICPUN_63024"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO70574.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniParc:UPI000199C7FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD4"
FT                   /transl_table=1
FT                   /translation="MAGEVTLAESEFNARMRETARRVLGKLIERRRNSPPGVGRGGERR
FT                   HSLRIKALPTPSYTERARTQAIAVAGADSGSGPCDANNTSGAANQRRNSVSNWSWEDSD
FT                   ASNDSFGNGESDRRSGGRANVNKGSPGHAPNQTPAGPSFVKVMAPGHISGHFYVDAPCG
FT                   LSDWLPDETATLVLECDGEEWKTVWLVDTKGGDKSAGLSGGWRGFAVDQRLAVGDALVF
FT                   TKERGARVSVRIHRCGTGGVGRDGGRRTGGARCPPGVRQVSESAARSAAFTDAEARTDA
FT                   FVRFAAGETSFAALTDQTPHPQPRCGGTCRSLHVYSRRRQGRYDAVAAAAARRRTGASP
FT                   DECADIARTEMDGVRGAGGAGHDQPRHGSRLIHAAHDAGSPSRWKRAGMVSSPPAPAKD
FT                   QLPFASPKAGTPKKNARRRPTSQISSSPSDPAAPLGSPDKVTPAPPGTTEREANAAAAA
FT                   VAPLKEGLPARRTRRQSTGGGDRCLIESKPPSAELTWATPAVGGGVLARDASGDFAVLP
FT                   QRRSLRLGEEETPAMRTAGCADVPPPAPKAIRSRPPRRCAPVRIPDEKSSKGGLERGAS
FT                   GEGTPLSQVFRSTKRARTTPMFVTPV"
FT   CDS_pept        688074..689141
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639274"
FT                   /orf_name="MICPUN_103404"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70333.1"
FT                   /db_xref="HOGENOM:HBG610304"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniParc:UPI000199C7FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD5"
FT                   /transl_table=1
FT                   /translation="MLATARAAPAPLASFAHRQGSTKPVGARFGNPARVVGVVVRRIDS
FT                   SKPRPGVGVVRASSNSALGDVAAKAAKVVAAPAKAKMAIPTLATVLGTAYSFPFLWALS
FT                   IVPCLLGLVNPVYVFSVGYGLSVAAQGIGLLAAASASGVWISNLCLAHLLGAVFYGVRL
FT                   GAFLYWRSVTWTEWGRRAKNAPEAKPMPPPARLAVILTCALLYACMCSPMLWHVQTANV
FT                   LPASQNFVIVLGLATQWIGAILEAVADQQKSAYKFSDAGKSRWCDVGVWSRCRHANYLG
FT                   EVMFWVGAFVAGVPGMLASGPVSFVPAVVGVGFIVKLMTSQCVKQDEKQAGRYGDDAEY
FT                   KAWVENSGSLFPKLA"
FT   CDS_pept        join(complement(690008..690078),complement(689195..689876))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639275"
FT                   /orf_name="MICPUN_63022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70575.1"
FT                   /db_xref="UniParc:UPI000199C884"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD6"
FT                   /transl_table=1
FT                   /translation="MTNERWQRGVGTGIGLSNHVNTYRQGVIIDNWIEDDVAIRTVGKN
FT                   LIGNESVPFQGSSTFRDAFSPDKYQGVAPPQRMDVEPRAILELRHKFPHGPTREQQDAF
FT                   YDATVGGLAFAPPSGDKPQVTSSLWTGSNAADAMVPVNGGRTSLATRKKAQAAAEMAGF
FT                   DPYVTTTRTALEHGLSGGAYEKRRADPPAPSRGGWGNDLGDDAGAQSATIGRKGKGAFC
FT                   TEFDRRATRQVVGLRGAIAIKDGPWAGK"
FT   CDS_pept        690112..690591
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639276"
FT                   /orf_name="MICPUN_52516"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70334.1"
FT                   /db_xref="UniParc:UPI000199C885"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD7"
FT                   /transl_table=1
FT                   /translation="MHRGERRRSNRTTDPRRELITRSGCRHADRPGLFVITGAFSGFGL
FT                   SFCRLDFAKIRDQHAYLFRGKSRKITRRFAPDRGSTLTLDLPVRRLTERGPRVKYLSVK
FT                   KIQEAGPPAVTPRSADTARDGAPESRTGYPVAFAEPFAEPRGAEAGARHSLPAHL"
FT   CDS_pept        691174..692754
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639277"
FT                   /orf_name="MICPUN_52515"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70335.1"
FT                   /db_xref="UniParc:UPI000199C886"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD8"
FT                   /transl_table=1
FT                   /translation="MTEVDLSQGEVTWLSPPEPGWEAAPSAIADGDGDKRARSHSPSAI
FT                   ETLEEVEKRIGVGTIKWICFQVLKEAGPHGLLLSEIVSKTQEKGLKDWTSVRQPSNTVN
FT                   ACCSGDPAFVKVAPARVGLACLGAFESKEIADEEEKAAGEKILYCSACDNGPFNTKGMR
FT                   MHISRWCTFAAGKPTANPDIVPTAVADPERSTRDTNLRITAHLVPSDTPHLNHKGSPDD
FT                   PNHKAAVKTFVCSACGAGPFNEKGMAMHASRWCKVQNALDEDDADYAAAIGGALGRQQP
FT                   TTSPTSYLGGSVGLTGLAPVGMPGVSIGALSGGLPADLGGLLPQLSNGGAHSGHITGSG
FT                   SGSGGKKRKAAVDLGPVDPTMFDKHLPAFPVGFAAVAGASGLAGGRGQMLPPPPVFGRR
FT                   VGKSGKGNKDEAHGETTELRLEVEVWKQDGSFVAKAPLVVPANVTLGKLKMAIADNTKG
FT                   ALPPHRQALKYLGVPLSAPDDVGLVGLLGVTDNISLHLTILEDTMAPPKGAGMPGSPAR
FT                   KAFMKNLAM"
FT   CDS_pept        complement(692855..694102)
FT                   /codon_start=1
FT                   /gene_family="HOG000265314" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639278"
FT                   /orf_name="MICPUN_63020"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="ACO70576.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG557895"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="UniParc:UPI000199C887"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJD9"
FT                   /transl_table=1
FT                   /translation="MSALRHLARRCASSLNAARGLATKTSRKGSGKTAAKAAASASPSS
FT                   DDDSGSPDHREAAAGTVEDGTIGAEADKAARAAKEAAESFTRWAKGAGAKLGDGAAKAA
FT                   GGAKSFSETADKRSGGLMTTIVNAFKEEYRLAMMDPGDAAMERRKSAPGYVAPGPVDPY
FT                   EGTTAVAIAQKKKSRFQAAWETVSEKTGLGAHVTSVFSKLEGLKQTPAYKKGEEMLEDA
FT                   RERWETSDNPMVHRIQDITEGAFFAETEQAEAYRVLQQRVPDFNMNGFIAEVRRDVPKV
FT                   LGAYLKGDVEALERCAVSKEMLERMGGQMKLWQHEGQFVDPRILHLSEMELVEVRTLDN
FT                   APMIVLQFSCQQINCVRNKDGEIVEGAEDDIQSVHYLWAMQLEDVEYTHSDGRKYTAPT
FT                   WQLREMVLRGMMAVAA"
FT   CDS_pept        695600..697087
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639279"
FT                   /orf_name="MICPUN_109262"
FT                   /product="Predicted protein"
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="ACO70336.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="UniParc:UPI000199C888"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE0"
FT                   /transl_table=1
FT                   /translation="MILNAVLEPLDSAGGSGGSTGDSSEENAYLSRGSTDGTVLPPRND
FT                   RCISPLHAGLEGKRGAPKVWDSLPDDSLARDAVATTTRTTTPRSSPRTSVRYDFDLARG
FT                   LAMESDDLPHHPELLFAPPPMTPPGAVRANKTKSRSPSASPKRVVGRDVAATTATATTT
FT                   ASGRESFSKQQLVPTHHRRSSSVISVGSQHGPAINGVGFGRLNTRRHTRSVSGGGSMDF
FT                   DAAGFGFEDEISPYNSDAEDEDESEVATVTKTSVCFFSVGFDASIAMQFHQLRERTPCC
FT                   ADSVGKVVAGHGLLGITEAFSSRKYLRPGVMSLRVDGEDIPIPEGAKTVQFFNIHSSAT
FT                   GIDFFGSNEPSTSADLLQEYSEPNVGDGLVEVVATFGVTHLAAIRLGFGHSRRLAQGSV
FT                   IEIVLREALPVQVDGEPWLQPPAVIRMELRGKIPFVLGRGETKNVPRAAHRRRSSSARN
FT                   EVVLDKMPDKTGGSALADEAVVDRFLRDSLRARPVDA"
FT   CDS_pept        complement(697249..699603)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639280"
FT                   /orf_name="MICPUN_63018"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70577.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199C889"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE1"
FT                   /transl_table=1
FT                   /translation="MSSRAGASLLSAPPRALASRRDPPSRRPIRGALVARRTNKNLHAA
FT                   RMGAPFPFHVSASAASKSPGMPRPPKVVDRPPPPRAQKGGGAAQTAHAHPLPPQALGNL
FT                   GAVGEGEGSAHQIAALTIWLRQHGVDFTDRAQFVRVRGMGIGGISTRAFDEGDVIFSLP
FT                   LAAPKRELNRFGDRVEATDAEGAKQGAGGGDSIPGGVEPTSLSPLVLTTSAVTAHSGPL
FT                   GRLGRALSAAGLTSVRPDGRRVPSTLLGGVIESTHDFPLDASKTTLLALGIMHQCCLAA
FT                   GSAPHDAHWKAYVDLLPREVDSLIEWSENELDALQGSRLADRARERIALADSVYDEVFP
FT                   RLNDADPTLWMSGKLGSAVAGGTGIDVTAAARKKGERARDKYTSKEAFRWAWATVLARA
FT                   FSLPDVGEDGEMGLCPGLDLFNHGSEAEKCEVRGVLGASLELDEDDPQVGPRIVLRAGV
FT                   GGAESGEQLFHDYADRASGGSLLEFGFTHRVRSCTKPIDGKNNIVERHHDDEGVFDGLD
FT                   ENWALGAQLTNDAGDEDEEDFEECSLTEESDHLRRALHALDVSLKPLMATCDQDTVAAR
FT                   LEALADAGLCGGLTWEVSNVDPKYPAGERRLKGIECVPDAMIRAARVLSLTNEELERVR
FT                   DANAESDDDKWTAREALSLEHERRSFDALATIFRGKLVRYAAPRGECRPTTVVKDAAIA
FT                   DCIRLLANGDGGYVLAAPEMAWARTRAEVAGCVAANVRDEDGGKTAQDQDEEVARAARW
FT                   RRRTLMAVEVRRGEKLLLGEIAGEFERLASL"
FT   CDS_pept        700976..701467
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639281"
FT                   /orf_name="MICPUN_109261"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70337.1"
FT                   /db_xref="UniParc:UPI000199C88A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE2"
FT                   /transl_table=1
FT                   /translation="MDPTGASHPGSIAMNVNGTMRRLQPVCAQALPWSTSFIGCPGIKC
FT                   DDGHDFTELFLEDGSRNAGNRRTTPLEVEHPKDVAAFHARSTNCPWAKPNLQATLETAS
FT                   DPMALHALLNEIAPKKPLKVKRVDGQCEACYAAHVALAARLRAKHNPKSKGGAAADVDA
FT                   "
FT   CDS_pept        complement(701647..701985)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639282"
FT                   /orf_name="MICPUN_63016"
FT                   /product="Predicted protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70578.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C88B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE3"
FT                   /transl_table=1
FT                   /translation="MSSFALSSRVFRPSLKRSRVCTTSGGSTAARAEAKEVKVCTNKEC
FT                   KRGGSKKTLALFEALGLEGVEIVEIRCLGECGMGPNVQINGDDGPIINGVKTEDDVKKV
FT                   VDRLMMES"
FT   CDS_pept        702289..703683
FT                   /codon_start=1
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639283"
FT                   /orf_name="MICPUN_98146"
FT                   /product="Predicted protein"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="ACO70338.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="UniParc:UPI000199C88C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE4"
FT                   /transl_table=1
FT                   /translation="MYANAPADDVELEEFELYALDRIKLLKAIDDGLSTGKKGPEMKTL
FT                   IDSKMREFGLQTGRDYDIRKDEVSHFALRMAYCRTDELRRWFLQNECTLFKHKFDGMAP
FT                   NQKAAFLKTHDMGYQPVDNDEWTTTIQQGIRDTIKTFANKEVDEIMAKGANGFYKVPFE
FT                   EVFDLVRSRRVFLAGGSAYVPQKDLTSLVVGVFRSRLSKALAMTSRRWAQHVAGEEKDR
FT                   LAPVIMSLSKRYIGRDYGKQGADGEVGEVITLKDLNKAAAESFPLCAKHLFRKMKEDHH
FT                   LRHEGRRQLQLYLKGIGLALEEAMLFWKTEFCKKIPAEKFEKEYAYAVRHAYGKEGKRV
FT                   DYTPHTCMKCIAANPGNGEHHGCPFKTFGEEGLRAALSGMSIKAAKVNEIVEKAKGQHY
FT                   QLACGMTFEATHEGKTIDAGVQHPNQYFQESRKALGYAKGDGEGEGVVSPEKVPVTPGQ
FT                   KAVGVN"
FT   CDS_pept        join(complement(704562..>704600),
FT                   complement(<703776..704531))
FT                   /codon_start=1
FT                   /gene_family="HOG000198119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639284"
FT                   /orf_name="MICPUN_76254"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO70579.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG735894"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199C88D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE5"
FT                   /transl_table=1
FT                   /translation="EGARSWERFYRTHPIRAFKDRHYLRREFAELMPQSIRDDPKAHTP
FT                   PLDPSALPPPDVDSPDHKVVLELGCGVGNSAFPMMRANPDMFVHACDCSETAIANLRAS
FT                   PEFDPRRCDAFVADLAAGDSPLAEKIGDGTCDAVTGVFFFSALDSRTFAAVAAECRRVL
FT                   KPGGSVLFRDYGLDDVKNAGGTKGATRGEIRGAEFEPGRQIEDATYVRPDGTLAVFLDE
FT                   ARVEGVFGKVGLEGECRRVTHEVVNRKLDVRITRSFVQGRFTK"
FT   CDS_pept        complement(704937..705419)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639285"
FT                   /orf_name="MICPUN_63013"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70580.1"
FT                   /db_xref="UniParc:UPI000199C88E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE6"
FT                   /transl_table=1
FT                   /translation="MSPLTSMDELQDIEDLVVEGDEIAGARVGAAPGGASAGIGGRTGG
FT                   SAPGPALTMDEDGEDKYRKKAPLHVQLMQQIAPGLTAKIGTRADTLDAMESGRKAGGHG
FT                   RHEEGRTPTKGAGRRRGAIGGGHRRTDPRTVIVGLSLLSCIATMILLYSRLARTLP"
FT   CDS_pept        706226..708727
FT                   /codon_start=1
FT                   /gene_family="HOG000224124" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639286"
FT                   /orf_name="MICPUN_86840"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70339.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000199C88F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE7"
FT                   /transl_table=1
FT                   /translation="MPHLDRYEDEGLDQEPDDYDEEAELEARLRAEAALDDRDEAQRGG
FT                   RIDPATGRVRPRALEVDEDDDVWHRQQRRRRAADRDEDDEEEEEYEVDIENYDGPLREW
FT                   INRDRTKLEIRRKFARFLRKYTAENDPGNLVYRKRIRDMCVNNRQSLEVSYLHLSRLEP
FT                   TLAIWVADAPAEMFELFHEAAKAETLKLYPSYESIHKHVFVRLEDLPIKDQIRDIRQSH
FT                   LEQLIKVEGVVTKRTGVFPQLQEAYYTCGRCGFLAGPMMCKNGAEEQKPGSCVECQSKG
FT                   PWSVSQEKTIYRNYQRVTLQESPGNVPAGRLPRSKEVILLNDLIDQIRPGDEVEVTGVF
FT                   TTNFEGGLNTRTGFPVFSTHIVANHLLRKGDRFATTALTDEDKEEIRRLSRDPRICQRI
FT                   VKSIAPSIHGHDDIKAGIALALFGGQEKIVKGKTRLRGDINMLLLGDPGVAKSQFLKYV
FT                   EKTANRAVYATGKGASAVGLTAAVQKDPVTREWVLQGGALVMADRGVCLIDEFDKMNDQ
FT                   DRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVGGRYDSSRTFSDNVELTDPIL
FT                   SRFDILCVVKDTIDPVLDERLAKFVVGSHVRSHKDFDPETDDPTGLLSVTNMSDTHDDL
FT                   EPISQDMLKKYVSYSKRFIKPKLSSGDLPKISQVYAELRRESVTREGMPVAVRHVESII
FT                   RMSEARASMRLSEHVDSEDIDAAIAVMLSSFIGTQKLSVQKSLQKKFARYTHFHRDYDQ
FT                   LLLEILRGIVREMNYWDKVGAPGESVSQRSGRTTVRCRMLESKASEYGINDLAPFYAST
FT                   AFASARFTHDPERGMIYHEPL"
FT   CDS_pept        708982..710220
FT                   /codon_start=1
FT                   /gene_family="HOG000265308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639287"
FT                   /orf_name="MICPUN_109260"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70340.1"
FT                   /db_xref="HOGENOM:HBG557901"
FT                   /db_xref="UniParc:UPI000199C890"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE8"
FT                   /transl_table=1
FT                   /translation="MASKLGDEIKDNALSGLSEQYDLAGFSPGWIQDLVTGCLSQTLSA
FT                   KTYVGCKFVIGGGKKARGKYDPDMLKHFTEALRGAGFEDDRGASACKECMGTYKYQHDT
FT                   DQDLKYLHVFPKVDLSAAAAEAAGADTGGAGGDAVPNSPEYQCVACTLEEFQELVAMNT
FT                   PSFSQKRALLKRMKVMQSALEMLESMLCDQQTLTEQEQEMYDSMVDVNAKIEHLNKELE
FT                   KMVAKGRLTKGEQKQMVDDLAKKLEEMDVAIATADAEGKAKKRDALEAAKKKAEEKVAH
FT                   ISEFKPIVYTMANEKELNDLRKELAALEKIENKGGLLKGDDLAKLAKKPNIEKRIADLE
FT                   GEDKGWFEDECRDVLFTPAAAKPAAAKKKPAAAAGGGNGWLVKAAKGGARPSGAGGGNA
FT                   KGPANPFALLGDD"
FT   CDS_pept        complement(710317..712989)
FT                   /codon_start=1
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639288"
FT                   /gene_name="PHO3"
FT                   /orf_name="MICPUN_87288"
FT                   /product="Glycosyltransferase family 35 protein "
FT                   /function="phosphorylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO70581.1"
FT                   /db_xref="GO:0004645"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG444050"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniParc:UPI000199C891"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJE9"
FT                   /transl_table=1
FT                   /translation="MDESTHGGSRYYGDDSQSLRAHDDEIATRKDQLWRLSSSYLVSDV
FT                   PSIQRSLVQHVEYTLARRRYKFDRGSFYQATAHSVRDRLIERWTDTQQFYASRDGKRMY
FT                   YLSLEFLVGRSMGNAVSNLGLRGAYAEALRQLGYDLEDIMSQEKEPALGNGGLGRLASC
FT                   FLDTLATLNYPAWGYGIRYKYGMFEQRLVNGKQVEFPDYWLTYGNPWEVERLDVKYLVR
FT                   LYGEVKTYEDEQTGETRFRWEGGEVVVAVAYDTPIPGYGTYNTNNMRLWSSKPSHEFDL
FT                   ASFNAGDYYGAVEAKERCESITSVLYPSDDTDSGKVLRLKQQFFFVSATLQDVLRRYKK
FT                   RIVPGRTLKNLPEKVAIQLNDTHPSISIPELMRLLLDDEMLPWDEAWDITTRTFGYTNH
FT                   TILPEALEKWQVPMMEELLPRHMQIIYEINHRFLQQVEDRWPGDNEKMRAMSIIEESTP
FT                   KMVRMAHLAMVGSHVVNGVAEIHTRLVKSRLFPEFDQMFPGRIKNVTNGVTPRRWILQA
FT                   NPAMAGIFTSILGPGWVNDLRRLATLKPFAHDDTFQHSWNEAKRLNKERLALWVKANMG
FT                   VDLMTNAIYDMQVKRIHEYKRQLLNVLGIVHRYAVIAGSTPEQRARMLPRVCVIAGKAA
FT                   PGYEVAKKIIQLACAVSKAVNNDVRCAGVLQVVFIPNFNVSLAELIIPASDVSQHISTA
FT                   GMEASGTGNMKFVMNGGLIVGTADGANIEIARAVGEDNLFCFGATADEVAALRNTMKSR
FT                   LPAGDERLQRSVRMIRSGVFGNPDDFSQLMDNIEPANDYYLIAHDFPGYLDALDMADAA
FT                   YLHQPSWTARTIRAACSMWEFSSDRTIKEYADKVWQMEPLPFKPPHHQDGGGGSMGGGG
FT                   RRGPSFNGRGSRAGYDGGR"
FT   CDS_pept        <714395..>714791
FT                   /codon_start=1
FT                   /gene_family="HOG000251997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639289"
FT                   /orf_name="MICPUN_73936"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70341.1"
FT                   /db_xref="HOGENOM:HBG667395"
FT                   /db_xref="UniParc:UPI000199C90E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF0"
FT                   /transl_table=1
FT                   /translation="TPETVFDVENAAIFPFWLGMIAFPKNKVTETVMGSYAVPILLGFV
FT                   YIYLTYYSFSDPRIIEAFSTGKPDLAALSKGFSYEWCMAVGWAHFIAMDLFVGRWIYLD
FT                   ARKNDVFAAHSLLLCLFFGPTGVISHTL"
FT   CDS_pept        complement(714963..717722)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639290"
FT                   /orf_name="MICPUN_103393"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70582.1"
FT                   /db_xref="InterPro:IPR013636"
FT                   /db_xref="UniParc:UPI000199C90F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF1"
FT                   /transl_table=1
FT                   /translation="MTADGSASFLSRVGRPKAPPPKEKFASIMEGVFDGTLAGLRRKPE
FT                   EFWNELFLLGCNARALTELVASSTPDTLHRRREEITTLCQRASERINDGALLRRSRALE
FT                   LLCVLLLQIARAPFPERSLGVINTCAGGQETCDAFFADLISRCAACAANHDLPVALRRL
FT                   AVRCMLTVVCAVDDNVNRNALVQYFMIDDVYEPVMKVLIAPVDVPGGGVSSETHEDATA
FT                   LAHGARGFGPGAREVVDGNGDATGGDSPGGDSPGEAEDRRMARKGAALGTTKERSMLRE
FT                   EAGCLLALLLSWRETRNAYTLRLSDADGVEMSVILRAACSMLAAPARGDPNESGADGLT
FT                   ADPGAWMSSVTANVAAAVRGTREPGGLMGDLAMRLGFDEDDDTAVVRGDDGSRGWELGP
FT                   GPCAAILLLHALVRDSGLLRKPVIWLELTPKPDEMLHGVPVGQRWREALGRVLCFIRIL
FT                   CRGRRRRRMRRKLLPGGGARSLPAGVTVPTAIGDVTAEEEQGWWDWLTGAAAAASPYKL
FT                   SATRRLGKWVGAGSRGTGAWIEHDGESADEEFAGSTALLAVSLLRALLDDASAAEFLHA
FT                   VDARRLAPPEETLGFDSRKSGLERTEETEGTSNPDFFSLASSLGAALGLPVSGARGGEG
FT                   GASSVRSSPPVASAVLELLSSVLAEGAPGELNSTSPAAVESHAVYVIHRALETQVARGG
FT                   RVLCVRWDLLWLGLMSTLRRCADGGADALASPHVATLVSQCVNLINFVLARRGALCQSD
FT                   DDVVPLVNVLREEESVLATIAHGASLNGYLVDAADVAAMARRRNVLVDDEDFRDGDVRR
FT                   AGVRMETVHAVQSHFRSLPVVADEVVMRKALQMFRAPVGDALDAGWALGTTLGGGGGGV
FT                   GARGRLGGDAARMERAAASSARALVGELLEGPLGSVPAGLRPKIRVPR"
FT   CDS_pept        717871..718371
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639291"
FT                   /orf_name="MICPUN_109259"
FT                   /product="Predicted protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70342.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG314920"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000199C910"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF2"
FT                   /transl_table=1
FT                   /translation="MSLVCAAVISPRNAPVHVQTFGELVGDDDESADHAVQRTLHCSLD
FT                   AVEDLLGRIDRSSIASASGGSGAAVATTGRGPKDPYLGPVFRTEDHQVHAWVTNTRARL
FT                   LLVYEDRIGSEPSAETVRAAFKAMQDAYADAVSDPFATKEGKIESTRFARRVAALATGT
FT                   HGQ"
FT   CDS_pept        join(complement(718667..720190),complement(718430..718606))
FT                   /codon_start=1
FT                   /gene_family="HOG000236578" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639292"
FT                   /orf_name="MICPUN_87128"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /function="magnesium ion binding"
FT                   /function="nucleic acid binding"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70583.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="HOGENOM:HBG631383"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000199C911"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF3"
FT                   /transl_table=1
FT                   /translation="MEIAAGVTPPPAPEKPKPASPQKKGGGNNQQKKGGGGGGGNSKGG
FT                   DAEGAGTSSAEEVKALRIAKVAQLRDAGAEPFAYRFDRTHTATQLQSIHKDLADGAEVE
FT                   GTVEAVCGRVKARRVFGKLAFLSLEDDGGSIQLYCDKKRIDAVTPGAFKRIVDLVDMGD
FT                   IVGARGTVKRTEKGELSIAVDSFEMLTKSLLPLPDKFKGLTDVEMRYRQRYVDLIANPE
FT                   VRDTFRARAGIVSGIRRFLDDRAFMEMETPVLETRAGGADAKPFNTFHNALGMNLTLRI
FT                   ATELHLKRLVVGGFERVYEMGRIFRNEGISTRHNPEFTSVEVYQAYADVSDMLELTEEM
FT                   ICYCCERANGGALKIQYGDELIDLGQRPWRRAPMNDLVKEAAGVDVMGDYGHNGDLAGA
FT                   KAAAEAALRALGDKESMSGIPGVQQAPSVGHVLNEMFEATVETKLRQPTFVLDHPVEIS
FT                   PLAKPHRAKPGVTERFELFIVGRELANSFSELTDPVDQRTRLESQIETHRYEAELYPIA
FT                   MDEDFVTALEYGMPPTAGMGLGVDRLVMLLTNSASIRDVIAFPLLKSQD"
FT   CDS_pept        721152..724385
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639293"
FT                   /orf_name="MICPUN_63005"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70343.1"
FT                   /db_xref="UniParc:UPI000199C912"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF4"
FT                   /transl_table=1
FT                   /translation="MSRLGRSSDGSGPESTPSGVSSPCARATSGRNSPTRASSSTPSTP
FT                   FRAPESSSTGNSRTSETARVTRRAPLRISQGGEDDTAACSPSPEALLAAMSEHDDTRDV
FT                   FIDAEALAEDVAAPGEGGEQPRDDDETTRDVKNTFDDDEDEDEDEDPVVDADTERGLLC
FT                   ASRESSLHLSRAPRVHDAFDYEPRFDGPEDLDDSADDSADDDDDGDVPRRAFATGAHAG
FT                   DVSDVSDVSDVSDIGHVSDERDERDERGERLALTPLHDDDRLVERDDDRLDAGSEFRSV
FT                   GVGASVSDVFDVDDENLWLAYSPTQGTSSHPNPTGSVDDEDGADPSGPEWAGPTSPLAN
FT                   PNRRARPRRRGVPEGRRDVPIGDGRRWGARPTSSDGDGDGDGDGGDGGGFFFDEEEEDA
FT                   PRRARGRRSRTRTLRFTGEALAGVQVQVEVANVEVDERACGEDSDEEAEAVVAAVRRWQ
FT                   DPWRRHRDATAPARSTYSTTAAHPLHPIVGVADPTAFDGTTDPAREDPAAAAMRRTMWR
FT                   RDDDADAIDDDDDEIRGTPFGEFSAAVDDDEPAHPRRDDGRGLPAMDADIRDAARAIEE
FT                   ARRVLDRELTSSAGGYEDAMDEAVDAAFARAEETLARTEETAAALSPGALSPGGVAGGG
FT                   TGGPCRSAGRPGKDKVDGGGDDEVGGEISRRAGVDVSTDSAFDGGGAGGAGSAAVFRSR
FT                   SLESTPPAAPASDLSSASSAASPAGGASGGANVATLARRSSSKKRIEMPPSAVAGHDRP
FT                   STRLHSPAAKSRPTSREARFGSPARERGGAHLGAHPGAHPGAHPGASAASAFASAFGLG
FT                   GYGFDPTDPSLAHNGGTCPRGVADLVMSRESRLVGALRGEIRRAREERMELEARCQGLQ
FT                   LRSSAAEWERDRLRSHVEELERSLEQHRRALRREVTTRVKVGLDYGDFRGGRHVGSDGS
FT                   VVGSEHAHHRAPLFPQEVLQAVVRGAVDQSVECALGTGHGGPVGHGAALVDRASGGGGD
FT                   RRVGGGLSRSSISRAIDDDADSAQTLPAASPPYPAPFVPASDLDLDAGATQLAGGDVVE
FT                   FAARAPDAGVLEDASHLYSMVRDALRVRT"
FT   CDS_pept        complement(724503..726443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639294"
FT                   /orf_name="MICPUN_63004"
FT                   /product="Glycosyltransferase family 21 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO70584.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199C913"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF5"
FT                   /transl_table=1
FT                   /translation="MVAVPEAWATWWRAQTLFCLIGFWFSWQWAAWSRGRARRALRKRG
FT                   TASTSFCDGEDDAQNPGDDGARPGLRRRGRGEDERAKDAPKVSVVMPVKGVHPESLSNW
FT                   RTQLRSAYRGDVEYIFVVESGDDPAVPLIRRLMNEAKEANIAIRAAGTSMTCSQKIHNM
FT                   LAGVDACDARSTYVLFLDDDVRLHRNTIGSLVSSMEANSPEMFLSNGFPFDLPPTRGVN
FT                   FPSYMTMAFHMVLLIAFSHPGEWTKNVWGGCMIVRRSSFANDEHGCRSKYERGGYSDDL
FT                   ILAALCDEFKRTVGAPADCVFPQHIEHTWHQWWNYMRRQLFVMDTYSTSHNKLVNHGML
FT                   LVLSYLSLAVTSGVAMCAFDLCAWAREIVTESGKTPGWEVCEWTPERCASAASFLAFAG
FT                   AMHGARKMYAELAGMAALLGDEGVTESAGAIDWWRVGAAFWCCYACVPLMAVYTLTKPT
FT                   VVWSGITYRKRRGLVMRMPTDDERRCMKIERMNRGFGLKVPELDAFALLGRLKSEASDY
FT                   VLVDVRTEKERIVSVIKGSVTEEEYESGANAAYAGKKVVAYCTIGYRSGKYVEKLIERG
FT                   VDAYNLRGSILAWTHAGGELEAPDGTPTRVVHTCGKAWALPRSDHTAVYFDNPAVARVK
FT                   RMLGLAKRFGT"
FT   CDS_pept        726594..>727028
FT                   /codon_start=1
FT                   /gene_family="HOG000006322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639295"
FT                   /orf_name="MICPUN_72096"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70344.1"
FT                   /db_xref="HOGENOM:HBG444053"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="UniParc:UPI000199C914"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF6"
FT                   /transl_table=1
FT                   /translation="MSLVTLHVYDITNTQYEAANASIQGLNRFTKDILGAGGIFHGAVE
FT                   VNGDEWSFGYCDRGSGVYCCRPRGNTGYTYRESIPLGVTALSPARVRNILGALQAAWQG
FT                   HEYDLLARNCNHFCEAFAEMLGVGSLPAWVNRFASQADATV"
FT   CDS_pept        complement(727387..728808)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639296"
FT                   /orf_name="MICPUN_63002"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70585.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C915"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF7"
FT                   /transl_table=1
FT                   /translation="MGKAKELRKRPNAKKDAQKAVGKIFGDPTGKKTEAELEEEFNKKV
FT                   ELWCGRIIRGVFMSYSLFGALASAVEWATRPDMPPLVPIGGGDDLAGVNAIVTGGCGGM
FT                   GLELTRGLAMRGANVVAGCRAPKPPLPDDADADFGSSSGDELLDSLLDPTTIEGIPEGS
FT                   VRGSAVRHELDLEDFSSVRAFAAKALAEHEGKVDVLIHAAGSMRACENTTDGFESATQV
FT                   NYLSPVLLNRLVTPRLADRAGSSLKPLGNARVVHVTCSSAASMGGKGADADGVLLASDG
FT                   VKPRKKGCDPGSRYADSKILLERHARVLARKFDKKNVLVAAVDPGDMLTDYVLKANWRR
FT                   GGMRYHPAAIVSWAVGKASTAAFGPHGFGSFTKRQPERGAAAVAHVAVGDVFRNVAGTG
FT                   AGGRVFSDRAGAFTRATGCAREVEHECGVVREPGPKRSEDARVHEAKALKRDETDSEVW
FT                   KMTSKVLAPWSGELE"
FT   CDS_pept        729007..729396
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639297"
FT                   /orf_name="MICPUN_63001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70345.1"
FT                   /db_xref="UniParc:UPI000199C916"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF8"
FT                   /transl_table=1
FT                   /translation="MNVAALSAAAVGVTAPRVAVSTGAARRDARLPSAASLVKTRGSFV
FT                   DPLRATPGGKEEAESREVLDAFFVGKALAEVLLEKAGEAVSEALSTVGRLEAERDEAVR
FT                   QFQEDVLAKARDAQRRERGGEDQIR"
FT   CDS_pept        729615..731960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639298"
FT                   /orf_name="MICPUN_103389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70346.1"
FT                   /db_xref="UniParc:UPI000199C917"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJF9"
FT                   /transl_table=1
FT                   /translation="MSTAVALAMSARCVLDPRPVASGVKARSSAAPLSKSRRRLGRLAV
FT                   IPRASEDGDAPEPGGDKKPFDPKTTNEERIRSIKGGPPTEGGDPEKPKGPLDSLDRGTL
FT                   DLINLLVATGGVKGSIAVVVGALVGINALAQIHPDIASLSHGAMFAAPVAFLDALVMVP
FT                   RWNLSDDALDEIAKRQGRDAGEKPGEALARYRGALAKYQREEALSNPCRSMPAWQDGLV
FT                   ACVARLTDEMLERAVVLGFLGAWIGDRAVEAGAEPYEVEGAAMYAAVALCLAFFEVRAQ
FT                   RRRRRERDSMRAFRVQRDKITGKQKMVPMTEEEVKALMTKGVVEFEKDKVKKDSKDTET
FT                   TAARDGGEVPKGLGGVGLPVAEKAVRRTEEEVADLVGAVTESEPVLDDDARDPSNEPKP
FT                   PTPPVPVAATSAPPPNGLDPVGSVMLGANVKRTLDGVRSRITLFAQCACFVTAPALAGG
FT                   TVPNLFAPVVSGLACDLLFIAHQRLAMRRLFADADCEMPGGFKAPRDAEIKKAQMKLLK
FT                   KDLDRRRRVMASRLMESVDNSVAEGAKDFNIQMREVVDEVRKAKGYTRQDDALTEVLDA
FT                   IHKKFPPSKLAAMDEAESVAKMRSVLVEIRDELANPKTAEEKEAERVAVAKAELEKDPI
FT                   DREPWRSLEKTLVEDQRLTHEEARDKMNGVMKKIEEGAAANLERAKRERVEGEGAAKEA
FT                   PKKKITLGDISKLAESASELPPARSIFEQAREEKEAEIKAKAEEAEVEDEDEKKEPTGE
FT                   FASTISALDRLTAAIDEKLGTAEENKRK"
FT   CDS_pept        join(732235..732837,732886..733362)
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639299"
FT                   /orf_name="MICPUN_86934"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70347.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199C918"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG0"
FT                   /transl_table=1
FT                   /translation="MPASEKDYYAILGVDKNADDDQLKKAYRKMAVKWHPDKNQDKKEK
FT                   AEAKFKEIGEAYDVLSDKNKRAIYDRYGEAGLKGGPPPPDTTQDAGMPGTQNMPGGGGF
FT                   KGFGRSGAFSAQDATRLFESMFGGGGGGFSFGNDDAMGGSFPGMGGPFGGMGGMGGMGG
FT                   MGGVGGGAKRPAPEEYRLALSLEDLFAGCRKRLKVTRRRANGAVSMRETEEVIEVDVKP
FT                   GWKAGTRLTFAAKGSEQPGHPGRPADLAVVIDEKPHALFKRDGDDLVYHCAITLRQALC
FT                   GFKLTFRGVDGEDVVAQPATGEVTWPGATVRVKGRGMPSRKRPGGRGDVIVKVDRVDFP
FT                   KRTTEAQRAGFKELLSGAK"
FT   CDS_pept        join(complement(733577..735250),complement(733482..733499))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639300"
FT                   /orf_name="MICPUN_62998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70586.1"
FT                   /db_xref="InterPro:IPR007940"
FT                   /db_xref="UniParc:UPI000199C919"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG1"
FT                   /transl_table=1
FT                   /translation="MDGAVPTKMLARCQRSQHRKVPLQSVSRRTGARRGTLMSMSERAR
FT                   QTLRKPSTPSRLGASSPKPERRDEAEREPEADEPVGVVNSHDSAPEPAPEPGPEAEPEV
FT                   GPEPRDRPSPAPSPEPTTPNAPKGDEPAMSTHSPTATLARQRSEATSEPDSDSRGAAAE
FT                   KPSPLRTSVDAEQMSELGHELDHLETIPTMSLEDFLTPAFLGRGDGGTSVSTSAPPSEL
FT                   GDPPYAPDDDLEFAEEVDPRVAGALDEMNEAMMSVNDAETALAAAKRRRRAHKAEGSQK
FT                   IEETRKKLSSSVRAAVPFFHAQAVAHMYQVRSIECLRAYEKAHDMHAAAKESAAQLEAE
FT                   MASSASPGKKITGNEGGTFDTDLMIALSDAMSKVVETEIMKKRAEGAHGRMTKLATTAV
FT                   NESMALRKKIAKSVEKAQPYFAVKSSVEAKARALEEEVVDVEKRVKEMKRRYHAAMDEL
FT                   AKISDEVHARRLREKEEREAEAAAAKATEEISESRSNAGVEKEETPDEDKLSGDDGGVD
FT                   DADDDASDSLEPEPESEPESESEPEPESADPDVLERVEAEVRRRER"
FT   CDS_pept        complement(736146..736580)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639301"
FT                   /orf_name="MICPUN_109258"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70587.1"
FT                   /db_xref="UniParc:UPI000199C91A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG2"
FT                   /transl_table=1
FT                   /translation="MVNNDTVAAKSASDDRWNRWRGDGKKTRVHTVQIWALWWPQTLVG
FT                   GATDFPTPFPLQDNEMRFTFLARTLLGHRNPGTLVESTGVPTFPFTVTPVREAIIPALS
FT                   TVSNAYIEFDGPLDVVRKQLMRGAKQYRAPDTKFFLRCAS"
FT   CDS_pept        complement(<736946..737726)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639302"
FT                   /orf_name="MICPUN_109257"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70588.1"
FT                   /db_xref="UniParc:UPI000199C996"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG3"
FT                   /transl_table=1
FT                   /translation="MRRGDDADIGFVPQRRGVTHMCEHLDNESIWINSWDRGCARCPLG
FT                   WPHATTCVRAWRQFLHHYRLLGTGEYWQQEFDGVYPYEEEETDILNLRGQAELRDVQMH
FT                   KQWNRRLMRMLRRARSMIREPGRATGGWNMLPLDLAVEEDFGLRPEVIDVSYVNGIYEE
FT                   GGTRAESDGERRERNDEVVNRAEDEWKGHVLPCHNQVGVDGFPVITAHMPHGCHRYGRP
FT                   LARKDRVRAGTLLPGPLESSQPRRTPLNEANAFRFRAM"
FT   CDS_pept        complement(<737886..>738479)
FT                   /codon_start=1
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639303"
FT                   /orf_name="MICPUN_71607"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO70589.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG444343"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199C997"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG4"
FT                   /transl_table=1
FT                   /translation="YDVGEARRYTSQNDKVQAELTACALDLLVLQPVDASGPLLIADIG
FT                   CGSGLSSRVIEHRGHVWVGLDASQAMLETATGEGAEGAVFRGDFSQGLPFKKQCFDGAV
FT                   SVSAAQWLCQGDDEDVIAARLKRFFASLHEMLRPGARACLQVYPRDVNETRRLEKAMQA
FT                   SGLVGCAVTAFPHANNAKKIFLCCVRDPRPSREER"
FT   CDS_pept        <739350..>740566
FT                   /codon_start=1
FT                   /gene_family="HOG000062297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639304"
FT                   /orf_name="MICPUN_66561"
FT                   /product="HlyC/CorC family transporter "
FT                   /function="catalytic activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70348.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG673071"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniParc:UPI000199C998"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG5"
FT                   /transl_table=1
FT                   /translation="ALLVAYAFFCTSETAITTLWPWKVREISDQEGPDSPFTLMRKDIN
FT                   RFLTTILIGSTVTSIGSATLAAQAAMHLYGEESIALCTAALTLVTLIFCEIAPKSIAVQ
FT                   NAADVARVVIRPIAAMSTLVYPIGRLCTNLVNAVFAVFNIKIAAEPFVSEEELKLVLSG
FT                   AAKSGQVDSGEKEMIQNVLDMSETPVREVMTPLVRVVGVEQSTSLVELQKIWRTHRFSR
FT                   VPVYADRVDNIVGVVYSMRLLEYELKQELLSTIKVENLTQKPPYYVPESMSVVKLMREL
FT                   LARKTHMAIVVNEHGGVVGIATFEDCVEEIVGEIYDENDRPDESEINDDYIRQVAHDVY
FT                   DVDCRAFVDDLAESIGIDIPSSALYDTVGGFTCDCFDRIPNVGETMVVHMASASKNYDD
FT                   DSQDED"
FT   CDS_pept        join(complement(741825..742164),complement(740950..741770))
FT                   /codon_start=1
FT                   /gene_family="HOG000265310" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639305"
FT                   /orf_name="MICPUN_62995"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70590.1"
FT                   /db_xref="HOGENOM:HBG557911"
FT                   /db_xref="UniParc:UPI000199C999"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG6"
FT                   /transl_table=1
FT                   /translation="MRFLALAFAIILSHAPRAYAGSLGAQGGDAPEEPFLSLMGRTKLR
FT                   VPIATTTDVDVFASSSYSASASPGAPLLVFLHGFCLPDAEQQSYSVNALRYNAGGGQIP
FT                   RQQTLSQFNADWSLDVAERGPFLYAAPTAPHFTRKCALCNIGLDSPNAGDMLTVRFINS
FT                   TLERVAPAWHCPAWDGSDACCNPEFSGASDDVEYVLQLVDAIKFRHNVDPDRVYLFGIA
FT                   TGGFMANRIACQAPESFAGIATFAGSVWAEKSRCDPPAGASTNVLNIHGDADLTVPIEG
FT                   GVNFAGVPFPGQNKTVDTFATTFGCEPAIASPPGTVTLPVGDGSAQREVDARVVTFGGC
FT                   ANGVEVEQWTLPGVDHFMENPTSYAMFDAALEWLASKNRRDHRSVA"
FT   CDS_pept        complement(742357..743481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639306"
FT                   /orf_name="MICPUN_62994"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70591.1"
FT                   /db_xref="UniParc:UPI000199C99A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG7"
FT                   /transl_table=1
FT                   /translation="MEATVTACAGFRVPARCVAGAEASTSRRAGEVTKRSRGDRVTFRA
FT                   AGSSPRLVLRRGSRRGDVSAFALKRAGPTTPKPTYNDGPVDRELLRAFHARVASELGED
FT                   PSAVTGDYDATMRACVRLVSSARTPDQAQARGERVLRSLLPRWFPGFFRLFIALFPRWF
FT                   VARHAAAVTPMILPWLVGPARVIDAPDDLPVDDRDRPPANALDSLLTSTSFLSSNVGGG
FT                   DGGEDAKGQAPGYRQGVLLERCRVLEEGGCASVCLNVCKVPTQNFFSDVGLDVELRPDY
FT                   ETFECRFVYGKKPPPAGEDPAFDTPCFAQCSISKSRGGGAGATDATLPRWAVDGIDTVD
FT                   GVGAGGGVHGAASNCGRLPEYTGDTRRNHGRGTR"
FT   CDS_pept        join(complement(745330..745604),complement(743657..745208))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639307"
FT                   /orf_name="MICPUN_62993"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70592.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199C99B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG8"
FT                   /transl_table=1
FT                   /translation="MLRGARELARRLPLASGSGPSSRAWGVAASSRDDARESTWMPRSI
FT                   CRQRRDAATSSREDTRPCYGGDARNHIGLEFKLTADDAQRALRKWANAKPFRPWSLVDG
FT                   DRREPTLRPVFLPYWIFDVTVSVKYRGKVGFDAGEKKEWVEVDTWRDGGTTTYDSTRSE
FT                   VQVCASFAHRRDLAAAVTGAHVGRLPATGAVGQSQNQNQNQNQNDVTMVPMPDPADAAL
FT                   RAARSGAGPPGSVEVERYGMKRSLAWELASRRIRETERAKARRRLLESHKATYAKDVVL
FT                   DVELHPGRRVRAARLPCYIARFTHGELQGVDNKISDAVHHAFVCGYTGNVAVHDEIVCQ
FT                   NKVRALTVLACSVPGLAAAYAFGPEHYGTIAAQTVGASAVLSTVSGIVARQFPRVARER
FT                   EEAERVADEESAFAAAMRHGAASGSGDGAGVKAAWMDEPVQQRRDDVEWGRWKETDKGN
FT                   WDEHKREEWAASIWQWQKIRRREREERRRAEEIMRARMEEAERRDEEKEKRWGPGWRTG
FT                   GPRARGGPGGGSSSRGRDVKGYYRLLGLHKKTHRATAEEIKTAYRREAMEWHPDKHQGT
FT                   DAKERAARTFRQLQKAYQVLGNQQERDVYDAQ"
FT   CDS_pept        join(complement(747742..747829),complement(745823..747519))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639308"
FT                   /orf_name="MICPUN_62992"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70593.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199C99C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJG9"
FT                   /transl_table=1
FT                   /translation="MDFRQNPGFAPGQAVFLPPGSWPGSGLPVAQFQSDGRGGMMGMTA
FT                   GLQVAMGQNQSMMMAAPPQGPAVAQAPGGHAHHPKPKVTCTHPGCGKEFAWQQDLAKHV
FT                   RRYHSGEEPRFACTHDGCDKKFYERKLLVAHERTHTDERPFACKHPGCGKAFRARNALA
FT                   YHQKALHESGVVLRCTEDGCRFTTRKAEALATHKLRHQQRAAAKVWKQQKKGEVQAAVK
FT                   TAKEELRTKSAELVNVQKQLAQEQKAHAKALKELNALKATHAKMKRKVTASATELESLR
FT                   QQKRARTGGGKDAGAVGGKTKATGNGAGGGGGGGVGGERNAPALMPEIVLLDGPTGKMP
FT                   MLAMDAPAALTAAASSARARESDAAAARQLVDGVVVPGAVAGFGYPGGVGTRVAPPPPL
FT                   ATTLNVNGTMRRLQPVCAQALPWSTSFIGCPGIKCDDGHDFTELFLEDGSRNAGNRRTT
FT                   PLEVEHPKDVAAFHARSTNCPWAKPNLQVTLEKASDPMALHALLNEIAPKKALKVKRVD
FT                   GQCAACYAAHVALAARLRAKHNAKPAGEPAADEVDAADEVDGLVEDALVDGDGDGDGDD
FT                   DDAVAEETPRAVRSRRGV"
FT   CDS_pept        complement(748172..748699)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639309"
FT                   /orf_name="MICPUN_109256"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO70594.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniParc:UPI000199C99D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH0"
FT                   /transl_table=1
FT                   /translation="MMLNCTTRLQVDRVLWRLFLLVPTPEDAVALGALRDGGNDGFDGK
FT                   SGLDRIEEILRPLGLHRKRARALVKLSEDYVAARGAAPLPGPPGATGSDDDDDDGGGGR
FT                   GSLGGFFGSSRRLSAPVASLHGVGAYASDAHALFCEGTLGVAPRDHALRWWYAWALERR
FT                   ESERRERRAARG"
FT   CDS_pept        complement(750987..751802)
FT                   /codon_start=1
FT                   /gene_family="HOG000219455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639310"
FT                   /orf_name="MICPUN_87321"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70595.1"
FT                   /db_xref="HOGENOM:HBG300393"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI000199C99E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH1"
FT                   /transl_table=1
FT                   /translation="MVVSPPETTAPDSATRFVDISAPIKQGAQTDPPKCAPNVSYTNHS
FT                   SPAPPELDALFPGLRLGDLPGGDLWALERVEMCTHSGTHIDAPWHYSATMADGSKPMTI
FT                   AEVPLDWFHGRGVKLDFRDVPDGHVVTAAEIRAKLREVGHVLSPGDVVLMNTAAGAARG
FT                   DANYIHRGCGFGRDATLFLTGEGVRLVGTDAWSWDAPFIHVGRRYEETKDASIVWEGHK
FT                   AGRERPYVQIEKLANLDKLPSFGFDVAAFPVAVEGGSGGWTRAVAILDR"
FT   CDS_pept        752266..752772
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639311"
FT                   /orf_name="MICPUN_62989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70349.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C99F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH2"
FT                   /transl_table=1
FT                   /translation="MQEVPLLFEMEILSRLNVSDLFALAGVSREARAAMFTFEPIAFLT
FT                   RDNLMPHEDIRRQCSYACTEACKEGRLDVLRWLTLDPSYEMDRRWTYHAARNGHVDVLE
FT                   WLVDEGCSLAEDAASGAAEGGHLDALKWLVSMGCPWSGSVWNYAVKGRHEHVVEWLRGE
FT                   GCGGI"
FT   CDS_pept        complement(<753590..>754567)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639312"
FT                   /orf_name="MICPUN_68014"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70596.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199C9A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH3"
FT                   /transl_table=1
FT                   /translation="SQLPGYNLGKVVGEGGFCKVRLGVHQVTGAKTAVKLVDKAKLTEE
FT                   NDRRRVGREIRVLKRLAHEHVIRLFDVVDSPKIVYVVMEYADGGSLLDYVRRRKKLPEP
FT                   EAARFFHQMCRGLDYCHGVGVVHRDVKLENVLLDAGENVKLIDFGLSAVLAGDGKKLKV
FT                   HCGSPSYAAPEIVARRAYDGPPVDVWSSGVVLFAMVAGYLPFHAHGGNKQELCAKIQRG
FT                   AFTVPDAATEDFRALIKSVLKVDPVRRATLRQCLDSPWIRAHVRSRDHDAGKAAPAHYP
FT                   AAVSGADLDSARVESLTDAGLDRRRLVEHLRAADHNYYTAAYHLL"
FT   CDS_pept        756497..758614
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639313"
FT                   /gene_name="TOC34-2"
FT                   /orf_name="MICPUN_62987"
FT                   /product="Chloroplast envelope protein translocase "
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO70350.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI000199C9A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH4"
FT                   /transl_table=1
FT                   /translation="MDTSGERARQGAPNEWAQRARSLGNTVRDGVRPLRAQLARIRERA
FT                   SAAARGPAVASLTAATGVGSGPASSPGSSRPIGLIGAGMAFVARPSIAQIADAGSSSDG
FT                   NPASAGDDSRPILISSVEFDAEDPDLAQLARSVVTIRPNFSYTVADISADVRRIFSTGL
FT                   FEAVAPESVDTRDGVSLKFKLVANPVVRAVVLRGASQLPVTVIQSVIKPQIGKVLNTNA
FT                   MVAAVHEMQEWYNDKKVAHEFVNVGISADGIIELQVQEPRIGNVEVRFIDRKTREPCEG
FT                   QTKPAYIFRHLKNIRPGATLSGRMSEDITDLTNTSGLENVNVQFSQRLHAVDGSPIMDA
FT                   IVNVTEKQKAGFSGGGGISAKGLQEGGMSALVANADYYRRNLFGKCQNLTARVELSPSP
FT                   GGGKPDVDVKLSHTDPWIGDSHRTSRRVFLDSDSTSLEPIHAKAEPTDDNQDVDDVAAA
FT                   GDGPKALYVRKVISGVEYRRPLAASWTGTLSATYQRAYTHDDLKQTCLHDAYNSPLTFS
FT                   GLPHDTTFNVLSRFVYEGRGKDEALLVLTAEQAVPVTADMLWFNRVVVRARRKFHAMGA
FT                   TLEVAAKGGNIIGDLPPYEAFQIGGANSVRGYPEGGVGTGRKFIVGSAELSVPLAPDQF
FT                   DGYVFFDIGSDLKSGSQVLGDPAQARGKPGQGYGYGAGIAMHTPVGPIRFEYAVSEKGA
FT                   GRMHCGLARSF"
FT   CDS_pept        join(complement(760409..760670),complement(758768..760119))
FT                   /codon_start=1
FT                   /gene_family="HOG000109651" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639314"
FT                   /gene_name="HEMA"
FT                   /orf_name="MICPUN_62986"
FT                   /product="Glutamyl-tRNA reductase "
FT                   /function="NADP+ or NADPH binding"
FT                   /function="glutamyl-tRNA reductase activity"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70597.1"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0008883"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG732626"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="UniParc:UPI000199C9A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH5"
FT                   /transl_table=1
FT                   /translation="MALSGRVRAMEPKRSSAKSSAFATGGKCAAKARATFARGRNTVTR
FT                   AVVTPPTTHDNARPDTTLRPVSAAAVDSSKALEQFRSMGGASRYASEAKSSIVSIGLSI
FT                   HTCPVEVREKMAVPEDKWEEAVKQLTSYPHVEEAGILSTCNRMEIYVVALSWHRGVREV
FT                   EEWMSQYSGIPLDELREHLFLLRDQDATSHLLKVSGGLDSVVMGEGQILAQVKNVFALG
FT                   ENVEGFGRHLSGLFKAAITAGKRVRSETSIASGAVSVSSAAAELVQMKLPSNSFDGCRV
FT                   MIVGAGTMSRLLVKHLVSKRCTEMTIVNRSAGRVEELQADFPEANIKLALMDEFLPLAA
FT                   EHDVIFTAASTGVIITKDDLATMPAAAACVDGKRRLVDIAVPRNVDADCGEDANTICYN
FT                   VDDLKELVEANKEARERAADEARELLAQEQAGFEAWRDSLETVPTIKRLRGKAEAIRAT
FT                   ELEKAMGKLGDGLTKKQMKAVEELSRGIVNKLLHGPMQALRSDGTDPAQVSQTLVNMHA
FT                   LEDMFDLKNDGVPGSRNGKK"
FT   CDS_pept        join(complement(761980..763967),complement(761344..761680))
FT                   /codon_start=1
FT                   /gene_family="HOG000198117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639315"
FT                   /orf_name="MICPUN_62985"
FT                   /product="Peptidase M50 family protein "
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70598.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG316729"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniParc:UPI000199C9A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH6"
FT                   /transl_table=1
FT                   /translation="MSTLSSAGVVSLGATTRGGLPAPRRRSRAHVAARTVNAVRAGGDP
FT                   SPSAVWPHRGANSGRRVARRGDAVVRRGFLDRLFGGDKKEPSDGNGDETPASKPVAAPD
FT                   TEPEPPAATTSSSSSAASTASDPAAAPAKPKRRVEYDMPKPDFTSTMSALDALVGATDE
FT                   EKQREEEAKADDAAFAEAERKRLDKEASRSSSSDDSDGVTLTVAPGVLEAIEQAEKARK
FT                   SGSVPKDVESFGGKPKGETEGAKEGKKIQVTLDDKAVKQMMDKDSWLDNVVEGLSESAA
FT                   RERDERTPEENAKLDKVLADLSDLAKKDKGERSSDEVREKFESLFEILEISDEPAVPKE
FT                   DMERLKKEVFGYNTFWVTGTEDLGAEIAGEGVLVKGNLRAPRQEVFEKVQAGCERLFPN
FT                   KYTVFVLEEPGGIFDDDSSPGASMSGSFDSSDPSANTRGPRVSFLIVPADKAGPNPSTS
FT                   GWQYLVAMVLFGLTAGSAFQLGLVAEVSRLPAATMDWLAAGSQGIDTTLAPGELPPGLE
FT                   DFDVQAYVEGAFPIAGGIWAVSAAHEVGHMIAAAVREVKIGIPFLIPNGQLGTFGSITQ
FT                   IKSLPKTREDIFDVAIAGPIAGTVVASTLFFYGLALSAGGDASELLPIPSELFSGSLLL
FT                   GSISEIFLGDTGNAAKGVMVHPLFIAGWCGLVTQALNMLPVGQIDGGRVTQTGFGRRAL
FT                   GLTSLGVYIGLSLGLIASSLSLSWALYVLICQRTPEFSPQDDVTEVDEARQRTALLLIF
FT                   LAFLVLLPGGQGVSQDVMPML"
FT   CDS_pept        join(complement(769283..769453),complement(764157..769106))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639316"
FT                   /orf_name="MICPUN_62984"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70599.1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199CA25"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH7"
FT                   /transl_table=1
FT                   /translation="MANPRNLRWWIRMIRSLRLGLLNLPRKVKILELRTRRQITEASAM
FT                   VQEGLRLALFGSVSCNLLESLPDGIGQLMFLEHLDVSGNALVRLPSLSGLKAITRLDCA
FT                   GNRLKSLPVTLSGCATLRELCCNNNPSLEWLPTDLGLFQPELRGVWCNGCALLELPNSL
FT                   EAATGLVHLDVGRNRLRRLPDSLGGGQQPNLQTLRCGENAITALPAGLGGAVSLRALDA
FT                   SHNALEEVDVLAACATLVEIRLGDNAIASLPRNLAGGPRRLKAQLKALAHASSSVSRGS
FT                   TGVLKPRVFTGWGDGEWDGLRVFDASGNSLRKIPTDLAATLLAGGRTPWRVLLHNNPMQ
FT                   ASIRAALGQPDAEDVATLLRYLDALNDELELMDRDESELGDRARRVREGKLSAECPARI
FT                   EKPEIGVMDRSDRFARRVHRRFSVSEDAPRVLQRVRTANPGALERVKPIDEQYLLRCEA
FT                   RKAAAAARARTRWGAAIFSKMKGTNDVKEAAAKLQRRDQLLDAIKRATEEKARRDEEEF
FT                   RWIHDVELLRFIPFRLRCQLARSCRAVRCTRGERVYAEGDDGDTAFIVVEGRCQTRVNV
FT                   PKDADEINSDDESEADLIKTEPNGDVVSGALALADVVEDFAKRNGRDPSEAEKEGLSRG
FT                   RRHGEKACVGLETLLTGAPRPHTLIAKSQRTVLMEISRRELAKCLAEDDASRAKEHALK
FT                   VTRAYNEAKRAFVETYGQSQGASWGEDAVAEEGADAYRESLLETPPAPSVREALFRAEA
FT                   SRQMSATPGFDAIDSEEERDAMVEDYFRRVKVTAHHLGLGLPDDLYSESDEEVLPWTRT
FT                   WRANRSVEPPELLGSDPDGSSSLDSNRIAEWESLRATPLLGGGAGLFLCSEPTLTKAEL
FT                   RHVVSAGCRRVAARQDERPLCLENDPGERGCAYVVSGNSRGDIVRARRPTKFDPNPVPE
FT                   RVGVVKPGDVVCALSLLTGAKATQTVIASTAARAPPKMKALEINKKCLRAVVMRRPTVL
FT                   DAMARVVAADVAQSSFADDARGVPLEKRAANELRIAHRIANAGWRHYAVGWRTWVRVGS
FT                   TVRAECRRRIIREKLFGGGAGAFFAAAAGASLDAANDDEMIDEANNRPPQAETAQRRSS
FT                   KRRGELVDLDNSQALGMAKPLRALIASERAAIAARSTRRVLARAGEVFVQQGFPGNSAF
FT                   LVLGGSLEALVKKPGAQDDVEGGTLCRAGKLRPGACFGETCLLLGARRAATVRATRDSW
FT                   LLEVGRRGLEWALRERPALADDLARVAAKGIARERVIGDEAAAAAADDEDDDLGLIDDD
FT                   ARMSSEEHRELVERVTKWVFHGEKPRGEEGDADDAKAPAVDDDGTPHGLRPTRSRLAFG
FT                   EATKKVMGVLQNVDCFAALDRTQMLVMLREGADLETHPPGSRVCEQGDDRRDTMFVVME
FT                   GELEVKEETLTDPRSSAASGKVDKKVLRTLRRGDVFGESCLFTGAPRGCTVTATYRGAT
FT                   LIELSPAAIAPILRNVDSFVPTVAQVLASRLDAGDQAPNQGPNQATYPDQHPDALIDRA
FT                   ARLDASIRLRHDLAFPGEDAPRSFDVSEFRLSEKGTERSVIDESLSGLLRARHPFFRRF
FT                   TSEELAAVAARGVAREIGTGKHLCRQGDAGKTMFIVVSGVAMVFLEERVGERAVKRKVG
FT                   EVVAGQCFGEECALRAGGAAVDRVSTIIASPPGVRVVELGAGAFEAAFARRPALVDLAG
FT                   EYLASLELV"
FT   CDS_pept        complement(769788..771317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639317"
FT                   /orf_name="MICPUN_62983"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70600.1"
FT                   /db_xref="UniParc:UPI000199CA26"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH8"
FT                   /transl_table=1
FT                   /translation="MGGTGEPDVGRDVGGGSKRSPLLEFMRRDLRDNAPRRSGATAAPA
FT                   KGADDDEENENDGVASSARAKPPPSLARAASTAAALRRWRRDVVPASARGERSVLTTDT
FT                   DEGVANDDDASDGGSGAESSLDGFAAYASDDSDVENAPATSARATHRPKTNDDRARAPV
FT                   TNDDDARHRVARRGATAKERAAEEERTRALAEEAEAARVVELGKRAERDAKRAVTERVE
FT                   LLRRAARTHGMIARYREERATVAARAAEEARVEVDERWRLERNAMEDTSSASSFERKTP
FT                   LPSAHEARLHLAYVREERSRAGDGGCVLCDRGELHSALECSLCEAPAHNPDAADGRPDG
FT                   GSSIDAGDERGGDPASVAAGELLAASGQAEVDRWRELTTVRARASTTELRLTRKGLVSF
FT                   SEAFLGGFHGLTSLWLARNRLSVLPDLGRLTPLLERLEVSARETKKSCVSSRLHWWFFP
FT                   EAPVWRWEGARATVGSPRASRSMRARDSRRGEVLTSSRGVSRALASWPAPG"
FT   CDS_pept        complement(771428..772174)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639318"
FT                   /orf_name="MICPUN_62982"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO70601.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniParc:UPI000199CA27"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJH9"
FT                   /transl_table=1
FT                   /translation="MHAYRLRQLQANSTALLLNVATCASGALVFASAGHVDPVAGCLVA
FT                   SGATATAGPGARLAHAMRERTQRLVFASALLALAPVIALKPVISNPANDDDAKEDGGPT
FT                   HAGGGGWNGLGASRIAMPPAEKIAYYVGLGAAVGVASGALGIGAGTMMSVGLALAGNMP
FT                   HKTMLGTSMVAQIGPGLAGAWAHARLGNLRLDLVPALAGGAMVGSFVTSEVAVDLPEEG
FT                   LRAAFAAFVAGLGMHAMRGALRMPKV"
FT   CDS_pept        complement(772420..772923)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639319"
FT                   /orf_name="MICPUN_62981"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70602.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="UniParc:UPI000199CA28"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI0"
FT                   /transl_table=1
FT                   /translation="MRRASSRCSQVVRMSADPSLIRTEDGDDGVQFGTEERSVLRMGRG
FT                   KGDAPRIFPAGIDPSLYTLEQLAFLSRKEQGIMPTGHDCSCCDGVGTIICHSCRGQGTN
FT                   QQSQESRFDDEVRLNSNAMQAGVVNMMMQEGMMCWVCRGAKHIACTSCQGTGKRDFADN
FT                   WIAD"
FT   CDS_pept        join(complement(775024..777291),complement(773118..774755))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639320"
FT                   /orf_name="MICPUN_103377"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70603.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013323"
FT                   /db_xref="UniParc:UPI000199CA29"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI1"
FT                   /transl_table=1
FT                   /translation="MPLIQITDAYNEPLDLWLSPNHEGQTRFVRESDIPKAVADADDTD
FT                   DANLLERADDDDGADDESALCLPCEVEDEASVVRVPAPPPVGLVGLLKPIPTVLPHPDK
FT                   DKELLKAVEDTRKFSSEAGVPTVFVTRPPRDVICRACRDVYRDPVIAHDGFTYCRQCAP
FT                   KDFDSDDDEGIHHSTVDPDHDPTAALVEDHDAWEKVLAMQILCKNGLTFMDNAAGANRW
FT                   VYNPEGCTQSITLEARAKHELDCGYRRARCSLPYGRRDNDSCPVTLYQFEREEHQRECP
FT                   FRLVNCGIEGCAKRIQFNRRAQHTALCERKVFECANGCGWRGARNERAQHKNACELEVV
FT                   TCGREDTEDPSLFCTHLAERRFMSPHANECEYRPTPCAHCKRKVSARHAAEHEKHCEER
FT                   RVLCDDCGARVLERHLPEHREVHCGKGSFRCEFQKYGCAERGTRAELERHCADDAARHL
FT                   RLVMLQLDAQHEKYAQWYREVDDVKETVAERVRADDEVVAAVNAEVRRVEDEGKAEIVT
FT                   LRRGLADLRAYYEEEVGRLQAQMKRVAKDSDARVADLRAENAALRTALSDKMTKDEMNA
FT                   FVADASAFRETLEHETARARDEMDRHRQRWERDVSRVHEDIKDVRAMCDERVKAVDAAV
FT                   AKHEASDHLRVDAVEAELHEANKEFVDDLDELARRQRDLEQRWQETNEALRGPRKLKES
FT                   VRDLQWAETRAPEVTRPAVSAGKSGSVRHFGMGTTRDEKGLARSRAQGAAALLFGKGSR
FT                   MDPVRSGAMPQSLTTEQLVFGKSRRNATRPSPLKRCLSQATKKRNWCFVEECEHQGFTH
FT                   SRHGDPYFLPATHYVVHSWHRNWGQLTEALERFTETRRLNPRETSFFIDVFSVNQNVPP
FT                   HRELLPDALAFPSIPEDGPAGADPSSSSSTLDDDLTAEKFFKTTVDAATKTSLARCNYR
FT                   VVVAPSSWSKPPAYRRLWCVFELALASAQREFGTAGDTAESVPSSPTSPRALVPADSAP
FT                   PGFDLALVRSEEADLVRSFTATREGDVAFEWIGGIDAQTATATDKLDETLLREYAEKKF
FT                   PGGYRLLDAAARDAAASALASACEHNLREAIDAEDVATECDMRAALGRLHAYRRRDADA
FT                   SAQFEAEAAKRLEAAERGGPNAPAADASARARCHVNLADSRRQAAAAAAAGGLDGSDAR
FT                   AALEDAAANYSTAVSLIPDTDPIACTALEGKLTTLREMQRLIPRMQDRDDDVLTECRIA
FT                   LGRAYFRHGRMQECSAVMASAVMVLDKKHGRDHPSTVAARDLATRLLGRAPIEDWVGEE
FT                   TGREVERLGGRLADVNV"
FT   CDS_pept        join(777607..777810,778148..779533)
FT                   /codon_start=1
FT                   /gene_family="HOG000220902" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639321"
FT                   /orf_name="MICPUN_103376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70351.1"
FT                   /db_xref="HOGENOM:HBG717050"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199CA2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI2"
FT                   /transl_table=1
FT                   /translation="MSISSDEVNYLVYRYLQESGFTHAAYTFGYESYIQKTSIAGTDLP
FT                   PGALISFIQKGLQYLELEANLNEDGTDVDGNFSMLNSSDLLSKPVEELKNIVKEKRKSG
FT                   SDKDREQEKRVKREKPDAETANGGSTPMDDAEMDDADVGAEAIDDEDVTRLEGHKGEVF
FT                   ICAWSPATSQLASGSGDATARVWSVPAGPSGRRAQGSLKEPTVLVHSPVDGGDGDGDGD
FT                   GDDDKERGFESKDRNKNSKDVTTLDWNGEGSMLATGSYDGSARIWDAEGNLVNTLSKHK
FT                   GPIFSLKWNKKGDYLLSGSVDKTAIVWDAKTGEAKQQFDFHTAPTLDVDWRNNVSFATS
FT                   SMDHMIYVCKLGESKPIKAFKGHTDEVNAIKWDPTGTLLASCSDDYSAKIWSLKQDECV
FT                   HELKEHTKEIYTIKWSPTGPGTNNPDMPLILASASYDATIKLWDAEEGKCVHTLRRHTE
FT                   PVYSVAFSPDGKYLASGSFDNRLLIWDVRKGELVKTYKGDGGIFEVCWNKDGTKVAAAY
FT                   SNNRVTVLDFKP"
FT   CDS_pept        complement(779782..780147)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639322"
FT                   /orf_name="MICPUN_103375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70604.1"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="UniParc:UPI000199CA2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI3"
FT                   /transl_table=1
FT                   /translation="MRAIGALGKGTKVAALADEMHVAFASQLLAAGAGGGGMQGRRGAR
FT                   RGAGDSMVEWAAYVAMHVEDGARRERLVRCTLHGRCADWCDDEGKTSFLRDVLGVPTPW
FT                   LEEARREWFDYNWWEAD"
FT   CDS_pept        782432..783553
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639323"
FT                   /orf_name="MICPUN_62976"
FT                   /product="JmjC protein"
FT                   /protein_id="ACO70352.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199CA2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI4"
FT                   /transl_table=1
FT                   /translation="MAGERVIQWTAVPSFPNAIACEKKSVADITPDAFERDYVHRAIPC
FT                   VLTDVTAEWPCRARWSLDFFAREHGDLEVSVDDGRKEKMRTTMREYIERFEEFARDAEA
FT                   SAARDPAGRPGVPVPYLRTWNFEDDAPELSEGFPHDSPYFRDFFQTLKPTWRPPFTWLF
FT                   LGPRGSATRLHVDVWHTDAWLTMIRGSKKFVMFHPAHLPLIHDEATGTYVDLHAPDLAK
FT                   FPRFRDATPIEFTLEEGETVYIPRKWPHYAVALDHGVSLTVNFASAANRRGVVDRCVAY
FT                   ANRRDACEHVLGRTLRASDNAMKFCVHGGEVNKNLAASILGVDADELDRRMRARRLERL
FT                   RAEAEEAERAEEEEEEAAVEEAGESVAARAVPA"
FT   CDS_pept        784029..785603
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639324"
FT                   /orf_name="MICPUN_103373"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70353.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199CA2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI5"
FT                   /transl_table=1
FT                   /translation="MVAALEENERSATFGWDLSSAADATGLDDPAACSIAPMHSLSPHH
FT                   PDAFVGRERRDGGAEDGGFPWADLRPTGVSWNASGYSLAVSYGRFDVTGWCDSPGALCV
FT                   WNLRRADVDPGRPHVVMETSSCLQCVAFHPQKPNVVAAGSLDGEVMVWDLAIDTDAAGV
FT                   PAKGVPTGGADGVPRSGGGKGSAVGDALVGKSEVSDASHREPVTCVGWMRNPEAVTTVT
FT                   TAGVGGGHDDGTYELVSAGSDGRVLVWDLSDVSQGPVYGYELAAVNEASGAMTTWGASC
FT                   AAFSEPFRSRFGAAGVGSRSNGATTTHVEPGSFYAGSDGGPVFRCALRHSRVTRREFRD
FT                   RLKDSGVAPPMYSPIKQTHDGHVGATHAVCVNPHDQRVFATCGGDGALRVYTRYVRSGV
FT                   VTATSAPGALFAAGWSPTRPALIACGGVGGRVCLYDLTATGGEDVQPTEQFRACDAGTD
FT                   VQAIAFNPALPEYLATADARFVRVWELGAGLTTERAGERRVIDAIAGAETAAEAAAALD
FT                   AAKASRR"
FT   CDS_pept        join(complement(788445..788559),complement(785786..788283))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639325"
FT                   /orf_name="MICPUN_62974"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70605.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199CA2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI6"
FT                   /transl_table=1
FT                   /translation="MSSATKPRRSLNGGTSPSRGRGRSPPREREMVQRNHRRGPSFESV
FT                   GEATEDDDSVLGDGAPKAAQLSRARSRVEGREGAHQSSVAAVKGFEQKASQIAEAIKEQ
FT                   ERGDGAIDPMVMHPSAEWRRYWDGHFNFIVLVYIAFTVPYRLAFDMPAMGGWYLFEFII
FT                   DLYYWVDFVMCFHTAYWEKIDDGDDVRYVTDLEEIRAHYLRTWFLFDLLAILPVEYIKR
FT                   NAQNIAVCSWHLVKDPCGDHVVKGVDHHVMRAFTVIRLFRLLKLGHLPRVQRIIFGYFD
FT                   EFILKYHLFFSMSKLLLSLTFISHWMACLYGSQYNFEREDHSGIEGLHWEMYIGAMYWA
FT                   VQTVTTVGYGNIVPTTISERVIACFVMLLGGFVFSTIISKVASVLEPNSGENIEVRRKL
FT                   ALRRFIEEKKIPRSLIVRINTYYKNEKDDSFGNNEVIAGLPDVIRTDVNYFVYGGVIID
FT                   AFAGTVMPNEMFVEFMCRRMYPKRYTRDMPLSMTNEFVENIFIVAEGRVAVAAREEDLL
FT                   EDTGDVDTKAYNEKISDANCDNDDPGAGCLMPPGALINPGVALGYNRGVLCTRPYDKIV
FT                   NLMVLAKQDLMDVVEEHQPLLARNVMDEFIEQLTWSRKSAQRLGLEGIGRIDLWDEENK
FT                   RVKAKWDVILQQERRKEDEARLSRGGSLNSRDDDDAIVEAPQLIEAEIGGDKFELVQKQ
FT                   VQQQSIVLAQVANSFKESAEKTRDKLGEQNADLKKFQTSVIDALKSHSHRIERIEGAIE
FT                   GLHRLLVAQMGGLPYHAETGEDTAGGVGFGTASDPYLAKAKDDLRLGGRAYAGQPKPRG
FT                   GPDDFGVEALNADVADDDNARRLKYAAGASASGRPGSRSSPQPPPLQGYEAARLRRAL"
FT   CDS_pept        join(788723..788802,788923..789409)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639326"
FT                   /orf_name="MICPUN_92116"
FT                   /product="Iron-sulfur cluster"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ACO70354.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG730174"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="UniParc:UPI000199CAB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI7"
FT                   /transl_table=1
FT                   /translation="MRTRGLLAAARSLATATRRHAVERGSRTESWRPWVTAPPTDVHRV
FT                   DSWNRAGIATSAGAREAAARAAAEAGVEDPDGKSDGITLTDACVRRLRELAAEDPAASI
FT                   LRVAVDGGGCSGYQYTFSLDTTPAPRDRVFDVGGARVVVDEISFEFVKGSTVDYVEEMI
FT                   RSSFAIADNPNAEGGCGCGSSFVAK"
FT   CDS_pept        complement(789461..790609)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639327"
FT                   /orf_name="MICPUN_113308"
FT                   /product="Putative uncharacterized protein "
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70606.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199CAB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI8"
FT                   /transl_table=1
FT                   /translation="MEGELPPLARPLLTNRDETTVGFADDWTPSHVKVALNLTLNAEFV
FT                   PASANVRDLSSLPGAPSGCRAAVARVVALDGLIDKTALGWIREHLGVDIEDERRHGGAK
FT                   PRESLWERKTADDDLAEPTYGLRKESMDRLVRTMMHREGVEPTTRLDEFHARLQALYPD
FT                   WIVCHMPADALRADEEASEKPDDSLDASAGGSAGFRCDAFVANAAVHGDEYRWHVDADP
FT                   SSFPDSCAWTRTYGDYVNGEPGKPLFVSAVVYANSVWDEDAWGGETHFMDVGSGVGALV
FT                   CPRPGRVVLMDQDVTHRVSPPTRAANGRARYSLVYKLVFFPRAKGGAAGPDASLWERGI
FT                   ARAEWGPPSPIGSAAKLAAIVNAAARARRTETGAVKRDREEE"
FT   CDS_pept        complement(790774..791508)
FT                   /codon_start=1
FT                   /gene_family="HOG000036776" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639328"
FT                   /orf_name="MICPUN_98140"
FT                   /product="Predicted protein"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="ACO70607.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG703830"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI000199CAB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJI9"
FT                   /transl_table=1
FT                   /translation="MPLPAVVALGAQHFCLDQSDDQVKRIAKSLPWYGPKYSPHDVPSF
FT                   YDVSGITEDPAVFQLVVDFFVERYRSQGEDGPTHIAGFDARGFLFGPPIALALKIPFVM
FT                   IRKAGKLPGVLVTSGTYVTEYSTDETVMRLGSVRAGDRVVLVDDLIATGGTALAGFDLV
FT                   DQLGARVHEFAAMVSLPFLDGVGKIHAYKEGKYKDVPCFTMVDDASIGPEMCSDPPEGT
FT                   PRMVSAEQAGTMEADIVAKRAC"
FT   CDS_pept        792029..793600
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639329"
FT                   /orf_name="MICPUN_62970"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70355.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199CAB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ0"
FT                   /transl_table=1
FT                   /translation="MSRGCEWRWGPSDSATLRRSTCRSRALRHHGGRRTLRVTHGQSSI
FT                   WHLGIWHLASRAFPHPFFPARKSLSNAVMSLARATTAEIWSPRPPATVRRPSSRRIARA
FT                   PVPRAAAEERAASVVPTLEDATRDAVPLAEAIGPSGPPGAAVFALLVNGGTRVHYVGVA
FT                   KDASRALAAAASATVAADAMGDVAVAWANLPKSSRKPALQAAWRSWLGGVGYAPEGNAM
FT                   AARAAAEPPTSPSPSSPSPSSPSRSSPSRSSPSSPDEAAVEIAYAAVSKEAVASLCDDG
FT                   FVVLDDVLPADVLAACLDAANALKRSRKTVNVGQEGRDDSIAVLAGDALPAEGTALAGL
FT                   SPCARTLLAVPAALRRRHVEMAADEDGSLGDEDGRYVGTGRRWRGANQGANPPGESSGR
FT                   AEETMRRLATATAPDKLMLANYPGDGARYVAHLDNDPGDPRHSEGEPGLRASDRAVTAI
FT                   LYLNPDWEESHGGCLRVHLEGTGAKTTVDVAPSAGRMVLFDCRRIVHEVLPSHASRWAM
FT                   TAWIND"
FT   CDS_pept        join(complement(795087..795125),complement(793843..794724))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639330"
FT                   /orf_name="MICPUN_106326"
FT                   /product="G2-like myb-family transcription factor "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70608.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199CABA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ1"
FT                   /transl_table=1
FT                   /translation="MSDRSNEESGSPEIAPRDDDDTERHKTNGDATTAGGDDDVHGGGH
FT                   HHGGGGGGGKQPKKPRLVWTPELHMRFMNAVNHLGIKNAVPKTILQLMNVEGMTRENVA
FT                   SHLQKYRLYLKRLAGVPPSTPLPADIMQRVHPFQYPGTATAAGAAAMHAAGGMPSATWA
FT                   PTIEQMHAGVPPGMPTGFPDFQNLPPGHAGPPSADAFKDAEAFHAQMAATAQFMSYMGA
FT                   AGAAAGGFGPPPGAVGNAGAPGGSEEAAMNAAAMMRQGYSAGYPAMPYGSPPMPAGFMP
FT                   PPWMVPGAPSPGSGSFHDDPSSRRG"
FT   CDS_pept        complement(795957..798467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639331"
FT                   /orf_name="MICPUN_62968"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70609.1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199CABB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ2"
FT                   /transl_table=1
FT                   /translation="MVGFPRDVSPADVDSPGPTPSERPPRPQSSAKRASSLLSVPWRFF
FT                   RERSAARARRREEETRRAGIRREQRRAERERLRERVLSGALGCYPLSRAVLASEGRVLT
FT                   DLNRNARLIDGDAAGIRPGDVVVSSMMEDAGFLAPLDEDEDEDDQARRVDDDLNGSDDD
FT                   DDLNDTAGDAPRRPGLRRGRRSGRAPAPRYTHEPRVYFVLRGRVDVLAPGPGPAKDPTS
FT                   DGEDEKNEMNEKETGRKKRREGRDAKVRHGVWHRAVGLGPGACFSAPLQAMHGAECPGG
FT                   ARAVAGGKGLRLLTVPMSIVRRNGSAAVMETCRRETMELIRAVPWLAWIEPAWVRGFVI
FT                   DSFVLERRGDPPDARYVPVSADGSSGESPAGLDVPLVRAGEAPRAMRVVTEGAVTGAGN
FT                   GGVVTAGGVFHEISLAGAHAVFADSLDGEDGKKDGDGDGGGVSEGRLSSREWTAVTDAV
FT                   ARIAPTECIAMRLDRLRAHAARSAYVARSLERNEGAKALRASLLDRVVRSDDVITDEDL
FT                   VAMGILADANALRGHVPWRIGAAPVGTPGGPVPDPSSAPHGSVRREKIRAALKESLAFE
FT                   GAEDATLDKAIAEMRELSLARGDLLAEEGGECWGLCVLERGELSLYRSTPDPRRDRSAT
FT                   GAYQELVGRVGRGYVAGEIPVMFNTPNDATVVATHVDDDTRTRLWGLSRAQCERLWGKR
FT                   DERWRVKENALFAPFPRELPVFRAMERVRLEHQKRVLERAKAGLPPLARTASSAELCLR
FT                   ALPHGLGGTLLESVISRASPVHRLEASRVNEAIERTNAFIEDVRLAREAREERDRIQRE
FT                   RAARRAERDAEVAASGGGGSDGDE"
FT   CDS_pept        join(798888..798973,799103..800813)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639332"
FT                   /orf_name="MICPUN_62967"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70356.1"
FT                   /db_xref="UniParc:UPI000199CABC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ3"
FT                   /transl_table=1
FT                   /translation="MKRRESPVIDVKDTQPYWATVTTPATGSKNDANDPAASSTIRYLM
FT                   LEDTETGDIVCPLVYLREVFGLNYSRKTSNDRTRVIHEVPDGLVRAPAMTAQNLIQQQL
FT                   MRARQQQVTGRPAQPPAEPVPCWKLPFESSTDVKLQIRELLGDEGFSKGHVRLVSLPLA
FT                   FNVLSEKDEFRDTALFRAVHHVLKNTSYKCLLRRRRPAPTPDLDENGASGGREGASGVA
FT                   AAVSNGAAATTTTGDDFVLVDCVPPHRAGVTVAVEPAKLPRDRGSGVSLSARNRSGGDA
FT                   CAASDRRAALRGPWDMQKSFDKYVDYVSPDCMAKSGGRSGSSRGTAGDNGEGLRGNSFT
FT                   GPSRSLEPSAAGMILGLGERVMGHNGGPNEAMRMVIDPNDGRFSKMRRVSNTSTPPGGS
FT                   EGGWIGSDGQIVDPREIVSRQGEEIHRLKQSNEWLQHELASVKNALNELIGAMTEKERM
FT                   DVQQRRKALAGGSSNGGDRANSSALDASRSTGTDLPVDANGFYAGNTSMAASMLGTIES
FT                   VQAAVVAASVGASAGHLDAHHGLHAKPPPGLLQPGWGTFGSMPGPMSVPMRTGSGDHFL
FT                   HGTSDTLGDMNLEGGADGYMHH"
FT   CDS_pept        801125..805144
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639333"
FT                   /orf_name="MICPUN_62966"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70357.1"
FT                   /db_xref="UniParc:UPI000199CABD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ4"
FT                   /transl_table=1
FT                   /translation="MGGKDDVERWTSLYKGFTRPGRGKKLPEPDDATLRRLREVESRAA
FT                   PVSIAPPAPTTNRRERPSAGHATPAADPPPPPSSANDDTPPPTDELPAAATNAPAPASD
FT                   VQPRRRRQNKAELAEAQAAAKREAVRVAVRHAMGGALAEDPHLRRLEAAAKLEAEVERA
FT                   RAMAMGAGDGAGDGANDGASAHPRNGSSNPRQPPARRTKPTASTSRLARLTPASPPPPS
FT                   LTWEQHDAFLTYPPTRARYRHELPRGLKTSDLDALYRAVEREQRRFLAHVAQAARGVCA
FT                   SMGPRGMVRAAREWASRDVARRVDPKTGDAPRYVTPAASPAAGPGLTHAFSLVTGLGKW
FT                   ESDELNPSSSPAVLSLESVRRTGGSRDKPPSRPSSRLGGSVVGGVDDKPSAPSRRGSTS
FT                   NLSAFSGDSGGTRPHPTEAPIPPALLAACGRGVRLGEFVSALNPPLATALESDAPFVPG
FT                   EDEETIAICESTGASAALTEGALACLVANAPGRLDRAWDLPVAICVWDGNDDDDASKDG
FT                   SIGDVNGDVNGDERNRRINSRRRPAVVVHIGDPLPTRDCSPATWRARAAATYERAIARR
FT                   VEDARRVRELERLSQRGPLGSLSGDVPPPVHFATAHDGCVPVVRTHAVFSLGERKIVVR
FT                   STDMEVEAGDGSAQGGGKEVAETVRCKVEFTEDPDALVAGDLRVDCVEEEASWAEAARW
FT                   WCALAARGGDPGIQTSEGGSANGVGVVRDLTVVLCRVRARDGSVARPPERFDADEILRR
FT                   FCRDPPPPPSEMARTLGGGGGGGGVLSNGSTRAASRGTSLGDSGDDSGDDDSGDDDAGA
FT                   ATDPPHWFRGHGFDPAHGIQNVASAIDALATLPLGRYLLRHDVGSDVAEVFKEVAGPDG
FT                   SAPTRGATMRRSTFDASRSDSPGGGVGGVSGRRRGRPAAGSGSGPPRRGKPPATAIHIP
FT                   SGGRRTFGGRRMKNGGKRGHLFGGFSGVEEEEERPPPKSAKRLMVLPEIPMGMASALFI
FT                   GSSLEDPKPLRRGAGSLALAGAKNSKDFEPMPGPRDVGAECAAGVGYDWAAGHEKCADA
FT                   ERDSDEEDADGKPRDREECANANRLLGFEFLPPVCHTEGQIDRTPAPRGDPGAGRAKAR
FT                   RDQKRGNWRAVLAPPAKESSEGRSSDDSDSADDVPIAGLLARERTNGARSESDDDVPIA
FT                   GLLARSARAGGSKKKAGAIARSRRKGGAKGGGGKEKTAGKERDAPPAAAASSSDDDDDD
FT                   DVELEVDDDGHYVGVRYCRPFAHAGRCVRKGKCPDPHLTLREIRRMAARGESNEHAMRE
FT                   VRQRVYATFAAVNAGRHHQHTQQQQRAPAWGNMPSLGGTRKASWARAANSDEDDD"
FT   CDS_pept        complement(805362..805835)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639334"
FT                   /orf_name="MICPUN_109248"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70610.1"
FT                   /db_xref="UniParc:UPI000199CABE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ5"
FT                   /transl_table=1
FT                   /translation="MPPLLDGSALRRSLVQTPSERVMRKLSSTSPCAPTMPSTGKTRGK
FT                   ETFEHLRGILYPNSLVNGNTGTPVSFQAGMARLAEANARHVANRVRVSVKATPARVGSC
FT                   EAAAAVADVAIARWHLERAAPGGDEDGALQDVIDKSLAKDAICNIDDLLDHAE"
FT   CDS_pept        join(806886..806942,807184..810828)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639335"
FT                   /orf_name="MICPUN_62964"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO70358.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniParc:UPI000199CABF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ6"
FT                   /transl_table=1
FT                   /translation="MSTLAIDVERTAQNGVTSSNEPSPVGSMTHSPTGRKSPFTEDRIA
FT                   SIVGKKTLRRESSRGSAGSLAGLGLAGDASAATSPYGSAPPSRRESIGDLSAADDNGGW
FT                   RDDVDASAGDDAASVGGASVSSGMDGGRRRSLGRASGASSVMSFASTVSAGGGGSRAKP
FT                   ADTNLPGAPGRFLSWLPREPTLEGTLEKQKSEGYFGSISRMFGMTKRGWKMRHFVLYDN
FT                   HLFWGRGFSRMYGYGTVLSAKPAPEEGETAFSLELVTHPKFSLRRGGYDSLDYMQRLYG
FT                   LCCSTHGYSVRVMRAGTVLDRDRWISSLQRGLPPPDGTTRPNGTNTPTSPIDAIDSQEQ
FT                   SVFGLSTPKMSPRSSPEPPEVVAGGLARSPGSSENIAEKVEESGGFSPRVGIKKSPRAK
FT                   APATLEEAREQSGLWTPRDTTGAEAEAAAAWEAAAHAAMLSEAAAAEEELAREAEEEIK
FT                   AKADAAKRVANRADSRGGGSVSFADALDSVLEDEARAESKTPKATPVPGGGGKPPRPGK
FT                   GFPPKKHDSAQSINRSSSSSGSDEDVKDSARGSPEDSTSPADEPDSPEPDYDTADEALS
FT                   DAGSARTVLGTDDKTSGGGGAGSTGRRGDSVPAEWLAANTGGVRRNRLKSQVPPVSVLR
FT                   KTSSIEQKSRHSKGGSLHIADAIGLLGGGSGSNPEPTDGPGSLRRKVSFREEGEIESTK
FT                   LYAPTPTKRNPQGVGQTSAKYAPFAARGDGGGVPGTINELDDPSFDEALAGQFGSFSQQ
FT                   RALQQAAGRWVIPPQELKLGRRIGSGSFGVVYTADWNGTEVALKQMHDKSLSASNVQEF
FT                   SGEIRMMQGMRHPNIVLFLGAVIQAPRLSIVCELMPLGSLHALLHGKTQNGVELATNGR
FT                   LRRQMAQDCARGMSYLHSRSPPVVHHDLKPANLLVDSHWTLKVSDFGMSRLKHNTYLSS
FT                   KSPGGTPEWMAPEVLRNDPTDERSDVYSFAVILWELITLKYPWEELSSPVQIVVQVAFL
FT                   HRRPKLPTWLPAEAVALLQQCWHKDPDERPAFSAILGALKAEMPEAWVDQPTESPKAAA
FT                   FAELARKEQPFSGPISPQRPRRRDRAPSPSGSVNSVNSLASSVNDSLGGSLRSASPSIE
FT                   GNFVTLTGLKPIKTPKPAKKKGSSALGPNHMSENGAAAAEEDDDDDDDEDVFKGFPGMG
FT                   RVKVPGTARSAGSASANDGLRTPPMSPSRSAPGSSSSGGVKSPDMAAAAGVLPKLSPLK
FT                   IVRKLPTK"
FT   CDS_pept        811424..812824
FT                   /codon_start=1
FT                   /gene_family="HOG000100808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639336"
FT                   /orf_name="MICPUN_52494"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70359.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG557937"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199CAC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ7"
FT                   /transl_table=1
FT                   /translation="MQRMAANMGGGGMPYMPPGAAEQMKNMKPEDFARASEELGKMDPD
FT                   TLKAQMNAFKNQNQAQRDYALRGAEQLKTDGNRLVGEGKYNEAIEKYMRVKNNLAEDPS
FT                   PGAKTLRQSCQLNMSLCFNKTKRYNSAISECTEVLKQDGKALKAYYRRGQAHAAKEDWQ
FT                   AAVRDLRRAVKLAPGDETVKGELDKAIADLGRAGLADETNGECPEFEISATPSATPSMP
FT                   MPSGPAPDGDQMARAMEMMKDPDAMQKAAEMMENMSEEDLEAMGQMGGMNGMPKVDPKM
FT                   AKQAAAMMKNMDKDTMKGMMDMAAKMKAQGMDPSSMAANPNDPAMMAKMAEQMKNPEMQ
FT                   SMITDMMKNVTPEQLKEMGAAAGMNMSDEQAAQTAQMMKNISPETMQRMMKVGSALNGV
FT                   FTRFRSTYQWCMRNKLMAGSVAALALATFVSYVMRWGYFARAVAPDLVANGGAAADADE
FT                   EEVDIFAQ"
FT   CDS_pept        join(complement(813907..814206),complement(812863..813819))
FT                   /codon_start=1
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639337"
FT                   /orf_name="MICPUN_98139"
FT                   /product="Branched-chain amino acid aminotransferase "
FT                   /function="transaminase activity"
FT                   /protein_id="ACO70611.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniParc:UPI000199CB39"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ8"
FT                   /transl_table=1
FT                   /translation="MPVVLSEDLRENPEGTLRALCEAIGIEFKPEMLRWEAGARPEIDG
FT                   CWAPWWYKTTHESTRFEPPRRDKPPSPPLSAELSALVNECMPYYQFLRSHALKPRVEGG
FT                   PASGTHAYAPDPRNASVLIGMRDGVTGAFSLIPRVDAKVSVFDSGFVLGDGVWEGVRLH
FT                   GGVLLYAAEHVKRLFQGAKAIDMDVDVTLGDLIKMMYDTVDANEMHEGVHIRLMVTRGL
FT                   KSTPYQNPTFTVGKPTIVIAAEHKAAAEGPKVNGMRLMTTHVRRGAPDVQDPAWNSHSK
FT                   LNCIAACIQANKAGVDESLMLDPHGFVATCNSVHFFIVVDGVVLTSKRKYILHGITRDN
FT                   VMRIARGLGMETREEDFTLTAVYSADECFVTGTFAGVLPVREVDGRKIGTGERGPVVRR
FT                   LQEAYVKEADAIARRGRGC"
FT   CDS_pept        814940..815644
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639338"
FT                   /orf_name="MICPUN_62961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70360.1"
FT                   /db_xref="UniParc:UPI000199CB3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJJ9"
FT                   /transl_table=1
FT                   /translation="MSATTAFGFAASPFLAAAPASPPRITPRARFASAPRAPAAVLAND
FT                   GSSAMADDATAVLYYCSRAPAPAQLRPDASSLLPRDYHRGPQRIADVGRYWAMPNLRPL
FT                   KETDEGKINAMKVASVLILGAVLGALIQSNVQASRDAAPAAGADVDVDTEKGYGYGYGY
FT                   GYGYGYGYGYGHGYGDELEITTKRSAPEVEWRDAETTRPTPKKLSESDNVLIRLLAKVG
FT                   IGLKGVWDMLPG"
FT   CDS_pept        join(815753..815851,815963..816121)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639339"
FT                   /orf_name="MICPUN_62960"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70361.1"
FT                   /db_xref="UniParc:UPI000199CB3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK0"
FT                   /transl_table=1
FT                   /translation="MLAITLFWIVAFGVMIYFMIKEWKGLSRATRAKNLKLRTVIIPGR
FT                   GTVQVVAKPAPPGDPEYVPPTVSQGPRRKRMVDGELELPR"
FT   CDS_pept        complement(<816325..>817059)
FT                   /codon_start=1
FT                   /gene_family="HOG000265300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639340"
FT                   /orf_name="MICPUN_70710"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /protein_id="ACO70612.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG607565"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014599"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="UniParc:UPI000199CB3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK1"
FT                   /transl_table=1
FT                   /translation="HQSTAAKLSFADECRTLVDLGRYGVISTFAREHGGEYPTGSIVGF
FT                   ASDDDGRPIFALSSMSGHTGDLKANGKCSLTVTAPGFTGAADARVTITGTVAPITDADD
FT                   QKAARETYLAKHPDAFWVDFGDFSWHRMDGILGARLVGGFARAGGVSGEEYAAGAPDPV
FT                   AGFSAPIASHMNADHVDSLVAMVGHYVGLTVEDAAIASLDAIGMNMKVTRGGESFKIRL
FT                   PFTEPARDRKAVKEVLVGMTKAA"
FT   CDS_pept        817476..822071
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639341"
FT                   /gene_name="BRCA2"
FT                   /orf_name="MICPUN_62958"
FT                   /product="Predicted protein"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   homologous recombination"
FT                   /biological_process="regulation of S phase of mitotic cell
FT                   cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70362.1"
FT                   /db_xref="GO:0000724"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007090"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199CB3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK2"
FT                   /transl_table=1
FT                   /translation="MSPTTRSARASGGAALIREGTPISAGHDVTVAPRPDGSWVVQPNE
FT                   GRSAASHPPRVGPPKDADGLFLPLVDALNHGPGNECVSHDPAFAAWRDNLRVRAAAVYR
FT                   AAPRVDDTADRDVEKTAAARRRGSSAPMHDPSRSRDDENRDPASRVIGSMDVDDVGPDP
FT                   RREPTYNSSDDAPRPPDIYAVQTEDEDGPDAVETGAMGRTPSAGPAAGPSIPSTNSADP
FT                   SRTPATTLIKTAVGSIPAPPTAPPSAVTNDGGDAWGWGGRFDRTAAKTPRCTAPLSLTD
FT                   DAAFSPWVESDGGTGLGLGFAAGAANHGPPRGFTLDVNDAEEDANYFQNMAKAAKRTGG
FT                   LHAPSPGMFLPRGTPVIDGRGFTYPSPAATDRTPAAAAAAAALGGSRAYTPAALDKTPG
FT                   CLEGVHSLHAYTPAPRRYIQLESEVQAPVSSRGARPRIAAASRLAAESGNLPGPATEPE
FT                   PLDWLSPATRPSEKPLNEQSSEKTDKPPRKTEKTEGPSGDDAADEVGGFAFDAGFDGGG
FT                   GGASESPGFGGFRFAEETAPTPSPAAGIFQMASGKNVTPISADAMRRARGMFRDDTAEF
FT                   RFGNGRVTVGGNGGGGIFQTASGKDVAVSADAMRRARIALGGEVDGAPGGETIHATGLI
FT                   TPGVTASDGFKFQTASGKTVTPSVAAMRRGERVLGERGSGPEDTARKKARTTADTAETA
FT                   DATPAPPTSTGQSGLFRTGTGRAVAVSDDAVRRARSILEVEPAAPSAPAVAPAAPAAPA
FT                   AAPAPGGFKPPARTKQFNPPIRPGTRAVASTTSRLGRVGGTGGTTGGTGAGAAPSVHDL
FT                   FASRPDRERLGSFFDYLKPGERPGLPSVVLDPQVRAMSADTAVGYRVRDEANDIVLDSS
FT                   DIRSKMISEHGCLDRLLEPEWCANAYRWTVWTQSCVARAFPDAADAVKAPAVIHRMLYR
FT                   YEREILRAQRPWVRRVLERDTPAAAPAVLCVAAIRRFGTGGRDGHPARLELTDGWYGVD
FT                   AVLDAGLSSLLRAGHPGLRVGAKVLVQGAELRPHNSEPVPPLSKNAKDVHLALHFNGVK
FT                   PARWDATLGSLKKRVAVPLRTLRPDGGACASAVVYVERVYPSVWIETDKASGKRTHRGD
FT                   RAEALARDRWERARDAEVERIREEGTGGGTAGAGGRGGGPVGGPRGFVTEEAAREILRA
FT                   KGFLERDARRATRLRVSGVRKLAPGPRGSGSVPGPTGAALLTAYDLPDDLIATMTEGSV
FT                   FCVNDLQCARSFLDPAGGLELSTTRSTRWIPLTRSSLAKARLAPTPTPRRLVDCGQLGG
FT                   PTVPPGAEFDAVAYLIHASAPTPANAPKSQWAFLATASSGVDLLAVEIDARTPEMFVSA
FT                   DDWGAGRGWSSAMGGTMGLGLNPITPPPGPPLALRNLTYVAHDVANGLKVARATELTAV
FT                   TPLAQGAQGAQGAQGAQGAAREALEAWIRRVDARALVDRVIRLTGSGASGEGSPPCPAP
FT                   PPPVGSRGDRVSVGAADGAFGLDGWSLSQARAAEDAAMATLARKREEAEAARREEAEAL
FT                   RAAGLDDDDDD"
FT   CDS_pept        join(complement(822795..822969),complement(822219..822619))
FT                   /codon_start=1
FT                   /gene_family="HOG000265299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639342"
FT                   /orf_name="MICPUN_62957"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70613.1"
FT                   /db_xref="HOGENOM:HBG557941"
FT                   /db_xref="UniParc:UPI000199CB3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK3"
FT                   /transl_table=1
FT                   /translation="MSTAVASAPTIGVRNGNLMHGQRLSHARRVAVGARHGRVAPRTMA
FT                   FVPNLIPNPFHRWGDDANPNAPPETTLRGMLAAKHDKWQVGHENGYDESDTVWRKFRCR
FT                   NKAKGHELLEAVQDELYVPNEQGCRIRRESQGMFYMCCDGVRVRLNETKSEVLVEVPLP
FT                   RETNAEIAACEKTLRVVEDLAKKSGCKV"
FT   CDS_pept        823298..825073
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639343"
FT                   /orf_name="MICPUN_62956"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO70363.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI000199CB3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK4"
FT                   /transl_table=1
FT                   /translation="MAWAARGGEPSSLPAAVADAVLSKYASLPKNGKPQAHEYTSLAGF
FT                   ALTDDLTPDAPPVVVALGTGTKCLGADRRCSEGLALADSHAEILARRALVLYMYDEIDR
FT                   LVAAGRTRALENPRVSIFRPIQRAEKTIVGGAIARDRPQPWCSLRPGVRVHMYVSQSPC
FT                   GDASVFRAQTSADATNGLTDKPWVNHSSMGQPWVNKRAKTAANLGAGSTGAKLLTGAPG
FT                   AVTDAEFGAGAQRLGAARLKPGRGAQTSCMSCSDKMCKWNALGLQGELLSSVVESPVRI
FT                   SSVVVAAPEGGVEGGAEEGADKNDHAPHVAALRRAIHDRIARPYGAGYEWYTSISRFGK
FT                   SVDGNLVALPPPAVASCRPPPPNLSSASGLRRGWVACGTSINWIAGGGTSGGGGTTEVT
FT                   LGATGRKAGFSKKNARSPKSASRLCAASIAARFVSLAPKFAIDLRVDAGPGGDGRRLRY
FT                   ADLKVSDRDAWTERLSGSCLDVVERTEAYRRRRDVLIRPRDLLREGDDGTARCDSTAAS
FT                   SLVAASRHHLAPPGPDHPMFDTPLRDWVKKRGAPGGSMRADSPGASSFAVHGATPGAID
FT                   ARWWEPEDDGDDGNG"
FT   CDS_pept        complement(825198..826235)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639344"
FT                   /orf_name="MICPUN_62955"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO70614.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199CB40"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK5"
FT                   /transl_table=1
FT                   /translation="MSAPLAVARLAPPGFKLNPVPTPTRRRGRVVVASASPSANDAELA
FT                   AKDENPYEILGVDVTASKRAVRDAFRAAAKRAHPDTPGGSAKAFDALAKAADVLTDDAR
FT                   RAQLDAVLLNVPAGSLALEELRWSRELAALREAEDAGEVKDPAAVLEAARAYAAAEKAL
FT                   DAIAKRKKKAEDAEKLRRKEEALRASQAARLEITSRIATKGLRGNDVAVTMTVTSEMLT
FT                   EALEAQSAGGEKVPDRVTLPLRATTSVNCAKCNGWGEKEGHWTLALDKLCVKCSGMCRV
FT                   EKTSTVRVPLRVDALDGERVVVTGAGDEGYRKQVTALGEMTEPGPGGDLIVTVALLRDG
FT                   ETTRR"
FT   CDS_pept        826341..828284
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639345"
FT                   /orf_name="MICPUN_62954"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70364.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199CB41"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK6"
FT                   /transl_table=1
FT                   /translation="MEAAVEDAAVDPRFESFLADATDPTTPDEIQAQIRAGLARQYANP
FT                   PVAQTERCLRQNLTPERCRALVYWPDEDDASLYPALLADPPPGAPEDHPQFRCQVTYLM
FT                   SLYLCHSKRWAFAKGFILAGGLRALVGMCAHPNLHLRGQAMETLGALTREELYPWHEPP
FT                   VAGSSSDAALHARMLELARTPLVPNLVLNYDAPFPGASSLALRTLAFFASYLRLRHCPN
FT                   NVLRLSDDLLATLTRWSTRDDEHVSDDERQLAKTLLEDFGKFADVADAPTLNGPDAARA
FT                   AAELAQRQGADVLDVEVGVSNPGAAGADPDGAVVVADRTVVMTGSKSTNAADSSSNARD
FT                   RLDPNDADTGDAHRRRGNDAFAQKRWSAAIEHYTRAIDAPVSYARLFDEAPRRAAYHAN
FT                   RAAAYLARGNSPGGGYGQFDACGHLENHAWTDGDDGDGAVATAAALNAKAALLDCDAAL
FT                   EMSPGHVKAKFRKAQALWRLARVGEARTCAMSALHGAPDEATEAEVRALLESFDAPWRP
FT                   TPFPARGGERRERGGERTTKERNGAGVSTEKGRTEGDDDDDDGVGAPAPAGVMGGMSDL
FT                   LASLGASSDDGYPDFDELANFKSAGADEVFAEVDRFAAEMRAKGSSRETPSAASGIDAL
FT                   GSVDGDELYGLD"
FT   CDS_pept        complement(828342..830051)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639346"
FT                   /orf_name="MICPUN_62953"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /protein_id="ACO70615.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="UniParc:UPI000199CB42"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK7"
FT                   /transl_table=1
FT                   /translation="MSKKKRRDALAHVIRSRSPRLTPSFGSAEVLTISSSRLNRIRSKV
FT                   RSRVPLQEPPRDMSATPARVAIASRSVIAPRASRPPHRPASHARVRRARPVVPVVVPRA
FT                   GLEDTSDASSSVRSPAEEGEPTVTGPFPVDLSTLTADERAWLDARDELRVLVLGKTGVG
FT                   KSSLVNAIANANSAIGRLDVGTTQVQRVENTIEHDDESHDVCLFDTPGFFDVEGRTPAG
FT                   VLRELGGKVDDYHAIVYAHVATDRRLRLEDEQSVSFIVRALGARCVSRVVVALTFANEI
FT                   AGDDGTADEVLATRGAQASGLFADAAARVEGASSVEGASSVEGAVWVPCGSANDDGRHR
FT                   GWEGDLWRAVIRRAKAAADANAAGSPPAPFDESYDCTAAELEIDWDGLAASGISLQGAP
FT                   PKRPPPPLELVRAYVSLALGEYVSNDGRKERSAFAVKQRGMPSGFAATVVLEVYGPLDP
FT                   ERRGNGATTNAIYMLMPGTAADTVMKVRMGSVEDDELPSPAALRRGGAEVTVGGLSVNG
FT                   SGPVTLRLDRNDGSFVGGTTRVSAGGIVEIDPETGDAVVMARKTPDTKEEPG"
FT   CDS_pept        830269..831330
FT                   /codon_start=1
FT                   /gene_family="HOG000136697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639347"
FT                   /orf_name="MICPUN_62952"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase "
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="ACO70365.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199CB43"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK8"
FT                   /transl_table=1
FT                   /translation="MASAPPNPPHGVPTTLLVVTKPELLASAPLARITSGTDPRFPTAR
FT                   FDVRVATKLEDFPREITQARDGCPVALLWWFGDPNVMGGVLRSPCAERVTWIHSGSAGV
FT                   EHILNTQPEVRAHPAPMTNARGAFSASLGEWAIFASMWFAKKVNAMRKSQAAGRWMRDT
FT                   VGMLKGKTMSIVGYGDIGRACAERAKAFGMRVVALRRDPNKFAPQDERVVDEMLPLTEL
FT                   RRAMEEGDFVVLALPHTPQTEKMINAGAVASMKRTGVLINVGRGAVVDEDALVDALREG
FT                   RIGGAGLDVTAVEPLPTGHPFYALDNVLLSFHCADLTDDYYELTMETFVEHARAYVGDG
FT                   GRGWNLVDKTAGY"
FT   CDS_pept        complement(831406..831903)
FT                   /codon_start=1
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639348"
FT                   /orf_name="MICPUN_113535"
FT                   /product="Putative uncharacterized protein "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="ACO70616.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG436297"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="UniParc:UPI000199CB44"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJK9"
FT                   /transl_table=1
FT                   /translation="MPLEPVEVEYCSLCGCPPEYCENAGCKRVKLEKEMEGASVCDEPP
FT                   VDAPAAEGDAPAAEGEEKKEGGKKKKEKKAKGVTITRTTRNKKKTITNVAGLEHYPEVK
FT                   IAECAKTLGKKFACGASVTKGPTGKDEIDVQGDFSHEIADLLAEKFGVDRETTKVVDKG
FT                   RH"
FT   CDS_pept        832087..832950
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639349"
FT                   /orf_name="MICPUN_62950"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70366.1"
FT                   /db_xref="UniParc:UPI000199CB45"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL0"
FT                   /transl_table=1
FT                   /translation="MAAHEATAPRAIVARSIARATAGRRPRAGPKGAVASRIQPGPGGH
FT                   PRSDGDVAPETSSSRRGRRDALLASFLAVTLRGSSARATDAASASAEDRAPAACGSCEG
FT                   VVDGTLGRCEGFGRDDCRSCFDDRPPYFVAPWEYEGSAADAARAIEDAVVATGGRVLAS
FT                   TNEAGDDGGKGERDGYVVGVFGGDDSIVLEFYIDESAAACVVRGTRRAPTRPTLTVPRF
FT                   DSPLDRQLELVRAELRWLEVPVLRNRKINALVGMETPWDDFGPPPPPTMEEMYGADARR
FT                   LDDPLQ"
FT   CDS_pept        complement(833033..835705)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639350"
FT                   /orf_name="MICPUN_62949"
FT                   /product="Predicted protein"
FT                   /function="phosphorus-oxygen lyase activity"
FT                   /biological_process="cyclic nucleotide biosynthetic process"
FT                   /protein_id="ACO70617.1"
FT                   /db_xref="GO:0009190"
FT                   /db_xref="GO:0016849"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniParc:UPI000199CBB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL1"
FT                   /transl_table=1
FT                   /translation="MATDNASVPPHAAHVPRVLFERIARDPASAGRPHAFTADAAVVAV
FT                   DICGYVPMTARAMLGVLRRERSVVRPERLRGSFGSSSSSFDRSFDGDVDVGDEPARRSW
FT                   SPRSSGSSSPGSERDDLICHMSVAGLTGEEARNVVSACFAAVIEEIHRRGGDVLKFAGD
FT                   ALFAAWIATERESLGDCVARATRCALAVHARVAAGDDQKPAQTQKPGMTGTTTKTELKV
FT                   CVGAGRLCAFNVGGVGGKWEFVCAGEPLAQIARVMPAATGGGTLVSEEAFLAFSAKSPR
FT                   SSSRVGRNVRFAAADTERGYRLVTLGPCDDEEEDDEDDDEGDVARRRRRTTVTPTPEDI
FT                   AARHAPGAPNERAEWTAAVAAACASHVPPPAEGGGAPLASIDPGTHGRGGIHHSDPSLD
FT                   ECQWIGSIRRCSVAFVHFEGVDLNDVDERTGACLGLPSLQRAVVTMQRALSRTRGASRQ
FT                   VLVDERGSALVAVFGADASERQSSGNGINDEPSTDPYGADGVGRSIRGVSDACAASNTC
FT                   ASDATLAAVDIARELRGVGLRVACGVSTGDAFCGLVGSIDRCEWAVYGDVANVAARLCH
FT                   HERNAGVLVCDATRDACEEETRTREGGSGNVDFFETASPLRIKGKRRAVVAHEPRARDP
FT                   ASDPSSEASPRLTTGSRRLRRTGSLAAELDTLRRRMDAMPGDVRRVARTAAVIGGDVDV
FT                   ELLADIVERTSYMSNERGHHVRRRVDACVRVLTERGVLVEVSGGPNGRANRGGCATVRF
FT                   ADELTRKVTYSSLTDAARRPLHGAVAAAREVALGVGSGPVRGGIGTIRGGRRVGSRTLG
FT                   PEDASELAYHWNRAGRVDRADEYLELETEEEEAAALGEEDALDIGDLSEVTVTLSLDGE
FT                   KGGEGGSRRRKGCFAGLFR"
FT   CDS_pept        join(835955..836154,836312..845300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639351"
FT                   /orf_name="MICPUN_62948"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70367.1"
FT                   /db_xref="UniParc:UPI000199CBB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL2"
FT                   /transl_table=1
FT                   /translation="MGRAMGRRGASAPATAASFAPRWFVPWAWVVVALMAPLAVGGADP
FT                   EFTLAYPPPPPPGPTAPSYVPRQPPPPPEPPLPAPPPLPPAPPPPPPNPSPPPHPSPPP
FT                   SPPPPPEPPTWGVPFPTRDANGDFCVMDFGVQPEGTANAKYGSVRPNEFPTAQFLDAAS
FT                   YVPARTLANASIAAIDETQTDPRARLLGGCPSKRVACVSSGYGGSYTWRDTMTTDQNII
FT                   QEDQLPDVEVLAAVFPAQPESSSGPRSWGGDGWGEYHLETELSQGMLLFDTDVYRLSFK
FT                   DGLVYLAAGTTCQPERRARLACPDKYWLNGTMVPNWEEVQRTNFSLVFDGVPPGVVIGA
FT                   YPPGRWAHVRVTISLQTPTPETGVIGKMFDVRAEVHFQGSLPVVGSTVAYARLTDRLGP
FT                   VRLTHRGDTRPGFPPPPAPPFAPGYIHPPTPPSPPTPPSPPPPPTPPTPMPPYPPPGSA
FT                   GGADVARPPPSPPPSQPSPPPAPPAPPSPPSPPSPPPPAWETFKYHPPACIDSIYLSFV
FT                   RKAFITKKVDGNSTTELVFQRVQLSSQRFEGAVAVTDASFELGYVSVEQTKRVSATVPP
FT                   QKCYNPYVTHTWEVLEAPRAVSPVGYRSNPWEQASADEETTGAAAATTTRTGTGGAQLA
FT                   LPPPPPAPPSPDESLASDWRRFYAKNQPVGHASKLSVIPDGPGRYVFRVTSTGSCAGQA
FT                   SAGTVTMHVDCNLPPAPEAAVTQAADVVVDLELSPRYAAPPPAPPPLPPPPPENPPPPP
FT                   PLVAGGTPGGTPGGSTGGAGPAPPAPVTVYAAINPYPPTKPLASTPRCFAKVSLDGAVS
FT                   RDPNEGRAFIDGGTGGDTFTYVWTLESTPGASLLARGTYGDPHGSFTQKDTVATLRPDR
FT                   EGTYVAALTVYDGCADPVKKTFEVRVAWDGTCIERAVATRTGFIVPLAIPLALALIVFS
FT                   AKLPPLRWTHPRQIALDARAAAAARRNAEEKAKIIAEAVVDGPTLRERNDWLDGERRRR
FT                   RKILRATCYDVLLRGVPRREARRLAAQAQPPTPTKRPAGIGPPARTSKSSTGRTSQMTR
FT                   GKTISVTDDGVPSAGPVTEAFDFSSLSPPKLFGKERVQRGGTQQQQQQQQQQQQQQQQQ
FT                   PHKRLTERERRAQMLNRVVASPIERVAAAFTLAGDYAREAYDAATRRPRYVFFRFRSQL
FT                   VTGWMYLFHVPGGWQGVLLRAHLVLEMPALVSPFIRPGSPPFARDGDPSTEGLIDAVAP
FT                   AVFLGANMTTEDTYFALAVFTLLAFASIAGPSLGWALTKLGERSWVAVFEIAKIVESGG
FT                   LVLRERDKRDPTRRAEKEASIEKRRKDRFRQAGAAIPEEMWRRASYADVLDALDDHFEI
FT                   PAVQRMLLDDEDEDDRMIKWTRRGLRRRRAARWLTWSGRVCSLCGTLAVAVFATLGFLP
FT                   ATHAGLSTLIPSANDHARPWVYFSKDPNVFYGSPEHVQLVGLGWFVVTTCFVCALYRAR
FT                   VTAENVVSLRPQPAFEIFAACAKLATAFVSVSWEAQLGREAVAAARDAVIRTAWMHDGA
FT                   LTLIATSLLVTHMTTQSLRGDAAGWNQWRAASFGAAAWVGTLCIAAKMFGHDPAYLPFL
FT                   NEPSVPGGGAPTSANAEDASSENLWRMVLSVTIFPAMLLFAVLNRILYRHVSLADEVAR
FT                   PPNPLLDDEGHTDAGPIAAAKKARMADRKRVAVDDGAWKTSGDDRKQPGRGGYHLGSSE
FT                   ADDDFNDVETGRARNTAAGLGSDERNVGRGVRTAAGRRVRRLPPPTAASDSFGLSGLLS
FT                   ATLSAVGAVASVLRRAHAASLALVLGTPAERGAAARSKAIAFARSRHRRDRVVAWLCEF
FT                   RNLNAFDKSLAGRVEEARSADASHAIRATEELLALAYVLLADADVWVRLGGEPMASAAL
FT                   TSLATAAGAACRHDPRLAWRALPLFARALRSPHPELRGGAAQALCDDTFASAASALLFH
FT                   RHDVGLRKPRAWDLRRFIDVTFEDPTLLAAQHLPGTGLTRYRQLDMAYRAECVVPWRVV
FT                   VRAKARALVEMEGASVGSGERDKEEEGDSRNDSRDGALALHLALRSMDPTGETLGSTPL
FT                   AAVGKRIVTSETVSATAIRTQVRRAKAARAVTRSGEEKSERRVNARDDSDDDVEDDDIE
FT                   RMNEDQLSNFNPLVLMRRAHEEDEATHLRTPLESKLASIRRFKPAAPITGTEDPNGRNL
FT                   WHRACLYLGASAAMRRKRRTHDAERIRRAREVLDLLLDAALGGRGDQLGSARIAGDGRR
FT                   GAKRSAFSLGDACEVPAGGGDGGGQGDDSGGRGGGDETRPAELPAHGAAAAIHAVSKFV
FT                   VRSGGGPALIRSERRLAAALRASGGHDRPAQVVSRAGGMLHALVQRRRLRGKLLRRLGR
FT                   VCSRLAEENAQPVNVSVGEKPDTEVLAMRALDLMDRAARACMNDRGDASEAAVTTAHAW
FT                   HVAGNRAAVDGDSRNDANLFELPLKLKARAACDAARAADRGSIVIAARGALALLLDLTP
FT                   AVRVAAAAALGKLGALLVAGEATAAAEKIAEIVGDEDEDDGCGRVPAVRWNREPDDWET
FT                   GRGPGEDDMEAEEEYRGSDGGKTLAKSGEEGKEEEDEEGSDDEDDDASHEVSALDAVEN
FT                   LDGGVRLASRVVKSSSKSRPFDSSWVCTALARSAARDDSQHSKEAAVAARDAILESKAC
FT                   AKFACERYKYGGVVGAHVAVWAALNPDQETPKMVDEIHAAKTEAILRRVKREIKDRRAI
FT                   MRIEGDAKLPDIDEEAAARLVEVCTNAVREALSAHQLTHTSARMAGAPEGAARRERVVA
FT                   RQRAALEAQAVVLREAGMSLDDPNALDLARSLGIVVPEEFDERVVGHTSGNTFDPAPKP
FT                   PGWTQDENAPSSRGGVPSGKISAEDMHRARGPDKETLASIKNMLRHSVARQHEKHETRS
FT                   RARVANVWRDARLQREKKLLRRGEELPKYPGYEPVPAENIPRTSDPTHRPVDVYHGLRD
FT                   PTNPRAVADDDPMHDRKVAPPGGDIELSRPFASRPKLMRPSARDAFRRDPLPGPSTRGI
FT                   RAREEVRDAERAARGERRLETSRRYFGTESFRRPETLTRRDATGPAATDSGSDAMGGGT
FT                   NGGGSDAS"
FT   CDS_pept        complement(845488..847029)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639352"
FT                   /orf_name="MICPUN_62947"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70618.1"
FT                   /db_xref="UniParc:UPI000199CBB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL3"
FT                   /transl_table=1
FT                   /translation="MGSMFNKSGRQMVLMAHGDTSYDDPGSGLCVPRKLTVTGRDGFCR
FT                   KFEPRNGPRKHSCEVLSKSLVSPRAEITSRHARAPRAASSDSATHSTVVMPPSPGARDP
FT                   PRARNGARAQPRTRRLVASGFYAFLLLALTALAPRVSALALGEDEGPFGIADDRRILID
FT                   VDFDPNDYPEPYDDEGTPPFSPLSAPGPSSSPTGALAPAAAPAAAPSAAPTPTPTPTPS
FT                   PSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPAADTPPPTPEQ
FT                   VEEKKAAADEKKAKATATRDTVLQSIPDEKLKEKAKLLADAAISGAPVRKMTATLTATT
FT                   PDDACATWFSTAGLSPDSGACVASVAPPAANTRRRLLLSLRGSRNLRRNLAQTTSAAYD
FT                   VDVFFDSTTIDVAKLDDAVASLTQSGVAVEYVQEVDPVQELKTIPGVDASAVEDFAVDA
FT                   KEAEAATREYEQAAAAAPPPGVLIKGPVVSPAGGRARFAFGCVAAVAAHALLLAA"
FT   CDS_pept        847196..847756
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639353"
FT                   /orf_name="MICPUN_98138"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70368.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199CBB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL4"
FT                   /transl_table=1
FT                   /translation="MEVSESEEEEEEATKKGTKRKRAPPTKGPCEHGVKRRSSCKVCSA
FT                   CPHGKRRRDCKECGGSGICVHGRRRFRCKECGGSGICVHARHRSSCKECGGGAICEHGR
FT                   RRSRCKECGGGAICEHGRQRSQCKECGGSQICEHGRMRSYCKECGGSQICEHDRIRSQC
FT                   KECGGGSICVHGRRRSTCKECKK"
FT   CDS_pept        join(complement(848958..849692),complement(848598..848870),
FT                   complement(847887..848525))
FT                   /codon_start=1
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639354"
FT                   /orf_name="MICPUN_98137"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="glycerone kinase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /protein_id="ACO70619.1"
FT                   /db_xref="GO:0004371"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="HOGENOM:HBG473357"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="UniParc:UPI000199CBB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL5"
FT                   /transl_table=1
FT                   /translation="MGHKFLNDPGSAVTEMLEGFVQSHPGVKLLDGFPDVKVVVRSHVD
FT                   KNKVALVSGGGSGHEPAHAGFVGDGMLDAAVCGDVFASPSVAAVLAAIRHVTGPPGCLL
FT                   IVKNYTGDRLNFGLAAERAKLEGLNVEMVVVADDCALPPPLGVAGRRGLAGTLFVHKCA
FT                   GAAAAAGDALDLVAEEARAAASAVGTMGVASAAHKLPGADDPARAIPPGELEMGLGIHG
FT                   EPGAFTAPAAPVASVVAKMLETIEKTKVCVMVNSLGSTPAMELHVAARCAREWLSSHDL
FT                   NPVRVYTGSFMTALDMTGFSITLCQVDSARLARIDAPTGAPAWPVVARTVSVPVPPPKT
FT                   ECGALAKKAILGAAEMLKMAEDELTDADAKVGDGDCGTTHARGARALEEDVVYMPLDEP
FT                   SELALAIGMTVRRSMGGTSGALYDIFFSAAAAAMKGAPATSPATWLAGFKAGIASMSRY
FT                   GGASEGDRTVLDALLPAAEAASKAITQSAGGAWAASVAADAAEKGAAATKEMVASAGRS
FT                   SYVPVEVMKSVPDPGATAAAAWIRGVAIAIA"
FT   CDS_pept        <850295..>850930
FT                   /codon_start=1
FT                   /gene_family="HOG000233412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639355"
FT                   /orf_name="MICPUN_71530"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70369.1"
FT                   /db_xref="HOGENOM:HBG319955"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniParc:UPI000199CBBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL6"
FT                   /transl_table=1
FT                   /translation="VNPGLYCDWSVTDADVAEVWAYRVSLSVVALSVLACSSRVFIGNG
FT                   GSDPSWLDAAYFTGAAGLGVALRLIHMYVDPIKKFMQALYAAGLAGSIGVAALASQTGD
FT                   GGSVPAYVVAHPAAVWAVGPMFAALTGVAFKEGMCYGKAECAALFFVVPATLLAHLTGL
FT                   ANEEIEKGLLGTWCVLIAVFAARKYTQEVKDDIGDKSVFIFADLREDEK"
FT   CDS_pept        join(complement(851817..852404),complement(851064..851717))
FT                   /codon_start=1
FT                   /gene_family="HOG000218323" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639356"
FT                   /orf_name="MICPUN_87019"
FT                   /product="Glycosyltransferase family 28 protein "
FT                   /function="carbohydrate binding"
FT                   /function="undecaprenyldiphospho-muramoylpentapeptide beta-
FT                   N-acetylglucosaminyltransferase activity"
FT                   /biological_process="UDP-N-acetylgalactosamine biosynthetic
FT                   process"
FT                   /biological_process="lipid glycosylation"
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO70620.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0019277"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="GO:0050511"
FT                   /db_xref="HOGENOM:HBG617076"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI000199CBBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL7"
FT                   /transl_table=1
FT                   /translation="MDLAEESSPALRVLFAAGGTGGHVFPAIAIADALRRMSDEGSLPA
FT                   AATARIDFAGTDHHQEATHVPAAGYALHRVPAIALARPLLSWRNVLVPFKLAYAVARSI
FT                   VLITELAPDVVVGTGGYVSLPTCLAAKLCGVPLVIQEQNAYPGVANRILAKAASLVCVA
FT                   FAKAAEAFRMEPLGTHDGTLGTLSTPARGGACVTPSIRDTDRVLVVFGGSMGCETLNDA
FT                   MSDAVGGMLERDPRLWVVWQTGRGGYERVRSKTPSHPRLAVRSFINDVENCYAAADLCV
FT                   ARAGAVTCSELLASGLPSVLIPSPVVTEDHQSFNAKEMADLGAAVEIRDCDLAQKDPKK
FT                   SIKPGEPAPRRTVRLDYVIGELLYDPEVLAGMREACLEAAAPEAAEAIANDVVSVALAA
FT                   RRRRAGGRVASLGR"
FT   CDS_pept        complement(852917..856075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639357"
FT                   /orf_name="MICPUN_62942"
FT                   /product="Vesicle coat complex AP-1/AP-2/AP-4, beta subunit"
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO70621.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG557951"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199CC3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL8"
FT                   /transl_table=1
FT                   /translation="MVGQSPPACGAAGLLSRDDNTQDAIGADTLRRERPTPARGPIVKA
FT                   RTSPIARPRCRCRARWAVSATTTPRCAAPRTRRIPRIRPSARDPIPRARFPRQPPAPAR
FT                   ASVAHPLRVRSPHILQIADEARELDKSLRSTNTGEKLNGMKKLLGMMSAGRDVSNFFAS
FT                   VVMNIAQDSFEVKVLVYLYLVRTAEQKADEALLSINSFQKDLAHQNPRVRALALRVMSS
FT                   IRVQVIVPVVILAVRKCAVDPSPYVRKAAAHAIPKVFRLDPKRVDELTEIIETMLRDST
FT                   PFVLSSAVAAFQEVCPERIDLIHRHYRKICRMLVDCDEWGQILLANLLLRYARTQFTRP
FT                   DAYDRSLADTGADDDDASKTLELVLPGDGGAFEKASSNPLAGTKGFYSSSDSDDSDDDS
FT                   DGDDADGDGSGGSDSDVPRAKKPPAVVKKKSDKSKKKRSKKGAKRGPKGPKPTKDAAAA
FT                   AADRMTSEWLDDDHRLLLRSSRPLLQSQNTGVVMAAASLQFYLAPVADLPKVLRALVFA
FT                   MRMKPEAQHVMLKNICTMCAVQSSLFQAHFASFFVHPADPVDVRALKLEILTHVVTSDN
FT                   AAALLRELQSYLRSTNNEFVALTIRAIGRCAAIMPQIAAVCIRSLLELSLHPSEEVAGE
FT                   AVVVIRALVQQNPKEHAVIVMRLVRRLEMLAAPAARSAVAWLAGGELYIFGEKAVSLAA
FT                   LPEPVTADPTPEGPSGFVATQVSMLESSLLDSPTGTNGSDAGEERGDAAIDALIAAAAG
FT                   GEGEDSPATEDAGAAGAVAVVDEKAQKRAAKKAEKEEKKRLDAANSAKAEAEQREKFFE
FT                   LSFSVLKRSLRNFARETDVTKLQILNSACKLFIKDPNRVGPVLKHVFALCATDPSADMR
FT                   DRVRIYRAMYAVGGNAAPLAVLKEKVVLCDKPAPKLPSPAAPTCVHALGSLSHFVEHVA
FT                   PGFVALPDHPDVQPPSHVRDQYYNQNADAAGKGGKKSGKGGFYSDSDDSTSDSDSSDSD
FT                   SSDSDSGSDSGSGSSGSGSSSSSGSDSDSDSGDETSMSESSDSDSDSDSGSDSDSGSDS
FT                   DSSD"
FT   CDS_pept        join(complement(857508..857547),complement(856826..857385),
FT                   complement(856455..856730))
FT                   /codon_start=1
FT                   /gene_family="HOG000265332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639358"
FT                   /orf_name="MICPUN_106323"
FT                   /product="Putative uncharacterized protein "
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO70622.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG557954"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI000199CC3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJL9"
FT                   /transl_table=1
FT                   /translation="MPSYFGDIAKAAKDLLTGSVNFDNKASLDAKNVADGLKISGSCVQ
FT                   KGGAGDPTGTVKATYDLASDVVAETEVGLPSNKITASLAHSGLLKGLKATLSGNPQDVK
FT                   TAKLALQYLQGAVGLKADLTDLTAGAPKADVSLCWSEGDLAAGVSGAVDTKAFPDPAAL
FT                   PGKLSYAVQSTGVVPDSTVALALSDAFDTVKASIVTKVDKDTTAGAEVVYKRAKGTASG
FT                   SVGLSKRFSAACTGKAVVTSPLPLNGAAAAPVLTLQTTGDVFANTSGSASVQVDTAAKY
FT                   KYGIQFATKV"
FT   CDS_pept        complement(857993..869683)
FT                   /codon_start=1
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639359"
FT                   /gene_name="DHC3"
FT                   /orf_name="MICPUN_104978"
FT                   /product="Dynein heavy chain"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /protein_id="ACO70623.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniParc:UPI000199CC40"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM0"
FT                   /transl_table=1
FT                   /translation="MNRCVFDDAIVQPQHGLGSRVERRLARGGAAAPVGDSDALIEGDA
FT                   DALLVEAPEGYDLPTRSLTRRPAPRKATAEDVPPYDFAQSFGAFAQATKLTKPEAYAAE
FT                   MTIAAENAALLRNYAMYRTLFPKPTRLEEFEGAQKQALQNLSVARDKWVAAVRKTIVVG
FT                   FKTAGKGWFNLKETDQTAYGYGKLKRFIKTTQLRMEDTLRSLTESNVRGFRDFVLDRCA
FT                   PKLTVAATNDVRFENPEEESAFGPLFAVDLVVKEDSKKSENSSFQFTTSVDRFEPAVLD
FT                   VFENGVCSLHGIKSLEPGIMSHLHWTTWPVTASVQMTEPLVADARSRVADALKNSVDSL
FT                   NAYYSLYDEHLPVLRLDVNAYVKSLLARDEIEEGEGLRLFTGEIAEHEAGLAKILNTVP
FT                   TTQVVGPFRVNTSHVREFLVAKYETLIERCKQLVADVPMRVCEEVCRVYKEFNAKLTTP
FT                   AEDPESVKDVRDHAETIPLTCNQQKVVLDEAYPYLDALEAMRRPLDDGLGKLLAAAQFY
FT                   PRQLEDTAGLVETQNAELMLKFQEDQAAEQDDFWSQAKNLETTVSELGGFTDMEECAVN
FT                   AARVEEMMAELKELQAKADLYNSREGMFGVKQTDYGAVKKIAEQFDPFYQFWTYAQGWR
FT                   DGLARWRDGAFVELDAEGMDRDVAAAFKVMFKMGKAFNQRQLPDCAKNCDTIRQEIEAF
FT                   RVYVPLALAMRSPGMRERHWEKIKADIGLEIPATDPEFTFGAAIEMGVKDKEDEIVAVC
FT                   DVAGKEYGIETALEKMHGEWEGIALEVKEYKETGTYVIRIDDEHAQMLDDQIVMTQAMS
FT                   FSPYKAPFADEIATWEKTLRTVSDVLEEWLEVQRSWQYLEPIFGSDDIMEQLPLEGKRF
FT                   GAVDRQWRKTLVVAEEEPGVIVACNKKELLELFRESNRVLDGVQKGLAEYLEMKRLAFS
FT                   RFFFLSNDELLQILSQTKNALAVQPHLRKCFEAIHSLDFEKDLKITAMNSVEGEKVPFS
FT                   EHMYPKGPVEIWLGEVQRIMIQSCRQSIIDSLVDYQAQKRAAWVKCWPAMTVLAVGCTY
FT                   WTSEGETAIKAGKLAKWFDKNISQLNDLTDLVRGKLSRQERGTLGALIVIDVHARDVVT
FT                   LLQNQKVTALSDFDWVAQLRYYWESKEDDAREQPGELNVKMVQASLPFGYEYLGNQPRL
FT                   VVTPLTDRCYMTLMGAMHLNLGGAPAGPAGTGKTETTKDLAKALAMQCVVFNCSDGLDY
FT                   LAMAKFFKGLASSGAWACFDEFNRINLEVLSVIAQQILTIQIAIQQKQKRFIFENTELD
FT                   LDARCCVFITMNPGYAGRSELPDNLKALFRPCAMMVPDYALIGEISLMSFGFKNARPLA
FT                   RKMVATFKLCSEQLSAQDHYDYGMRAVKSVITAAGNLKRDFPEDDEEILLLRGLMDVNV
FT                   PKFLAHDLPLFEGIISDLFPGSSKPEADYKDLMASLDQSCADLGIQPVPAFINKVIQMY
FT                   EMTLVRHGLMLVGPTGGGKTMNYRALSTAMTRLAKAGSDIYKKVKYVVLNPKSITMGQL
FT                   YGDFDPATHEWEDGVLACYMRDLSEEQTLDKKWLMFDGPVDAIWIENMNTVLDDNKKLC
FT                   LVSGEIIQMSATMTMMFEVEDLAVASPATVSRCGMIYMEPTTMGFTPLLDSYLQSLPDL
FT                   FQPHVDKFREIFDAVVPGMEGIVFFMRKNLKETVTTVDTCLVKGQFNLMASLLKRYVRD
FT                   PMKGEEPLSGEERRNADKAAVPLWIFSMIWSLCASVTGPGRPQLEQFFRKKAEEHEFAN
FT                   FMPPEGKGDASMYEYCYDQDKCKWVEWMQTIPEYKPNPDQAFASIIVPTADTVRYTYVI
FT                   DKLLLNDKHVLCVGDTGTGKTLNVMDKLNNNMPDLYVPMFMTFSARTSANQTQDFLDSK
FT                   MDKRRKGVFGPPMGKKYAILIDDFNMPMREKYFAQPPIELLRQWMDHGGWYERHPPCPF
FT                   RTLQDMIIVGCMGPPGGGRNPVSNRMLRHFNFLSFTDMSDESSIRIFDTILNSYLTKKF
FT                   DKDVAALSLPICEATVNIYNTVRRDLLPTPAKSHYTFNLRDLARVFQGLLRADPRVVAE
FT                   DRNELYGLWMHENLRVFQDRMVNNEDREWFRELIDATAKEKLGVGWDEVVSLPEPKRPP
FT                   EEADNDDWVPPPRVDRLIYGDYMIPGAEPRVYQRVKDRSELQRVVEEALDDYNGETTAP
FT                   MKLVMFLDAIEHVSRICRVIRLPLGNALLLGVGGSGRQSLTRLAAALEEFHLFSIEVAK
FT                   GYGKNEWRDDLRKVLLMAGAEGKDVVFLFTDTQIVQENFLEDINNILNSGEVPNLWKSE
FT                   DVQTMTEALRPLLQAQGLPTTKNAVNTLFITRVRSNLHCVLAMSPVSDEFRQRLRMFPS
FT                   LVNCCTIDWFSEWPLEALESVANTFLGDASLETPELLKGVVDTCVYIHQSVERKSKQFF
FT                   DELRRFNYVTPTSYLELLQTFIRLVKEKREEINLQKSRLQNGLDKLSDTEGKIDVMKLE
FT                   LVELGPVIAKTTEEVEAMIEVIKVDTAKADETKAQVLAQEEAANAKAAEAQAIADDAQA
FT                   DLDKALPALDQALNSLKLLTKADIVEVKAMRNPPAGVRLVMEVVCIIFGQKPKMVEDKS
FT                   PGAKPGAKVADYWEASSKMVQDPVAFLSSLLEFDKDGITAETIEKVEPYIQRDDFKPEI
FT                   IQKVSKACTSICKWGIAMYTYYMVSLQVAPKRAALAEAQASLEVTKKELAAAKETLAEV
FT                   EAKVAGLNAKLDEANGKKKDLQDQSDRCEAQLERAGKLIGGLGGEKVRWNNTIVALDEQ
FT                   LGRVVGDVVISAGVVAYSGPFTPSFRTDLLKEWSERMVDANVPHTPGADITSTLADPVQ
FT                   IRSWNIAGLPSDGQSVENGIIVAKARRWPLMIDPQGQANKWIKNMCKESGIDVIKLSNK
FT                   DYLRTLANAIRFGRAVLLENIGEQLDAALEPLLQKQTFKQGGSEVIKMGDDIIPYHPDF
FT                   RFYMTTKMRNPHYQPEVSVKVSLLNFFVTLDGLEDQLLGTVVMQERRDLAEAKNQLVVS
FT                   NARMKAQLKDLEDKILYMLSNSTGNILDDEELINTLAQSKVTSDDITEKVAEAEVTERD
FT                   IDQTREKYRPVATRASVLFFCISDLAIVDPMYQYSLAWFISLFIRGIEEADKPEEMEDE
FT                   EARAKLPADDVEARIEILNEYFTYSLYNNICRSLFERHKLMFSLLLCVAIMQQRGEIDA
FT                   QEWRFLLAGPTDTNISAKNPAPEWVTEKVWIEVVNASNLPAFAGFSDAFAASVDHYRKY
FT                   FESGEAHRFPLDDTFDGKLNEFQKLLVIRCIRPDRFMLGVTDFVSAKLGSRFIEPPPFD
FT                   LEACYAESRVDAPLIFVLSSGADPMADLLKLCEEKEMLQRFDQVSLGQGQGPKAEAMIE
FT                   RAMEEGMWVCLQNCHLAESWMPKLDVICETIDAEAVHPDFRLWLSAMPSPAFPVAILQN
FT                   GIKMTLEPPKGLKANLIRSYTRITDEYMDECKDPASHKKLLFSICLFHAVIQDRRKFGP
FT                   LGWNIRYDFTDGDLNMCQRQIKMMIDDYEEIPYKVIRVLCGEINYGGRVTDDKDRRLMN
FT                   NLLNNYIIPEVLTDDFTFSPSPTYPSPKAQNVEEFVEFIKSLPLIPQPEIFGLHENADI
FT                   TCDQNETYSMFETILSLQPRVAAGGGLSREEVIGAAARDIFDRCPSPFDIDAVGHKYPT
FT                   DYNQSMNTVLTQECIRYNNLIVVMRRTLQESLKALKGLVVMTDELEAVTDSIFDNQVPD
FT                   AWASKAYPSLKPLSSWVLDLLERIKFINGWIDNGPPPVYWISGLFFPQAFLTGTLQNYA
FT                   RKNGFAIDSIQWNFVVQDTKTYENTTEPPQDGCYITGFFLEGARWDYDTHLLTESRPKE
FT                   LYTDFPLMWLEPCKDRVAPTSGVYNCPAYKTLTRAGVLSTTGHSTNFVMYLEVPTDKSE
FT                   SHWINSSVALFTALMF"
FT   CDS_pept        join(871330..871376,871482..872289)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639360"
FT                   /orf_name="MICPUN_62939"
FT                   /product="Predicted protein"
FT                   /biological_process="mitosis"
FT                   /protein_id="ACO70370.1"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="UniParc:UPI000199CC41"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM1"
FT                   /transl_table=1
FT                   /translation="MAPGPDPAPSRHANLRVDATLEFLEAAIHHTLHARGVYPKELFEP
FT                   RSLYGARVQRCRHPDLDAYIGDAVSALRRPIAAGDVKRVVLAIKDDDAAASDGPLERFT
FT                   FDFLLRDDDDTAGGGDTAGGLNGGGVADVTGGSVRGPSRADVDQCQRAFAACLSKIAFS
FT                   DALLTPLPQAAMNAGRLSFEIVAYSTRAGVAAQLCAGGSGPNEYTCEWTEERVGCGTSY
FT                   ATGDASRDGGTGPAGGRAAVGDVEPRLEFRAGTAKEVVPVKSAATPIVNLDVFVERRRS
FT                   SAG"
FT   CDS_pept        join(complement(872892..>873409),
FT                   complement(<872678..872801))
FT                   /codon_start=1
FT                   /gene_family="HOG000023024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639361"
FT                   /orf_name="MICPUN_69994"
FT                   /product="Predicted protein"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="respiratory gaseous exchange "
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="ACO70624.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0007585"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG283976"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="UniParc:UPI000199CC42"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM2"
FT                   /transl_table=1
FT                   /translation="IPRAERAINSAIIWSAVLVIDKLYEGRSYARFYALETVARVPYFS
FT                   FLSVLHLYETLGFWRRADYLKVHFAQTMNEFHHLLIMESMGGDKRFTDRFFAQHMAVFY
FT                   YFIACAMYLVSPRMAYNLSEQVEEHAYHTYDEFLKENELELKSKPPPPIATHYYTEGDL
FT                   FLFDEFQTGAARRRPSIDNLYDVFVNVRNDEAEHMKTMQFCQLPGAILRSP"
FT   CDS_pept        874068..>874895
FT                   /codon_start=1
FT                   /gene_family="HOG000282965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639362"
FT                   /orf_name="MICPUN_71270"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70371.1"
FT                   /db_xref="HOGENOM:HBG627901"
FT                   /db_xref="InterPro:IPR021298"
FT                   /db_xref="UniParc:UPI000199CC43"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM3"
FT                   /transl_table=1
FT                   /translation="MVLIHCKYKGEEQQFLYETTVEIGVKDLIKELVEVHNLRLRIQRI
FT                   KSEGDDLATHGPCKPPDKQGLDEDIQAEADGVELPPRGPTYCKDPIGKRTGDAPVPQAQ
FT                   ATLRKALDDAAAAASKKQVEAKHPLTKRELMEHIDLIRGAVMIAYPMGLPEYDPVRIDI
FT                   EEDEKPSETPIGIDILDETAQLWWAGKQMLPGNKLSVHVGRNEKTKVVAKLTKKGAGAP
FT                   QRENPITPEEHKAMLAYYHKRQEEMKHLEQNDEDDYTNSAWANSRALKNHFSGV"
FT   CDS_pept        complement(875025..876608)
FT                   /codon_start=1
FT                   /gene_family="HOG000265328" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639363"
FT                   /orf_name="MICPUN_62936"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70625.1"
FT                   /db_xref="HOGENOM:HBG557956"
FT                   /db_xref="UniParc:UPI000199CC44"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM4"
FT                   /transl_table=1
FT                   /translation="MHASVALRRGCAPAPGRRATAGRRHHPRPIPPTAVVDDEDRWTEE
FT                   VARDEQPEISWAEERRLRRMSERASSTTKSSGKPAPPGGPFSGGAPRLARASRPAPIKE
FT                   YLRLVELGDGAWELQSATAVFRRNARFDPTTGECVAPAQEVALAATVHVGDPTYYQGLQ
FT                   EECDADYDAVLFELITGEENLREGRAPESTRGGARHGGDEDEDDHNRDRRDPFLPQLAV
FT                   ALAPTPDARRLADTHFLVPQLDALDLCGDNWYVADMPKQELARLQAEAGEAMMATSSRS
FT                   VPGPSVPTTSPALEALVVTAKGRAGGGPLRQATRLVCWLVPCPEAHLLLLDWVWGGGRP
FT                   APVLGALLDSLAGGNIIAARRLAFAQMIVSAQAKGAVGGGADVPVLVERRNDVATECLA
FT                   KALDAPGVSRVSLLYGGLHMPGLTRRLTEQLGLEPSTQRWRAVWRVEPPGANNAVRWAA
FT                   LPLLLFLDGTDWAATITDAAAAADAGALGAAAAMGALYVVRHGAVYYSLGKWVLEWNRQ
FT                   LFDGSDGVNS"
FT   CDS_pept        876691..877068
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639364"
FT                   /orf_name="MICPUN_62935"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70372.1"
FT                   /db_xref="UniParc:UPI000199CCC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM5"
FT                   /transl_table=1
FT                   /translation="MTAGGVDDAEVAAVHRESIEAEKAVVDALRKDGTFERVRKALIAR
FT                   CVADGGVRAKVAELVDASETLRQRGAAGAKFDELVDRLREEVEKDVMGAFADKAWELMT
FT                   DERGEVGGMIAEAVEKRLGER"
FT   CDS_pept        join(complement(877864..878557),complement(877133..877797))
FT                   /codon_start=1
FT                   /gene_family="HOG000220904" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639365"
FT                   /orf_name="MICPUN_98133"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70626.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG444677"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniParc:UPI000199CCC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM6"
FT                   /transl_table=1
FT                   /translation="MFARGGGNGEPRHVVVFDAGSTGNRVHVFEFDTTGDGPRLKQEVF
FT                   HAAKPGLKERAKDPRAAAALLDPLVATAMRSVPARARKRTPLTLRATAGLRLLPEGPAA
FT                   ADAIMDAVRSKLVRTGFDVNPSRDVSILSGGDEGLYGWVAVNYLLGRIGGGGGGGAGSE
FT                   KKTTVALADLGGGSAQLSYAVDADVASTAPAGYVRTVPGTRGPAGALSAYVHSFNGYGL
FT                   VAARHRILAGTRGGPPSSRTHACVHAGHAGHSCDRDCYGLDDKTASYSVTPETNGGSFK
FT                   GCVEAALDAIDADEGCEHAPCSFGGAWAAPRAAGVTEFYAMSYVAERAVQCGAAAVPSD
FT                   EKTPTTTTPRRLAAAGTDACATRVDQLGAKYPEVDEEHLPWLCADVAYVYALLTRGFGV
FT                   GEDETVTLVDKIAYRGEAVEAAWALGDAIAVMEGGHGGEGGEPGVVTEKSRAR"
FT   CDS_pept        878935..879579
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639366"
FT                   /orf_name="MICPUN_62933"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70373.1"
FT                   /db_xref="UniParc:UPI000199CCC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM7"
FT                   /transl_table=1
FT                   /translation="MERVASVASVAGTRAGTRNRASGGARGKTRAIATPGPFGGTHARR
FT                   RRRPESIGHRRAPSRSAPSSVACAGTGAGARDGDDAPVPELARLAKLLRVNAGVELAGA
FT                   VAVAANPASVFPGIAGSGVECSRWYALALGSVAIASFLASKLDVTNARAATATATPVVG
FT                   GMLAYHVGISAFQVNAFAAGAWTTATAGALLVHGCLAAAFALAAAFCSKER"
FT   CDS_pept        complement(879753..881510)
FT                   /codon_start=1
FT                   /gene_family="HOG000243452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639367"
FT                   /gene_name="POT"
FT                   /orf_name="MICPUN_62932"
FT                   /product="Proton-dependent oligopeptide transporter "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70627.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG586603"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199CCC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM8"
FT                   /transl_table=1
FT                   /translation="MPAPTRREAGDGRDVSGDFEGRVLLHFSSDEDVDGSSSRLGGLDG
FT                   STAAREAGDGDGDRGGDRQMFGHPNGLFVLCATETWERYSYYAMRALLVLYMRDVLLAR
FT                   GAWSDVWGMRALASAYGAPDDDAPDETRDRQVLALASRLYGLYTALVYLTPLLGGYLAD
FT                   RHFGAHPLIVLGAATMGVGHALLAHRRAFLIGAALIVLGNGCFKPNVSTRVGRLYDRGD
FT                   SRRDVAFGIFYCGINLGAAVAPLAAGMLHAADGYEAGFVSAAVGMAACLATYAFFGYLI
FT                   DAGEERAAARKSGGGGWRGHDASAGGAVHEFDALEGADGRAVGSRGVGSAVGSSIPAAD
FT                   PVQGVRVRRQSDLARVVWRHRRRLGAMLAVCALSAGFWCAYEQQGNTTALFADQWVDLA
FT                   GAPTEFVQSINPVLILALTPAVTRTWERQRRNGNEPSQITKMAIGAGLCAASYVVLAVA
FT                   AAASGAGTAGSSATKNQMSFVWLFVHLVVLTTGELYLSPVGLSFITTAAPVELASVSVG
FT                   AWFLSSFAGNYLSGELGSLYAFTPAPTFFFIAASTAAAVSAALFFASPALTRELDPATV
FT                   DDDDGYEQI"
FT   CDS_pept        complement(881718..883406)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639368"
FT                   /orf_name="MICPUN_62931"
FT                   /product="Predicted protein"
FT                   /function="fucosyltransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70628.1"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0008417"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="UniParc:UPI000199CCC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJM9"
FT                   /transl_table=1
FT                   /translation="MRESNNHSRSGRGVWTAVATVAVSALALTGRAASRRAAGVSDQSS
FT                   SLGAGRSRRGGWRERRDAWRPEEDRLAAAMRADPVYHRYLPTIYPGFDVNSDDWWHKPR
FT                   GEVPSLGAASADDERRDFDLPGLPPRRAGVPSTNDDRRPAHGRRHDNTNKNKKKNQFKV
FT                   CLDNGAGSWDVAFAKGIENLFHPGVCFDTVEQNNCHANADVVIFNEHDFIWGGAHRNAA
FT                   RGGRIELPEKAHPSQVYLYFAHEAAGGFGAELRDKSFTSQFDYLSYVDKRRSAMWWPFG
FT                   PSLRSLTDDFEWFRKRREARVPAVAWLASDCVAQPRVSILRSIADAFPVFSMGECLRNA
FT                   PPPAGGLPRRGAVDPASHASFQRAMSDYMFYYAVENAGACAGYATEKVWMALSRGSVPL
FT                   YFGTDDVYELLPDRDAIVDLREYDSVESLARKLHAIATDEREWAKAHAWRYRDPSTWPR
FT                   EFRTLLRTTSTDVKYGVCDVLMKGPRGYHKSRERPRQARCDDGVKVLGRTLGGIGGWGE
FT                   VRGESGGALRAPTEHLHRRCGAATGACWSLSRPGEGGKGGKGGRG"
FT   CDS_pept        884059..886035
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639369"
FT                   /orf_name="MICPUN_62930"
FT                   /product="DNA polymerase"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO70374.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR013627"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniParc:UPI000199CCC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN0"
FT                   /transl_table=1
FT                   /translation="MADVAEVKDAFESQGYALDSKVIADEAFALCRQFNLDAFDLALHW
FT                   DGFSVEQASKKDKKALMPDASNIEAFKLHVERKVAERRKSTSMRTPKSLVYGRPNLMES
FT                   LEKNPRALEESGAFASITPGRGGTTPGAKTSAAKAAYAGTAPSQVVALPEVDARGALEA
FT                   HAAAPGASAYAKRAGSRSVKTELGADLPTLAQAPDTRRPPVAVRVIDAVTDLPALATDV
FT                   RFMRDRIGDKVDMLESRIGDFRRETERVTGADASRAVYAASQDDVTVVGRVVCDSEGRL
FT                   NEASVQLEGDMANSAGMRVRLELRDVPSFSLFPGQIVRVTGANPSGHCLVAKSIVAHAP
FT                   PPMCASPASSPAFGAQSVVIASGPFTCSSDLSFEPFADLLRYCEDKRPDSVVLCGPFVD
FT                   CDHRVVRGDAGVDVSFEKVFEVGVRDRLAEFASRCEAGGYAPNVVLVPSVRDAVADPVF
FT                   PQPPLEIDTLGLDALLPDGRSDGKKGAGVDVIATPNPGTFTINGVRVAVCTHDVLRHLS
FT                   AAEAAREDKSSGAGPSSDRMARLASHLPGQRSAYPLFPPAHGACLDASLASHLAMEKTP
FT                   DVLVLPSDLQPFAKVCECPGLRGDGGDDDARFVAINPGRLAKGNIGGTLAHVYVSEGAP
FT                   EPGASGARAHAVHARARVDIVRI"
FT   CDS_pept        complement(886151..886504)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639370"
FT                   /orf_name="MICPUN_52483"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70629.1"
FT                   /db_xref="UniParc:UPI000199CCC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN1"
FT                   /transl_table=1
FT                   /translation="MREHIFEGERGDRWAPHHHHPHHPTAGVPAEAYDAPVGRAASHTH
FT                   PVPHHPKADKNKTLKFPAADGFRITSPRILPNGERIRWNSHHTPVVTRRWSEVHHVQHH
FT                   VLYHFPKFDGFFY"
FT   CDS_pept        888171..891215
FT                   /codon_start=1
FT                   /gene_family="HOG000241410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639371"
FT                   /orf_name="MICPUN_62927"
FT                   /product="Putative uncharacterized protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="ACO70375.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG557963"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI000199CCC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN2"
FT                   /transl_table=1
FT                   /translation="MPTQGMVVSASAASGFLPRRAAPGRRVTASPRAVFDGSAASTMRS
FT                   SGSRLSIHRARSPRVSGGTPRGRRLTARVSAIGRFFGGGGGGASDDDDGKAVFAAKSRR
FT                   QVRIPGFVFAVSPAVVNGEDADALAALEAAVASGATAVILADDTGDATTRELFNAALAL
FT                   KESLRGRASLLVADRTDIAASAECDGVVLSDDGVPVVVARKSLSSASGVVACGVKDEQA
FT                   ALIAAKEGADLILAPNGRVADAVRGKISVPVFASPRNGWAGVSAPDAIQALVDAGAKGA
FT                   VLPTPPPSVDVARGITAALAPIAAAVKKDSDDSEPGAAPSASTTPTPVGTSVGTTTMAG
FT                   KIIDPTTQALLERERVLLDDAVAFLVESTPSLEEIGLLVEARKGLEELFLLVIVGEFNA
FT                   GKSSVINAMLGQKALKEGILPTTNEITVLKFGNEPRTEQSKDGFYTQLIPADLLREVNI
FT                   VDTPGTNVILERQQRLTEEFVPRADLVLFVLSADRPMTESEVKFLSYIRKWGKKVAFVV
FT                   NKCDRLENQGEVDEVKGFVADNAERLLGVTDPAVLPVSAKAALAAKERGGSETDFAQLE
FT                   DYILSFLGAGDKKGKNSGEGLRLKLGTPLQVGTMLFGAAEEILAQERAEAVEELSQAEG
FT                   VDAAMDKYREAMEADFGAQVQAVRTAVMGAVGRCDDLLDATLRLTNGADLFTTYVLGNG
FT                   ANGAIRERYKKEVLGDSEAKLRAAIKEHTGWLARNNDNQLRAYADAVRARGFDPSATDL
FT                   NLFEREERIAAEEAEAIAAVRAEVAAKQTAAAEAEAKAAEAKAAEAKARAAAKEAAGDD
FT                   GAAAGDGADDSNDDSKENSSSLADELAGPAPAQTSASSLITRASSDLTSPATVAAGFDQ
FT                   AGAARLLEEEVKDAVYSTVGAAGASFFFAVFLSGFLDNFAEDVLAFSLTAAVGYVSVLS
FT                   LPLKRAETKAKARAVAESFLDEVEGAMRAEFERKVGATTAQVRATTAPWVASAREAEAA
FT                   VAASQSRRDRIAEDMDQLQRDVQSI"
FT   CDS_pept        complement(<891477..>891896)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639372"
FT                   /orf_name="MICPUN_71867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70630.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199CCCA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN3"
FT                   /transl_table=1
FT                   /translation="VAAEVGVLSALRELSLNYNELTSVPAEIGQLTSLTGLSLSHNQLT
FT                   SVPAEIGQLTSLRWLNLSYNELTSVPAEIGQLTSLQWLSLEDNQLTSVPAEIGQLTSLR
FT                   ELILNNNQLTSVPAEIGQLTSLEWLNLGDNRLTSEP"
FT   CDS_pept        join(<893606..893763,893812..894175)
FT                   /codon_start=1
FT                   /gene_family="HOG000200897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639515"
FT                   /orf_name="MICPUN_86842"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70376.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG739441"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199CCCB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN4"
FT                   /transl_table=1
FT                   /translation="FNRTTLADILAAKHRTHTYWGSNHWCDASEPVAVAVRRMNSQDVG
FT                   ALLVMDRSASPQTGAMRGIVTERDYLRAVARGAVSPGTAVGDIMTDFATDNGAGLISAS
FT                   PDTSVLAAMEIMTEARIRHIPCIAPPSRDGATGAVMEGMVCIGDVVKALLAEEREEVQI
FT                   CRDFINGVYD"
FT   CDS_pept        894916..896310
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639516"
FT                   /orf_name="MICPUN_106321"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70377.1"
FT                   /db_xref="UniParc:UPI000199CCCC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN5"
FT                   /transl_table=1
FT                   /translation="MQTIASRSAIIGQRVTARPSGKTSKSAVRQPIKVNAVQTLQSGQG
FT                   MMVDPDQYDDDANRGRGSGFVARPAGQRVSSSSASYSAAARPSRVVRAPDGVTYDPDQY
FT                   DPDANVRSSGAIYSPPAAQLVNDLQAPAGAGQVTRAEVQACQDFWAKSIVDISASFLQG
FT                   GDYVGLAGARAGELYGYGNCNVLFKPTKAAQHPFRPTANDAMSYFVGHDAVAGGYNEDH
FT                   GFAINAKKGFSKVVFKNHQIDCHSQVALAMGTYEFTCATTGAVSEVEYTFGYKRCPDGK
FT                   VRICLHHSSIPYGGGAAAPATGAVTKEDVMKAQDFWAQSICDISRTYLQGGDYVGLAGQ
FT                   RAGELYGYGHSNVLFKPTKAAEYQFRPTANEAMSYFVGGNAVPGGYSEDHGFAINSGKG
FT                   FSRVVFKNHQIDCHGDVALAMGTYDFTCATTGAVSTVEYTFGYKRNSDGKCRICLHHSS
FT                   IPYGAH"
FT   CDS_pept        join(complement(896489..897150),complement(896316..896424))
FT                   /codon_start=1
FT                   /gene_family="HOG000239175" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639517"
FT                   /orf_name="MICPUN_113519"
FT                   /product="2-c-methyl-d-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase activity"
FT                   /biological_process="terpenoid biosynthetic process "
FT                   /protein_id="ACO70631.1"
FT                   /db_xref="GO:0008685"
FT                   /db_xref="GO:0016114"
FT                   /db_xref="HOGENOM:HBG630070"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="UniParc:UPI000199CCCD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN6"
FT                   /transl_table=1
FT                   /translation="MSAACAASAVMVTRAVAKTTHGRVSRPAAGPAAAARRRSVATRAV
FT                   KLATGEVLDVKPVPMRVGHGFDLHRMELLSEMPDLELWLGGIKLEHDRGCVAHSDGDVL
FT                   LHCVFDAITGALGLPDIGQCFPDNDPKWKGCTSDVFIKEAVRLMRDSGYEMGNIDCTII
FT                   AQRPKISPHKKAIKENLAKLLECDEGLVNVKAKTHEKVDSLGENRSIACHTVCMLVKAR
FT                   SGGEDGFTQSNKNLFVITLCIYGRYGSSSAIGVG"
FT   CDS_pept        join(897590..897660,897884..897998,898157..898450)
FT                   /codon_start=1
FT                   /gene_family="HOG000265274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639518"
FT                   /orf_name="MICPUN_62922"
FT                   /product="Thioredoxin-like protein "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO70378.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557965"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199CCCE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN7"
FT                   /transl_table=1
FT                   /translation="MAATRLSLNTASFAPSRVARPAGRRAMRCNAAAKGIQGDGKVQLC
FT                   ISKEQFDAINDKAGDSLVAVQISTKTCGPCKVVYPYFAGLSEELPAVSFVKIMGDHDAD
FT                   TRALMKEWGVRVVPLFMLFRNGEKVTEWSGAKPEVLRENVIEACNDKEKATMVTA"
FT   CDS_pept        complement(898648..900453)
FT                   /codon_start=1
FT                   /gene_family="HOG000162393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639519"
FT                   /orf_name="MICPUN_87151"
FT                   /product="Predicted protein"
FT                   /function="imidazoleglycerol-phosphate synthase activity "
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO70632.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0000107"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG330620"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014640"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000199CCCF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN8"
FT                   /transl_table=1
FT                   /translation="MIATSVTTPAPPLAARAQFERRAPRALARRAAVRVRPASRGAIRA
FT                   PGPIRVFAAESRGEVTLLDYGAGNVRSVRNAIQALGFTVKSVDDPAGIAAADKLIFPGV
FT                   GAYGSAMDVLTSRGLVDPIKDYVASGKPFMGVCLGLQLLFDGSEESGGVEGLGIIPGVV
FT                   GKFRGDGLVVPHIGWNTLDFKRDTGLMADVPPGDRLYFVHSYRATPDVANEDWVLATCE
FT                   YGGEFIAAVQKGEVMACQFHPEKSGEKGLSIFRNFLEGDTEERGAGRAKTKLAADTDDL
FT                   GLAKRVIACLDVRSNDAGDLVVTKGDSYDVREKDDGNDVRNLGKPVELAGKYFKQGADE
FT                   VAFLNITGYRDLPLTDAPMLEVLRRSSETVFVPLTVGGGIRDFTDSNGVSYTALEVAAA
FT                   YFKAGADKVSIGSDAVYVAEQYYANDKKKDGCTSIEQISERYGVQAMVVSIDPRRAYVA
FT                   DPSETKNRCIKTSRPGPNGEEYVWFQCTVKGGREGRDIGAYELAIAMEDLGCGEILLNC
FT                   IDEDGQGNGFDHELVGLVADAVTIPVIASSGAGEPKHFTDVFNATKCSAALAAGIFHRG
FT                   EVDISEVKDHMKGGKIPTNEFRSVL"
FT   CDS_pept        join(complement(902162..902904),complement(902124..902130))
FT                   /codon_start=1
FT                   /gene_family="HOG000100785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639520"
FT                   /orf_name="MICPUN_62919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70633.1"
FT                   /db_xref="HOGENOM:HBG557824"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199CCD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJN9"
FT                   /transl_table=1
FT                   /translation="MDAQNSSRIVYESDTVTYLRRGSLNILDALAVQLPDVFIGEILPK
FT                   LDLTDTLNLAQVSKAYRDAVWSVGGVQSMEAKLVAHEAHLVKTGTKLLFPAMPPMHYAA
FT                   KHGNLRAVRAFLQSGAWARGDENLLGCLWCSSKACQSSSIYSHAAVVKEMIQAGADVNM
FT                   TISRPIRDRPGKTLSNITPLFAAAALGHTPCVMELIKAGADVNIARSDGKTPLHMAAYN
FT                   EHEGCVASLIQAGADIHKVVDDGCTPR"
FT   CDS_pept        complement(<904395..905543)
FT                   /codon_start=1
FT                   /gene_family="HOG000200898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639521"
FT                   /orf_name="MICPUN_87287"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO70634.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG747744"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199C498"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP0"
FT                   /transl_table=1
FT                   /translation="MIVLDSAKGDGSPAANGDGTSARAGGKSASSPKAGSRGVVVADAL
FT                   YPREHIRMEWPTVRKVGSGLANLGNTCFMNAVMQCLTHTPALAAFCLDGEHRRFRPKGG
FT                   NGGGGSFSAIYEMGEHVCRALAGERRVVSPSAFVKNLRSISKTFRKGRQEDAHEFARCL
FT                   LDAMHEKCVEHARPKPPKNSPRAETTFVFQVFGGRLRSQVTCKTCGRKSDTFDSFMDLS
FT                   LDIAKAKSVEAALKRYVAVEVLDGSNKYKCEMGGGKPHMTRATKQFTIDAAPLVLTVQL
FT                   KRFEYVPFGRGKLTQFVEYPTSLDITGAMSDANPKARGVEKYSLFAVLVHAGGSMHSGH
FT                   YYCYVKAATGVWYEMDDEGVSATSERTALNQKAYLLFYAREGT"
FT   CDS_pept        906458..907456
FT                   /codon_start=1
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639522"
FT                   /orf_name="MICPUN_98131"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70379.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG716455"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI000199C499"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP1"
FT                   /transl_table=1
FT                   /translation="MHVQYVKKSSEDKDAIEYVLTDHLRLSGMYWGLTSLDLLGRLDVV
FT                   DADEICDFVQRCWVPDVGGYAPCVHHDAHVLYTLSAVQILALFDRMELIDRDAIASFLN
FT                   SLQRESDGAIMGDEWGEVDTRFAYCALSISTLIDRPRCIDRGKVVEWIDKCKNFDGGYG
FT                   SDPGGESHAGQVFTCVGGLALCDAVDRIDHFFLGWWLAERQVKAGGLNGRPEKLPDVCY
FT                   SWWVLSSLCIMGKMHWIDQKALARFILGCQDDKKGGIADRPDDEPDVYHTFFGLAALSL
FT                   MGFPGIKPIDPVFALPTHVCERIGVMRTAADGTVVGRKENPTSTKGESAEP"
FT   CDS_pept        join(complement(908908..>909096),
FT                   complement(<908476..908823))
FT                   /codon_start=1
FT                   /gene_family="HOG000150181" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639523"
FT                   /orf_name="MICPUN_72074"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO70635.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199C49A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP2"
FT                   /transl_table=1
FT                   /translation="PPAPGDYVFPGDGTRLVIPYPFDFVCHVKARHAGANVVAMFAKEF
FT                   PARDRGYYEAAHAAGYLRGMSGGDDETVEPLRPLAAGERVRHWLHRHEPPVLDHPVDVV
FT                   AVTDDLVAVHKPATMPVHPTGQYRKNTVLGVLAATRRDLGRLSPAHRLDRNVSGLLLMA
FT                   RNARTASALREALAEG"
FT   CDS_pept        complement(909240..909566)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639524"
FT                   /orf_name="MICPUN_62915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70636.1"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI000199C49B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP3"
FT                   /transl_table=1
FT                   /translation="MRPARTAGGLGSLARLARRVWTGAGGPTPLAGRDRVGRHDERPPP
FT                   APICETCHRRFCRCVHKPPTEPAAPGAEDCCQSSPQCKFCVWLVYEENVAEYQAYLATK
FT                   NDGR"
FT   CDS_pept        910015..910803
FT                   /codon_start=1
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639525"
FT                   /orf_name="MICPUN_109237"
FT                   /product="Chloroplast ascorbate peroxidase "
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO70380.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="UniParc:UPI000199C49C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP4"
FT                   /transl_table=1
FT                   /translation="MSHGANAGLKKALTYLEPFKERYANLSWADLIQLAGATAVECAGG
FT                   PKMYMRYGRVDVTGPEECPKEGNLPDAEPPYHDGADPDASTHLRRIFYRMGFDDREIVA
FT                   LSGAHTIGRAFKERSGVSQFGYGEKAATKFSGRGCPVAGGVSKQAGCPAAHVARADDKP
FT                   GIGMPGGQPWTKSWLAFDNAYFKKEYVQDPELLWMSTDKALHTDPGFKPHFDLYASDEK
FT                   AFHRDFAAAFVKLSECGARLRPINGIKINEDPPRRMVWRG"
FT   CDS_pept        join(complement(911736..911868),complement(910934..911535))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639526"
FT                   /orf_name="MICPUN_62913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70637.1"
FT                   /db_xref="UniParc:UPI000199C49D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP5"
FT                   /transl_table=1
FT                   /translation="MSAPSDPAAAYYAGAPFYVPPPASASASAAEPRNKPRHWPNVSIE
FT                   SLYVDLETNPPGALVDVRYPPAPPRADGAFSPPTNDERLRRAVTARELDAPLVTAAGTP
FT                   IRGETLTIATVCEVFIPDDDFSSRGFEGYRGVTANRGRVRLRGAHEARDAAYGTATHEV
FT                   WERTEVWGRRDWAQLCVAGDETDGRTAVRDEDGAQRGLSATSSRSRSFDFASGTRIARG
FT                   AGAGAGAWGYGTSSWGASRRGG"
FT   CDS_pept        complement(912241..913659)
FT                   /codon_start=1
FT                   /gene_family="HOG000012602" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639527"
FT                   /orf_name="MICPUN_92108"
FT                   /product="Quinol-to-oxygen oxidoreductase "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="respiratory gaseous exchange "
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="ACO70638.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0007585"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG610796"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="UniParc:UPI000199C49E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP6"
FT                   /transl_table=1
FT                   /translation="MEHSHRVSRGAGTPRASRGARSLARPAVTEPSRSRSSVDDEIESL
FT                   ANARDEAQAALRAAQDAYAEACARRDGRVASRSEDEADVLFNASPYVDVRCEYGYIQSN
FT                   AGLYIDVSKTRPPGVPRNALTLATENFTRELSAMRAFLSGDNSVPGNGEPVILAASTDV
FT                   SPEEAELMSELRDQLATLTLSNDAIWAREKARPEVPAPWIIKAPYLALCVFLDLVFPEN
FT                   RPIQRFWFLETVARMPYFSYNTMLTVYELLGWWRRSSELRRVHFAEEWNEYHHLLIHES
FT                   LGGDAAWRDRFLGFHSALLYYGALNVAWLLSPALAYNFSELIEAHAVDTYAQFAEENKA
FT                   TLRKLPAPRIARKYYEEGDLYLFDEFQTARPRSSRRVRVTTLYDAFCAIRDDEAEHVAT
FT                   MAECQMEDSAMADVRKIDLLTGAALAFIAANAWIDRLAQSAGLDTLEIGGVDVGETLSE
FT                   DGILVQILRFLPFF"
FT   CDS_pept        complement(913921..914799)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639528"
FT                   /orf_name="MICPUN_92105"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70639.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C49F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP7"
FT                   /transl_table=1
FT                   /translation="MACRDQARGDKAADDVAAATGNRPDVMLLDLASLRSVEDFAKRFE
FT                   DTYGRCDRLMNNAGVMALPKRTVTVDGLETQMGVNHFGHFHLTNLMMPAIRAAPGRKRI
FT                   VVLSSVAHEFGHPDFDNYNSTGAFGYLGSGWLTYGKTKLANLYFTYELHRRLRNNGVLD
FT                   VDVNAVHPGIVDTDLPRSLALNFYPLLRRTGGLITPAQGATGQIDACVGGAWEGISGKY
FT                   VAEQSGPRGSEVGPGGKKGVFKVTESSRYSYDQEAAARLWKVSKALTGAGWEALGEGKV
FT                   EKASVAVSSWM"
FT   CDS_pept        join(complement(918648..918752),complement(915135..918416))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639529"
FT                   /orf_name="MICPUN_62910"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO70640.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG557968"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C4A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP8"
FT                   /transl_table=1
FT                   /translation="MADDTEKAIIYAFDQSGAVAADLRERALSYLRDLQASPDGWKQCV
FT                   PRYQSTAYPEVRFWCLQTLAEAVRLHHASLSDQDASALRAHVASWIHDAATRTDPATAV
FT                   PAFIKNKLAQVCARLAGAEYPARWPSFFADLLQLAANAGDGGLDALVRVLDAVDDEVIS
FT                   SGDTQHAGQGAGVRDGNSNSRGGGANTHEVPASVRVKDAMRAEPGLLPRIVDALRAVIA
FT                   SGLERASAGPGRAALAEAAAGCARRYAEWVDVSLFADAAFVRTINAMLASADHGLRGGG
FT                   CDFLAALTHKGMDHGAKVGLIARLDLVNVSRMALNGSLNGANNRADGDDDDAEESEGKA
FT                   AALAAAVGGELLSCLRAEAASHAGAEANEPHAPPPPKDACDAAARMVDELMPAAVAALC
FT                   SRHESTTMAIVPLATAYVNRLKDAHALKLMPASSAANAEGTLRALLDAVIRRSSFPDES
FT                   IVGVDFGDGDDVATRECEADAVAMRQELAVLFRAIARLAPHLALGAVRGALARALEGVG
FT                   GGDEPVRWQTVETALGALHLVGEGAHDGAVKPGVEESPLGELVEMLLGAWDVLGSKSPE
FT                   VAAHRLVAPALLEICVRYHLAVERRPEQLLRPALAAFLDGRGVAHRSREVSRRACYLFC
FT                   RFVKPTRGQILSHGALPGVMAALEPALMDAAVPDSFANSSSSANSSVGSSFTGGGTGGA
FT                   MATAGNDDRLYVFEAFGLLLGIDDVPDDLRIRCLEAVFARLRGAVEAASSTAEPANQNL
FT                   NPAAAQHAIVAMGNVAKGFTLRVATQTSPRVGEILASGLDPALRCVQLWPRDPLTRQRV
FT                   VAYFQRLVTTVGPAVFPYASPLLEHMRCGSPSAAELRECLVLINQLMASFKESLAPFLA
FT                   TQLPPLVTQIAQALAPFAAPGGGVNGVCGLFLDGASQINPSLVGTAGNTEEAREARDLE
FT                   KIFVAHAHGVAANNLAGVLVADPRLRECFLETLAAAAAGHPSAMSRKSALQALIRVAQC
FT                   WLPTAEDVATGLVAKEGPVQGFAAFAVSRVAKEACVDAVMRGDLDPRDAGCAAAVAETV
FT                   NFTRVMLERLGNEFANHLRVNLLGANWGLDPESHGREYVRRVTSTTQNSAREARAFVAE
FT                   CAKIAQGKNPGVASNKCTPGM"
FT   CDS_pept        918920..919639
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639530"
FT                   /orf_name="MICPUN_62909"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70381.1"
FT                   /db_xref="UniParc:UPI000199C4A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJP9"
FT                   /transl_table=1
FT                   /translation="MSVVVASALPIASSPRAAAAGRHPRAARLPAPLAANLASATPKYL
FT                   PPKRRRLMARRGASFAAATPPTAADDGRSPRVTRLSSPSRAPSPAPSPSRAPSLATRVA
FT                   AAARRALASLALLVGLALGALVPSAAARDGTPTAPRHHAHYHSGFPTASATAAHIIGRA
FT                   PAVDYSAGLANIPIATGDVGSMGGLTPDNWGLPYKGKNPAMALFMASAGVTLRMAVNVA
FT                   VIYCIYTYWLNDGPDSS"
FT   CDS_pept        join(920272..920589,920753..921238)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639531"
FT                   /orf_name="MICPUN_62908"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70382.1"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniParc:UPI000199C4A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ0"
FT                   /transl_table=1
FT                   /translation="MRPVTRPGGGRSARRRRVRSCVWASEARGARVRCSRRLRRASRRG
FT                   DGSRKSAHFFSASLAVFDADRPAPLPPTQVAAMTEVNTTTSSPLVGAIGKIKESAMHVF
FT                   SQRKPMSEILDRTAYQRPASFSEATGRMSKNMNYFKINYVLFTAAVLAAFILYNPTSLI
FT                   ILSLVGAAWTYVYLIRTEPLKIGDRPVSEREKLLGMSGASLLAVFFMSSAGSIIFQAFG
FT                   VALLCIGAHSAARVPDDLFIDDANSEGGFFSFLQPPRPGITGSVA"
FT   CDS_pept        join(complement(922177..922183),complement(921611..922008))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639532"
FT                   /orf_name="MICPUN_62907"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70641.1"
FT                   /db_xref="HOGENOM:HBG557971"
FT                   /db_xref="InterPro:IPR019184"
FT                   /db_xref="UniParc:UPI000199C4A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ1"
FT                   /transl_table=1
FT                   /translation="MAAPSLALEVFLYFGKLWDVVFWLISFMVFCYKGYNLPYPGNAYE
FT                   MEFTYLFMYLLVEPPRLFLGSQGNKSVRAGPLWASMVLAGFVLFMHVYYIVAQTFVLRV
FT                   DYWMNVISLVFLSAQFLLSGTQALDFMRGA"
FT   CDS_pept        join(922651..924063,924196..925353)
FT                   /codon_start=1
FT                   /gene_family="HOG000265275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639533"
FT                   /orf_name="MICPUN_103335"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO70383.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG557972"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C4A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ2"
FT                   /transl_table=1
FT                   /translation="MKGAGKGAATKRKERRHAKFNPGPGPQSVKPVGGAEAAGFDDGNV
FT                   EAKKKKKLGKLSKKRKAEGASNDDADDATAAAAKKKSKKSAVDATHKAVSKRHDSKPAW
FT                   TNQTRREQKDWANEQKALQKPNFTLIQEITALWERLRVKKISKDDKRKLVAAIFKASKG
FT                   KCAILANNHKASRVIQALLKYGTEDERASVYAECAPHLGPLAKSLYGHFIVQKLVDATP
FT                   KEKLPELLANVKGRVRMLAKHPVGSQVLEALYWPAPAPCKRDMECEFYGSEFAMFGASG
FT                   LSGDADKPATSLREAMLSKPVAQRQGMLREMNKTLLPILEKGLVSPSLIHKVLSEYLLA
FT                   GGPGTRYEAAHSVAGPAMLRMIHTRDGAHAVNMMMSHAGARQRKMVLKALKGNVARIVR
FT                   DDHGSMAIMCMLDCVDDTAQLGKVIVNELKAEGLAQLAEDPAARRVLLHLLRPRSRRYV
FT                   HPHALAKLPDQDEDDGMDDEMMDDEFDDDEFEEGDAAGDEKVNGMTKFKSKAAEAAAAV
FT                   DDSDDEGAGTAGGASDSVDFGIARKPSDLRRREIFGQHGKLGAALVDACERNASSMLRS
FT                   VAGCDVLVETCSGGAGGALTRAVGAERLRKLHASVAEVVRASVEGEEDESEEEEEDDDD
FT                   GKGKGEGEGKVREPLHTGFVSSRALRRMVLDIPGPQPEDEDDSTGGGGEDAGRAPSFAA
FT                   ALWRGAVAGTLAEWVHGHGAKVVAAIVRAGDEDTVADATAALGKILKGEDSSVDEWVAG
FT                   FFRDGAKAGAKAGAKASTKKPPAANGKKNGESGGDKGKGKKADAASAPKTPAKTPAKTP
FT                   AGKKASSKKAESARDEAPAEGSMKKKKFSPRQTRAQRAAKAAGK"
FT   CDS_pept        join(complement(925983..926102),complement(925468..925899))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639534"
FT                   /orf_name="MICPUN_62905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70642.1"
FT                   /db_xref="UniParc:UPI000199C4A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ3"
FT                   /transl_table=1
FT                   /translation="MDDDGLQYDSGYDSEVLNMHWGRGRPQMSEQAKHTLAFAKERLEH
FT                   LLRTVDAPDIAEAPVFPPDAGVKARKLLTTAHHRLLREQAPFVQLTDKHLVQAARKEFR
FT                   RHAEQWGVVVRMQSMRKKGRKSPIYHTHVRLLKCNQDRYRRWAAERVAAEAKPAVEVKR
FT                   EREEATVGRADAKRVKASEP"
FT   CDS_pept        complement(926233..926559)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639535"
FT                   /orf_name="MICPUN_62904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70643.1"
FT                   /db_xref="UniParc:UPI000199C4A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ4"
FT                   /transl_table=1
FT                   /translation="MRAIAGGYKTRARMARACTLVLVVVLLALLELALRRRGGEGKPRP
FT                   SPRTRRHPTQFNDVGNIVNAGIGGFPNAIYRDWWAPLWPTSCFAVGNYGLWSLAQCVMF
FT                   TGTF"
FT   CDS_pept        926691..927764
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639536"
FT                   /orf_name="MICPUN_103334"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO70384.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="UniParc:UPI000199C4A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ5"
FT                   /transl_table=1
FT                   /translation="MIQVDSAEPLISRAASARLRTAVVRPKLRLFCIAQAGCDAGCFHP
FT                   WQDLLLPGEVEVLPLELPGRGQRFRESPDAFGSIRALVADEILPKISKLLPRTDFDEGA
FT                   RGCPATMEQHHEWTNPPFAIFGHSFGALVAYEICAQIEARARRHDWPWAKPSTLYASGM
FT                   RAPSLCGPAHDPDDTNPTLSTLIDDDVFWTAFERRYGRNPDLLKPEVRAMILPRLRADL
FT                   AAMETYVPSSSSSKLTVRTRVILAEGDDRTPRSLVEPWAGHCEPQTLCSFTAVKGVSPA
FT                   NEASGSGYWGTPHRVVLDYPDELLSFLRDDVPTLFKTATLPAESTDPDINSKEMFAELD
FT                   RLYGDFTAWDLEYPPVK"
FT   CDS_pept        complement(927832..928650)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639537"
FT                   /orf_name="MICPUN_62902"
FT                   /product="Predicted protein"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /protein_id="ACO70644.1"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="InterPro:IPR013110"
FT                   /db_xref="UniParc:UPI000199C4A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ6"
FT                   /transl_table=1
FT                   /translation="MPALATAVVALAPRAPRGSRPPRTTKTITSRDGVRCEVSQLAEPP
FT                   AQLRFSMDADAARAVIEPAFDEDARQRCMSGDFTPALSAEDIAAARAMSPGQTEFALTY
FT                   GELTYEGCTRLGEILAMGPDDVFYDLGSGLGRATIQAHLQWGVKRAVGVELSAERSAQA
FT                   RRAVERLEQNGQLDHSRRLDLVCANLLEGSYREATAVYLCCCCWDSTFVAQALEVLEKR
FT                   AVNLRQIVTIEPLDRKFGLRPAWLTLKQETRVGQTWAPEGYPCYVYEVTR"
FT   CDS_pept        join(928813..928901,929050..930358)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639538"
FT                   /orf_name="MICPUN_62901"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70385.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniParc:UPI000199C51C"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ7"
FT                   /transl_table=1
FT                   /translation="MAGEGHVSWPGVACIATGALFGYSSRAFKRNIPQYTDFRALERDL
FT                   RAAASRARAEPTRRRHHPTHAAGENEIRARPAQADDDDDDAPFGMLVAITGAARSDVLV
FT                   PCVHAKRPDGRTPERAIYVDAVTDQYLARQAVRSGEWIRDCVVVAAMAKEAPTWRLEDP
FT                   AGHGVNMHRATSMAQASDAARAADWHLSLVHDEFESAGSAGAGSSLHSRIIANALDVNM
FT                   GLNVLGLRHRERVLAPGARLTAVGEVFIAPNGGPVGVDGGDGAGEIRLRRPRRRKGWRR
FT                   HGRGWRRKGGTPGDEKSAPGDGDGDGDDAAMSPRMDPNVFTVTQKPFDEYVDGFGSWGK
FT                   VNAALGLGFLGVGVALVLTKLWRARLTRWREARFLRRMREAEEARRAAGGGEGDDGGDT
FT                   AGTNTDTAGAKVSPGETCVVCMYARSEVVYKECGHLVCCGVCAGRMDRCPLCRRRSAHM
FT                   RVYRAGL"
FT   CDS_pept        join(930448..930762,930890..932494)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639539"
FT                   /orf_name="MICPUN_62900"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70386.1"
FT                   /db_xref="UniParc:UPI000199C51D"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ8"
FT                   /transl_table=1
FT                   /translation="MSALRRRALWAPGVRLLGRREDLARVTPSRPSSSSSASEPPGPDP
FT                   AARMASDLTTYARGRYRSGDRAGAAGVLEHGAEMVMRVGAGPEVDAAASRARLAWALVQ
FT                   ADAGELAHAQDTLSAACASADAAGAAHARDKLASHVAAAINAARCVAAGPAAGVVGAED
FT                   LMRAHLASADAAAGADDGAEGAEGAEGAEGTEVGDAAVMRVAAAGARVAAAAAIGDSDV
FT                   ASKSARYILDAFSDHSPLGGEWDGGFGDVPPGLERASSVSLSRSEALIELALRAANEPH
FT                   GFAVAHAFKQCAQWIALAAAGDDDVNAVLEGDARGSGRATLARADAMYALAEEMSASAR
FT                   SSAATAAAASGMYADVAFADVKLGRAQLALRLATSLAARLNRKDESEVARSSEGGGAAD
FT                   GSDPGGESPGGESPGEESESVEETRGYDELRDALAAAESSAAAALTACEALGGSGSHAS
FT                   EDAPNESAFFPDARVALAVAASGDVYVARAVVAAKGRGGVGDGAGVMFAEGLYRNALRL
FT                   MGTPRPPTSTADDADAAAGGAAPAHLRLCAAMVHARYAAILRASGGGRREREAGEWAAA
FT                   AAREWRAPGYGDKDDACAVAWAARSIGSVGEGGEKACVHDLTLMMPVTLHCTRYPRGRA
FT                   TGGG"
FT   CDS_pept        complement(932579..933952)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639540"
FT                   /orf_name="MICPUN_62899"
FT                   /product="Predicted protein"
FT                   /function="acetylglucosaminyltransferase activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70645.1"
FT                   /db_xref="GO:0008375"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniParc:UPI000199C51E"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJQ9"
FT                   /transl_table=1
FT                   /translation="MPQDAAGTVLRERSVADRARAPEPAARNSPAHPPPPPPPPPTRRR
FT                   GAFLPAPSDGGRVRRFLVSLAMGAAVAAVFEATAGDDGVIRASRWAPSPRPDPPAPAVQ
FT                   TPPPPDDAFDPWVFDKDRRKVAFLFVTKTGELPHDHLWARFFAGQDPDLYAVHVHVPSA
FT                   FAFDATNTAAPEVFAGTEVRSVPPFFDDTKPRSGSTVTRVTKALLRRALLDEDVARFVT
FT                   ISDSCVPIRTFPELRAYLLDGGQDQGKNVERSFVDSRLDPALAPKVRDAMRSLGVPKLA
FT                   WRKGSSWFALTRPHARLVAEDVKVFDAILKGCRDDNENDDDNGDDKNDDTTDERVCVVD
FT                   DHYVPTLLAFHGKEPHVEVRSVTYENWWPVTRRRAKRYAVQEAKDAVRVIRGKFLSDDP
FT                   VRDGNKDVVGGSGSRSCGYFRGGGDRAGTRRPCWLIARKFTARAGRRIGKFAATAVGY"
FT   CDS_pept        complement(934169..935446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639541"
FT                   /orf_name="MICPUN_62898"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70646.1"
FT                   /db_xref="UniParc:UPI000199C51F"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR0"
FT                   /transl_table=1
FT                   /translation="MPRADPTTYKSMVSENTPLLERGAGSWWDWRRSTAVASAVLLVTA
FT                   LVVAVLGARSSGWRIGTAAAPMGDSSGMEPMISPIGDGEFGRTLVGVLGTEGLGIAYQT
FT                   MLNYECLARRLGRKLVLVPLVTSHFDDVPIDLAELFQFDDGQLVPLAQAPHDIMARVWK
FT                   QYGDGEATNQWIRGGAYGAASVYFGRYLPGVPKGSVARRGGIWTCPADDTMPCVEALAS
FT                   QAQAKDDEELVTVFSDAHFCGIDEGAGALGSPPAVKMSPPNEIYQRWLAATERYFPKGA
FT                   GLSTLHWRRGDRCTQAQITADPNGREFACADFDQTPIPAMCAKNRPLYIATDDFDPDFQ
FT                   DSIVKAGCFSYPQVFGDVGVTDAFGSFLLDILTMTLRTERTFFVLGGSSDNPMMAQLQE
FT                   FEVGAPVETKEITPEGAVPISMLFNR"
FT   CDS_pept        complement(935813..939289)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639542"
FT                   /orf_name="MICPUN_62897"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO70647.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199C520"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR1"
FT                   /transl_table=1
FT                   /translation="MADEAWLSGGDLLDLGSGDAPASVAAAPAPLVVSPLNDITKMANL
FT                   KPVRTAVPPGSALHRTLSIESSGKASTVSDGPFPFAPSPVASKPSAAAKFTPSATKMTT
FT                   SSVAAPVAPVAAAPSPVFKPPSRVIAPAPSPGPEPSPIAVAPSPVFKPPGAGSRFAPSG
FT                   GATFKTAATPESRAKPRGGASSSSAARHNRRKSLGLDAFSCFEAGGGLDDLDLAGGGAL
FT                   DLDDPTADFVFVPAMTPKGKGARAAAAFAPSPVREEPEEEDQPVEAAAAAAAEEEEEEA
FT                   MEMKKAEMKTEEAPMPAFELSPIVTVEPEPAMPEPAMPEPAMPAAAADDDFERKLLAAM
FT                   AAAERGGGLSALGGGVANTPPGAVKTYPAAVDPEPSPIAEPEPEPESAPEPAPENAAAE
FT                   EVEAAAPAAPVDDEFERKLLAAMAAAEQGGGLSALGGGVANTPPGAVKTYPASAESPAG
FT                   EEAIKEPTPVKDPTPVKAPTPVKAPTPVKAPTPVKAPTPVKAPTPPPPAVDDEFERKLL
FT                   AAMAAAEQGGGLGALGGGVQNSPPGTARAPVQNSPAPVAAAEPEPEPESESEPEAADED
FT                   RAIEEVGEEDETVVVSCEDDTVVLEGEAAPEPEEEDHEPVSAMKGDMTMMDVSMMDVDG
FT                   GATPAPPPPPAAAPPAVNDEFERKLLAAMAAAEQGGGLGALGGGVQNSPPGTARAPVQN
FT                   SPAPVAAAEPLQPLQPEPESEPAAVDAEEEVFNDIPCFETNKMKRHRVAELREACVRRG
FT                   LSDDGKKDELIERLQRWNDAAAKAAAPAKEDHEDEPEEETHDPMSAMKGDVSMMDASMM
FT                   DADEPPEEPLQPLHPEETPAKRTPGRPPRPSASAKKTRTSPEREAEPLQPSQPLQPAAA
FT                   FPPPPPPPPTILAAAAAAAAAAAAPPPPPLPPAQWMRRVTTTTTAAPAPAPVAVPVAPV
FT                   AAPAPAPVVAAPAPVAAAPFARASASVSHSHASPPAAPAARRPVPVVDFGCSPVVKAAP
FT                   VSRIPKPPAPVHHVAPMHHVAEPLQPLQPARRAKSSERPAWVTDATEPAPVRVATEPVP
FT                   VHVAPVQVATEPVHVAPVHVARVAHPPGATTNDAPVADDFEARLAAAMAAAEAGGGLAA
FT                   AIAGGGGGVMNSPLGGRGGGRVDLKAEARRLGMTAAQLRHEGMHQCDSPLR"
FT   CDS_pept        940356..941381
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639543"
FT                   /orf_name="MICPUN_109234"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70387.1"
FT                   /db_xref="UniParc:UPI000199C521"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR2"
FT                   /transl_table=1
FT                   /translation="MRASASRTAVFLADEAVDWTESLVHDEFAFDLLRRSGLGEDAADV
FT                   AGTFMSFLLRPRRVHGLGSPVLLTTPEGEGEIAGSIPARVVVGVHALEDALEYRSDVAE
FT                   DEEDSGDAEVGGSIPTAGEDPAGELRAWTESCVAALTSPRPRRDGGGDGARKKRGGRLS
FT                   GLFRVAGKQTPVRSRTDVEGSNPDGAARQVFDVHVAFEDASFSARGAGTVRAWAERVFA
FT                   NKHGSNKHESSNEHGSNEHEAGSDDASLADLVALTAGSDALVVTALGSDLGGVVSAVWR
FT                   AVTGSDAYAPGDGCGGGGNEGTQLWRGSFGGERAAALARATGRGVVAPARRASRGGEGE
FT                   C"
FT   CDS_pept        942300..943394
FT                   /codon_start=1
FT                   /gene_family="HOG000265291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639544"
FT                   /orf_name="MICPUN_109233"
FT                   /product="Predicted protein"
FT                   /function="acetolactate synthase activity"
FT                   /function="amino acid binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="ACO70388.1"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG592923"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniParc:UPI000199C522"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR3"
FT                   /transl_table=1
FT                   /translation="MCVERGLMLMKVNAKPEQRTELAELAKIFRASIVDVSPTSLTMST
FT                   VGDPGKNRAFQQACLKFGILEVARTGKLALKREPVFSESRRRRVKLMEAMKEARAAVAG
FT                   LRGGSGSEKEELIASRIVRAVANMGEGGDGELNIGDTYAAMEDGDGSGVWDVPVLNAQY
FT                   QGAGKSGGIDMSDGIPKMDPNAKYTPHTISIVVMNKPGVLDVVTGVFARRGYNVQSLGV
FT                   GPERTFDISRISTVVPGTFDDITKLLRQLLKVPYVISAEDISRTPFVERELMLVKVVCP
FT                   RNMRGELVDLCNIFRCKVADVSEDTVTIEVSGKVSKIGAIQSLLEPYGILEVARSGRVA
FT                   LPRDSGVDSKLLAAIEDEGDLEFA"
FT   CDS_pept        943567..944637
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639545"
FT                   /orf_name="MICPUN_62894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70389.1"
FT                   /db_xref="UniParc:UPI000199C523"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR4"
FT                   /transl_table=1
FT                   /translation="MSALAPRAIASVAARRALFLRSPRGRISRVSRPLHFFTRNATDGP
FT                   SQDKPFPPGDAREYDAGAILNRTGTHARRPSFPAIFEDARPDELAPPPSRRVLSSFPTL
FT                   FTYRSYVSPRAGFLVTAQSSRERKRVARAVEEAKYMLTRGDDPPALGEPAPLLKAGELG
FT                   CAFLPLLGHLPNMVTAYAKEAVTTFVSDPPPPHNTPEYLARLVPVERACDASVHAIAET
FT                   LTQIVEFEHPELRPTLEPQTYGDAARDAVPWTMHYEHHGHTRDVPRAALEDAVAAMFPP
FT                   PDFVREDESVGGDTANNEKSKFCVFVAVFEGAALVTVTRDWDVTRGYRVREMAEREEAR
FT                   REGAEHAAAETTGGGG"
FT   CDS_pept        join(complement(945682..945782),complement(945488..945579),
FT                   complement(944728..945080))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639546"
FT                   /orf_name="MICPUN_62893"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70648.1"
FT                   /db_xref="UniParc:UPI000199C524"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR5"
FT                   /transl_table=1
FT                   /translation="MTCSNPGRAGDELGTQENTNVSRSKRREEIKSVRQSLKILFGEIS
FT                   EWWKYPAGWVSERWIPARMELDTIYVGAAPHRASQHGSSFRAVVLGHRTPRASLGRVPC
FT                   STDIMPHRSRVGPAARAHGTRRKTQLCATPTPSFVPRHSAQTALTLQQGTAQGDVVHTR
FT                   LPGKNTSGVWSKSPWAAR"
FT   CDS_pept        join(945892..946135,946228..946391,946744..948921)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639547"
FT                   /orf_name="MICPUN_62892"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO70390.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C525"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR6"
FT                   /transl_table=1
FT                   /translation="MNCNLALSLNPCLARAPRRALARGRQRRLQKKSTVVRSALSSKQP
FT                   TEEGAGAPGVSSDPFSSMMNFISDVNPLASVFKSPDDKLHVHFGAGRLGFGLVLPALES
FT                   SGSPYVIMNRPSKVWHPIIAGEEEAQQHVAVKINGECSCGGRGLHVITEADIRSREDGV
FT                   LGCLKEGLDKGARGFLLLSMDVDLTAPLVAQATSFSCALGPAVDVLVNLLVQLPDCEDE
FT                   NRPVLYACENDHSSVEKLQFALRTKIEAVPCMVDRICVDLQVTEDGREVAVTAEGHEGS
FT                   IVVLNQPESGEGADGDGPLAGDYVSNPENEKDSRYLYRKKLLTVNGMHTVIAFRTLCSY
FT                   AQNQRNFQPPEKCLALPLLSDETITEEQRKEIWTWGVAQLLVLMWEHGLTTMMRVHGKE
FT                   SPEELVLFLLDQLRTTLDRFFSIEDSTARVLGGGVSLRYEGRLLPTFDTLNSDIFTVGW
FT                   DETSPQLALLKEAGLDFDEMKETLKSLVDEARPFAAVDKRARAMQALEEAMKEEQAAVQ
FT                   IRETQIRCNAASDIAVLFDFDGTLGDTETCAMEVAFWELAPYFPNVLAEDLTPQRMKEF
FT                   IRLNAGKAFELMFDRVESDRAAVGLPPIEEVRSRFQEDFDIIQVVNSNRAALGLQPFEM
FT                   VREDHASILDKARDETLVALTALAKPNDGVIKALNFLKISGFKYAVSTTSPKPRVPVCI
FT                   ETARLTDFFPEEKVHSGFSDFDPPKYKPAPDVYIKAAAAEEVPVDNCIAVEDSVSGVGS
FT                   AANAKIGLIVGYVGGSHIPYDRREEQAKALMKGGKSIDRRGADIVITDMTDLPTVANFF
FT                   LDLKLDCGDDEQCLARPYDFSQLGPSLVDKIYTPEFSGAMPEAEDVNPR"
FT   CDS_pept        join(complement(951280..951387),complement(949457..951061))
FT                   /codon_start=1
FT                   /gene_family="HOG000202982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639548"
FT                   /orf_name="MICPUN_62890"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70649.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG510279"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C526"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR7"
FT                   /transl_table=1
FT                   /translation="MTGTVTRTEAVACDRGDLSTGIVHFGVGGFHRSHQQAYTDDLLRQ
FT                   DFDAAKDWCYTGVGVLEWDAKMRDYLKNNDWRYPIVAREGTDVDAMDMHVHEVCTLRDM
FT                   LLSFEDPAAVVRLLAAPSTKIVSLTITEYGYRVPLNEGDHKLLELANQGVLDDPELSMP
FT                   ESIDAACAKATVFGLILAALAARHRLGRRPFTVMSCDNLPHNGEVAKRRVINAARDAPE
FT                   CDESLCAWLEDEVKYPSTMVDRITPATSPADIADLKERAGIDDAWPVMCEPYKHWVIED
FT                   DFVDGARPAWERVGALLVPDVRPHELMKVRLLNVTHSAMCYVGALAGLTHVHEAVTHKM
FT                   IKPFLRRLMTEEIAASLVADPTMPGELLAVLDEYVDLVLSRFENVAVKDTLDRVAMDGS
FT                   EKFRVQGREVIMERLAREGTVRGFALYVAAWAHFLRQKVRDGEKIKDASAGLVTAPWEM
FT                   DKENIGAIGATVGLEAFLDIEEIFGVLARHEGWREAVKREFLDIDQAGLEATLLGAIFG
FT                   VGHNSNADLSSLERARERASGTFALDETCVADTIETDEWRADDEAAVFVSLEA"
FT   CDS_pept        join(952227..952511,952964..954583)
FT                   /codon_start=1
FT                   /gene_family="HOG000202982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639549"
FT                   /orf_name="MICPUN_62889"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO70391.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG510279"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C5A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR8"
FT                   /transl_table=1
FT                   /translation="MAAHVAAMIGFRTALAAPRALRRVPRSRAARETRGGNDGGFPVVR
FT                   AEIRRIASPDGTVVDLPNVTFKRPPAVDRAACKSGMMHIGVGGFHRSHQQAFMNELLDV
FT                   NFDVAKNWCTTGVGVMPNDSAMRDYLRDNDWTYPIVARSGTDASTMRAEVEEVYALRDM
FT                   ILAFEDPIACIEAMANPDVKIVSLTITEFGYRVPLNSSDFKFIERALNGEMDCETPYPE
FT                   DMEKPSTFGIICAAAAARFERGQRPFTLMSCDNLPHNGDVCKGRMTSAAEELVCAGLCS
FT                   VSLDEFVVWLQNEVRYPSTMVDRITPATSWDDIATMPDKYGFEDKWPVMCEPYKHWVIE
FT                   DDFVDGARPPWETVGATLTKDVVSHELMKVRLLNVTHSAMCYVGILAGLTHVHEACLHS
FT                   KIRSYLELVMLEEIAPTLRANPEMDKSLCDRIPSYARSVLERFENVAVKDQLDRIAMDG
FT                   SEKFRVQGSGVIREGIALGLPMDAFALYVAAWAHFVKREVEAGVEVKDMGAQGVTAPFR
FT                   PGGTGLPAFLDMVDIFGDLAMDLTWRQNVTRMYDTINEHGMEFALDVVLGTVSAFPDSI
FT                   RSDLRLDNPTRAQEAQQLAGDEAVVAVVNPARLASAETIMYTSEMLMGEGSSVNVNAR"
FT   CDS_pept        complement(954757..956190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639550"
FT                   /orf_name="MICPUN_103325"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO70650.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C5A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJR9"
FT                   /transl_table=1
FT                   /translation="MAATFADYLGMAMLTPALPYWCADEAGMTPAQVATWTGAITTAQY
FT                   AGAAMGNFAVGAAGDGLGAKRTLLATLLGDVVLFTLTAVETRPGALLAIRLVAGASSPL
FT                   VAALMYILQRAEDKAQTLAGVNAYSLSVNGGYALGGVVVGLAYGTMGWLGLNLLSACVA
FT                   GAALVFVAVVAKRDLPAVTESGARRREEAEAGVGVGAGMSPRASFAVGEAGEGGGGGGG
FT                   PGGNRGGGGDTAGDTAGDGALTQLEKKVSVFRTGAMVSHCYTAFNTGYLFMGFIVLFVL
FT                   MAKQVLGWSVVRVGWAFMAIPVANVVAMYGLIPPFVARFGVHCSITCSSIGTVMVLSVL
FT                   ALPSVHRTQEGILTVTFFLILCVVLLQVPNQMRIKIIADAHAPGSMGRITGASRVCFAT
FT                   GQTCSPIVVALLYVQDPTWAVLSMVFVAAAVPAVFVACGQALWADPDSMAAGRGGDGSG
FT                   RGVPRARASGAEGPAPGRT"
FT   CDS_pept        956475..957278
FT                   /codon_start=1
FT                   /gene_family="HOG000100810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639551"
FT                   /orf_name="MICPUN_87026"
FT                   /product="Predicted protein"
FT                   /function="ribonuclease activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO70392.1"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG557988"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI000199C5A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS0"
FT                   /transl_table=1
FT                   /translation="MGGGWTDLGVRADPDNPLALREHIATAVALGYATVATDTRVDAGD
FT                   KAAGREIARGLDPIDPATLASALADASARTGARPVLNRLTRLTIRFGEPGELQTLLNAH
FT                   DRAVRAYDILALEPTTERALASACANRRCDVIALALGARPSFRLRAGAVKAAASNGIAF
FT                   EVAYNSALMETTARRNFFANAASLTRACGGGGDAGAPHGVGGVVILTGGSRRANELRAP
FT                   LDVVNLATMFGMKDGDARRAMAARCDALVARAARRRAAEADAADR"
FT   CDS_pept        complement(957451..958329)
FT                   /codon_start=1
FT                   /gene_family="HOG000245380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639552"
FT                   /orf_name="MICPUN_86845"
FT                   /product="Twin arginine targeting family "
FT                   /protein_id="ACO70651.1"
FT                   /db_xref="HOGENOM:HBG733232"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="InterPro:IPR019822"
FT                   /db_xref="UniParc:UPI000199C5A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS1"
FT                   /transl_table=1
FT                   /translation="MASSAADGFVPAAAAAAPRPVPALAAAAPPPERQAEQVRSFLYPG
FT                   EDELPDDVNMTIWEHLEELRDRALVSAGACAVAILLCFCFAKDLVIFLEQPVIDQVKFL
FT                   QLGPGEYFFTTVKVAGYCGLLLGAPVVLYEAIAYVVPGLTRDERKFLAPIVLGSSVLFY
FT                   AGIGFAYAILTPAALKFFIGYSNEAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLL
FT                   GQSGLVSSAQMLSIWRYVVVGSVVAAAVLTPSTDPFTQMLLAVPLMSLYLGGAALVGVV
FT                   EKGRGVNQIEG"
FT   CDS_pept        join(959636..959746,959935..962601)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639553"
FT                   /orf_name="MICPUN_103323"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70393.1"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="UniParc:UPI000199C5A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS2"
FT                   /transl_table=1
FT                   /translation="MADRAAQIVSEWFVKCANVVLQSRIVLASDEGKQNRWFNLDVVEL
FT                   DAYAKSLQPWRSKQRSGPEKSGRLPPLVLDVYVSDLGPDGEERGAEEGEEKSRERPRVL
FT                   IERWVLRHDADDADAGLLGDDESSSNDRRRQNPSPSKPGRTSAETVAVAYKRTVVMVRA
FT                   LHALCRSLPANRFHRAARQSQCRGLRFAMSHEVRPGGTGGGVDSSDAAVVVEEEKPSGG
FT                   GGDFGEYSFTPVRTPAGGSLRAVVYFLNADKLAGMDCVPKPTAPRVIDGYLGGGQKRSE
FT                   TAGGGGAHPTGPGPFLPSSHTSASPSPFSSTDAPAPPRRDFGFGTSPSSGGVSGRPFRA
FT                   NSWAGKATYGFGASPPARATLPAGGSPVTTGDGVPGGLPRAGSRGMLSEAIAEQKASEE
FT                   GAGGVNAPSVAPSGGAATKGESVGRSSTKPPPSPPQIYGFGVGSLGTATNFGDKVPPSS
FT                   PRYGSVGSPHVGSPSLPFASTSHPTRFTPLGSGGSGPRGGGHGFSTSLASGDHALARRA
FT                   REFGRSPGDGQTLPGSRPQSARLNGGAIDDSPPWHFRGFTGALSASPGSTPGGGTTPRG
FT                   SHGSHGGGSAGGAGHNQSNSGGGDRSNPIGVYYASPGRRPRRPSWSSPSSSLSASLSHG
FT                   GDASGGAGGGGGGIGSLVGGALSAPLGSSPGRLGFAYSHGGVGGFNGAPHAYSYGASPG
FT                   ASPGGSFANAMAHLRAQRAGQGAGAGVVHATGIQRIPDSGHGAMFESGADSDQLPFALD
FT                   DEDDGLGFDHGGGGASSGGGGGGGGGGGIGSSVDSPIDRQSREGSSFGSGVGGGASGRS
FT                   DAAVGALVRMLQDAAPLSAEWGTEGERVGGGPRGWGDAGGGASEIDSSRDASSEASGDT
FT                   AGGVTAGGVGGEMTLDWALSQLSRFRDFKASLDESTSTLEAVEERPNGEEGGTE"
FT   CDS_pept        963092..967372
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639554"
FT                   /orf_name="MICPUN_62884"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="calcium-activated potassium channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO70394.1"
FT                   /db_xref="GO:0015269"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003929"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniParc:UPI000199C5A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS3"
FT                   /transl_table=1
FT                   /translation="MADYDYDSARMKDASYAEASWDRFLFQQVCGLGGFFTVLILTRLW
FT                   TSFSHTRFLKRRHKSRIDTLFCLMDIIFSTGSMFSFIAYSDLRAYNIGLTVVEGFFAVF
FT                   YLAAMMRRLWLKNFDYGVAITFSNFFDSYSVAVILYQIFSGMPTFLTPLFMRSMAALIR
FT                   YEEMLELGLLNDWFGEVRQRLGLSALRFICITYFFACCGFCIEILGDIDINKDDAVDRI
FT                   FVSVNPDYEQTILKQLYYVVVTLSTVGYGDISPDTTIHQIFAMLMIVSGVLIASSEVSA
FT                   IMALKDSIDTGTGQYRRSRFRNSHIIVLGGAVTSGSATLQIFLEELLHPSRPSTMLPDV
FT                   VLMSEEAPGNGLRRILASPLGRQHVRFIRGSPMDQSALARADAANADMSFIMGDLSCLE
FT                   HLAHAEDEDTILRASLLQRQLPGLPVRVLLLRPWAKEMARTAGINPLSCLTSGVLNYYR
FT                   TALSVRVPGVPVLLTTMYSKLAGDWSQLPSSGQPWVREYFTSMRHDVYGAQVGPEYDGM
FT                   PFLKAAAIIYKNHDVNLLAVQSAPENGGRLCPAGFANGKLHVLAEGDVVMCLGRDVDRV
FT                   LKAVGSVSKHPDSWRKRFHATRKMAAKLGIRRETFSPTQLNVTALQRGGESVHGAHSVH
FT                   GVHRRSRSQSQGAGQEDRSAANLNTAPVATPVAAVATLAHSRSLDGYSMDAHTAGKLAK
FT                   EVAKEMRAEQRKQKRRSDDRQRRVSIEQVFSNPALQGSSTGVLGLDNLNSGDMHDTSSW
FT                   NVNFPKTKSQPRNPREIAASEARSKRYAYGLTESGAAQMPTMLAHPHPPVPSKFDYKGS
FT                   LNVTNLCDLAARLSATAAVQDAALVVRQQRAMGLEERDFTPNRTIKRIAQAGNHILVIS
FT                   DAELDEQRWEDIEVLLYRLRGNDGCNIKPIVVVTRTPPSVQRLITWRSIDVYVSEGFNV
FT                   NVDKGSNANILGFDVAHCIVLLADVCSSDNELLMDRKVLLATSVLERACEGYPNMAPHE
FT                   LLPKVILEFHHPKSVWHVRETKGFGSLASELTDKGAKAHEERRYKKAKDRHRNRRGSHE
FT                   MPTRASMSAEGHVATLERFRAQQYNDSPMPGRGSSLDGPRPGASLSGRFNSLNPVRAAV
FT                   DMSKQDTRGGKIIGGLLKFCGVLDMEGNERGSKANYNKYRERFQDQNRLSWIEHPESHT
FT                   QYARGNVMFRTEVSRVMATVFYTPGLMELVDSLTRDARAGENVGHHPRIWSVPLPEALH
FT                   GKTVGDAFEWYADSEALVIGVYRNVKKPRRRRRKKRSKGSTDSSSSSSSDSDSDSSSSS
FT                   SDDDDDSGDEGNRPDHSYVLTAPPHVVRLNPTDTLYIIATTAWAWSNLPELIELRKVFW
FT                   VIFLQRQFRLKCEQRREKERLEVQKAAGYGVEQTPELDPSSIQALREQSVLLTHQSSHG
FT                   ANGEHRTPSRGPTPPPRPRSTSPP"
FT   CDS_pept        join(967713..967717,967766..969929)
FT                   /codon_start=1
FT                   /gene_family="HOG000245986" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639555"
FT                   /orf_name="MICPUN_98128"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70395.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG678447"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI000199C5AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS4"
FT                   /transl_table=1
FT                   /translation="MAKPSGDAPDLPKWSSITPEHVKPAIMAAVDKVNAEIDAIETAFT
FT                   ESTPSSWSDLMDPLERLSEELSRPWGVVSHLKGVRDSEALRAAYDECQPAVVTASLRVG
FT                   QSRPVYDALVALTKNEAAWASLTDAQKRAVECEVRDAQLSGVALDGAQKDRYNEIAKEL
FT                   SELSTKFSNNVLDATKAFAHTCVDKSEVDGLPDSALEQAAQTAKTKGGHENATAADGPW
FT                   MFTLDAPSYMAVRSHAKNRALREKVYRAYLARASEHFAPFVDDADAKAKFSKNGSGDNA
FT                   PLIERILALREEKASLLGYDTFAEVSMAKKMATLDRAESLLEDIRAKARPAAERELEEI
FT                   RAFAADAGAAEATSGLMQWDVGFWSERLREAKYELKEEDLRPYFQLPAVIDGMFELAGE
FT                   LFGIKVEAADGDVEVWHPDVRFFRVIDVATNQPRAYFYLDPYTRPSEKRGGAWMDDVVG
FT                   RSSAMAPTTGAVRLPCAHMVCNGTPPVGDKPSLMTHNEVTTLFHEFGHALQHMLTTESC
FT                   GPVAGINQVDWDAVELPSQFMENWCYDKKVLRKIGKHFETNEPLPDDLYEKLVASKNFG
FT                   SGTRYLRQCHFAMTDLELHARYKPGAGADAVFATERKIAEKTMIMPSIDEDRFLCGFGH
FT                   IFAGGYSAGYYSYLWAEVLSADAFGAFEEAGLDDEAKVAETGKRFADTVLALGGGAAPL
FT                   DVFTRFRGREPAVDALLRHNGLVPVAAA"
FT   CDS_pept        972890..973399
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639556"
FT                   /orf_name="MICPUN_109230"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70396.1"
FT                   /db_xref="UniParc:UPI000199C5AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS5"
FT                   /transl_table=1
FT                   /translation="MNPAAPGLAAPKPPSPGASPTARLGPRHASPAGGGTPRSPRWDAV
FT                   AAAVAARSASPSSRSPPGSGSGSGSGSNPAVTPGSSRYYRERVGIAGPGVTTPPSGGSS
FT                   GDRIPRSPPSSNPRRAMGAGSPDSVDISRAMRTDPNLNTGTRDDDDSRQFSVSDISGDV
FT                   SVGKSP"
FT   CDS_pept        join(complement(974915..975041),complement(973670..974760))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639557"
FT                   /orf_name="MICPUN_109229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70652.1"
FT                   /db_xref="UniParc:UPI000199C5AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS6"
FT                   /transl_table=1
FT                   /translation="MPLSERCMYAFAALPVLPVLLLVGPIIAAAKCAEGDNSRYYKDPI
FT                   DDDGDETPERRREMLALRQAGYGDRVAVSLGNVPTGVIHNDYSFRGRNAQLRKPAGIKS
FT                   GSKPVKSANEIWLSHKDEPAPGGTISRDKTPNGSVRDATRAGAIVNGGEVAGSIPPGAA
FT                   ASGSPRSSNGGSRESSTRNGSHRARGRTISFNDAAEVLDDIRGDGVVRSSDPGVRPVRS
FT                   SLDSTRGLEDASTSGETTARSGLHAANQNQNQNQNQNQNQNQNQNRHVARPALRHPGSP
FT                   SRWGAPKPLTSDEVWAANGSSSPRRSLDGAEQEELARGGGRFRRMGSAAENENGDGGNG
FT                   GDGVRERGDSASGSLLGDVEAEARRTLELDASTVLVKPFTETLHPSPKQVVPITGGDPK
FT                   SGGVAI"
FT   CDS_pept        join(976004..976056,976318..977449)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639558"
FT                   /orf_name="MICPUN_62880"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO70397.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C5AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS7"
FT                   /transl_table=1
FT                   /translation="MGRTDYHEILDEAEHMESTKGAEVWDLEAEAARLNLKLDELPMEE
FT                   KAWDRAVNVAYRKAALRAHPDKHPPEQRDAAEANFKRLNRANKLLLRVGKAIRDEAESG
FT                   DARAAVEQSKRLDEERRKREEARLASQLKGIVSLHGVSGGFTGSNGRLPDLEHDQVRWT
FT                   RGDLENQLVKLLARCGEEFEARAKRRRRWKLIKRVAAGVAGVAFLWFVRKTSPPERDYG
FT                   EELREVAEGIRVAIRYMGRELAGAIGRPQDAEEMADDLEMAFLEGRMSVNDDGGLEVLI
FT                   PDPDEDGTYYKLNMSSREDGTMAVWAEGADGETVEYASADWDDESDRVGYFGIPVEQRA
FT                   RGTKGSVNFTPADGTEGDGGEGGDGGGGAPWSGGGGGEGGEKRRKFGFGRRAKR"
FT   CDS_pept        join(977687..977704,977945..978437,978579..979348)
FT                   /codon_start=1
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639559"
FT                   /orf_name="MICPUN_98127"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO70398.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG757733"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI000199C5AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS8"
FT                   /transl_table=1
FT                   /translation="MDKMVAQRVVITGAGVVSTHGDSREIFFDNLLAGKSGAIDLTAWK
FT                   PGVFDDLPTRIGAPVQELDYGDDLTAKEARRMDRVHQYAICAGKRALRDAGLWGADLEA
FT                   LDKTQCGVLVGSAMGGMQVYEDNVMALNTKGIKKVSPFTVPYLLTNMSGAILGMQAELG
FT                   FRGPNYAVNTACATSNYQFINAATHIRAGQADLILAGGTEAACTRSGLGGFIACRALSS
FT                   RNDDPTGASRPWDKGRDGFVMGEGAGVLVMESLAHAKKRNATILGEYLGGGISTDAYDL
FT                   TAPRADGRDVILCMRSALADAGLEADAVDLVNAHGTSTPVGDLCEVAAINAVFGSIDKA
FT                   RFRLNSTKSMLGHSLGAAGALEAVACLQSIGTGRVHPTINHDDPEEGVDFDVVANEAQD
FT                   FKVKVALSNSFGFGGHNSSVLFGAFEG"
FT   CDS_pept        979782..981140
FT                   /codon_start=1
FT                   /gene_family="HOG000248674" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639560"
FT                   /orf_name="MICPUN_62878"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="ACO70399.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG621020"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199C641"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJS9"
FT                   /transl_table=1
FT                   /translation="MGGGTREEDDSRPSKARRVDITPDPPCQTKHAHRAEGPAGVERSR
FT                   DSAPVAPSSIMGATRAAPRYLLRVQYDGTNFHGFQRQANARTVQGCVEDALDAFAGGGG
FT                   GGGGGGGGDGADTMRSSIVTHGSSRTDAGVHALDNTMHVDLPPRVSRREPTRALPPHEP
FT                   HVVASALNHFLKKRGAPDVAVTRCIRVDPNAFHARFSATGRTYHYRMHVSPTPPSLFER
FT                   GRVWHVCSGAGDRDAAGGGADGCHENAGHDGRWGLDVDAMRVAAAHLVGTHDFSTFRAS
FT                   GCQASSPVRTLWDVRVDAAPSWPPFPASPATDSTKPDDFSKVEVTEKPDEARRRSRGKD
FT                   RARAPRGRADLGAATTGFDPATSRPLTSGGVVVTAVGPSFLYHQVRLMVATLRAVGAGE
FT                   IDPASVPALLAARTPRAVPAMAPAHGLYLGRVHYDGTREWSSLGAVPVEEGAD"
FT   CDS_pept        complement(981265..982392)
FT                   /codon_start=1
FT                   /gene_family="HOG000265296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639561"
FT                   /orf_name="MICPUN_62877"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO70653.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG607560"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniParc:UPI000199C642"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT0"
FT                   /transl_table=1
FT                   /translation="MSAASARLTASGLSSASRGGKRAGPNTPRAVVAPSAMGSRPSRRC
FT                   VSRVHRATTAGAPSADLTRAWDATVTLEPDIRSKIPFLSSSRRGSGVVVSLDGTGHPSS
FT                   LVVVTAAHVACLAGSRNSIRVRRPSTKDDRDGAVARVVGVHPRLDLAVLTFATDDDGDD
FT                   QNQNQNQNQNQNQNQNQNRRAWLTLAPSPPSVRDPIAALGYPMGWSGAIKRAANAARGG
FT                   ARRSSRWGEVLDGFPKRDNNVTTITHLLHTSAVASGESGGPLVNAALEVCGVHSFGDHF
FT                   TGGERDVAVAVSAATLRGCFARGADNLSVGKAGGEAGREDDLRLVARAVTAAAPVAPAA
FT                   YDTAGVNAMIVESSDPALAAMCPELTREQRMSWIM"
FT   CDS_pept        <982778..>983176
FT                   /codon_start=1
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639562"
FT                   /orf_name="MICPUN_73292"
FT                   /product="Predicted protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO70400.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199C643"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT1"
FT                   /transl_table=1
FT                   /translation="LDVGAAAPVFTLPATGGGTVALADVVKANKYTVLYFYNQDFSSGC
FT                   SIEAERFNQALGDFKAKGAEVVGVSMDPMDKHEEFCSAKDLKFKLLSDNDGKVSEAYGA
FT                   DLKIPILGKFSDRQTFLIDSSGVVKGHWL"
FT   CDS_pept        complement(983347..984912)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639563"
FT                   /orf_name="MICPUN_62875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70654.1"
FT                   /db_xref="UniParc:UPI000199C644"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT2"
FT                   /transl_table=1
FT                   /translation="MGALVSRTRKRAKAYVLRPFKRRGYFLTAEEIRERNPTIFDKIAS
FT                   GKYTEEAVEKMKLKRRDDFVALRREMLARTRDPAERAGVMAKFFTSRKPPRRSRVNLPH
FT                   EAWAPGAGTGAGVGAVGGGVSGAGVPSGQSQFARLVSVDDAPVGSLPDPRAVALGRNHR
FT                   RTNEGGDKGVEDVGGEPRSRPSSSGIGARALSASSIHRALGSSLYDDSSLHDDSSLYDD
FT                   DDECYRDEWTSSHGGWYASAVRGVDDFVASPTKYFESDDERMTDDVGEPVPATLRKRMV
FT                   EQDGVAVEYPRPAGLRRWDGYVAEEDGKIARVLEEERKRRVEHNREMRRIYKRRYGRWG
FT                   RKPTQREAPEWTRNPTMDAPWRRPNNREGTKCTTREAVEGLAHELRSGTYGWWGAMELR
FT                   KNAIVREENAVRAAEKTWGETSGAQAWKESKPPAGGLSTAVATGHAGGISTSRGTGPGC
FT                   DVSDGPVTNETTSAALREDRAENGRWRAIRAEHREAQARARAERERIKAERAASRNSKR
FT                   KAGV"
FT   CDS_pept        985675..986052
FT                   /codon_start=1
FT                   /gene_family="HOG000227349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639564"
FT                   /orf_name="MICPUN_86807"
FT                   /product="Predicted protein"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO70401.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG526257"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="UniParc:UPI000199C645"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT3"
FT                   /transl_table=1
FT                   /translation="MADAGNPNEEMKLVLVVNEELGMTAGKIAAQCSHATLAVYQSLGP
FT                   NHRAVLRRWESEGQKKIALKCRSATELRQLAAAAKAARLPHFIVEDAGRTQVAAGSCTV
FT                   IAIGPAPESAVNAVTGALRLL"
FT   CDS_pept        join(complement(993463..993505),complement(993189..993280),
FT                   complement(986153..993028))
FT                   /codon_start=1
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639565"
FT                   /orf_name="MICPUN_107163"
FT                   /product="Predicted protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="ACO70655.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG398200"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniParc:UPI000199C646"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT4"
FT                   /transl_table=1
FT                   /translation="MADQEAHEAALEEKARKWQQLNAKRYGISRKFGYVEPEKQEMPPE
FT                   HVRKIIKDHGDMSSRKFRHDKRVYLGALKFVPHAVFKLLENMPMPWEQVRHCKVIYHVT
FT                   GAITFINETPKVIEPVYVAQWATMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNL
FT                   LDVDPLEAIELELDEDEDSAVYEWFYDHMPLKHTKFINGDSYRKWQVPLPIMATLYRLA
FT                   GQLLSDLTDKNYFYLFEQKSFFTAKALNMCIPGGPKFEPLYRDMDKADEDWNEFNDINK
FT                   LIIRSALRTEYKVAFPYLYNNRPRKVAVPPYHTPMVMYIKTEDPDLPAYYYDPLIHPIA
FT                   SYRSEGSAAARYADRVEEDEEDDFELPEEAEGPLLANAPLYTDNTMNGIALCFAPRPFH
FT                   MKSGRMRRTIDVPLVNGWFHEHCPSGYPVKVRVSYQKLLKCYVLNQLHKKPPKGLKRKN
FT                   LFKALKKTKFFQCTELDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTL
FT                   TTKERKKSRFGNAFHLCREILRLTKLVVDAHVQFRLGNVDAFQLADGLQYIFSHVGQLT
FT                   GMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGVGFWAPMWRVWLFFLRGIVPLL
FT                   ERWLGNLLARQFEGRHSKGVAKTVTKQRIESHFDLELRAAVMHDILDMMPEGIKANKAK
FT                   TILQHLSEAWRCWKANIPWKVPGLPAPIENMILRYVKSKADWWTNVAHYNRERIRRGAT
FT                   VDKTVCRKNLGRLTRLWLKAEQERQHNYLKDGPYVTPEEAVAIYTTTVHWLESRKFSPI
FT                   PFPPLSYKHDRKLLILALERLKENYSVSARLNQSQREELGLIEQAFDNPHEALSRIKRH
FT                   LLTQRAFKEVGIEFMDLYSHLIPVYEVEPLEKITDSYLDQYIWYESDKRHLFPNWIKPA
FT                   DTEPPPLLVYKWCQGINNLTDVWDTNDGECVVMLQTKFEKMFEKIDLTMLNRLLRLIVD
FT                   HNIADYVTAKNNVVISYKDMSHTNSYGLIRGLQFASFVSQYYGLVLDLLVLGLTRASEI
FT                   AGPPQMPNEFISYRDVRTETRHPIRLYSRYIDKIHMLFRFTAEEAKDLIQRYLTEHPDP
FT                   NNENMVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSITTLEWDNGFVSVYS
FT                   RDNPNLLFNMCGFEVRIMPKARMATEYFAQKDGVWNLQNEQTKERTAQAFLRVDDEALK
FT                   QFENRVRQVLMSSGATTFTKIVNKWNTALIGLMTYYREATVHTQELLDLLVKCENKIQT
FT                   RIKIGLNSKMPSRFPPVVFYTPKEIGGLGMLSMGHILIPQSDLKYSVQTDTGVTHFRSG
FT                   MSHEEDQLIPNLYRYIQPWEAEFNDSQRVWAEYALKRQEAQAQNRRLTLEDLEDSWDRG
FT                   IPRINTLFQKDRHTLAYDKGWRVRTHFKEHCLLRLNPFWWTHQRHDGKLWNLNNYRTDV
FT                   IQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRR
FT                   FTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESITMD
FT                   LCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAYKWPISKPSLMGDAKDA
FT                   FDQKSSNKFWIDVQLRWGDFDSHDIERYTRAKFLDYTTDNMSIYPSPTGVMIGIDLAYN
FT                   LHAAYGNWFPGCKPLIQQAMAKIMKANPALYVLRERVRKGLQLYSSEPTEPYLNSQNYG
FT                   ELFSNQTIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKVIHTSVWA
FT                   GQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGS
FT                   ELQMPFQACMKIEKFGDLILKATEPQMVLFNIYDDWLKTISSYTAFSRLILILRALHVN
FT                   NDKAKMLLKPDRTIITQPHHVWPDLSDEQWIKVEIALKDLILGDYAKKNNVNVSALTQS
FT                   EIRDIILGAEITPPSLQRQQIAEIEKQGADGAALTAVTTKTTNVHGDELIVTTTSPYEQ
FT                   ATFGSKTDWRVRAISASNLHLRVNHIYVNSDDIKETGYTYILPKNVLKKFITIADLRTH
FT                   IAGYMYGVSPPDNPQVKEIRCIVMPPQWGNHSQVNLPAALPEHDYLEDLEPLGWLHTQP
FT                   NETPQLPPQDVCAHAKILESNKAWDGEKCIVLTCSFTPGSCSLTAYKLTPTGYEWGRAN
FT                   KDTNSANPQGYSPGHYEKVQMLLSDRFLGYYMVPDGGSWNYNFQGVKHSPGMKYALKLA
FT                   NPKEFYHEAHRPTHFLEFSGMEAGAEGADAKAIEGGETAEGVDREDLFV"
FT   CDS_pept        993762..994085
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639566"
FT                   /orf_name="MICPUN_103315"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70402.1"
FT                   /db_xref="InterPro:IPR003659"
FT                   /db_xref="UniParc:UPI000199C647"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT5"
FT                   /transl_table=1
FT                   /translation="MARFIALLFFALLFVCSPAKAGAAPDPCGVADSCKTCVATNGCGW
FT                   CGETLECKKQPGMFGGGCKGMLKEMSSCTPLRDSLVKLGDSLPAVSAKMVAAYDAVRDA
FT                   ITV"
FT   CDS_pept        complement(994378..996753)
FT                   /codon_start=1
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639567"
FT                   /gene_name="PHO2"
FT                   /orf_name="MICPUN_104976"
FT                   /product="Glycosyltransferase family 35 protein "
FT                   /function="phosphorylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO70656.1"
FT                   /db_xref="GO:0004645"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG444050"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniParc:UPI000199C648"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT6"
FT                   /transl_table=1
FT                   /translation="MEYLQGRALTNAVGNLGLTGEYSDALRTLGYTLEDTAGVERNMGL
FT                   GNGGLGRLAACFLDSIATLDLPAWGYGLRYKYGLFKQAIEDGVQKEYADDWLEVGNPWE
FT                   MKRETQYPIGFYGEVVDGKWVPGANIRAVAYDSPIPGYKTKNCISLRLWDAEVAPKEFD
FT                   LASFNACDYDKSMRETNLASQLCAVLYPGDATREGKALRLSQQYMLCSASVQDILARFK
FT                   ERGNTDWSKLPEKVAIQMNDTHPTLAAPELMRILMDQEGMDWDTAWALTTKTVAYTNHT
FT                   VMPEALEKWPLELMTELLPRHVEIIKRIDEEFIASVKATYPKATPEELERKIGAMRILE
FT                   NYMTPAEELKAKAKAAAAKAAKLEALAAKAAAGEEVAVEDDEEWSAPAPMVRMANLCCI
FT                   SGFAINGVAAIHSEIVRTFTFKDFGELWPEKFQNKTNGVTPRRWLAFCNPQLSSVITEA
FT                   IGTDEWVTDTALLEKLGPLAKDPELQKKWRAAKQERKALCAKMVEETTGVKVSTDAMFD
FT                   IQIKRIHEYKRQLLNIMGIIHRYNEMKAMSPEERANVTPRVCIFGGKAYATYLQAKRIV
FT                   RLVTAVGEVVNNDPEIGDLLKVVFVPDYNVSLAETLIPASELSQHISTAGTEASGTSNM
FT                   KFQMNGCLIIGTLDGANVEIRECVGEDNFFLFGIEEPEVEPARAERAAGKFEPDPRFTA
FT                   VMDTIKSGVFGKPGEFDELLWSLEGNEGFGRGDYFLVAKDFPSYIECQDKVSAAYKDQD
FT                   AWTESSIISTAFSGKFNSDRTIDQYATEIWDIKPLPVP"
FT   CDS_pept        complement(997910..999850)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639568"
FT                   /orf_name="MICPUN_62870"
FT                   /product="DNA glycosylase"
FT                   /protein_id="ACO70657.1"
FT                   /db_xref="UniParc:UPI000199C649"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT7"
FT                   /transl_table=1
FT                   /translation="MDELGGGWERRSDGTWVKQSQRAHLRRRMRRALDAARLRFRAAGR
FT                   TGGGAIGKKASRRVTTHDARLRSDSSALRDACVDAWRGFGLTDPSHERLLRRRAEQTLE
FT                   IARVNGDGTTVTYLTFKLAMHRVAARHVAGLRLALADARAARGDDRGALREYRRALTEE
FT                   RAGWARTGRLEWAPASSLLNAARLTRVRARDQADLDNAEGLLRAAIGSTEPERVEDLET
FT                   PRLGEDVASAAETSRRAARHDLCVLLCQSDHRDDDAVEELRSMGYRYRLSEEVLRYDLD
FT                   YGAKVPRNKKAKAAMAAHGKYVRAFDGAMPASALSHLRSVFRAESQFWSQHGYHEPGCG
FT                   FFSYAHRLPPWNAEDVGNTHPLRSTMDAIVRRVWRVAAAAFPRAREATAAEWWAHCRPH
FT                   GSGHQLHFDSDDEGKGPEGIRHPICSAVVFVTGDVGGPTLVTDQTAASKKLAQRGWLVE
FT                   PVAGRVAVFDGRYLHGVVPGRGPAPRLPRNHVGRAAGFSPCSSDRDARRITLMVAFWDE
FT                   MKARPGGDGSDPRASFPKGSARPFPDPKLYLGDRSRPKGIDWPELFHAMHLTSMPDVVA
FT                   EAATGDGDEGGGTAGGGGAKPEQTRWVERCATPVGRVWQDVDEAENDACFPSLALEKIS
FT                   SVPPYDRCFMY"
FT   CDS_pept        join(1000032..1000067,1000287..1000460)
FT                   /codon_start=1
FT                   /gene_family="HOG000109502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639569"
FT                   /orf_name="MICPUN_87118"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO70403.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG391971"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="UniParc:UPI000199C64A"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT8"
FT                   /transl_table=1
FT                   /translation="MIIPVRCFTCGKVIGNKWDTYLDLLQADYTERDALDALDLHRYCC
FT                   RRMLMCHVDLIEKLLNYNTLERQD"
FT   CDS_pept        complement(1000576..1002921)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639570"
FT                   /orf_name="MICPUN_62868"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70658.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199C64B"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJT9"
FT                   /transl_table=1
FT                   /translation="MGDDEGRGGGCAHGGDGGADARENPAPSTGDDDRRPGILKTSGGI
FT                   YGEKFKFPDEPVRSPGGRIIKRHPWKTAWSTGAWRRPPPSAPRGATPASTPADDEPAGA
FT                   TMEDRGGEREPAIASPSPSRSPSPASLVGRLAARRRRRAATPSDSEPAMSFESESNSDR
FT                   SDAENESDLELANAPGLDFLRSAGPGDSPSPPASQSRRKRRRRISRIAHMEPIGDEDKS
FT                   AREEPPGDGDENRTDGEEKAEDANEPEAEEAAADARASQLSVEPLPPPRMATADDDEEE
FT                   DDDEPVPDSDEDPPDDDDPAPLSSPGLGTAASPVDLTQRADEHDDDDDVLETPADPPID
FT                   DADSNLWACAACTFLNRPDLETCEMCERSRPVRATSRVESRVESRDEPTGRRTDGKSRR
FT                   RRLVESDDDGDDDAGAEPGAEPGAEADAEADAEPTYGCSRCRFSRNGCYDSFDWSGRNG
FT                   GRGCRPDAWRGPSQYHVDGEVAATSPGGIEPATSPTATGERGPKPPGRARTPASRRRVN
FT                   TDGGGAVGGKRARGGQQITPGSGSAGRAARRGALPLVESGGGGGRGASRRVREEPRGKE
FT                   KDEEKDEEEDEEEDEDGGEIVISDSEDISEDSEDVSEEEDEVETDSDPDADDPYARGLP
FT                   TPATAPRPKRKPKSPKRPRYNDVGERVDSGDDLEDESDFEGYDDDMFERAMGGGGGGGA
FT                   GRGGRAGGGGDGSSSGGKGRWFTKNGRRVYKVGGREFTGGAAMARYRRDGGSTGATGGT
FT                   RRRKTTRKKKGTARRKTTRKKTTRKAKA"
FT   CDS_pept        join(1003106..1003222,1003363..1003437,1003570..1006224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639571"
FT                   /orf_name="MICPUN_62867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70404.1"
FT                   /db_xref="InterPro:IPR009738"
FT                   /db_xref="UniParc:UPI000199C6CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU0"
FT                   /transl_table=1
FT                   /translation="MPFGDRGGRFGGGRGDRDGGGRGYGRGGRGGMTMLGRDKSKGRTM
FT                   ATAMKLSVPKPVNLPSMKKEHSGNDPNAQLVPNAVPGGWTGKKPGDDKGGTAQPAQTTD
FT                   EARRALHRAGASWASGAHAPRTPGEHGDGTNATPGVGATDSGPAHVPAIGASQNLLLGD
FT                   ETVSRLRGERRLDSRDYPTLGGPGDDRGDPASSYAGDDRDYSRHHSRWDEDERGGGGRT
FT                   DPDRSGRRDRRAPLADGNRDGWGRERGSYGHHDRRTPGGGRFPHPRGSGGPRDRPYYDE
FT                   PNPFSDDDDDYDYPPPPPRGGGGGGGGGGVDGYRDDRGGHVNDRSGHVNDRGGHVNDRG
FT                   GHVNGPPRGYGDDRRGFRGGGDFRDFDRRDRRSSHGSDDRRRYSRESRDEEREEDERDI
FT                   HLPPPRSMIDSAADGASFGATPRGPYSPPGLVGGPQGRGLPGGVKPPGSPPQPPRVSEK
FT                   ERAAAEVTSSRDAFQAELERVAAEQEAEREERRRLERGGGAGPGGAGAAGVGGSLAHPG
FT                   PAEWAATSGLKVLGGASALVDRSSVSEKATREDAQTTNEPNPTEGGWKGWGGDDADERG
FT                   SADRAPSDGDTDGTDDVAGGGGNGLSDVCPTSGQGDSARKKRGGRRVREAEERRAARAA
FT                   AAAAAAAAVPEGTAAYHSGALGGVAFGGAIAEIQRSASTDMLGKQRSAAATADTSTAAA
FT                   AALPANLGYVAHAAQAQAAQAQAAQAQAEWAHSQAVAYAAHQHTANMYGRHAGPMPYGP
FT                   YGGFGTPIAQSPYGVHQPGGYPGGGLGMGYGGGMWSTGGGGGGGNGGGGGGAGMGYGQG
FT                   GDATSAAAAAAAAAAALRALDAGGGGGGGGVSRPPPPVPPHGVPAPNPYASGPSPAQPP
FT                   VPPGPPPGAPPRLVPAPAPPPGSPPPLPRNAETLDAPSLDEVTGMGPDGSSRARGVRGG
FT                   RRGRSGRGGGGRDGPAPA"
FT   CDS_pept        complement(1006380..1007633)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639572"
FT                   /orf_name="MICPUN_62866"
FT                   /product="Predicted protein"
FT                   /function="polysaccharide binding"
FT                   /function="scavenger receptor activity"
FT                   /biological_process="immune response"
FT                   /protein_id="ACO70659.1"
FT                   /db_xref="GO:0005044"
FT                   /db_xref="GO:0006955"
FT                   /db_xref="GO:0030247"
FT                   /db_xref="InterPro:IPR001212"
FT                   /db_xref="UniParc:UPI000199C6CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU1"
FT                   /transl_table=1
FT                   /translation="MWPGRTRRRLVGAAAIVILTVLLRAWSVARGGPGGAPAGRRRARG
FT                   DVAENAFTGVFRAPTAGTEPGAAVGYGERRRLEEGVARSARVASAASVFAREAGEESCE
FT                   GVCGLCRASCCCDRDCRAVGDCCGDFEDDGMCEAQKDEGQTPGGGGGGGGGGGAGGGGG
FT                   AGATRPSAPLGAPDSAPPPASPQSPRPPPQPPPLRPPPPPPPSPGAPPPQPGSPRPPRP
FT                   PPFALILRPPPPPPPPSPGESPPGESPPPSPGESPPPPPPPPDANVTALADPRGVWHSD
FT                   VSPPAPWYPTLPPAPFPPVPGVPPFPLFLYAKLQAVPRCSPFCDTRAPPPSLPKGDRAW
FT                   ALRAAEAARTQWAQMVDLAQIQVGGSHGTSGEMWQYGAAEAVTESEAAASAAAGAGASE
FT                   ELRRSRRLRRRRRDAVRK"
FT   CDS_pept        join(1008110..1008151,1008239..1008268,1008735..1009595)
FT                   /codon_start=1
FT                   /gene_family="HOG000200436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639573"
FT                   /orf_name="MICPUN_62865"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO70405.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199C6CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU2"
FT                   /transl_table=1
FT                   /translation="MEAVSGRAPRFGLNESPSTACIASVNSFTRLLDPCSTPSNDPKLS
FT                   PASHIMQQQGGGQGGQGGPPGAHGGPPAGMPMIYGQPYGQFPQGAPHPGDPNAQQQWQQ
FT                   QARAAQLQQAQLQAYHMQSHQVNQHHQQQLRMFWQQQMQEIESGSDFKNHQLPLARIKK
FT                   IMKSDEDVRMISSEAPVLFAKACEMFILELTLRSWIHSEENKRRTLQRNDIAAAITKTD
FT                   IFDFLVDIVPRDDFKEDGMNVPRAPPAAVALGAPGGDGQGAGGTGAVPAVPYNPGMYYM
FT                   QPPPGTMAGGQWPPQMSQDPNQYQMPPKQ"
FT   CDS_pept        complement(1009750..1010829)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639574"
FT                   /orf_name="MICPUN_62864"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70660.1"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniParc:UPI000199C6CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU3"
FT                   /transl_table=1
FT                   /translation="MDLGQLWSKVQTTASEIAAAAEETAARAYTAVEETGEEISKSEAW
FT                   LAMSSQFAKLQSDASFTFAELRARTVSEAERAERLILLKREEAERRARARATANIDPEV
FT                   YGVNIDHECFVRDLTERSFLEYPVEDGDDELDETWEMDEWERDHSEAIMAVVPELATLR
FT                   FALVRDPAHHLLTPGAEPMSEARFWRTYFRMCGWRLALAEASFKARAAARARGIEVADD
FT                   EPYPVEVDKAELEAFGFRVDDELLDQAAELIAEDLDEILGEEGELEQARIERERAKKAE
FT                   WLRTRKEWKPDGSEGSPGAGSGSRGGSPNKGKEGNKKSDGDSDRADSPAPTGIGKEDGS
FT                   VADSEDSGVLVEAPVEREK"
FT   CDS_pept        join(1011218..1011243,1011443..1012373)
FT                   /codon_start=1
FT                   /gene_family="HOG000265285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639575"
FT                   /orf_name="MICPUN_109226"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70406.1"
FT                   /db_xref="HOGENOM:HBG558002"
FT                   /db_xref="UniParc:UPI000199C6CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU4"
FT                   /transl_table=1
FT                   /translation="MAAAMTATRVITLASAKPAVAVRRAATQRRGATIAVRSAPEEVSP
FT                   NASVSASCSIDDPSSCSLADLEMMYIDALWNYYNGGDFTLTDEQYDRLREELNWQGSGF
FT                   PTLRRYEVQFVEAAISYARGEPKVSDKEYEELKRKVRAAGKRDDVTALLLYTKGQQLLE
FT                   PEQFNQLRDEMSKLSIDVGLRGATCTLSNTSTDLTADSGTVTKMYAALAIVPSLIGIVP
FT                   YLGATVFGVDVPPAAGLGFAATIALGLTSMIVNYTNLQNATILTGQCPCCEEPIKQFFG
FT                   GENPATSMDYKCPVCGTESKLDRVEMKIKEAGGLKSA"
FT   CDS_pept        complement(1012612..1016613)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639576"
FT                   /orf_name="MICPUN_62862"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70661.1"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI000199C6D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU5"
FT                   /transl_table=1
FT                   /translation="MSEDVDIPGGYAAMHQRRSEASGDRGRHVRWATVRPGGGSGRTDD
FT                   DDESNNVERDDAADDERRGAARAGPSGRRTRADSPERTLRRGDDRRGSRGVPPAPSPAR
FT                   RRAASAPRGTTHRGASNAERQRVAPPAPSSRDAAVRAALARPVRLSAVLRDHPTCFDPN
FT                   KMRISVVDKRLSLIDDVPPAYKSTQRLYMSHNNVKHLAGLAQFRELRLLSAGDNPVDDI
FT                   PQLDALARGCPHLEALSLELAPVAKLPFYRAHVLARLPQLKSLDGVVVTAHEAAQAPRL
FT                   VRKDVGHLEMLMNAAVTADKLRRVYRLAKVHEELTKVVYAPDGPVEPCSLPGPNEGTAP
FT                   LDPRLYLRLCAPERTMTSGELAALARRLRGAAAAEAPTARRTQREERDARQSSSLPSVD
FT                   ESAVWEASYAAVMRREQRDTAALLAFLDDARAGKLEARRGGEADPFGAALRFGYEAARA
FT                   REAEMRSDREAAVAVLVDESAERDRRVFGEALRRETRFNGATKVRVTSEEDGDDGDWVP
FT                   RGSRNYRDEDEEGDRDDADVVRPPTPRSRAPREPAARTRATTRPDDDDDEEEEEEDLFG
FT                   DDDEEEDRFVGSRRRVNDWARGFDVRLDRAGNASAVRLGGVDDSRTESRTTIPTTTTRA
FT                   RRVPWGHGPGTAGEEARAKRAASARVGGLTGPTGPTSTRAPPRRSRSASPARGPNDPPP
FT                   VRARANPNPNPKPSGKVYEMLSREVDALRDALESQLGSEAEILSINDELRRRCEGAEQA
FT                   TERAERERERAVRSHSDAMARVVNELREARELAESLANALEREREDRANESRAKEEERQ
FT                   RSEEVLRRKAGQMSERAAALDRELAATRSELDDVRGSLTTHLLSEERRVGADALRSRYA
FT                   AKRSLRRWLSHAVVAKHGRVLRLACFRRAGAFALLTWSLRVRTQRRARAMLARWYKKGA
FT                   IAAIRAWRLAALVAAVGACLRRRRALRRWFANAGVHKATRLREEEEAARAELERLEEEA
FT                   RVQAERAEEEARVEAERAEHKKNLGDYADAVLAASSPALRNARKLATLHKSLSTWRIAL
FT                   IRSQRARLDDLAGTCDDLARAAENAAAAAAGVEHRNTELGDAAEALRERIIVAEQRAEE
FT                   FERAASVESAERKAMEEELERQRDRASRAEERAAGAGAAAAMETRSAEAAAVAATGEAA
FT                   SWRAAAEVGERAIIAAAEALQEWAEEIEREAARTARSPRKGGLVGSGTPGPGARGTPPR
FT                   MSPKKLALLASPLGSSLKSPHSMSPSNPVAFLRRVDGSPGLAPEDEARLHSRLEHLPVR
FT                   ARGLHETLRGAIREARALREEAAAKSRGDAGEKPSLTPVREAQESGEEK"
FT   CDS_pept        join(1017145..1021064,1021141..1021297,1021446..1021946)
FT                   /codon_start=1
FT                   /gene_family="HOG000265284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639577"
FT                   /orf_name="MICPUN_103307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70407.1"
FT                   /db_xref="HOGENOM:HBG558004"
FT                   /db_xref="UniParc:UPI000199C6D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU6"
FT                   /transl_table=1
FT                   /translation="MARGKKPARGGTRADPDPAANPSVAAASGPPVDILADDALGPDHA
FT                   RVRRWVVFSDLHLNRRTSRVCVDVLEAVHREAVARDAGIAFLGDFWHARGAIPVEPLIE
FT                   ALNAIRSWTRPCVMIPGNHDQVTAGGEVHALTPLAAANPSRVKIISRPTVWRNALWLPY
FT                   RRDASVVKNAVEAAWSIAPTGEDGSVPKVRAVFCHADVVGASMNESFQARDGLDPSLFS
FT                   PETDTGNVRIPVYTGHYHKPHTVPNTSITYVGSPYQVSRAEAGQVKALVVLDAENGWIG
FT                   CDEANPDAPEKADPTTDPVTGVSPRARLPLDLGPRHYVVTGEDGDVPEGARAGDVIRWT
FT                   LPLGSSTRVSNNGTNKGTGSDDEMNKPPVGIERARAAGIAVEISYETTSAPPRIPKAES
FT                   LGPLGLYAAYAKAVDLPPDVVKLGTSVLEEVAANVAAADVDGTSARSSLGGNMTGARSP
FT                   VQLSMHGVEVEGYGAFTDAVAYPLRDRGVCAVVGDNRDDGCSDSNGAGKTTLVMAAMWA
FT                   LTGNSDLRVEGGAGKTLTKTDVVNDYAKTARVRLEGAANGIPFWVERRVSRSKLLGLRY
FT                   GVGDEERTLADSRLTQAAMDADLGASVAARIAFHGQHTVGQLLDANDAALKAALGELVD
FT                   ADTWQEAKDLSRKRVTAARKRAAALGADASARADYVRRIEQRLSAATAAANDWTAQVER
FT                   NLTRLAREEAGAADALGRALGAVVVAADALKAASARWDAEEADAAAEADAASAFLDPTR
FT                   VGNEETESASFEVDEAAIASRVAALEEDAERARGYARELQGAEAAARAVAAQAHRAVGQ
FT                   YAGSSGAGFEGVEGHEGVGDGSEGVRDGHDEGHAHTPDAPVCAACLQPIDLTHRAHVLD
FT                   RLKRDAETTAREHRRLLQSLQAAESEAVKAEQRRRDEMAAANRARADASARAAAAANRA
FT                   RDAQARLRAVRDARVNAHVVAAAMARAEALVAASPVAPVRGPTPSDANNLSGTTTDIRP
FT                   GHSPQHATRRADSGNAPALALVAAVETAVSDAERAFRQLETRSRDRSNAAATATANPHD
FT                   MEVASLQSQADVEAAELEARREEAAAAEAALATAQRADSAFGTRGIQSYLFEGALGELS
FT                   ARVGDYMEALTGGALAMELRPAAVGEPNGGSTRRRRRGRAAAGDAGGADAEDEDGVDER
FT                   GAPSVAAAEKIEKVIFAQSHDGERVQRSLRQLSGGERRRAALALALAHADLASARGGVG
FT                   CDLLVLDEVLQHLDGEGIARVAALLRSLPKGTVLLTSQADSATSHLFDVVDRVFKKNGA
FT                   SGVATGCDAAFGTDEDEDEVAAEEAENPRRPHSDARHTMTDVDVRSPGSGDSAEHKRKH
FT                   IVWNEENLSYNEANKSAKMKIDEPDTPWASPPKELFEDPVEAEADVAMDDVAERLRGFE
FT                   GGPEGGGAAGGDAPGAVAGDASIPPKRDDEWESSDDDERDDGARGGRVALDPGALSDPG
FT                   SSAAGGGTDDDGEDIIDEGPLDEYDQMLRARLFEAQRKSHQCTFRGVLARGRALLEEED
FT                   EEDGE"
FT   CDS_pept        complement(1022011..1023132)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639578"
FT                   /orf_name="MICPUN_62859"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70662.1"
FT                   /db_xref="UniParc:UPI000199C6D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU7"
FT                   /transl_table=1
FT                   /translation="MDSNDTAAPTILRDVGGVPGVHVLLNAFTEATERLLFTSPQFFNR
FT                   HAKNTEVRAGKQKAGWHRHASHPTFPEEHYKLSNLVIDSGLYPGLVYPDMLLAMTYRPK
FT                   IETKGYDGPDKGPKFEKHFDSKYKWGETIIGVSLGAASCLRFFPAKGQTMNGPAFAPFG
FT                   EFGKGLGASRVEGKRVEIELPRRSIYIMSGPSRTDWRHAISPIEDKSPPSLNWNPGFRR
FT                   SLTMRTVKWYSNAVLQIRLRKARTNEDIPAAAALVKRINAQNVFKKGVSKAEMESFYPR
FT                   GKKEAQQFAQEIESGELKGLRFTERELYVFQGAGRHLGGASGTSKRALPPLTKDEMRAA
FT                   RLRHLDPTAAAVESQEVIVIDDAESQEVIFIDD"
FT   CDS_pept        1023298..1025313
FT                   /codon_start=1
FT                   /gene_family="HOG000030436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639579"
FT                   /orf_name="MICPUN_62858"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO70408.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="UniParc:UPI000199C6D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU8"
FT                   /transl_table=1
FT                   /translation="MAAGSDAEDAEWAGPIERDVRSLAGWDGEGEGEGTPLEDEDEEAD
FT                   GDQIPLTLEALYRDGDVDPERPDDAGADDGTRGTDVDDDATTCPVCFRPLRDLADTDAA
FT                   RLAHVNACLDDGGWRDEEDEDGHPVSDESPPFAPSDTRNDDAIGATWDEGGEGEWHDVA
FT                   AWLHAVDHGDFAPNAILARLTFAALEGCADEGALAALGHVGDAARRRALLAAVDARRRG
FT                   SAAPASAAPPKGGHPVASKGWHPTRVPAGVAPVFALARGETAVRRPEPASEPQPQKRRR
FT                   TGGGAAAAMAVRNTGGGGGPRPGRYVPTAEAPPPPPPWIRVPGTRFIVDGFQGYGKSHG
FT                   GWWCRHWFLTHFHADHYRGLTKSTPPPGCLVWCSRPTAELCASRLGIQRDRLRAVDVGR
FT                   TIVVDGVRCTFIDANHCPGAVMIVFDGIPAGPVLATGDCRYHPGMKTDPTLAALASRRP
FT                   AVMLDTTYCSPAHVFPPQCEVLAAVRDAVKAESFNPRVLFLFGTYTIGKERVFFEAAKA
FT                   LGKKVYVGKQKMKVLDALGSAIDDADRDMITADDQATNLHVVPMGSTSFGRMKTILRYY
FT                   KNRYDTIVAFKPTGWTFEAAKKHARATKRTQRGAMIQYSVPYSEHSSFDELRAFVKFLK
FT                   PRAVLPHVGNDRGPKARRMVQLLTAPDESADDDDES"
FT   CDS_pept        complement(1025395..1027866)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639580"
FT                   /orf_name="MICPUN_62857"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70663.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199C760"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJU9"
FT                   /transl_table=1
FT                   /translation="MADQQDNAPVVRTSGVGHRGYGDGDGMGLALLPGISLPGQNELAV
FT                   APGETGGLIESADLDQENDLVAWHIRKIKERQENVTAADELAKSLTEKIVEAATGDAGK
FT                   SLGPAPDEEALRKPLTFGPTFHDIALRHYRDTPAPAPEAADAEREGRPRKRKSRWDTDE
FT                   KDDKPTVGSALAVVSGGQAAIKAHLASIAAKLQGGPADGAYGVGAADGGPTPAESDDPE
FT                   VVKQYAKYVDITDRVRSGYFADERPEHARSPSPPPQYDKYGVRTNTRELRIKAKLEDER
FT                   SELIGWLVARCPHMFRPPQDWKPKKRTRKLYVPLKEYPGYNFIGIIIGPRGNTQKRMQR
FT                   ETNTRIAIRGKGSVKDGVSREPGADYQEDEDLHVLITGDTEEEVDRAAAMVQTLLKPVD
FT                   DDYNEHKRAQLRELALINGTLRNPGGDGATAAGMALAELDKTGAGYRAPAELVTCKICG
FT                   DGGHPTSDCPFKNDPAAAAGAHKQLTSEYQSFLSELGVGDPGGLGPRPGLGAGGGGGGG
FT                   RDRNEINPCKLFVGALADHVTDEMLGGLFERFGEVRRAQAVRHTHDGSARGFGFVEFAS
FT                   EDQAAAAKVALHRTPFEGKTIVVKVAGDRSRDPDGPPPRGAGQPGMGGPMGAPPGPPGM
FT                   GGFGMHPAPPPPPPGMGGYGMQPPGPPGMGAYGMQPPGPPGMGAYPPPPPPPAAATGAP
FT                   PPPPPPAYGDAPPPPPPPPAYGDAPPPPPPPPAYGDVPPPPPPGYGDAPPPPPPPGGGF
FT                   VDPYYQQQQMGGYVQMGGYGGYQAPPPPPPGMGGVPPPPPPMGAQPPPPPPPPVDPTEE
FT                   AYKNFMADMEH"
FT   CDS_pept        1028038..1029384
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639581"
FT                   /orf_name="MICPUN_52455"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO70409.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199C761"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV0"
FT                   /transl_table=1
FT                   /translation="MQFSHAAPFIEKKIQKMGTARLFEIAPIRRANRTTRRAAPDGIAS
FT                   YHVMNSPQRHLRRAREAEEQAATDLKRLKTSFLEKVIPKTIVREQCNPTSKLERSVRAL
FT                   VFNHLPGNCGNLFATIGGDFATVYDDEHFGDHVAVVCQFKNEATDHTKGGDLTAVCWVD
FT                   PSGYTAHELGDATLAVAGGDDNAVQVISVADGRVVSLMKGHTCSILAVAAGSSEGGHPE
FT                   RLVSLDAAGNAVVWNWRTQAKLGAFQVGDAISLAVNPDGSGVYTGHKGGFVKAWTLPEN
FT                   LDKKTPEKGIALGVVCHGNNPVDCLKVAAGKLFSKSVDGTIGVLDLGSGKTATTWKVED
FT                   CVKPSAKDLLDGLTGFGVDPVGEFLAVGNGEGEVATYDVATGQVIKIVEADRDFKHLNL
FT                   VRAAGVSRDCRHVHAAFGPGIVWRFEVVPELDDEDDGTEGPGTPPEEDN"
FT   CDS_pept        1031306..1034989
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639582"
FT                   /orf_name="MICPUN_62854"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO70410.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199C762"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV1"
FT                   /transl_table=1
FT                   /translation="MRGSFRGSPSRAAVQRVIDRLHGLALGDRDIARDDGGGDDDDGDD
FT                   EARGIASAAGSPSAAATTSPTSARLAHVPPGAAVAALAAAFEAGERYADVRSAVVSALP
FT                   RGEDVADFLVSCVEHMATSSSAPSSVAAPLTQLLLEALQHSCATTTPRRVFAATDGSAT
FT                   RVECAAARTRAAKLVARAVCVDDDNVKDDTAGGIGPPTVDTAGGIPPPAEDPDPDAARP
FT                   LTVRLEPRAVARLLTAVGLDMDDLTVHHPSAERGIVAFVGACLGRASTDPSSAVAAAAV
FT                   AKHFSLAQFATPSALDAWEAQGHGPIADGIAATLTEARRLSYAASLRDKHMSATNAHNT
FT                   GGVASPADRADRHFRRLGLPPAFPEEERAGREGRLRRLAAAGRWDVAEQLAGEDVQARA
FT                   LVRGLRDAAATVAAEANGAGWSEWAAGHGALGGGGASTAAEVDQSYLPRRMRYLPLDLP
FT                   RGAVRWADDARSLAACVAALSLDAVIGIDSEWVPDGSFGASGSSRRSGNSKGSSGARRR
FT                   LESPTALLQLSGERCVALLDATKLGRECPGAFASALRGILSDARGGSESTSQNDVKSAR
FT                   PPAVVGFGVADDLRRLACSYPGEVADAVRSIPRVLCLQRAAIDRGHGSQPGLSSVCQAL
FT                   LGQPLDKRERCGDWSRRPLTESQVAYGAQDARVLLRIMPGLLLGKSRAREPSARADAAD
FT                   LAFELARPAAEFIGDVDVATVRIANPPSIRVTENDGDDDAVAPLTPADVAAALADRLPS
FT                   AGGDPTVIELGVETGPAASDTASALGDGIAPDAVVKSMGVMVAGDTTVGGLDPVARALG
FT                   ASGGDGGGGGGSGGSNGGSNGRKTWEPVVALLRGTDRADLRAIASHFGVARRHARLATP
FT                   DECVRVFGFPPGSMPPLGHRVECPTLMDSALMDSALREHAGGFVYPGAGAPHLVFRCLP
FT                   AVLERATAATTLPVAESSVAREAAKRAAAAAAAAAASSSRDPSTASFADGGSLDWGLGG
FT                   PSATSHEGSEEHEEHGDGTRERQRRFVADGSLGRLARWLRCLGVDAEHVPVPAQRLGNK
FT                   GNNNNCQYGALLALAQRDDRVILTKDRRLLQRKDAVAAFLVEDDDPKRQLARVSAHFGL
FT                   RYRRGKLLTRCARCNGAVERRCTPEEVAANGAIPAKVKASTNEFWACGRCEKVYWVGPK
FT                   SHLAMSFIDAEIAPTVTRARDEAKLFARSGNTREPDEEAVLEEALGGNPWPRRTGPNSR
FT                   EG"
FT   CDS_pept        join(complement(1035415..1035740),
FT                   complement(1035077..1035377))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639583"
FT                   /orf_name="MICPUN_62853"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70664.1"
FT                   /db_xref="UniParc:UPI000199C763"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV2"
FT                   /transl_table=1
FT                   /translation="MSTIWHPDLLNEDPVIVKEEPDDDHHTPPAVNVEPPADDHGEDEK
FT                   TEDLAGKMSTIWRPDLDRLRASIAEMEGSESEEEEKDATKKGVKRKRAPPTKGPCEHGV
FT                   KYRSHALGARSAVGLDSVSTVVSAVDARSAVGLESASTVVSALSARSVVGAQSASTVVG
FT                   AVTARSAAGLKSASTIVFALGARSARESDQLNRDSNDATDTDSGP"
FT   CDS_pept        1035955..1039038
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639584"
FT                   /orf_name="MICPUN_62852"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO70411.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="UniParc:UPI000199C764"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV3"
FT                   /transl_table=1
FT                   /translation="MPVAPKRTVGSSEPSAYERFHSTFQAAVTQELEALVGDLRSAAAR
FT                   VADQPVNLSDPPRGDGAEDASGSLKALVDELVARWGFVLATYRAHVAAEDEVVLPALAA
FT                   RVSNVAHAYELEHEAEDSLFDGITQALDEAVELIAANDGGGPAPTDAEGRERLQGAIQR
FT                   AARTAHATKTALAQHLAKEAAHLVPLMDGAFAPDEQTALVERFIASVPAAWVGPVLARG
FT                   PTQGEQGPLRTLIASWLARGETGGGVTEGKGLSDDPSDGGKSEGDQPPAKRSRSGADAG
FT                   VSTQAVGPIDHIFQFHAALRRELRRLESDVLALPKPEETAKRAAALRTLEGRFVFFWGV
FT                   YRAHSRSEDELVFPALENKDELHNVSHSYTLDHEHEAELFVEVDACLRDLREHAGLAGD
FT                   EGGVDGEKVHDAMEAKGSDRRMDPKTRAAIMEVERRLQAACVAVKVCLETHVAREEAEL
FT                   WPLFEKHFTSAEQGRLVGLIIGRTGAEVLQSMLSWQRKALTEEEKAAMIGSMRDASRNT
FT                   RFASWLETWWSSEEQTAGTEGGEDLGATTAGSERLTETNDGRANDAGVDAAAVDGLGQV
FT                   QEYLRRRADGDASTTGVAKAAALAAAAAADKSGYTPSWDDMFRMNRQQLEQAARTLSRD
FT                   DSLAPERKAYLMQHLLAARWICAQQRAKQLKKGEKGEDVDILDEGGVPGERAAVGNGAA
FT                   DAGVDGAAEKTGTAPPSDTAEAALALAGAPGLASYHKGASDDVVLCQPVGGEEVLGCKH
FT                   YARKVRLVAACCGAAHVCRFCHDESEDHTIDRYATKEMICMRCAARQPSAKECRECGNV
FT                   VARYFCSVCNFWDDSGNDVYHCPFCNVCRRGEGLGKDFFHCMQCNSCVSLTMGPHVCPA
FT                   AKNAKGDEGGGGGGTVFAGSMESECPVCKDFLFYSDTPVKCLPCGHFMHTSCFQAYTKH
FT                   YYTCPLCRKSLGDFSAYFRMLDAILAEEEEANATPGDDEEQPKRAKQRVACNDCGVESL
FT                   APFHFVYHACAECRSYNTRVLAVVPPSEVAKEEAKNDK"
FT   CDS_pept        complement(1039095..1042823)
FT                   /codon_start=1
FT                   /gene_family="HOG000241108" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22639585"
FT                   /orf_name="MICPUN_62851"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="ACO70665.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG317295"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199C765"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV4"
FT                   /transl_table=1
FT                   /translation="MGLPDLPPLEGDLGFPIDDGLPPFAPGTAGARAGSASPPEISTGK
FT                   ERSIVSPPRSPSMPNVGGGYVPGDTAYAQLATLADKMAVESYSRAHAKVVGKSSSNALG
FT                   SRARVHRAGTVGAMIEDMLTHEAKKPVPAALLPLGTDAIAKSIKMAPAVLRLATDLSIP
FT                   DVELCNTLSKLVKETTKRGELRDELFLITLRHTRCNDDPKSLVRAWQVLHLTCASVAPS
FT                   QTLLGFVSEYVNECANADASPGPVKDLAHKALLALKRSAKSGARRHPPAPEEIEALQAG
FT                   RQMNTIAFFLDETFEELPYDVMTTVGEATEALAGIIRLQNYHTFGLFVSTKELMSRSSA
FT                   ASKGEEVTEETRALQDADLITDVIQEMRLVKAERKEQVQLRLVFKKRMFRDTDEAVQEA
FT                   MFVNLSYLQAKHDYLAGNYPVGREEAIRLAAFQIQAEDGESLGQGPVETLAQVMVRFVP
FT                   KVMLQQHPVEEWAAEVQRTHGALTQHTREEARGGLLRMIRSLPYGGSIFFQVRRIEDPI
FT                   GLLPGMIALGINKRGIHFFRPTPMEYLHSAELRDIMQFGSSETAVFFKMRVAGVLHVFQ
FT                   FETKQGEEICVALQTHINDVMQKRYAQQAAKAAGAPKTPGAPAAQPPSPVANGQAEAAF
FT                   GKQAGAGGGAGAQQMQRVLEDANKKLDEMVRERSQLQQQLVAAQEAAQEAADRAAAESA
FT                   AKAQALADLNQALADVKLGGGAASDPETKKKLAAESEKARSAQAELKVLEQKIARLESS
FT                   SKEESAKRDKETAAELEQLKKKCAAAEAHSLSVSAELEQTSNAMEQMRIEFEESRKDLE
FT                   ELAELRELKADVERKEKQTAEMLKTQATRIQELEAKYQEESTLRKRYFNQMEDMKGKIR
FT                   VYARTRPLSKKEVGEKQTFALTLPDEFTLEHPWRDEKKPRSYTFDTVFGADTTQEQVFE
FT                   DTKYLIQSVFDGYNVCIFAYGQTGSGKTHTIMGDEANPGLTPRAVEEVMRIVYQGSKKG
FT                   KFSVNMEAYMLELYQDTLNDLLLSPDKANSPPKLDIKKDAKGWVTIQNATVVPVGSKED
FT                   IMHVVESGLKVRRTASTKMNVESSRSHLVFSLVIETTDLQTQQVTRGKISFVDLAGSER
FT                   VKKSGASGDTMKEAQAINKSLSALGDVISALAGEKAGHIPYRNHKLTMIMSDSLGGNAK
FT                   TLMFVNVSPSDNNIEETQNSLTYATRVRTIKNNASKDSANKEMVRLKEALAKWRAKAGE
FT                   MGPETQEIEDRIQGEME"
FT   CDS_pept        complement(1043002..1046439)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639586"
FT                   /orf_name="MICPUN_62850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70666.1"
FT                   /db_xref="UniParc:UPI000199C766"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV5"
FT                   /transl_table=1
FT                   /translation="MAGRKPLEGRPPWGSSLGIRQKTTTTNRPSRVGLASRPSTAPSPR
FT                   GTAPDAEPAPSRSPKKKRRSVAKKPAAEPGPSAHEENCEAAKEVAELIGRRATPPQSPK
FT                   TASKSPRRSPRSPPASTLRPTIAHKLKEATSPVASTPPETAPRSKQSPIRVPHGRIAAV
FT                   DEPSPAPMDPTPGKSPIGDRFDAPATHLEPSVTPSTLATPAGSGGVDIGRGDRFGSSPP
FT                   RDRFGSPIEDKPQSPAAPRLPPTPRGSAAATGEAHPPPSSATPPMTPVSVSAAARRPNP
FT                   EPTELLLEGGEPFVDVRALTAPGGALYALTLDAARPKIAPLGSSDERGTTPSPKGRVGA
FT                   DDDTDDEGDDDDAVYRAAKFAVRLVESAATELAGASRELTAAADEDVAQTAAEVSRAEV
FT                   ADVEDAVMVALLNARSAAARAERRRLLQQIAQRATDWVCAVQPSLGALPARLNAAMAKR
FT                   AAPSTPAAPSTTGMEYFVIKPPSTPAVMDHRAVQELQRELASAREEVATAKEEAAAAKL
FT                   ETAAAKQETAAAKQETAAARREVQVCTQKSDAGSPATTAAPESTVDAKSLLMEERMDAA
FT                   AKLASITATHQAELARLKTRIARAENEAATAKVETEQAKANAEEWKTRMEKAERFAADC
FT                   RERTSVALGNSAAEHAKYEAAEALVRSLTQREEEALRRAKEAEMRCAQVEGSIEAKIES
FT                   ESTRIVLDNNVRNATLVSDLRAELAEARAAQRRAETRAADAEEHEREAAAGEVLRVRAE
FT                   CAASRRNEAATRRELDEHRVAASAAAAARHEEIEELRRDIVTLRNQLEARVEAAEERAR
FT                   VAQAQLAANREAAAMESAQVTEQSNSLRRQAAEAERKLREEIAVVRAELRGARAGEAAA
FT                   IAREEEVMSKAVELIEQRDEQLRQAKDLHAAELRAALARQDDEMRALRRGGSLGDLHPE
FT                   FVRNVERALQDERRRRVAAEEDLVNWKRAARESRREVEESREVAEIGDGLGRLRRQLSR
FT                   QSSRQNSLKVPDRDKPIDAALLSPVDSPPRRRTPPPNFSQRQSPRGSPRVSGGTRANAR
FT                   DSQGSGRSDPATRAERLARDSSLNVFASKEGSQVQIAPPASPPPVPPQSRERTTPAVPS
FT                   TLNPAAPKPTWTPGYEGMQSPTQRAALLEEVLSNIESL"
FT   CDS_pept        1046702..1047487
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639587"
FT                   /orf_name="MICPUN_103300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO70412.1"
FT                   /db_xref="UniParc:UPI000199C767"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV6"
FT                   /transl_table=1
FT                   /translation="MAAVGLVIPKAAPVVIAGLGSLAVFVKKKIGKGKKRGDDVRAEDE
FT                   AKTRRREVDADTLAELKAELREAMAMLAEQKRTIEHQRKEILAMKRERADAQFHGFITS
FT                   TATPAAKGGGSSPKGVLSLQNSPTSTATTPESDRVGSKTNSEGEVHSPEQVVAHLVADA
FT                   IDNVVKADMYADLPDVPEGDEDALDDAVDDAMDEEEDFEDAWAGVPRGGAGPGSDLFDV
FT                   RSHGAASGVSALSTVTAVQAALVKTHQKMVLMQRIKQHR"
FT   CDS_pept        1047818..1048444
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22639588"
FT                   /orf_name="MICPUN_62848"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="ACO70413.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniParc:UPI000199C7FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1FJV7"
FT                   /transl_table=1
FT                   /translation="MATVISSAARLRVPRPSRGARDLIARAASSSSNPGDGGESGDEGA
FT                   YVVVFRGKEIRAKPGQRLRTALLLGGESPHNGGANAINCRGLGTCGTCAVEIVPSGAVT
FT                   PRDWTDAERIRLNFPPHGPPGNSRLRLSCQVRLGG