(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_2

ID   MICSR_2; SV 1; linear; genomic DNA; GRV; PLN; 1584431 BP.
XX
AC   CP001325_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 4, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001325.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1584431
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 4"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(complement(2468..2547),complement(567..2370))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631018"
FT                   /orf_name="MICPUN_57472"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62831.1"
FT                   /db_xref="UniParc:UPI000199ACD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E550"
FT                   /transl_table=1
FT                   /translation="MAGAAAPEPPWRASVGSKRSTSDDEMMSVDALELSDALGLACIQG
FT                   GASKRSRMEEQVFGKMSALSLSLDISNDGKGRGKLRGSGPASGTRGNKKRGDGTVHVKL
FT                   DLGAMNLVGGVGAHVPGRGRVNTQVPREHLAQGIWKTIHGSVDSIEPWSLEIRRATPET
FT                   VHGLETAVGPSGPSLDFTDFQALAGRMKHLVSLSLRSGRGVGDEGAKALARALHDAVPC
FT                   LKTLNLSGNNLGPEAAAAIAGALMKVQDEPLSMPQLASGCALEELDLAGNHIGSDGACS
FT                   LAGALVEVGCPRLKKLDLTHNVIGPRGAAAVAEIFLGQALRGEGDGNHTAHRRHSHQRG
FT                   YALEELNLRHNGIGDSGANSIANAITEAARLRAKTSGPLMSGQSSFVSPGLLDDARYEP
FT                   HCLRALRLGFNGISAVGAQSLSEALNAAVRAARLSLGDDAAKDAPCVRELDLACNSIGP
FT                   DGAKALAKALDGLEELDLGNNGIGDGGIKWLAKALKENTTLRKLIVSGNNVTAEGTFWV
FT                   AESMSTNQDLRHLDLGSNEIGDAGAKDIAEDLRDNTGLHSLILRRNGIGDEGALELCSA
FT                   LDPVALDTRQQKTNAYLTELSLRGNLISDKAAIEVKRRVGLRMDVELQQRY"
FT   CDS_pept        3060..4364
FT                   /codon_start=1
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631019"
FT                   /orf_name="MICPUN_57473"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62453.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG629124"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI000199ACD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E551"
FT                   /transl_table=1
FT                   /translation="MTTIEECQQQRRLTFFHHPHFLGQPSKWKSLVTRASSAFAMIAGF
FT                   VTMLAAGHVPTILLIFIIQGLMVRELFALAVEVRKEKDVPWFRLQQWYFYGTAVFFTYG
FT                   RFLKHKWLESSIVKDPERLGAFGLFMFAHHSFISYIGWMVGLVLFVLSLRSRGLYLYQF
FT                   GQFAWTHMIIVTILMQSSCFVANVLEGMIWFVFPVSIVFFNDAAAYMCGFFFGRTPLIK
FT                   ISPKKTWEGFIGGLIVTLIVAPFAAAWMQKYEWLICPVDDKSPLRLFGGASGCDVDPLF
FT                   VAKEVTVGSIVGGFESALGWMVPHGWVATVARALFGLETVRVSWFQVHAVVFASFASII
FT                   APFGGFFASGFKRAFKIKDFSDTIPGHGGITDRMDCQMVMALFSHLYITNFIRQPGLMT
FT                   VGQLLLKIEFLTNENLLRLYKAVGKMIVTRGLKLP"
FT   CDS_pept        complement(4472..5503)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631020"
FT                   /orf_name="MICPUN_57474"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62832.1"
FT                   /db_xref="UniParc:UPI000199ACD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E552"
FT                   /transl_table=1
FT                   /translation="MEGVHTSERRFSRIDRVLEALQNRQQRPPQPKEKKAPLSSSSSSS
FT                   SSEDELDTHAGVPTKEESVRSLEQNAATMVAMAEMAKLRVKAAGTSIPSKASIPEEWTR
FT                   KQSPIPSPTRPERRPRDPLTFSDDELITELRRLRARLRRDPENVKFAFQRRIGRRALTT
FT                   ALLKDVEDAAATIIAAHWRAREVRVGMPAWRVAVAHRDDVVWERLQGALIRWRKLAATR
FT                   RKLRIAARSLRLRRGDRAHYYIGDGYVDYDGDCRAWEAHEIDGVAGVADAFRRWRFVAW
FT                   SFVRWREWCVFEAEKASSSLVVKSNGQKRVAQDSESSVSSDEPSRGHDDFAGFSSDDDS
FT                   FFW"
FT   CDS_pept        5636..6976
FT                   /codon_start=1
FT                   /gene_family="HOG000166793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631021"
FT                   /orf_name="MICPUN_52640"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein neddylation"
FT                   /protein_id="ACO62454.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="GO:0045116"
FT                   /db_xref="HOGENOM:HBG521753"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR014929"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000199ACD8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E553"
FT                   /transl_table=1
FT                   /translation="MEGPDVNMQSIERDHRGDIVGRWTDLDYVLMRDGPSAGPGFEPGE
FT                   DTKSVLMDVMHVLVLGAGGLGCELLKDLALSGFKKIDVIDMDTIDLSNLNRQFLFRPHD
FT                   IGKPKAIIAAERVMERVEGVTVTPHYCRIEDKDDDWFQQFHIIIMGLDSLEARSYMNAV
FT                   ACSFLRFEADGTPDQSTIKPLIDGGTEGWKGHARVILPGVTPCFHCTMWLFPPQTTYPL
FT                   CTLAETPRIAAHCIEYAHLIQWGNERPNEEFDADDPEHMKWIYENAMRRAEAFGIEGVT
FT                   LHHTMGVVKNIIPAIPSTNAIIAGQCALEALKMATMCAKGMDNFMMYNGSDGVYTHTVA
FT                   YEKDPDCPMCSPGVAMELPKESTLSDVIDAIVKKFEDTVALPSISTSNGTNLYMRGVLE
FT                   EATRDNLPRKMSELLGEEHGGGEKLDGLIIVNDKKLKGPLRVRLSLA"
FT   CDS_pept        8042..11638
FT                   /codon_start=1
FT                   /gene_family="HOG000264796" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631022"
FT                   /gene_name="MSH1"
FT                   /orf_name="MICPUN_57476"
FT                   /product="Mitochondrial-targeted muts 1 "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO62455.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG560784"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI000199A5F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E554"
FT                   /transl_table=1
FT                   /translation="MTGGVGIAFRRGLAAWRRVGVLRPAAAEHVFAAKLPWVGVPTTVG
FT                   APSGRSFAASGYLAGSLRGARGDVIRADAARKPRASSSSARRQRAAPAVEVTEPFDDAV
FT                   YDREFWISQVTGPSVKQSARLMVQRVDFSDPLGVDTSLRGASKGSGKSGGRKTLYDYAL
FT                   EVKAQHPRKVLLIRVGEFYEAIGYDAVMLVMHAGLNPMGLTGVPRAGCPLVKVQETLDR
FT                   LTSRGFSAVVCEEVPVMHRYGTRAPPKERYVAAIITPASPQYVVGAADNGDDVEFDGAA
FT                   PPPVIGVASTAVGYTLIAVEPDLRRVTVTEGLTSESAAARLAAGGLAPPLYVHSSMDAG
FT                   HAGRSTGVAGQTRRLRLEVGNILSAGTNDGDYSKQRYDGKDPVRGLLDLVKREYGMTVD
FT                   QSFEFVGINGGREAAASKRPRPFPLTLSTAQQLGVLPTRSVPPLLSHALPASSGAPAGC
FT                   RAYIQELLLHPPPRDTAAAISEACVLMSTGLSPSDGGVPRLEVVPPQKITKLLWKKEAT
FT                   HVFFSEISAMASAVRRTLEHDSNVVRRAGELLLNPTALKTGRNVTKESLVKACREAEEV
FT                   IGAVVAEEVLDKGDWKPRAQVATSIDVDAEVDDDEYNELDGETEADLEALALGLDAPPQ
FT                   VDYVPRQFLRINEPWRGRVRRDRVQSALDACETAARELAEVIGRDLVPLIETSNAEHQT
FT                   RKVNRCHLEHDQRNNSLWLRHLPAAVAKRVQAEGLIDLKHPVDRYGKQIGDRWTTLAVE
FT                   TALDRYRVTSFEAGKEVAGALRALAGDLELLVADLVSAATFSTVATAVSLHARHAVSRG
FT                   WRPAQLLPANDASTPWHLTGLVPFWMDRDDAVVNDVLLDGISILTGPNMAGKSTVLRAT
FT                   AAAALLASCGLHCPVKSASVPFFDSLIVRMSSTDSPAEGLSSYAVEMAEVGQMLDVVTA
FT                   KSAVFIDELGRGTEARHGTAMAGAVVEELDRSGARGIFATHLHGVLDLGLNLSPFARRM
FT                   MMETRDDRDGRLRPTLRMVSGECRESLALQTATDMGVSDEVVRRSQALLAQIPETVVVG
FT                   NTPPAFQEKPSPASTILEEAPPLESLRELLVSVGALELGSVPEAGIVHVDDVPPPAARA
FT                   WSCVYVLRRGDGWAYCGETDDLGGRLGAHRATAAREGSNEVECAFIAVPREGGGKSRAR
FT                   ALESRVIRKLKAEGIPLLSGSDARNTSFGSAA"
FT   CDS_pept        complement(11771..13954)
FT                   /codon_start=1
FT                   /gene_family="HOG000007549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631023"
FT                   /orf_name="MICPUN_57477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62833.1"
FT                   /db_xref="HOGENOM:HBG315825"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016616"
FT                   /db_xref="UniParc:UPI000199A5F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E555"
FT                   /transl_table=1
FT                   /translation="MPLVPSFRIKLDDQILQGLATVGKFDGKNPCLTCATSGGKIFVYD
FT                   PYSRRDEQDTPKVRYLNINKNITAVASGRLDPNIGRDILLVGTNTDVMAYDVEENRDVF
FT                   FKEVPDGVNAMVCGRVGTHNQQPLAVVGGSCNITGYDADGEERFWTVTGDNVRAMALAD
FT                   VTGDGSNELLVGSDDYEIRVFANDDAISEVTEAEKVVGLAHLSGSRFGYALENGTVGVY
FT                   EGRKRKWRIKSKNRVTAFSAFDLTGDGRKEICVGWSNGKLEVRNQETGEVVYKDSFKSP
FT                   ISALLRADYRQDGGGDDMICCSLDGEVRGYKTQGALGGVGSLKDDEFMDENVKEETLVE
FT                   LNQKRQDLLAELKGYERNTRALYNAGVGGETETTGTIPKDTKVNSSLEMNPEEGCGEVV
FT                   LSTNNDTVIKAAILFSEEIFDEEARFVYFPNPQRVAKVAIKPKKDSAADVAIKVLVSSR
FT                   TSSTYHVFEVDFRLPRFCMYLPLKALPQVPASSVQVRIAERLVKIAKWIDDAFMLQTSR
FT                   EVDDYSEECGCHMVCLRDSKPLSIRAVNAGDDGCDVVVHCDDMDTCGEVIQDMTKALGL
FT                   GDVECTADFPYDMERLRETLTRVDEYNALRSRLVTDVADASNTIKHLIIRAEDSRILKD
FT                   WKTMTRMYGELRDLNRELIREHQKRVENHEALLAALREVNQTIQKAAKLRAGGPKTKMV
FT                   AACRQAIKVNNVHALFKIIQLGADLAEQTAGFE"
FT   CDS_pept        14203..14598
FT                   /codon_start=1
FT                   /gene_family="HOG000242063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631024"
FT                   /orf_name="MICPUN_57478"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62456.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG523634"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199A5F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E556"
FT                   /transl_table=1
FT                   /translation="MAGKAKPKKHTAKEIAGKVAAATTNKGGGKAGLADRLGGAAGHAK
FT                   FKCPSCGIQSPSIKSAEMHWDSKHPKLPFKPEDWSDMHAVHGGVTTQGVAVKGSSKEKT
FT                   KHELAKSQSGQQKLKEIEQQKAMAKFQ"
FT   CDS_pept        complement(<16163..16984)
FT                   /codon_start=1
FT                   /gene_family="HOG000233029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631025"
FT                   /orf_name="MICPUN_80714"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62834.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199A5F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E557"
FT                   /transl_table=1
FT                   /translation="MTVVGEYELIRKIGEGGYGKIFIARRVSGNGPSSEVVLKQVKLPT
FT                   RKQDREMCLREVSIMKGVHHPCILECKESFVHGSNIFIVMPHCTGGDLYSLLARQRKKK
FT                   RRLPEEVVVDWFAQIVLGVEHLHSHNTLHRDLKSQNIFLRRDHLGPGDRGGGGRSRVAL
FT                   GDFGIARELQFNKVAAQTFIGTPIFMSPEMLRKAPYGHKADVWAVGCVLYEMMALTEPF
FT                   RAKTMEGLMRLVQHGQPPELPNAYSDELKGMCMRMLSKDPNERPSAAELIRE"
FT   CDS_pept        17174..17845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631026"
FT                   /orf_name="MICPUN_57480"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62457.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199A5F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E558"
FT                   /transl_table=1
FT                   /translation="MKSRSLYGVLFLALFASATVHYADAAAKDYYRVLEVDRSASAKDL
FT                   KAAYRKLSLQWHPDKNSDPDAQSKFIEISEAYSVLSDPAKRRSYDTFARSGGGGDEWSS
FT                   GTFTAEDAAAMFESFLEELEGFMQDADKLDDLIHQILGGERDPKKQGWMEWAGKSLLKK
FT                   VGKRVVPWVMEQAEAGNLKVNIDGISHDNIFERRTKKNRPEFVDGKRRMPKQYRRPEAE
FT                   L"
FT   CDS_pept        join(complement(20294..20394),complement(20087..20145),
FT                   complement(17883..19999))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631027"
FT                   /orf_name="MICPUN_99814"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62835.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199A5F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E559"
FT                   /transl_table=1
FT                   /translation="MPPLPTFRVLSKVDLKIATRNFRSDERFGEEGPSGITYKGKLGET
FT                   AIAVKVASGSGTGIDKDPTARDFMKTLILKQPPSHPNVVPIMGISLDGGQCVMSALAPG
FT                   GTLESRLTQLNWFQRLKVAQGAFTGLAALHKAGVVHGNLKTTNVFVAPDGLDGLVGDYA
FT                   AGRRPDFEKMAPSVLNYYDPEFVKGNEATNESDVYSLGIVLLELLASQKDGEVPAVQNG
FT                   GDRGGGPLDEFADAAASGGWPEDVAREVIELAAACVRPNARRRKSADIIARALKQIAQD
FT                   EVDEAGNVVTLMRLADKACGTARDQSANLPRFDKMRARERAQFEFAALKLQARWRGRVA
FT                   RRRFEKLKRSGASSQVVSDESLDAMFTPEEVKAAVFIQTRWRGIMARKKTRKLIAQKKG
FT                   VALQEEDASTALTRKQLNEMALAEQEAEEREILHAEIFGRIAAMLADGDLEVQRVGATA
FT                   LAIYTDRDESPDPTEAANCAVNAGVLGPLVHVFTSRNQVAVMESARALENITVELPAEQ
FT                   NRALRAGALEACLRLIADSSHPVTLRASGARALRGLLLQNPPACRRAVEKGALDALTAL
FT                   MQVKDPEAQSSSSAALAGLADADSEILQKLGVERLVGMAVRARDAPMRAATIAFVSKLA
FT                   RDSDTHEEIIAAGGLELLIGMILRLNEEAVWGLASMSSVEDNWAQIAEVMTVDAFGALK
FT                   DLIELGGDYGKEGAAWACCYLAGHPSLQVMMIKANVLLPLVGLVKSGSRRVKKAAERAL
FT                   KALAS"
FT   CDS_pept        join(complement(22108..22167),complement(21141..21668))
FT                   /codon_start=1
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631028"
FT                   /orf_name="MICPUN_90425"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ACO62836.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG297325"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="UniParc:UPI000199A5F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E560"
FT                   /transl_table=1
FT                   /translation="MAVAPAEIKLFGKWSYEDVEINDISLEDYIGVKSKHAVYVPHTAG
FT                   RYAQKRFRKAQCPITERLVNALMMHGRNNGKKLMAVRIVKHAMDIIHLLSDQNPIQVIV
FT                   DAIINAGPREDATRVGSAGVIRRQAVDISPLRRVNQAIYLITTGAREAAFRNVKTIAEC
FT                   LADELINAAKGSSNSYAIKKKDELERVAKANR"
FT   CDS_pept        join(22399..22420,22568..23004)
FT                   /codon_start=1
FT                   /gene_family="HOG000233943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631029"
FT                   /orf_name="MICPUN_90428"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62458.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI000199A5FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E561"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGGKKRKKKVYTKPKKVKHVHKKVKLAFLK
FT                   LYKVDDAGKVTRLRKECPAPECGAGVFMANHFDRHYCGKCGLTYVYQK"
FT   CDS_pept        join(complement(24142..24191),complement(23187..24072))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631030"
FT                   /orf_name="MICPUN_57484"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62837.1"
FT                   /db_xref="UniParc:UPI000199A5FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E562"
FT                   /transl_table=1
FT                   /translation="MASRARILALRVAKDKWMFHARAVPETSYERASEVAAALAIANAG
FT                   PEKILPRFAARWVARTNAWCAETYAQWGEQPIGSWRRRLRDLGAWALDRIPPEETTLGG
FT                   LPPVISSVEVAYPQSADVRVVQRLLREELLGAKADLTRRRAWTNAGIAPLLLPLMLTPL
FT                   SNVPIYWIGWRAWTQMRASKNGVAARDFLASSAPLAGYDGYDASSITTRCTRLDDETYA
FT                   EDGDTVCCRVESTGAGPRVMFVPCALLDAADEPLRACNRAGGVASSFQSIHEDTERGLS
FT                   RLDRVVAPGASDLARRYRRARALGGGKDAG"
FT   CDS_pept        24953..27214
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631031"
FT                   /orf_name="MICPUN_52644"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62459.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A5FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E563"
FT                   /transl_table=1
FT                   /translation="MQVESHEDAHESEIPSLNESPCPSEASTSSSPSRRSDEVDDPKTV
FT                   FLGGVPQDLDEPKIAELMSRFGSVEHVHLMRHTRKKSGEKKSDDFHPSHRGFCFVRFGT
FT                   EEEAVKALEAGTLSAGEGESAMRIGEAEKGKARRSSNSGSASSGDQHSQEYRPGTVHAV
FT                   AAAAAAAAAPYDPYAYYPHPGPVGYYDPYDPYTAQYAAQVHYAQAAQYAHAMQQAQHAH
FT                   YAAAMHSSLYGITPPASPTAARGGRWSPQRSPRGMGSAALRERQVFVGGLPRLTTESDM
FT                   FRFFSCYGQIDDVKLVLDPRTGMSKRFGFITFADVANAEELKAKKVVNFGKGFMVNVGS
FT                   VKKNQGAAASNDESESGSSQQMFKLGSESSADDLAAEMQSMVMEDDTSESQLGSSLTSS
FT                   NSGSVLTTPRNSGNLDGKFTVSESPVSTLRGGGVQSGRIVMISKEINYTKASFIATDGG
FT                   EFLRKIMDETGALVRIRVRRSKRTRRLAIEVRGETRVVDETWAKIDAEVELRSANSAPG
FT                   GVGLQPDSRSSSIDPGSIDEELDEECQDATFLSLSPTAMDGFARPSPPRVRTKLTFEGA
FT                   TLAPPTSPTLMRSTSLPTPSASEMPMSPVKRALGRLRRLSDASDTSMTSDSSAPKRHSY
FT                   DGGSRSPDSAVVAVEGIGVGTDADELHDFFSSFGNVLNTEVTVKLPNRDGDTKPSTPTA
FT                   PVAFAFVQFEDCSTAREVKSQRNFVFNGQAIEVSSPDRYLTYQSSRNAHVPDRSKITPA
FT                   "
FT   CDS_pept        complement(27468..28328)
FT                   /codon_start=1
FT                   /gene_family="HOG000265026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631032"
FT                   /orf_name="MICPUN_57486"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62838.1"
FT                   /db_xref="HOGENOM:HBG610041"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199A5FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E564"
FT                   /transl_table=1
FT                   /translation="MSDFFSRLTNDITVAFEKLGSDFNKATSASKRKETAGKTGIVSER
FT                   EAGWSSFPEYVIELGPKVRSINCERNSIASLPEDFGLKLTLVTKLSMGYNVLARLPDSL
FT                   CLMTTLKSLRLEKNKIEHLPDTLGDLVRLEELVLRDNRIRVLPKSICGLKKLTRVDLSR
FT                   NRLTCAETQDESGLANVAGCARLTELRVDGNVGIEALPNAWGQLTALVSVSADETRVRT
FT                   VPTEVFTGCVKLERVSLRCCPTDIDAIRATKGWDEFDARRIKGRDKQIHGGVMLGSLDD
FT                   GLDKS"
FT   CDS_pept        join(28950..29356,29430..29568,29796..31738,31821..31989)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631033"
FT                   /orf_name="MICPUN_57487"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62460.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="UniParc:UPI000199A5FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E565"
FT                   /transl_table=1
FT                   /translation="MWRIRHPHNFVCIVLRIRCHPRKLPKRCHETGKADVTARRVPEER
FT                   IRMGRVCDYCSTAKAVIFCRADSARLCLACDKQVRQLPAPITAKPGLTTGRSEWGKSPS
FT                   TRRTGARVPVRRDVVNARSMPLDPSLPTGPFANRRLPFEVFLTRSRHPPSSQVHTANQV
FT                   ARRHVRSWLCDTCQNGSAKVFCGQDRVVLCEPCDELTRSVNGRLEGKSVPPRAPLKSFS
FT                   LQDEPVDEHGATYNGSHATMLSRHPFKEGLALFPASGGSGSKLSGLTGGPHRMGSGSPV
FT                   LQPGGNAQSGGGMQGLSRQHSGQRVVGGMAPYTIGGEGLAGAHNGGYGTAGVGGAPSWD
FT                   PFQMVGGITPQQHQYQLQQHRHQSQQRGLLTPFHHQMGGVAPPPMPSLVSQGGYFMDEN
FT                   GISRGSSGERTSAYAWLPGPHLDGLMRNPSHSSNGSDPIGMYMNFDSPEVRLAANGSNS
FT                   RGSGGSDGLNQGGSNTPPDITGDPRISDASHQEATSTQHWQQQQQKQQQKQQQGHVFSN
FT                   PADPMQRYPTPMSAYMPGVDLPYQGRVGPAIPSTSTWSPHHIGGGYMKREASSPNMGLR
FT                   SNPTSWSTEGSGGLQAQFGQVQPPHGAYLPPHPMPAFMQPQPAFGTYDYSSYPSMMPVA
FT                   GGVLVRQDRNSQGSAEGSGGGSPPNGGSGGGNIGGGGSVVAMSSMVPGGGFPFDGNPGA
FT                   GTPGKEDGEDAPETPGSMAPGTALRKEMLIRYHEKRKQRHFKKKIRYESRKVRADNRVR
FT                   IKGRFARADAPLTAIDKSSAKNHKDIKSKLATDDDAEHDAEEKKEEKEQVNLKHELSSE
FT                   VAAPPPLVTPDVLPGVTAPLPCEYDIFISGQPLCAGGGPLLFPRAPQILLRGLQEAIIS
FT                   RLDSSLDPPNDISM"
FT   CDS_pept        join(complement(32377..32499),complement(32074..32292))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631034"
FT                   /orf_name="MICPUN_57488"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62839.1"
FT                   /db_xref="HOGENOM:HBG610043"
FT                   /db_xref="UniParc:UPI000199A5FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E566"
FT                   /transl_table=1
FT                   /translation="MTALPTARGLFRQLLRARAVAFRGDQTALNASREEIRKHFQESAH
FT                   LEPEEARKKIEEGVEAESFIRLHVVQAQVNDKGNYEMSIEPQHVDRAVPGENTIESPDG
FT                   GGGCSSGKT"
FT   CDS_pept        32795..33814
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631035"
FT                   /orf_name="MICPUN_57489"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62461.1"
FT                   /db_xref="UniParc:UPI000199A66E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E567"
FT                   /transl_table=1
FT                   /translation="MRTHHIPSTDGVVLEVHDRGTSPSSSSSGLERDEPTVLLLAHANG
FT                   FHSRTWDAAAEELMRVASSAEGLGGRTGGVRVITFSFRAHGKSTAPISAGRDALRWGKF
FT                   SEDLLAVVEQTPGLVRGKLVGIGHSLGAHAMLRAEASRPGTFASLYCFEPIFVCDPGKL
FT                   PPFVPMSLERAAARRRRTFPSRSDARAAYGSKPPLNILQSEVLDAYVRHGFVDAAGGEK
FT                   GEVTLACTPETESTVFACGGVEAEANKLVGGGKVRCPVTVAHGATHDPRDVYGRSPNDA
FT                   IYSSIISPIIAEYIGENAFVEYAPALTHLGPLQDTVWFAKSVGAHLSRVGVAKGRSRL"
FT   CDS_pept        complement(34114..35151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631036"
FT                   /orf_name="MICPUN_57490"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62840.1"
FT                   /db_xref="UniParc:UPI000199A66F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E568"
FT                   /transl_table=1
FT                   /translation="MAYDSDSDDMFVMLDGEGRIFGCGDGMDYSFRVEADFPTPPPSTN
FT                   SVADEQTTIDDLIRECLTCDMMTECTLWLGAEDMEAPNCALEQLAAAIFKHHTKSCDDF
FT                   DPESSGVEWWIQSRDPGTNQGLTLHWDKDENLRIHHGLYAHPQLSTVTYLTEGAPTVIF
FT                   DGLTVPAIARHGNGTPTGLSPSPECTGVYVSYPKPGKHIAFDGRLLHGVLNDLSPESSK
FT                   DARRVTFLANVWLNHMPKGVRRLPLDAATGFGLMKPTTFLAAKAAPKPREVTKKIAPMG
FT                   GNDLFDFGCFGWNGDDFKLSSKLPKSSLSDSGSGTLLVECSGIQVVENEKQGGEQKSAK
FT                   RQRVE"
FT   CDS_pept        join(35329..35822,35884..36475)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631037"
FT                   /orf_name="MICPUN_57491"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO62462.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniParc:UPI000199A670"
FT                   /db_xref="UniProtKB/TrEMBL:C1E569"
FT                   /transl_table=1
FT                   /translation="MRVIIAPCSSPVRLFAPRTRLVGRSRRPSGVAASFSFEGRVTSET
FT                   SEARSKHAGAGGHAGTYPPIVRFTERGIHGAGDEPHCPIPLITGLEYKAAPDGAVHLPP
FT                   PDIRGHDSHPFEWVVAERRCCRDFAELPSGHLHLWEIAQLSWAAQGITAPETAPDEFGH
FT                   AGASRRTAPSGGRLYPLTLYVIASQAVGGITPGPYEYLPESHALLPIGPQCPPQQGEVN
FT                   DEACDDEGGDPEVLQKLLRSTVPQVAQLKHQSWMDAAGAVFLISGNPSLTKSHGGLYER
FT                   FGEDLVKFEAGCAAENLALQATALGLGATFVGAFEASEVKDAIASRDEGEVPLLMMAVG
FT                   VPKGSLREHHDGLGGAIPSDK"
FT   CDS_pept        36927..37688
FT                   /codon_start=1
FT                   /gene_family="HOG000238640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631038"
FT                   /orf_name="MICPUN_81164"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO62463.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="HOGENOM:HBG560593"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199A671"
FT                   /db_xref="UniProtKB/TrEMBL:C1E570"
FT                   /transl_table=1
FT                   /translation="MYADSQAIAPPSPRRVFLGTLATAGLALGGNFLGITGKLLNGVPD
FT                   VAESLRLDLIYPVGGFKRAYNPEKGYEFVYPADYLGDATMVARAANQREAMNPLDPPAL
FT                   GDVPKPPKIFGQTVQEPQSAFGPMGGTGEENVSVIVSRSPPGGFKLDRFGDAQNQAEWL
FT                   LANILAPPGSGKTSELFDAYTRTSGGGQKYFTFEYTIKTDAWYRHNVAVFTEKGGRLYT
FT                   LVAQVPEVDWGRRRDEFRRVADSLKVFVPTG"
FT   CDS_pept        complement(37737..39086)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631039"
FT                   /orf_name="MICPUN_57493"
FT                   /product="Predicted protein"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62841.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="UniParc:UPI000199A672"
FT                   /db_xref="UniProtKB/TrEMBL:C1E571"
FT                   /transl_table=1
FT                   /translation="MPSASKPPTGASNPTPKPRDAQKEKDYERKKQRVKEAHRKKRVRA
FT                   LMKSAPGEPVKLHYDTDCRSPATEAHVVMFSGVSSESKGEIAGSSGMGWYGMPRRAGKG
FT                   GAGGACANALLHYLKESDRTKPPDRSWLTTMVGMQKWLSKEGYTTVPRLSAGNNNFDFK
FT                   RPFSILNPQCVNSQRLSGRTRAVLIGCNYPGTESALDGAWADVSKMKRYIASVGFSNDG
FT                   DSLMVLRDDPNGKSGELQPTKENILEALHWLALGAAEGDSLLLHFSGHGVRVNRPKASE
FT                   TDDETVVAEDGLVPCDYKTEGPILDREVQEILVSRLPKGCSLVMFLDCCRGGSAVELPY
FT                   NFKLTPKQYAFEKERMAVGWPVRRNPLAALVDRTVNMVPNNCKRALRIGAKTADATCET
FT                   IGGVLQAAADSFLPKLIKREYQRGKRKIHKLTGVKVQFEPHDERTHRFLF"
FT   CDS_pept        join(39260..40270,40511..40609,40760..41146)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631040"
FT                   /orf_name="MICPUN_57494"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62464.1"
FT                   /db_xref="UniParc:UPI000199A673"
FT                   /db_xref="UniProtKB/TrEMBL:C1E572"
FT                   /transl_table=1
FT                   /translation="MLTLGGSACIARPPDRVVSRRGVARRVSAHRPRAAEKFCLSGSGA
FT                   SGIPADDAASHERGAERDGFVLSRRAFGPSIAATLLAPIVPSSIESAFAAGGGGSPAAV
FT                   GIECVVMRTASITPDMAANYLVEAVPGLVKRDDAPAGRAIVMGAGGIALELRGGGDEGD
FT                   EGDADGSSSSVKLPSESRDPPKLAAIFVGTDNPAKARNTALRNGAATQKDGPGSGERCS
FT                   GDAYAGCVANLVGFPLVFVKTRSAKPAVVRIAVSGALDPDAVVDALGGDASGLTIDSAG
FT                   KGQVGVVERAAEDPPLQGRGVILTPAGGGAGGLELRAGDRGSAAWRVLGVVGTGGKRSR
FT                   AKSPCPGTDRSPVCHRRTASDGKRLLNARKLGELVTISTLCPMPLHFATHENYLPATGQ
FT                   FLGFASSVRRPNFLGNDQRPRLARWHHLHARSGAQDSVRPRAARKSRGQPHVGNVKRKR
FT                   PLRGHHSGVRGIFSFPATLVLFSGAQRSSSAKLRVHRRNA"
FT   CDS_pept        complement(42437..44077)
FT                   /codon_start=1
FT                   /gene_family="HOG000265013" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631041"
FT                   /orf_name="MICPUN_81278"
FT                   /product="Folate-biopterin transporter family "
FT                   /protein_id="ACO62842.1"
FT                   /db_xref="HOGENOM:HBG411578"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199A674"
FT                   /db_xref="UniProtKB/TrEMBL:C1E573"
FT                   /transl_table=1
FT                   /translation="MSSVVGKVAVTPARARITSLGRRATKLPSPARPRRSAFHVVSQRT
FT                   ARLPRRRPPGKTSRPLAAPRERGSLEVEVESSEAALPTAGADKGDGFAGISLAGVPLTP
FT                   EVSAIVLVYFVQGILGLSRLAKDYFVKDELGLSPAEASIIFTISSVPWLVKPLWGFISD
FT                   SVPLAGYKRKSYLAACGFLGAGAGFSLCTVVNDVPGAVLAFTLGSLSTAFSDVVIDSIV
FT                   VARARGESQALSGSLQSLCWGSVAIGGIASSYFSGSLIETYGTKYVFGVSAAFPLLIAC
FT                   AALLVREDPVDEPKSRTLSQAETADKKDGKSVGAQLAELGKKLWGVGKQRRIWAPTAFV
FT                   FLWQATPNPGTAMFYFTTNELGFTPEFLGRVALARSVAALVGVGVYNGYLKKVPLKKMF
FT                   FWSAVVGTALGLTQLMLVTGYNREIGISDQFFSLGDTVVLTVLGEVSFLPVLVLAAKIC
FT                   PEGVEATLFAALMSVFNAGGAASGALGAALTSYLGVTAEDFTNLFWLVLICNLSSLMPL
FT                   AGLRWLDEADKEWEGEEDAVAALKEGGSD"
FT   CDS_pept        join(44262..44459,44535..45308,45444..45876,45982..48848)
FT                   /codon_start=1
FT                   /gene_family="HOG000265012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631042"
FT                   /orf_name="MICPUN_80475"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62465.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG596716"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI000199A675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E574"
FT                   /transl_table=1
FT                   /translation="MSFAIHKQVHPPTGVDHAVAAYFTHPIGDGGPPNLVVMQANHLTV
FT                   FAIRRDPSADASGDAALGAKAMSLEVVAEFDLNGTVGSIAVMRRRSGAPRNQRDALLIA
FT                   VRESKLSVIEWDPSEMTVVPSSLHSWETPVGTGGVPSALRVAPLPPLAIADPEGRCAAV
FT                   LLRAEGRSRLALCPAVDADADADGDGGGDDGDRRGQGPAASVRKSFVVDLTADLALSGV
FT                   RDAAFLHGYGEPVVLILHEREPTWAARMPLVNDTCVLTAVSINLDTKRCTVIWQREKLP
FT                   CTCYRLCAMPDPLGGAIVLSNNFLLHESQESSKALALNPLAGGGTESALGVSVELDSAH
FT                   AAVLSERQVLVTTKQGALMLLSLRVEGRRLAAHGAMHLRRAGGAVLSSGMCLITKRLLF
FT                   LGSRVGDSLLVSLKKKEAAGAAQMLPAAAPKKRKAGEAEPPKPPPPPQKVGTSQDDEDE
FT                   LEAMLYGEGEAAAKAANAGRKEDPGYTFTVRDSVLGISPIIDLTAGASASVQGDTEERA
FT                   ELVAACGHGKNGALAILQRGIQPELVTEVEAGTLPGLMGTWTVYHESRDNERLRESGAA
FT                   AAAANVDPFHSYLVISLESTTMVLETGEELREVSEAVELVTDAATLAAGNMHGRKRIAQ
FT                   VHKGGVRICEGPVKIQDLSAAEMPAAGDVSPDLEIIAAQVLDPYVLCRMSDGSLRVLKG
FT                   DEEKGSVEAMSPSSYANLPTGESIASAALVDDSVPAAERPGLTTREPGFLRRTATSTGV
FT                   LPEDEEGTVLAVTRVGGTLELYALPSCERIWSADGLSEGLNVLAPGGAGDDVNVDGDGE
FT                   VEPTDDYPAPEIVEFRLDAFPRAHERPMLTALRGDGSVLVYRAFLCPPGAGNVGHEAKP
FT                   QLRFCRVPIELEGGGGGMVDTKALSGSRLTRFERVGDRGGIRGVFVSGPRPLWLLVRRS
FT                   RVLALPIRGEAQRTVSFTPFHNVNCLNGFMLGTAAGGVRICQIPGRMHYEAAWPVRKLA
FT                   LRCTPHHVQYLPDFRLYALSTSAPVKWKDHEVNEDDIHLSTLIKVRKANAMAKGGVEQV
FT                   FSLRLLVPGTLECAWQYTVDPGEHVQSIRNVQLRNTMTGALQSMLVVGTALPGGEDAPC
FT                   RGRVLIFEVVWQMTDRGTKWQGQLVCVRDAKMACTALEGVGGHLAVAIGTKLIVHSWDG
FT                   HSLMPVAFFDTPLHTVTMNVVKNFILLGDIQKGAFFFRWKDTPDEKLLVQMAKDFEGMD
FT                   ILATEFLVDGSTLSMLTTDMTGNAFIFSYDPKSLESWKGQKLLTKGAFHVGSPVHRMVR
FT                   FRLKAPTAAPGQTISPAEQKAQANRHAVFFGTLDGSLGILVPIEEAAHASLQSLQRYLT
FT                   YATPHAALAGLNARTHRHPKTVEGRPMRQPAPHSLLDGGLLAVYEHMPWKAQAKAAKEA
FT                   GMTRDVALGHLHQLSARTAFM"
FT   CDS_pept        join(complement(55153..55161),complement(48893..55000))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631043"
FT                   /orf_name="MICPUN_99827"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62843.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A676"
FT                   /db_xref="UniProtKB/TrEMBL:C1E575"
FT                   /transl_table=1
FT                   /translation="MSMQRPSLPHLDIPGESGESTPLFASPRVPEPETSELPGGPAPVA
FT                   HGRRAGSLAPLAPLGGLKPLGAPLPPISGLVPKPVSPVEPQSPGAAPAPAPAPPPVPST
FT                   PLSQIGVSVPSLPPPDLPATPARPYFRDDWELHEEKIVGSPGGSWAVYLVDRTTGVAYL
FT                   PSDVWPEPAGMVSSDGAYVDADAPGVSSVDFVALMDAFLKRHKRRLRDVWDAHDTGKRD
FT                   VLSEQELAGFIDEIVGTHAVSRAQRKYLEVVLSDVRWVGASYEGLVKAMRECKDRKRRK
FT                   PHPLVAPGLSETPEVLDRLKSYMFNNMISAKRIFASLDVEECGWLEIEQLRQMVHKIAP
FT                   DVSESEKRRLTAGLAWMDPRGEAKVRYIDLIRCAKIAKLKVEPMSWGEVSTTPPAKEFV
FT                   ERADRKAEKKLEEKINGPAPTRPRPAAAKTPVRGPAKTPAAAKRRPGAHGGIVKSPKSP
FT                   GNVKIPVKLAGGTPKTPASIGARRASIGSVAENPATPATSPPDPDSEPRTDKPPGPSPP
FT                   VPKRRSPSTVSKRASPPSSKKSSPPTAKKSAPATPSSSLPPVNKPARSTPTARTALRSA
FT                   RPDELRSANKKRAAVTKKDLAADDDDGHPKPLYPEPGVEEWELERALTHDGATYLVDRY
FT                   NGSNIAYDDSGEWPVSVGKLVEDSDPLNRMFDSVSKPMIRIVRSTGTRDAGAIFDEIDR
FT                   MLKDERRRLRDVFDEYDRNKDGVLTGEELGRFIRAAVPDATLPEVRYFGVMCDVKGEGG
FT                   VRFEGLIEAIRESLDATQMAQAARHSDELAPVMSKLRNFMRENSADAKKVFEACDLDGS
FT                   GELEVFELRQMIKELQPDVTPAELRHLLAGFREVDTDGNGTVTYRELLRGLRLVKIVRV
FT                   SEGHHKRREAEKAARIRGEFGREPIDAAARPAPLPLFSERVDQAKGEDSPSPKSAAPLK
FT                   PTASPPKSDIVEEISYEDDFVEDDIVEELLSSDPETKEETKPTSTEPPPAPRFKPDLVG
FT                   FTPPDWTLEAITVGRETLLFDRETRDVYGDCDEFIGEWPVPRGSLDEDGHVVPTISGSS
FT                   RDLFEELDRRLKHERVRLKVLFDEHDFDDDGRLEQGELARFARRVIPEATREDVTYFRV
FT                   MMDADGGESVTFDEIIECVKRCKSAGVSMRASSQSKDVPEALVRVVQFMKENSVDPRRV
FT                   FDACDLDGSGFLDFAELKEMIKELVPDASAQEQRLMLAGMRTVDSDGDGRVSYTEMLRA
FT                   TRLVTLKILDSKGKVRKHPKKEGAKRSSSRAASTARKVPKKDAVESEPVTLPMDPTVGQ
FT                   DWRLRSMPFGDETCLVDDETRLVFTRIEDADLPLGERKKSKRKPIGRTMDTLTATWRTE
FT                   MRADLGKNSDDESSDDEWDDTDTDSANTSMVSEEGSTTDKEGTSKWPGPLRGKLAPSGK
FT                   LIKHAPLSDLFDAMKEYSQRNKISLRKLVKMHDANKKGSLTLAELTKLIRGSLLPGVTS
FT                   SELSYYGVMLDRDGDGFVTLRDFEECVAESARWGRDVAPRTGAPSPWIVMQRMSIAIES
FT                   GPHKGDVAAFYYACLLEDEDQDASALLLDSRRLLKLVKELFAGISHMDARCAVANLRAC
FT                   DLTGDATISLPELARALRQATVGKVLPGEGFGRVEAPAVETPDDSAKENRDKEALARKA
FT                   ERARSEMDATSGATAHVQRYRTGKLSDTTNRARSGTPVKISVRPESPEDDPWDSIPAPS
FT                   PARGGSPPEPYSRFGPSPPKKQTVPLSMTKTTVPLPVDKPKKSARTAKEELELKKRLRA
FT                   EKIRAEKKVAKGDVLPNDAREEIVAAQELLLARQFEKELTMKRVREHLIEQEDAKVQVA
FT                   EAWREQERIAQEEYERAMLAYQQDHLEQFGYYDEEADTTVRNYFEAQRQARVDEEVLRK
FT                   WKTEELLAMAQESGPKLVEALAALKRGHDGKIAPESLAAIHEAVREGVAAEAEGNLRVV
FT                   NSTDIAAGSNATQEILVGLMRQADEQRQMEKEDEADDAAFVARMREEYPDSGNWSDDEM
FT                   EPVPGIQRPESLFSPLFSKYPKMPFKSHKEFNETVPAVKRLQFANQ"
FT   CDS_pept        complement(55353..56276)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631044"
FT                   /orf_name="MICPUN_81258"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62844.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A6EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E576"
FT                   /transl_table=1
FT                   /translation="MGKVCIVTGGSRGFGRGIALILAKEHGCTVYATARDLGKLQDLAD
FT                   QATIECAKLGSEGKVVPCQVDQKDDAAVKAFVEDVTAKEGKIDLLVNSAFQGLVAMTPQ
FT                   FGKTFWQKPLSMYEAEVDNFVRFAYVMSYYVAPVMVKNKSGLILGISSAGGVVYFADVA
FT                   YCAGKAAFDKMHHDMACELREHGVFSMTLYPQAGITENANFPGGDTPSYAGRAVAALMN
FT                   ASEEDMTTLTGKVIQTREVADKFGFTDVDGKHPDGPFTNPDAIAGMRKAMRNPPHLNLD
FT                   SPPIDPDGWKSMNAEGFADMFPGYKA"
FT   CDS_pept        56492..58423
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631045"
FT                   /orf_name="MICPUN_57499"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62466.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A6EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E577"
FT                   /transl_table=1
FT                   /translation="MTIERYRGAPLATHEGVRCDGCGETPLRGTRRRCLLCIDADFCAS
FT                   CCEIHRHDCFIVMPKPAHEAWSETLQLITCFASLAGADDFRGDDGLDAPPPAGLNDRLR
FT                   AFIDQGAHAICPPGPALCPMVNPASHLERLARFRRIAHAREDARRLRARDASEAARNEI
FT                   LNPRLFDVVDELHPWNMPRDPATPGRFASQGLIAYLPRRQGGGMCLVSNDGFPMVMVQV
FT                   YAVEADKAERVDVKGGFFGDVGGVASSLAQTDKAGEFRASFAKGGVEVRAILTNVSSLC
FT                   SVRIAARRCDARGVCREDGVAPVFESELGPLESAEHAAEGTEGRALLLGSTGASNAPYL
FT                   KFTASPTEVWSAAPLTNAVWKGSRWHALDMFVAKRRAPDAPRRGSDWPWFGVGGIPVIS
FT                   ETRSSEDEIHRIRHVGVMAEHRGLSPEELRLKALTEPNENDQNAPEPPSADEPAPFVAG
FT                   MAPRPPASPVASSDEDDINAPTSSRLDLGRVVAEACDPPRPIRADRSLRPSPNPTERSA
FT                   VLRLAVEPNLTLPPVDPEHITRRNAAKLIVAARDREMVDVYERAVTGAHQSDACVVCLE
FT                   SEPACDLILQPCKHQCMHAGCMSDMVRRCPLCRVSVEWTLVRDADGGISSRQHGWSYSG
FT                   HVERQRVR"
FT   CDS_pept        58600..60978
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631046"
FT                   /orf_name="MICPUN_57500"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO62467.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="UniParc:UPI000199A6ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E578"
FT                   /transl_table=1
FT                   /translation="MAFGGAPAFGATVNANPFGGSGSFGPAATSAPFGGVQASPTGGFP
FT                   GQTGGAPAFGSSAFGRPINSTPGVSGSMQAPGMWNSTSNLAASSFGTTQTTTQPVQNAC
FT                   SHWNEGRCRFGTRCRQRHVCANCGSSAHTSRQCSSAGAATNSTAEYRPSRIVERNNNGS
FT                   TTHGTIHHVEAMPEHRGSSAEQIRHEARSSNNNFNSPVASTAINNNTMFNNNNNNNSNT
FT                   MFGGNNNNNNTNLFGGNNNTSGTNLFGNNTNTNTLGSTPTSWPGTTTTPLVSTPTPGPN
FT                   PFGPTPATNASSPWPAPQPSTPGGSFAFNPQAQTTPAPAPAAPASQNMFSFPQAQTGAP
FT                   ATGANPFSFTPTTAAATSPTSAFTMSQPAAQPANSLFTGLQQPATTTPAASPLSSSLGM
FT                   FNPQSAPAPAFTGLTRPAVTQPATSQPFSLTTPAFSLTPPAQSSPLASLGGLGTGAAQN
FT                   ASQGSLFGGLRPPVGGGTIPQIQTPSPAPTLFPSSTSFPSSSLFPSATNPSQATTYSNG
FT                   LVPAANAALAPPKVNSSPYGKPLESSKIISASREVVSGVSNASPASTIGAMGKGGSQLS
FT                   AWATSSPRRVYMSRAPLPAPSRISLRPRGSPVRREEWMLQPASKPRELIIRAETFETPM
FT                   GGETSPAVLSIAEKDEFVEPAFILTESAKNDGYSCEFEVEGKKLRDFRVTRRGFGSVRW
FT                   LQPVDATHLNGIDVARVVRIERGAVYMYDEASGVSAPRSGEGLKTRAEVTLLRCTSKKD
FT                   TEESRKKFEAKVVQQTRRMGAELLEYNIDTGTWRFVIDM"
FT   CDS_pept        join(complement(61939..63561),complement(61896..61916))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631047"
FT                   /orf_name="MICPUN_99831"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62845.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI000199A6EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E579"
FT                   /transl_table=1
FT                   /translation="MPSDAAKRRKEERAAKRAAKGFTVSKPKPGCECCDDVGHPAEATP
FT                   SSGPGSADAAVAAAAEEVTVRFPPSLTSRQRAVLHAVAERHGVPHSSSGDGEARRITLG
FT                   RGAEVVDVDAVGTDVATADEAICELLETHLGLSRDDARRAFDAPPPTTKTARGTAEPKR
FT                   GTAPAVKGADVTVEAFVSRTRALLELERAAEVEQSEAVLKGMSAETAQRRGRALLGLRC
FT                   VDLRGGLLGKTVVTLELASRKTTQTPPLPPHKLSPHDVVCVRPGKGDTCGEPLCTGVVY
FT                   RVRDTAVEIAVDDLPERSLEGNLKVERLANETSHRRLVQALDRVGRAPCSAGDPGGNVG
FT                   VGAALVDVMFGNIPPRFHAAAGALHKTVNPGLDASQIDAVAHALGAADVALIHGPPGTG
FT                   KTTAVVEYVTQEVARGSRVLCCAASNVAVDNLVERLMRSRGDALSKLGSGAQAKIVRIG
FT                   HPARLLESVLDASLEAQVLKSDNSALARDCEKECRELRRVLLKLDPRKDRTARNDARRE
FT                   LRRLAKEEKARQRKAVDEVIGGSNALCRTR"
FT   CDS_pept        join(63910..64218,64321..65046)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631048"
FT                   /orf_name="MICPUN_57502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62468.1"
FT                   /db_xref="UniParc:UPI000199A6EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E580"
FT                   /transl_table=1
FT                   /translation="MSFGLDLQQAIKNVQIAKAAHKSFKAAAKVGVSEAEADANCEGPD
FT                   CDGYDVLRKKVDDCLEAQIDLKQKLNAAEAAGDLAATQAVSEEMAALNEQCTEFWKQEA
FT                   LGHGPVRVPRNRPYPDEEAFGFQEVMALVVLATSILFITHGAKFHKFLICAVGMTIGTF
FT                   GGLFLTEQFGITEFKPKWGVSLALGLALWIAVMFVEQLMFSAVAMGIGGGGMMIIYSFV
FT                   GHYIPPQPEYYMFVAIGIGCVAGYFLTDMVKKAALTLIYSVLGGVLLGSAVSFTFWKYH
FT                   LAHGDLWLENITSNDVTLDLTQWPVLVSIGTMVAGALFGIWFQNKSAKKAEKEPLLKKG
FT                   DDTV"
FT   CDS_pept        65222..66934
FT                   /codon_start=1
FT                   /gene_family="HOG000198064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631049"
FT                   /orf_name="MICPUN_99833"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62469.1"
FT                   /db_xref="HOGENOM:HBG560668"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000199A6F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E581"
FT                   /transl_table=1
FT                   /translation="MPRLWTCVALGAYLLARASAQVLDDVVTSADYYYDYDEVDEPPER
FT                   ARAPTPSPASPPATPPTPNPPSPPAGPHPPVVTPPEPPSSPATRTEPSSPPPPPETPTR
FT                   PPRPSPTEPDQVLEYPPERLASVDDATYRPGDWLIGRSTYFDAPTAWKAKFEPHLFGDV
FT                   HGNGCGSFTNKGPGLESNSNFTLPLDAVAAVADFDPRFYEGACGTCYELGCITGPILNV
FT                   ATRTNQTKLPLWRMADGRSFYDVDPNALDSFNRTVPGENVLIEPGTDAEWEYTRCWNES
FT                   RTIYVTIVDVCPCQYSWGEQSICCGPVPHFDLSYWAHELLAHPLQGKMMLRFRPVHCDT
FT                   KEPVDARKGASARMGVADFSSENGSNRLNMLNGGGESQRVFVKNASSSAQLAPRVVPVY
FT                   RDEISPGWSFTAYRDQWATISKRGHGVGGSAALCVSVAPGGRMALRCTRCQDTGKPFAG
FT                   AKAVVRLWVRSTCATEPSHEPPVYLGVSTMGVYDYALGATPAERACGNKTKVWDHVVSD
FT                   WRDNCGWRISVPVSTLKGCSPDKASGANALFLELGRGAVGDAKVCMDDASIVT"
FT   CDS_pept        complement(67022..68626)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631050"
FT                   /orf_name="MICPUN_52651"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62846.1"
FT                   /db_xref="UniParc:UPI000199A6F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E582"
FT                   /transl_table=1
FT                   /translation="MGSADMTAGVDAVTAAVKAGDEALASWAESARASVDEAKTQVAKL
FT                   VAAHTLVAQQGAAAADDAAATASAALASQRAKLGEISAALASHVKDLEAHSAAVDAERA
FT                   AAADAARGVGAGLDAAKSALERAVVQHREGQSALVADVVAQLRKTLETQTKALLESLEG
FT                   SLGSGVCAAMAETGAIVETEARRAETSHASLVEATGAMRLAALAANQAVSAADGFADAA
FT                   DSGVAQTRTALGSMGASVAEAAERVGASAIGAFDATCASIDAHVASRESIASTIDSAAA
FT                   GSKSATEAAASAVGEKIAAVSAAIATWNAAENAAVDSAEARATEASAKANASLRVATDA
FT                   AKVAVESAAAEVYEFSGEVDAVLVDASAGVETLKLDVTSAMGALGGEVASHVADVDLAH
FT                   VPVEPVRDVEAVAFSRVLSSTPADEAVLSGGVSPAASSPAVTSVQDDEEEAFEDAEGDV
FT                   VDVFGEVGGDAPVVESAPARPTAPPAPTADTENVVPAAAPEKKSLASMREGFKSKIAAP
FT                   AGAERRTFGALKDVNAR"
FT   CDS_pept        complement(<69449..70543)
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631051"
FT                   /orf_name="MICPUN_81000"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO62847.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG443943"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199A6F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E583"
FT                   /transl_table=1
FT                   /translation="MAEQSGIQVVVRLRPMSQRELKGNTLPVVTASTDKKEVTVIKGTG
FT                   ARTLRNTYAFDNVFTSFSTQKEVFDSTLAPVISDVLGGYESTVFAYGQTGTGKTHTMEG
FT                   DINSSENRGVIPRAAFDVFRRLADDSYVESKVTASFLEIYNEELGDLLCDVDLNDLTAL
FT                   QQKQKQLRLVEDPGTATKKGRGMYVMNLTEEPVECPEDVLKLMARASERRAVGETKMNK
FT                   HSSRSHCVFTLRVESKRILPDGNMMETVGKLHMVDLAGSECAKSAGGADVDPARERERK
FT                   NINQSLLTLGRVITLLKAGGKAKGERIPYRDSKLTRLLQESLGGRCKTCVIATVSPSIM
FT                   SVDESLSTLQYAQAAVGIKNMVQAN"
FT   CDS_pept        70915..72936
FT                   /codon_start=1
FT                   /gene_family="HOG000100035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631052"
FT                   /orf_name="MICPUN_57505"
FT                   /product="Cytochrome P450"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62470.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560405"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199A6F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E584"
FT                   /transl_table=1
FT                   /translation="MMLATPRLSAATSAGPSSRRVSGSNRLVRRFTTRRAAVVRRVAAD
FT                   RENESSDAVTSRDLVDLSCGAPPCDDVVHEVPADVPTPVEAGKSGDCPYTAAKDAVSSL
FT                   LPGQRMRNKMPEGGPVMLPSNAFFKSLLKAGSSPVGMPEAMLEWVNMTGHETVGIKNAV
FT                   GPMCVSTVDPDIVEYVCHTNAKNYRLRMLPDAFRYVIKNKGITGSDGAYNREHRLMCQK
FT                   PFMNSFSLDQFSRTVEERVGLLCDAWAKAAARTDEGNLAIDIDDHSQRLTLDIVTSLAF
FT                   NMDFKQVEGIDAQLNGGEEEWRKRSSGGDLDYDIIDKVLHAYNNTSEIMGELFITPVPI
FT                   LKLQNLLGIGRVRELREGYAVLEDVGINHIIGRRRKELEENKQRGDNEDYCLLDVLLKA
FT                   TDADGNPLPKEDVWGDVNDIMAAGHRTTASNLTVNLHHLARLPEVQRKVEQEVAALGGR
FT                   APTFRDVQEGRLQYTQRVVKESLRKYAPINLFPRVVEGDDTLPTGHEVKQGDFILLSSW
FT                   AMGRNPRVWDKPDEFNPDRFTEESLRQNAERLAKESCGPDATEEELRLQMERMSRRILA
FT                   GRDFTYTPFGSGPRSCIGGTFALLATTVALATVVQRFKWSTVATKDPGFEIPFLYDTTI
FT                   TFPKGVHVTATPRAVPLGAERGSESQAGVGEESMAPAR"
FT   CDS_pept        join(complement(75117..78754),complement(74105..74872),
FT                   complement(72983..73790))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631053"
FT                   /orf_name="MICPUN_99836"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62848.1"
FT                   /db_xref="UniParc:UPI000199AF6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E585"
FT                   /transl_table=1
FT                   /translation="MKSASQRSNVSLEDQAPADVTESSPAPKPSAYRDKLEEQLGAMNH
FT                   SPSPSPIVAAPPVAAAEPSVDDSMLAAVSTNATYAAQADRAVNDDLAREHAQLLDNLER
FT                   ERSEWASREMELRAQADDARRELNAARAEAAEASAQLEAANSKVAAARLMAESEAKAMA
FT                   EAERHKADVAKLEAAKAEADAEVARKVDELKLAKEDIAAYLAKNEELSAKVSKAVKKGK
FT                   GIEVEKKQLEVTVAELRTQLEQAGSAYAAELVQATGSAENAATAAKEEAQDAHRRLADA
FT                   SSALEAANAARADAEAKVSALAESLAAAESAAASNEAAVAEANAKAAALEAAVAEANAK
FT                   AERAEQARAEAMSGMNENASAMAAELEAARAAHAAVQNEALASAAKLADAEEKLRESQA
FT                   MTEAAMKETDALNAELDSMKKETDALNAALDSAKAGGDEARRELEDKLRAAAADADAAL
FT                   SELEKARGDAAAAAAERDEAKAALGVAETMATNADARSDNLNSLLQDAAAKKEAAETEL
FT                   VELKAKLEEAVANLSAAEEAKATALADMNDGSRALAAELENVREKLQAATQTSESAKAE
FT                   LDAKAKEIADIVKDAEDLARDVAKAERAAAEDKERIAALEAAVADADARADAADAARAE
FT                   AESARLDRSVELNEGNARLEAELEAARADAEAAKGELEKALADATEARSACEKTSEKLT
FT                   KAVKKGKGIEAEKKQLELTLEETKRALEEAQRAAAAAVAEAEAGAAGTADEVAKTAAAL
FT                   AETERREYEAAAKAAALEAAVAEADAKAAALEAAVAEANAKAERAEQARAEAMSGMNEN
FT                   ASAMAAELEAARTDLARVTGELQTAASEKDAAAKSSEDASAKLKKALAKLKKIEAAQKE
FT                   AESMAEEAAAALDAADQRAAAAEAEAAELKSGTAAASETAAKLAEAERRIQSLVDLVEG
FT                   ARMETERVTDESSKLTALAESLQAKLHDAEAALRAAEANAHALGSASDAAARDAAERAD
FT                   RAEAALAAAEARAAEAERLLAEAESEAESLAAKVDEADSAQTRLAGVVAELDAARQEAA
FT                   KLAGAVAKAREEAARDARASAAAESESHLATRMRELDDLRAESAALREELARTQQARDA
FT                   ALADARAHASSSPGAAGEVTLTIGHGKKDEDGEMDIEGAIMTGGDQNFRPLLGRVKALS
FT                   WAPARENKHFQTVAGQLDKMSVYLQRRPLLRLGLLLYIILVHLMWLLPAPQGNVALGAK
FT                   AKAALSAHIEAFEERLSEDDSPGIREMLIDDARVVYDAELKACGEESEDAFLLYLLRPV
FT                   RFKKDDDKFVKFSDDTEWFDPVVDFYDDASYEILCHEPLSAAAFKTFAAHVSTYPGCAA
FT                   KQTADVKRKFKGAKVAVSREGSAASRASTRWKLTPDQAAAKTFYDTRVDDVGVPPAGEH
FT                   NGVGMPAPISRRRPTALERVLGPETTEKTPERNLGFQYDYDETPPGSDDMFAPPPKDID
FT                   WQDRGYYIWRAGAAGGKQRKTSSRPRSSSDDEATASASSSIDALDKLLGSMDEADLPPS
FT                   ARPSAREDPFADYAPPTAPADDSAEERARSGKGASGSGSFGGRRVNSDRTELDDFLDVG
FT                   MRFEGLWTLLRAISKGSVLNTDLGNVEVGELVVVGTDKPSLQLWEAQAYELTRVYYQRT
FT                   TDELGTRRVDVDSLGESPPQRMYAYEEEALGKDGGGGDWVLYCELFSEEYHSSPVRVRP
FT                   EEVGLRTVGAEIGEALFIAVPVAFFWAAVSASFVVTSLGR"
FT   CDS_pept        complement(79202..81037)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631054"
FT                   /orf_name="MICPUN_57509"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO62849.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI000199AF6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E586"
FT                   /transl_table=1
FT                   /translation="MTEDNRPPPGRRRVILHVDADAFFCQVERRRNPALAGCPALAVQQ
FT                   HQDVIAADAGAKKAGVTKRTPPADARALLRRVGGALVHVHTTTGQRVSYRPYLAASHEL
FT                   HSLLASADLAREVSRDGFNGVAVEKASIDEAYVQLPTGSDLRVDGARCADVIRDVVKAR
FT                   LGIVVSVGVAHNKLLAKLAGASAKPDGRRVIVSREDIADLLATTPAHELPGCGGALAAK
FT                   IRATLGVTATVADLARLPESALVSALGANPATARLIHARSAGECDDPVRRGRGILNKSV
FT                   GVHTSLTLTPRAMYGVPGCGVSASGGRPGMFEPLRCRETGRLDSLLRAMASDLAGRVMD
FT                   LAHAEKRWPRTMTVSLILVLGRSENGDGKEVRCSKRGPFPDRDPRVSEADGETETGKAA
FT                   HATAEALTRSLIANRGDALVAKVSITAGEFRASAGAGGGGGLASFLSAAGEGTAREPAP
FT                   VDDAAVDDANVDEDAENVDGDEDEDEDEDGEWYPSPPFYFNPTVETSSSGGGGDRVEPP
FT                   GMDDGVGDGGIAPGAATAREPVECVGPGADIASPLSPSPSVPPEQLDGSEPIDATSLLR
FT                   CLAEGTVSGEDARRALRRRHERTGRAVPTSSASTP"
FT   CDS_pept        complement(81114..81587)
FT                   /codon_start=1
FT                   /gene_family="HOG000232015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631055"
FT                   /orf_name="MICPUN_80725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62850.1"
FT                   /db_xref="HOGENOM:HBG584735"
FT                   /db_xref="UniParc:UPI000199AF70"
FT                   /db_xref="UniProtKB/TrEMBL:C1E587"
FT                   /transl_table=1
FT                   /translation="MAAILKHVLLLQRNVPAAAAFYEQGLGLIVTQCSDSYAELGDGLD
FT                   TNGRPVDPKDEKAKPRTVLALKAVGNVSQLTTGYSPFVNFEVRDMDTAVNNMLRMGAEL
FT                   DGPIKYPPQGKVAALRGPDGHMLGLYEMSDSPFAGGNVMMDMDRVNALKEGKD"
FT   CDS_pept        join(81769..81840,81957..82901)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631056"
FT                   /orf_name="MICPUN_99838"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62471.1"
FT                   /db_xref="UniParc:UPI000199AF71"
FT                   /db_xref="UniProtKB/TrEMBL:C1E588"
FT                   /transl_table=1
FT                   /translation="MKLQRSLVIVLVLAFAATASAGRTHTKKLTEPMPFGSDILDTGKE
FT                   TDPSDIQADIALLPALAEGVNARVKTFSVGLDPMHEQTAAEWFESLGYRTLTGDVKYVK
FT                   GYWGGTRAEADPRLGASFCQGAADLAPTQDYDFANWLPVPNVLDELASTYPDAKFLLFE
FT                   SEPGRWLDNVYIKAQEAALRGAKCGCGGDVEDRVDNAKCRLGDEVHFCDVYPCVYERTF
FT                   TTSAVDPSAWVDTYVRHVKNVKQSLGSRLLVVDMETPQSPIAVSQQIASHLGLSANPEA
FT                   FALAHPFEPHVLAHVSEHRWLVFWFACVGALGAAILFAPSPFTDGGARFYRDMAERV"
FT   CDS_pept        complement(82941..83849)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631057"
FT                   /orf_name="MICPUN_108028"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62851.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199AF72"
FT                   /db_xref="UniProtKB/TrEMBL:C1E589"
FT                   /transl_table=1
FT                   /translation="MAGGLSVPVRGRVAVSTRRGSRVAARSTRASRHARAAEGADPLAS
FT                   RDDEKNHASSASRRALLAAVVSAPVAAPALAVDLEALNEDIMRVADPERYYKDASKVEL
FT                   ERQLGAPGSPVNAPGTEKGEDGERDVVTTPSGLSYADVEIGRGDGVKVGDLIVANVVGY
FT                   TPDGKVFENTYARKTALTFQLGIRPPGVCEGLEEGIRTMRAGGKRLIAVPGSLGFGEAG
FT                   IRAPLGKVPPNSALRYEVELMRCVTDSFVADSASPAVDDDDATATATGRRPERICCSDA
FT                   AYPCDPARAAEEGGKSAPMFD"
FT   CDS_pept        join(<84122..84640,84860..>85378)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631058"
FT                   /orf_name="MICPUN_69150"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62472.1"
FT                   /db_xref="HOGENOM:HBG447453"
FT                   /db_xref="InterPro:IPR012430"
FT                   /db_xref="UniParc:UPI000199AF73"
FT                   /db_xref="UniProtKB/TrEMBL:C1E590"
FT                   /transl_table=1
FT                   /translation="GFLVGLVFFAASTALLWWNEGEAVAVYTSLKEARDAVVALPERAR
FT                   ASSANKGSLVHVVGATSGDTLADPDFGVVYPDAVKLTRKSETYQWVERTHKRRVREDEH
FT                   RTRVETSYTYDTRWREGTVRSSNFRYPHGHANPGPSPFDSRTYVAREVGVGDGFTLTPT
FT                   LVDELTRAHNMPVAIRSPLPDGWTIRGGVVYSGSDSAATTSPLVGDRRVAFSAVPGKQT
FT                   VSVLAKQGKNGSLRPWTSPSGRRVVIVSHGRHSPNEMIASAERENAWKTWGLRALGFIV
FT                   MIIGSALIVSPVREIVSYLRWIPLVGGIAAGVVNLGVSLAAATASVSIACGVIGTSWLA
FT                   HRPALA"
FT   CDS_pept        complement(85689..86255)
FT                   /codon_start=1
FT                   /gene_family="HOG000007078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631059"
FT                   /orf_name="MICPUN_108029"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62852.1"
FT                   /db_xref="HOGENOM:HBG560728"
FT                   /db_xref="UniParc:UPI000199AF74"
FT                   /db_xref="UniProtKB/TrEMBL:C1E591"
FT                   /transl_table=1
FT                   /translation="MSAYGDIAAMATLLGGRDPDDTESPGPSGAPFNPGALPVAKDDGV
FT                   AIPAVRPGKKDAKAIWDVSELVDDFDDDSSEEGEDGSGLRIPTYEFMYKQAINTADAFL
FT                   GMAHNKDPGSRSCEDMVLKIHLPGTRSMRELDLEVETDRLRLRSATYKLNLYLPHKVDA
FT                   DEGKAEWDQKLETLKVTARIREEEY"
FT   CDS_pept        87668..88735
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631060"
FT                   /orf_name="MICPUN_108030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62473.1"
FT                   /db_xref="UniParc:UPI000199AF75"
FT                   /db_xref="UniProtKB/TrEMBL:C1E592"
FT                   /transl_table=1
FT                   /translation="MVAEREARAKAEEETAAREAEEKAELVRRIRSEEDADLRAALEAS
FT                   AAEDAAKKAAVEEAEAQEAAEMEAAIAASLAAEAEAKRFADEVAKKEAEELAEAERVNA
FT                   IELEKAEYAAATRSSEIYDGRSSNGSDGDEPVNEAKRIENNLARKPLGGGGGQVVKLPA
FT                   IGKTGLPPVGRLPKITASGGVGGTAIRSAGCTAPASVDFAPAFTSSSVREAAAAAAAAQ
FT                   KNMLRGQGVADGGGASTPAASPERERAFIDEQRRLLVAKKNAERERELQEWSVSSMNPL
FT                   FDDSSRPSTAASVRMRPMVEPVGPGVNSAGLTDEEQAAKREALRLELAKKMKEELNAKR
FT                   MGTVQAWGEPAEQQV"
FT   CDS_pept        complement(91391..93370)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631061"
FT                   /orf_name="MICPUN_57516"
FT                   /product="Histone deacetylase"
FT                   /protein_id="ACO62853.1"
FT                   /db_xref="HOGENOM:HBG560743"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI000199AF76"
FT                   /db_xref="UniProtKB/TrEMBL:C1E593"
FT                   /transl_table=1
FT                   /translation="MRREDSDDDEGSALTITPGTTGDLDGLAAALSGIELASKAPENSS
FT                   GYQGVGNPGGPDTILARALAGIAEDASTPPPPARAQPRRSPRLKPFPATPAGTGGVGDG
FT                   EEFRKPKLVVRYKRENVTPAASAANTPEKGTPKESFETARESFSEVKEDEDGQEESSPA
FT                   PVSVATLASRYVVVEPEVDEEEKEKDRQPPSTSPAVKPPVHRKPRSKVKTKPRDPSSFA
FT                   AFREMRREQVKATAKASDAEEEADALASMFEKKVSVEDTPSRRGGRKAPARAVREGDDV
FT                   GVVGLCYSDVMELHEGPSHHFERPARHAVTVARMRKDGLEEKCDLIAAREATDEELLTC
FT                   HSREHLEYVANAFDRTSDEKVQGVGDIYWTEHTERCARTAAGSACAATDAVASGTHHRA
FT                   FAVVRPPGHHAECARAMGFCFYNNTAVAARAALTAHPHVNRVLLLDWDVHHGNGIQDVL
FT                   YRDDRVMYVSLHRYGDGFYPGTGAMEETGAGEGAGYNVNVPWTEKGLGDADYLAAFDLV
FT                   IDPIAKSFDPDLVIIAAGFDAAEGDPLGGMKVTDQGYALMTERLVSLAGGKCVAALEGG
FT                   YGLTATASAAAATLGAMLGYATPPLSSRRRPKRSTVETLGKIIEVHKERWPVLASEEHR
FT                   RRFRSALEMTRVAGKERNAGELEN"
FT   CDS_pept        93480..94388
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631062"
FT                   /orf_name="MICPUN_57517"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62474.1"
FT                   /db_xref="UniParc:UPI000199AF77"
FT                   /db_xref="UniProtKB/TrEMBL:C1E594"
FT                   /transl_table=1
FT                   /translation="MARGAHWLSGGARRWLDDLAHAWWKRGMLARLRGDHRTSGGGREE
FT                   VLVAEIERRTKSLEAVYLGNFAWMKGPSRDDEAASGGDARDASHVSRACRVLATHQALS
FT                   PFFPDTSKMVDIIREHEGAEALASSVLGAGVAAAMMMTRDPTALAVRIVRALAYDHGDR
FT                   GWAWTEARPGVGVDRGSTGDRRSAEAFAGSAATGIEPGTTGRIGDVGDDDDEAAYAMET
FT                   SRCLYHSLFAAEGVPGLVAATCCAVDGEAWFSRVPARHGVTVRRTESLGAGDGRCVIRV
FT                   ERRRDARRFVASNGEYQGKGS"
FT   CDS_pept        complement(94517..96445)
FT                   /codon_start=1
FT                   /gene_family="HOG000280352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631063"
FT                   /orf_name="MICPUN_99842"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62854.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199AF78"
FT                   /db_xref="UniProtKB/TrEMBL:C1E595"
FT                   /transl_table=1
FT                   /translation="MPDWDVSLVTDMEGLFRDCPTGEDWCGNVVVSTSAFNQPIGSWNT
FT                   ARVTSMRTMFMDAAAFNQPIGSWNTSQVTNTAHMFRNAAAFNQPIGSWDTSQVTDMYRM
FT                   FEGAAAFNQPIGSWDTSKVTIMGYMFYGAAAFYQDITGWSDAAGFAAMFTGATAWLDRV
FT                   ERVDGSASIDGPISEWVHKPCLADERVQSGWCVPCGGMFSNAAGDDPAAGVDTVCDGDN
FT                   QGLKDAVDACLLYGPDPNGEACCSTDPNCTDPSLARCGSAGCVDMPDWDVSRVTDMNSL
FT                   FNGKASFNQPIGTWDTSQVEHMGDMFRGAAKFNQAIGSWDTSQVTHMVNMFRDAAAFNQ
FT                   AIGSWDTSKVTSIGSMFYGAAAFNQPIGSWNTSQVTHMWYMFRGAAAFNEAIGSWDTSK
FT                   VTRMEYMFYGAAAFNQPIGSWDTSQVTHMARMFEGAAAFNQAIGSWDTSKVTNMGAMFQ
FT                   GAAAFNQAIGSWDTSKVTNMRYMFYGAAAFNQPIGSWDTSQVTHMARMFEGAAAFNQAI
FT                   GSWDTSKVTSMESMFDGAAAFYQDISGWSEALLETSTAMFTGASAWLDRVKHVDGLNNL
FT                   GGPISKWVHKPCLADERVQSGWCVPCEQDHLNAAGDDPAAGVDTECNKTSCCQAKMIRF
FT                   GFIPKRE"
FT   CDS_pept        join(98138..98920,99011..99580)
FT                   /codon_start=1
FT                   /gene_family="HOG000214943" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631064"
FT                   /orf_name="MICPUN_80958"
FT                   /product="Predicted protein"
FT                   /biological_process="heme a biosynthetic process "
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO62475.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="GO:0006784"
FT                   /db_xref="HOGENOM:HBG628966"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniParc:UPI000199AF79"
FT                   /db_xref="UniProtKB/TrEMBL:C1E596"
FT                   /transl_table=1
FT                   /translation="MIPRRVDPIAGAGHAAWRAYAASTAKASTAAPSSAALATAARRAF
FT                   SSAATTASSVPPVATHPLVNGGPAAERALGWWLAGGCAWVYSMVVLGGVTRLTRSGLSM
FT                   TDWKFVEKPPLTAEDWDAEFAKYKESPEYKKTNTWMTVDDFKFIYWMEWGHRQWGRALG
FT                   GYFVLPLAYFAAKGWVTRSLATRLATFFGLGAAQGAIGWWMVKSGLVEDADNPSNAPRV
FT                   SPYRLATHLTGAFTIYVAMLWTTLDVMYPTPPVVRRAAERARAAAHPLAALVGVTALSG
FT                   AYVAGMDAGRAYNTFPLMDGKWTPDEYWSMWESRGWRNFFENTAAVQFDHRALALTTLA
FT                   AVTFVWGAHRFNGHLPAAATALLDATALVTFAQVGLGISALLNHVPVSLGSLHQANALN
FT                   LFTVVVGLMHVLRRPRAGGLPAPAFSDAMRVASTAAKTATKPGVKVKVKRK"
FT   CDS_pept        100611..101288
FT                   /codon_start=1
FT                   /gene_family="HOG000263862" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631065"
FT                   /orf_name="MICPUN_80817"
FT                   /product="Predicted protein"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO62476.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000199B023"
FT                   /db_xref="UniProtKB/TrEMBL:C1E597"
FT                   /transl_table=1
FT                   /translation="MGNVTGRIAADLGIPGKSWPTPRTTESEFAALTRSDGNLDRATFG
FT                   AGCYWGTESFFANNFETKRPGCVRATSVGFMGPEPPREGEFPTYKEVCTGRTGHVEVVQ
FT                   IVYDTTKCSYEELNEHLYTFHDPTTKNRQGNDHGPQYASVVFAHDESQRKTAEKVKAKV
FT                   QRALDAGEITDYAGAKVHTAVEDATVFFPAHEDHQRYLEKRPGGYCNHRRRFSWEGVKL
FT                   GRM"
FT   CDS_pept        complement(101329..102873)
FT                   /codon_start=1
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631066"
FT                   /orf_name="MICPUN_81102"
FT                   /product="NADP dependent malic enzyme, cytosolic "
FT                   /function="NAD or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62855.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B024"
FT                   /db_xref="UniProtKB/TrEMBL:C1E598"
FT                   /transl_table=1
FT                   /translation="MSATLSALNGFRAASRAIDKYVFLRQLQHEDAGVFYRLLVNNAME
FT                   IMPYVYTPTVGEACQTYHTLPIAQQGVYITADDKGRVGEALRSRAPPSLANDLKVAVVT
FT                   DGERILGLGDLGAGGMGIAEGKILLYSVCAGIRPNQCLPVCIDVGTDNKSLLEDPMYKG
FT                   LRRERLRGREYDEVVEEFMSEMRSWQPRCLVQFEDFGNTNAFRILERYRHRQPCFNDDI
FT                   QGTACIALAGVLSGLRTTGADLTEQRILFYGAGEAGVGIGELIAMALEKRGMSHHDAIN
FT                   RCYFMDSKGLVCKQRLDAPQTPKHALQPHKVAFAHDVPYEPDLLSAIDAIKPTVLIGVS
FT                   TIHGAFDERVVRKMAAINPRPVIMPLSNPTSKAECTFEQAVTWTEGRVVFASGSPFPAM
FT                   TYRGKTLHPAQANNAYVFPALGHAAVLAGAREVSDDAFLAAAEALSAMTTEAELAAGKL
FT                   FPDFDSIREVSHDLTARVCELMERDGQGVKPAGVTDWKKYVDSQFWEPEPETPSKL"
FT   CDS_pept        104130..105107
FT                   /codon_start=1
FT                   /gene_family="HOG000215910" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631067"
FT                   /gene_name="ATPC"
FT                   /orf_name="MICPUN_104789"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO62477.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG586593"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI000199B025"
FT                   /db_xref="UniProtKB/TrEMBL:C1E599"
FT                   /transl_table=1
FT                   /translation="MNASGKEMRDRISSVNGTRKITEAMKLVAAAKVRRAQDAVINARP
FT                   FSESLVKVLFAINTRLAGEDVDVPLCNVRPVKTVLLLVCTGDRGLCGGYNSFIIRKTEA
FT                   RVAELEAMGVKCKLVCIGKKGGVYFKRRPQYDVVKRFDMGQSPTTDEAQAIADEVYSEF
FT                   VGEEVDKVELVYSRFVSLISAEPSIQTLLPMSKEGEICDVNGKCIDAKEDIMFTLTSED
FT                   GKFAVKGTPVETEVAGFEGVMQFEQDPNQILDALLPLYMNSQILRALQEALASELAARM
FT                   NAMSTASDNAKDLSKRLTLEYNRVRQAKVTSEIIELVAGAAAAA"
FT   CDS_pept        complement(105440..106768)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631068"
FT                   /orf_name="MICPUN_57524"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62856.1"
FT                   /db_xref="HOGENOM:HBG622036"
FT                   /db_xref="UniParc:UPI000199B026"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A0"
FT                   /transl_table=1
FT                   /translation="MSALQEHLAEFMSQPYALPTAAMALFLLELVITLVAPNFGRLFLP
FT                   RYGRRHRAMGAVYIAVLIVGLTDIAARVSSGSDDGERAGSGAGGAWFHALGFPMNRPGR
FT                   VAFDVLLGVAGTTLTLTAAYDFKHAHEEDRVRNKASGPLDPDQTVTFEEMLEHSFYQAL
FT                   NLCQVAFLHLVARVDERDRALGRRHMSLGSLAPRLTLLSAVTVPWVFRGAFPTNRFSDN
FT                   YDAKKGRDPWGVTSVLYRMKKYQYVFYKHFMLHGLNVGVAIDGFDGLRKPRTGGTPIGR
FT                   ISLVNATPFRLYWLGLNAAYVMEFFLQTLVKRNYITQGRMLRMNQFLMLVSTTAALAVL
FT                   RHCSVPGSIVSLIVNFTRLSGECGGVALAAAAAVAWRMAPGSPEYGYGGFGAGYDAVED
FT                   GHALVWCLALAAVALTPLERRARTYISRRFGARRAHPAKAKVA"
FT   CDS_pept        join(107160..107745,107886..109054)
FT                   /codon_start=1
FT                   /gene_family="HOG000271512" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631069"
FT                   /orf_name="MICPUN_81136"
FT                   /product="Aldehyde dehydrogenase"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62478.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000199B027"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A1"
FT                   /transl_table=1
FT                   /translation="MSRIGHLILFSFVYAIYRLITHEWVPQVDVELTKEEKAGLPGKRW
FT                   KPGTPFPKDFIPCYDPGTLEMLGPDMPADTADQVRVKIERARIAQKKWAKSSFKQRRLL
FT                   IKTIQRFVLENQDTICKVSARDSGKPLVDAAFGEVIVTLEKCKWLIKEGEKWLKPEKRS
FT                   SGLMMFYKNARVEYHPVGVMGAIVPWNYPFHNVFNPLLANVFAGNALVVKVSEYASWSS
FT                   LYYGRAIKACLAAVGAPEDLVQIVHGYGEAGNALVTGGTDKVVFVGSTGVGRAVMKAAA
FT                   DTLTPVVLELGGKDPFIVLEDASLSQCVPMALRGAFQSCGQNCAGAERFYVHEKIHDEF
FT                   VKRVMKAANQLRQGWALSPGVDCGAMCMPNQAAYVQSLVDDAVAKGAVVECGGAIDKDA
FT                   PGQFYPPTVLTNVTHAMKIMKEEVFGPVLSIVKIRSDDEAVALANECDFGLGSNVFGSR
FT                   RRALKVGAQLNAGMTTINDFCATYMAQSLPFGGVKESGFDRFAGIEGLRGCCNVKSVVV
FT                   DGIPGIRTDIPPPLQYPVQHCAFPFCKALCHMFFGLNILENARGLFMLVSAMMIPTPKV
FT                   LLKGGKTD"
FT   CDS_pept        <110699..>111016
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631070"
FT                   /orf_name="MICPUN_73241"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62479.1"
FT                   /db_xref="UniParc:UPI000199B028"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A2"
FT                   /transl_table=1
FT                   /translation="GNAPQVMHADDLARVAPTWADLVEFGEDNAVIKKVFGWVRDMYAF
FT                   DFALASVGIEVHYPPVPFNKLMVQPPADVRLGAASFMHYTWSPILSDKTGATRWRFDKR
FT                   QF"
FT   CDS_pept        join(111794..111857,112118..112653)
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631071"
FT                   /orf_name="MICPUN_108032"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62480.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B029"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A3"
FT                   /transl_table=1
FT                   /translation="MEAAAEDGAAVSGEEGVKLYVGNLSWGVTNDSLADVFNQYGASDV
FT                   TVVTDMNTGRSRGFGFVTVPDQAVADACIAALDGADVDGRAIRVNVSVAREDRPPRPDR
FT                   PPRDGQRRGYDFDGRKVYFGNLSWGMDHLDLQDLCGEFGTVEDARLITDRETNRSRGFG
FT                   FVTMSTVAEAEEVVNQLNGQDVDGRVLRVNIANVDK"
FT   CDS_pept        113002..113958
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631072"
FT                   /orf_name="MICPUN_57528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62481.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B02A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A4"
FT                   /transl_table=1
FT                   /translation="MGTNGANFAWTPSVSMLSIERVAGDEVGCSTPRRESTDAGGDLAA
FT                   TILGRLCLDLPDVFAGEVLRRLSACDRTMLAWTCGCVRRAVLASKLPRCGVVNHSRRER
FT                   DVEPRDIVGSRNHGTEPPSGRRRADESRVMKFDERDLLNTPRRVRWAHELGMRLHWKLC
FT                   ESASSRGRLDVLKELRALRCPWNWRSCAAAAKGGHLATLEWLKDNGCPFPWDVLVAFAA
FT                   EGGHREVVVWCRERGCPWDCETSASAAQGGHLELLKWLHASGCPWDGETTMWAARAGRR
FT                   DIFEWAKEAGCPGHAWSELVFREEPGHFLASPTTGST"
FT   CDS_pept        join(complement(118457..118635),complement(117679..118266),
FT                   complement(117369..117502),complement(114146..117216))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631073"
FT                   /orf_name="MICPUN_99850"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor complex "
FT                   /protein_id="ACO62857.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005667"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="UniParc:UPI000199B02B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A5"
FT                   /transl_table=1
FT                   /translation="MAGQPKPKPAGPASGRGARAAAPVVVEEDMSKLVPCPIITAHPNG
FT                   FVERTEPERETHEVRAYKLGKKKRSYNQVELTFDRATAGSWANAAEGAPNGDVLGIYEA
FT                   TERGFSLDVPENVRDSALEYELRLYNGTSVRALIYLVYAEPLSRGSASSGSKSSKGLTA
FT                   NGSAALTDKNGNTWLPVTRSRCAKGCQGPILSAIQRFGKQGRTQKGAPGASAPDAATAN
FT                   DRDKWKDARNLFISIDEASNHVQAFGPNKCKIFRLLFGIFSATSDEFLGSGVSGPIRVL
FT                   ANNDVPKGAACLRIRSSLADTWSGWKNPVVLDADDVPVAPSEDAFARANPMAARGAQVA
FT                   PPTSYGAKRGSSYRIDVRSPKRIRHPPHSQHHSQPRGAEAFPRPPVELAQFPHDLSHNA
FT                   LETFFKEAIGVQGGTPDGADKNGFDASIFHTPLNELGASHLFANPRGASALPITGQDLP
FT                   PVCTPGGDSALKKMAAAADAGLIPPPTVNNAGVGKFTPAQAALLLNSGGAPNSLGSLGS
FT                   LGSLGSAFKDAKSPRSVHAKTRSVTGAARKMKERAETDAERNARAEDETAAVEAAAAAA
FT                   ASPVAVAPAVGYDPKSAAAAAGGGSKNPTLSPHSWLLSVLGSGSRDGAMRTAIANAVQQ
FT                   SEMKAANPDAFLANAGGSPFTVARDRGPNTVMNNNAATRTGAQSVATHAQQTADAAAMP
FT                   PPAIPTLAHTVGGGVVGGAQAAEDFALSRGALLGSPAGLAPTRLLFSPVTNAKDRAIRA
FT                   LADESDDEDGVAMGHANPFTGTGVKAFKSSKKGVKDSLPAEAWMSPSKSAAVAAANQGP
FT                   TYVRKDHSLASITDRIVAEFDEANVENNVSAVQTEGGGSTAQWAGNVAVDSLAERLGVK
FT                   RRRLYDVMNVLEAVGVTERISKGACKWHGATRVANVLGKLLEEAPAVIAAAEQEDANTS
FT                   GDASSLKALACRLMQHVGSTPKHVPIAFDACVATMRLGGVPAPDAPGAHGTGALAGAAR
FT                   RLHDVASILIRIGVLEFVEREGKAKGRGELRWLGATSVTKRLAEGAAGAAVEKGYGTGA
FT                   QQAALERAAAAAAASQHKSVLGQVPLDKKWDAANAQAAAANNANAAKAASRLSSFFQRA
FT                   GPGGAPAPVPIPAVNFGELDGRASKKSRKGGQSVKFRQDVAGANSLFSPPMHAPPVNPR
FT                   DTAAAAAALLRSPEWIAGLAQAASAPSPAAPIGGAAVGGASWASPAFVAPLQALYSFYS
FT                   GAIGPKTIGGDRRASGASEGDLEGSVSLSGLSGLSPTLFGTSPAEVEATLHREVMQAAA
FT                   QAAVQAAMAGVNPPDSVVREKMDGARATRAAATRETAGR"
FT   CDS_pept        join(complement(119855..>120600),
FT                   complement(<119478..119752))
FT                   /codon_start=1
FT                   /gene_family="HOG000109570" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631074"
FT                   /orf_name="MICPUN_69157"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62858.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniParc:UPI000199B02C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A6"
FT                   /transl_table=1
FT                   /translation="TVAVDADTLILGIETSCDDTGAAVVTGDGRVLGEAKTSQDAIHAP
FT                   WGGVVPNLAQEAHKAAIDDVVTTALRNAGVDASRLDAVAVTVGPGLSMCLRVGVVAAQD
FT                   LSAAHKIPIVPVHHMEAHGLVARLAGGTELVRFPFLALLVSGGHNQLILTRGVGDHVIL
FT                   GSTLDDALGEAYDKTARLLGLDVGGGGGPALERLAREGNPRAYAFPVPLRKKKNCDFSY
FT                   AGLKTAARLAVERDLGVPDGDAAFTTIDKAKRKIRADIAASFQAAAVKHLEERTRRAVG
FT                   WANDALAEESGDARTLSCVVVAGGVAANESVRESLARVAAEVGLPLVTPPPRWCTDNGV
FT                   "
FT   CDS_pept        join(complement(121952..122887),complement(121665..121877),
FT                   complement(121030..121587))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631075"
FT                   /orf_name="MICPUN_57531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62859.1"
FT                   /db_xref="UniParc:UPI000199B02D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A7"
FT                   /transl_table=1
FT                   /translation="MAQRAARLKRERAAASREEARAMKRARLDWADLPSEILVLVMQRI
FT                   AELPADDAEDPSRETHRLGAVPTVPRVASVCRGWRHAVASDPRALWRVVDLSYGWARPS
FT                   DAIVRRYCANGDWARLTSLSLADCAVLTDASLRALHQHCPELVSLDVSGTSKMTLAGMK
FT                   PLGERLTELTLDRVKQRSMGATNQLVSGMLTDKLARLSVADVTGLDRGFIRNLHKCCGL
FT                   ALRHLNLSHSGMHHQNLPWLELQRSCPNIETLFLNGFGGASGWSTVPNAQGAAFAGDVP
FT                   GWQNLKTLHVGAATRTHSTGHSLTPSYVDAFVLDALTRNANVEDLDVTGCAISAVHLWG
FT                   IPSLWLGALRCLRAAKTGFASDEGIEFLAAVDRPWASSLARSLETVELGTSHMNANDVS
FT                   DRGLDVLSTNLTNLRALGVAGADITDRALERLVDARHKTLRVVDVLGCRGLSRAARQAA
FT                   HGGEPLQIRAAIRKERGETVSDEDDDDKKEEEHLVPRRRAAARAVDRFEEILDSDDDAN
FT                   ENWIDEDENEDEEEEENEEEEYDEEEDAIPASPAAAAAPHTGALKIVMRRR"
FT   CDS_pept        complement(122946..123122)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631076"
FT                   /orf_name="MICPUN_57532"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62860.1"
FT                   /db_xref="UniParc:UPI000199B02E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A8"
FT                   /transl_table=1
FT                   /translation="MSARQPRPPPGAIKTGPVAAACAFAAIYYVYGITNHTAPHDVERK
FT                   RHSEKVPFWKRSN"
FT   CDS_pept        123247..124188
FT                   /codon_start=1
FT                   /gene_family="HOG000012385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631077"
FT                   /orf_name="MICPUN_108033"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62482.1"
FT                   /db_xref="HOGENOM:HBG560845"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199B02F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5A9"
FT                   /transl_table=1
FT                   /translation="MAATLAPGAARAAPSARPTPARALKPRASSSGNAHARLGRVDVRA
FT                   RATSTTDASQASVSAAKRALYDAVEGTYRGAGASASERAAVEEAQVALETLDVAGAADI
FT                   DLELLSGKWRLVYTTAADVLSVLRIQRDLGPLSPVEVGDIFQSFTADGRIENEIRLSVP
FT                   FLLAPATMGTDGGVALKVDADYAKCGARTLSLTFQEARVTEVRISDLAETLIAPALLPR
FT                   GSINHQILLAIKELELRFPLRGAVTAMGGPATGGPARGGDDGGGGSRARSGGAAVGAYL
FT                   LSYLDETTLIGRASGSGGTFVFERASGGPQRS"
FT   CDS_pept        join(124938..125054,125195..129793)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631078"
FT                   /orf_name="MICPUN_99853"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62483.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199B0EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B0"
FT                   /transl_table=1
FT                   /translation="MAKEEEDRDPQYEEGDPSGSGGGSGGSGGEGGGSGGDKEASDGDD
FT                   SNGMDQERENSATRYSGSHREGHDDHGRGSRGASPDEIGQDARSTKKDPSEGDDEELGV
FT                   DEEMVDVDGVDGSDEGSDAMHKETPVNRADQPNANAPPRFDFHDFPRKTNQADVANAAV
FT                   TAEVRESRRTHAAAIRAHAEVTASASAAGGGDKTSSKPAHALTGSAQTTQGEGRMSEAH
FT                   KTDTTDKKTADKKTSVKVEDGFAVPPPPSSTVRGAGGLPVMPPPHAPQEPVRVSGHPRV
FT                   FGAAHRSIFLAGGGVVGHNIPMRHAGKGPPTPAASAGGNNKAALEHYIRSGKQVESVLG
FT                   ARPSPSSLASLTCGFEYLVKWQKQSHVHCTWIEEDLLDQLAPAALGEYLLQHGRGPLML
FT                   MDQNWTRPQRVVAVHQRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSNGGSGGGVPD
FT                   AGPGRGGQGAALATGRPGSATDSGDGARVPSPDARGPGSDGPGSGGSGDGGTGGGGGGG
FT                   GTNSGSGGSDSGSDPKTRVLVKWWGLPYDACTWEHVEVHPDLPDMLHRYREWSANSLAA
FT                   SKDLTENGSTAAARAIAAAKKHNQKRAGSGFGGSGSGSGFGEGSGGGSGDGSGKGSAQG
FT                   VNSGSGEGSDGGEGDGAKKDSGSGSGNKDGSSGSDTDDKGVGEKTSDRGSGDNREPMDL
FT                   DSGHGKTGQNGPPDGELDVAVANQRRRHRHGTTASSADPAVRWLIAAWMHREGVVMTIP
FT                   AAPFEPPSLLASLTAAAREDVDRPGMLARRRAAAIGMLAAQHTDFGARNAPALVIVPAV
FT                   VISEWTADFQRYAPELNVVEYCGSAVSRQVVQEHEWSHRRAVRLRRPSFNKGSIGKPKE
FT                   MTPVSASGGSGEGGNGNSGSGDATNTAQMTAQGGRARELRVLGSGSGSGSGDHAATGAG
FT                   PGGSGGSGSGNGSDGAKEPTGSGSGGELGGSANGAAGGSGSGGVGKGGSNRDASPSGAG
FT                   NGSGNGSGNGSGNASEEGKRTGSGSGNDPNVMVDGRNTSGGGGSGGGGSDPSSTAAAAA
FT                   AAVAAARRPKFHVLIATHDAASQDLLLLRQVAWETLILVEDVDSHRSVTMSMLPRVGTL
FT                   QSANRVLMLNGPIPRTIGETLTIMDFIKQSPEGMMALERHLLGLEDAMALQEATSILEQ
FT                   VTLDLTLVLKREPKHAPEEAKHAAPDAAEVPPRLAGFDVRAAAAANLGSNVQPMVRGIN
FT                   VPPFIAATTPSGHAAAHGLKRQGSGVEDARPTKRPGVSHAPPVAPPPVGVNVNVGFPNP
FT                   LAGFAGLNIPPGFPPPVPEAQARNVSDEGIQRAAQVASAAAAQAAAAGAPPQMQIIQAL
FT                   MTTMHQDPAAATAMIQRMQQMMLPVAAHHGVSPEQLAHAQGALLQQMFHNATQAGLPSN
FT                   PFAAFPEMPPAAGLAQNPMAAAMAAAAVAAAAATTAHRAPPPAAEPPAQQGARKPAEAE
FT                   EEPPKIVKATKGKRTRAAARGSAVKKAKKPSKESKSTSPDRSDDGIGGGGSGEDGSGSG
FT                   GRGGRGASNSGGSGGSGGGSGQGPGGSGGSGGSGGSGRSKTAGKTTRKRRS"
FT   CDS_pept        complement(129980..133267)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631079"
FT                   /orf_name="MICPUN_57535"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO62861.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B0EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B1"
FT                   /transl_table=1
FT                   /translation="MNAPVLNMFNNPILHSMANIIRDYDDIREDRRQRRRPRISFRPEL
FT                   EDDADVEANAPKTEIMRLWKAKRWKELREALGAKAMIAGAAMVQIGHDPKTAKQKQKEK
FT                   ETAIGTERHKARAEVAKCIRKRLASMLYDFARTFAEMDGLDCPTEDEYDHDKDHHTLLR
FT                   YMTPDVVKFTLDDTGPWRWPMEHIKGFFSRNYDKFPPRLDRDLHRRLGLSNEPLPWVSV
FT                   IKLLCDDICSFNECCQVGADRIAFATKQNTPNTPRTIFEERQRDEAIRRFIAKHRRGEI
FT                   ANPAPVRNQHDVGLPKHHVDLIYDCIERATIARYDCWKLAHDFVENDFARGAAGREGGP
FT                   CHVSAKDLYYVLGSCRDVPADIIHAMISVAPQHALKYRDFSSKRNLLHVAACSRRDPVK
FT                   SDSDRIGAFIKHRLQIDIIKRLIDLRPVLLNEEDVNGLTPLARLILFDKSGHNPDKKDH
FT                   ARGDFATLVKMMCEGGTKTCAGKARSKDAKELPLHLAASCQVHPSVLADIIEAFPEGID
FT                   KPCRNGYNAVFHCLSTMDPRPSKNAIQNLHTLIKAKPELARTGRVLTGVPGGPPIPPEA
FT                   GRTPLQFCIEHGLDDGVVAALLDADKDCAKDKNSQGNLPLHQALRVVAHDVREIGRVRK
FT                   ILRAYPGAIEQPGQFGWLPLHFALASNCHAETVRLVLRAHPDAARKLVIDADGGTGGMQ
FT                   LNDPSEAITALHLAVERGDAGLVKDIVAAAPAMATHLNAEVGLPLHHAVHCKAPLPVIK
FT                   ETVAAFPEGTRVANADGRIPLHLAAGGSSGSSAYATLKFLVESYPDSVHVLDHNGKSAA
FT                   DLLGNSEAARLLIQGISEWQAERAARRAEQTANRMADVAARADAHRGAPAAPNAANPNA
FT                   APANPIQPGGMDTISLLSRVHQGSAADLQPHELDRLVDGLRMALGDAKYEQTRRPLEDD
FT                   IVDDKEDWMCPIGHCLLRDPVKASDGFTYERRKIARWMRKSRNESGGDGSTRGGRREAK
FT                   WKSPMTGAYFKDFTVEPNDEMRTSIEAEVKRRVDDARRNARATDDSDAEEDAEEDVAAD
FT                   SVVAGVTVPRKGKTKRGASGGAKQTPAKRTRRLNANAAVGETPRRLR"
FT   CDS_pept        133730..134449
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631080"
FT                   /orf_name="MICPUN_57536"
FT                   /product="Predicted protein"
FT                   /biological_process="apoptosis"
FT                   /protein_id="ACO62484.1"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199B0ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B2"
FT                   /transl_table=1
FT                   /translation="MAAQWQLKVAVESLRPQDVVEIGVTPETTWEEAKLAACQVAYAEP
FT                   VDVATRRLLFRGRERSPTATLGRDGVRPGHKLMLVESDESKRERARAAQEAQMEQIRAE
FT                   RQRHHASSVHRDGVGGTVGDGGAVGDGARLAERCRAEVDTAVRAADALERELGELERAT
FT                   ERAVQGGVASAMGAAVPKDVAFLHLGDRLEKALISLDGVDTGGEDDLRALRKGAVRRIQ
FT                   ALMERGDAARARAAGAR"
FT   CDS_pept        join(134668..134737,134862..135538)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631081"
FT                   /orf_name="MICPUN_57537"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62485.1"
FT                   /db_xref="UniParc:UPI000199B0EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B3"
FT                   /transl_table=1
FT                   /translation="MSSLAQQIYAGLGAPHRTLARPRATRGLRVVNMAGQKDGMGGPRN
FT                   RTGRTHDPYSTPLRDANRDRLYGMLTARAAATLLTYLTELNKTTAQFFQEYMAKNPIPY
FT                   AYWESGKVKDVSGETFIQGLLTMGPRHIDEKYRQSYITVDPPALAVRLLDIRLALRDEF
FT                   VADLAWVKEENADIMKVACMSNLESSASLDCDIDFDNMDEDDNFGGIPEEEYIPSGSSV
FT                   DRDDGPSWSYESMRGREIQGEGVDVD"
FT   CDS_pept        135660..136331
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631082"
FT                   /orf_name="MICPUN_113313"
FT                   /product="Predicted protein"
FT                   /function="cyclic-nucleotide phosphodiesterase activity "
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62486.1"
FT                   /db_xref="GO:0004112"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniParc:UPI000199B0EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B4"
FT                   /transl_table=1
FT                   /translation="MTSIWSIWLEPPPGGALEQRSCEFIKAQSARLKPHGASGPFAPHV
FT                   TLVGGFECSLEEARKRTVQLAADLARIPVAPFVDVTKGERFHQCVYMRVEPNDQLATAH
FT                   AIAAEAFGVKAGNGGGSPYMPHLSLVYGDVPESEKDACVAEAAAQLCGDVDVMGGWEAT
FT                   NISLWRTDVSDATCESWERVELVPLRKCSLVKWARFYEDYIKRTQSPDGSPRDSPRSAE
FT                   G"
FT   CDS_pept        join(complement(138868..139601),complement(136427..138554))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631083"
FT                   /orf_name="MICPUN_57539"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62862.1"
FT                   /db_xref="UniParc:UPI000199B0F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B5"
FT                   /transl_table=1
FT                   /translation="MGFATKTAQMQAEIDELTEQVEEARAKNKQMQKQMIAMEGEVAEA
FT                   QDKLELAREENAQLQGEKSALTDAVKSLNKEVSKLKNFKMNLMATLKDDDQNEFTNDAS
FT                   GDRLVSSVLQSAKPTASPRQGSILSERTGAYGNTPSASPARFTNGGSHSSTVTSPSVGG
FT                   HGSPPVGINGAGGKVDGKEFFRQARARLSYEKFSQFLSNIKELNAHKQTRQETLARASE
FT                   IFGDANADLYATFETLLVKHLPKYQSTLKLYFFDDCVTYRSEINEVGFPRQCDLPIKPR
FT                   QKRRLGESSATLSEGSASSATAEGRAKMQRQAISLGVVAPVVLARRRVAATPAATSSRA
FT                   PPADQKSHFLGRRPSHGASAPPRGPPSLRAVADAAPARAPRGRGRGGKGGRGGGGGGGG
FT                   SGGSSADVSTSARIQGELTGARDPRDILAIVDADGDAFDPIHTATAIHRIATHTKGDAT
FT                   RESVTSSPSFAALMDLVRANLGGMNAQGLANVAWACARLDHSPGADLLDDITAGLEREL
FT                   TAKPPATKGGRAAKAREVKPQAVSNMVWALGSLRHRPSDECLASIFSAVAPRLRDFRAQ
FT                   ELTNVVLGAAHMEYVPGDAFNASVFDAVATNVQSFEGQETSNLLWALARVGARAPDELV
FT                   STLLEQSAAQNLGGMASALNLSQCLWACAKMGVAPPETYVKAVDAELPRCAARLTTESV
FT                   DCILWALATMGAPLGADAMDALTNSAARLADRMDAEMLVKTHWALARLRHRPAPGDMQQ
FT                   IVSAARRLVDELPADDRLTVMHAWGVLRTNPGDDVIRAYTADFRGEGEGEDAPAGARES
FT                   ELDGDQAAKLLCAYGRTRHQPPGAHAAALANRLVEEAAEGSLHPGAAVLGLWGASLLDM
FT                   RMSTKQLDILARNAISQDKKLAPRSLAKIVWALAALGYDPTPKDLAALKDRSAHAMPRL
FT                   MAKDQEALREALARLGDVQITRA"
FT   CDS_pept        join(140601..140636,141065..141595)
FT                   /codon_start=1
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631084"
FT                   /orf_name="MICPUN_57540"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62487.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI000199B0F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B6"
FT                   /transl_table=1
FT                   /translation="MTAFIIHCDASCYRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTR
FT                   AKSKFWYFLSRLKKVKKANGQILACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYR
FT                   EVSMNKAVDALYEEMASRHRVRAPCLQIIKIAQVADADVKRDNTIQFLGVKEPVSFPVV
FT                   NKVLRHDSKSQKTTFKYKRPNFSAV"
FT   CDS_pept        join(complement(144382..144435),complement(144131..144213),
FT                   complement(141891..143994))
FT                   /codon_start=1
FT                   /gene_family="HOG000176712" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631085"
FT                   /orf_name="MICPUN_106836"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="ACO62863.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG622322"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniParc:UPI000199B0F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B7"
FT                   /transl_table=1
FT                   /translation="MMGDRKIINLEDGWDFMQKGITKLRAILEDGGQEPFTPEEYINLY
FT                   TTIYNMCTQKPPHDFSQQLYERYREAFNAYITSDVLPALREKQGEYMLKELVKRWDNHK
FT                   IMVRWLSRFFNYLDRYYIQRHNLAQLKDVGMLCFRDLVYSELKKNVKDAVLALVDKERD
FT                   GEQIDRALVKNILGIFVEMGMGGMEAYEQDFEAHLLTNTAAFYSRKASVWIDEDSCPDY
FT                   LVKAEECLRREKERVGHYLHASSETKLLKEVEKEVLAAYETQLLEKEHSGCAVLLRDDK
FT                   TEDLARMFRLFKRIPAGLPPVADIFKKHVEKEGVTLVKQAEDAEGAKKEAPKDKAAAAQ
FT                   GTEQVFVRSIIQLHDKYLQYVVDCFSNDSLFHRALKEAFEVFCNKVVTGSTSAELLALF
FT                   CDKLLQKGSSEKLSDEEVEMTLEKVVKLLAYISDKDLFGEFYRKKLSRRLLFDRSANDD
FT                   HERSILTKLKTQCGAQFTSKMEGMVTDLQIAKDNQKEFEKWLDDDETRKPKMEFAVTVL
FT                   TTGFWPTYKFTELALPEECVGCVTTFKEFYDKKLQHRKLTWIYGLGQVTMKGNFASKPI
FT                   ELNINLFQAAILLLFNEQETLKYTEIRERLGLPDEDMARNLHSLSCAKYKVLLKEPENK
FT                   SINQDDVFTYNEKFTDRMRRIKIPLPQIDDKKKVEADVDKDRRYAIDAAIVRTMKSRKV
FT                   LPHQQLVLEVVQQLTKMFKPDFKIIKKRIEDLISRDYLERDKDNPNVFKYMA"
FT   CDS_pept        join(complement(145408..145500),complement(144802..145221))
FT                   /codon_start=1
FT                   /gene_family="HOG000265001" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631086"
FT                   /orf_name="MICPUN_93885"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62864.1"
FT                   /db_xref="HOGENOM:HBG593555"
FT                   /db_xref="UniParc:UPI000199B0F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B8"
FT                   /transl_table=1
FT                   /translation="METSLRFDSGNKHLKLFAKEKFCNDDNYVLTVSGSLDTRDGRVES
FT                   RAYVRKKFFPSSVLSRVDMGLSYATTQDDVKYGVAGKKTFELDHDGLLTLDVKGGCMVG
FT                   SKGFSRPDVAGSVELTKKIFNFVEDQDLKLRLGYDLCERGFYGQIRENNWTFNTNFRDK
FT                   WDVKYDL"
FT   CDS_pept        145631..148303
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631087"
FT                   /orf_name="MICPUN_57543"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62488.1"
FT                   /db_xref="UniParc:UPI000199B0F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5B9"
FT                   /transl_table=1
FT                   /translation="MAPWRPASAASPYRHAVSPARSHVSTESSDPYRLSESATRTSNDA
FT                   YGDYHEIEKIMRRERQENDRMQAQKAELKEAERRAFVAERRAEAAERAAAERAREADAE
FT                   VAVAEEVATQAVVANRDARRALEAARAEVEGYRQTLSEMGTPPASPLSARSIRASPHAS
FT                   PHRPDDAAIPHQPASPVQPAKIAELVNALAQADAKAERHRVIADGLRVDLDAAAAALDV
FT                   ERGARLAAETQLAAHEQKRMDAIERLLRRAKDGAALRSDVATPTRASRDIIAGALTPND
FT                   SHDVASAAAAAPAAPALTRAEEDLVALEREHAIELDHLRKQLMKSKAETDATRRALDAA
FT                   RAAEEAAVLERDAAAMAGAVAERDLALLERGRVGREGRRALRRVLEELDAIERRSAGIY
FT                   KVAASAIDLNRRMCEAIEAMPVRSGRWLGNGSSDDDEDANEGDPVGFAAVDEGVERTWR
FT                   VGRDVLQEAWHHTRGEMRTLRREARTLGAQLERAALAEVRAVATASMYRSHDSRLSSDF
FT                   DKGFAVGNRLAAIEVNRRDGRSGPDSARSSWESRTFAPATTKTRSRPETAARRSNEVRT
FT                   SEEVRRSAEVRRSVSRDRLHSRASSARSSAATSIALESHRRGRTTTHRPGSSRTAARSP
FT                   SASPARMGSVRSSAVGSIASAGFQSQSQSPSSFGGAGATRRSRSVPRGGGAMSSSADRS
FT                   GRSPAAKRRVFPESPGRSVGRARSASAGRTVPIASPVAAYIRGEAPANARPEPRRRGLT
FT                   AGDYSDASRSKSPGSGKERLKNVILRRGPAGEPRPRDGKTPSQRLAEIQAQRRIPAPSK
FT                   GKTGRGLATSARPSSAPGTRDSSESRFAKSPARSPAKYLRKGGAYEVASRYKSPKGKVD
FT                   LMPAHRHRSPRKPQGRYAL"
FT   CDS_pept        join(complement(149391..149492),complement(148983..149261),
FT                   complement(148458..148931))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631088"
FT                   /orf_name="MICPUN_57544"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62865.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B1A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C0"
FT                   /transl_table=1
FT                   /translation="MKSSARKIEIGRLAVTTTIYLSVHRQELDKYEIRRANSKSSAPIS
FT                   ATMLGTMTTPTTYRVSRGHTCATRSAGGRTTTTAPRNASRNHFRRSVKTGASTGLYDDE
FT                   TFAASVLGKYPQSHEPADTEEARVDFEGKVPDPPRPGSSVGDRVLAVPLVHASRVYDSV
FT                   AGKKVYKQEPFDADLFVNAVLERCGGGADIDANGAKLLVMDADGGTRAARAARLLNERG
FT                   FTHVVTVKGGAAAWKAAWDNQMRRRQLPGSFSRGFDSAMFAECNVTAETFGGAGDDTAW
FT                   VLD"
FT   CDS_pept        join(149681..150724,150775..150816)
FT                   /codon_start=1
FT                   /gene_family="HOG000100057" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631089"
FT                   /orf_name="MICPUN_57545"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62489.1"
FT                   /db_xref="HOGENOM:HBG560921"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="UniParc:UPI000199B1AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C1"
FT                   /transl_table=1
FT                   /translation="MREAAGKLLQGTCGWASPHQALSIYGGKVRGSEERLRIYSRKAFA
FT                   ALEIDTTTYAIPNPERTRLWAELTPPGFTFLVKAFGVFCGSVDVGNLPKSTRAVLGVDP
FT                   ADRKRVSYSDLCEVAREDLWRRFHAALEPLSESDKLGCVVFQFHLSSFGPHRTNRAHVE
FT                   HLRAKLSPRIKMAVEFRDRAWIQGDEACRTVEWCRANDFALVGADELLHETMQPDRAQT
FT                   GLRPGEVRRAMPTLLAATCEWGAVVRVHRRHGTRERLLEDDEIRAWGRRIREVAPRLRG
FT                   PIWCLWGTDWKDAAIENAAKLAAAVGDEIAFDWIGMQKKASMQEKGGIASLFAKAQKFE
FT                   LSAEDRAADSGDVRHRAHVRS"
FT   CDS_pept        complement(150902..152836)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631090"
FT                   /orf_name="MICPUN_57546"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62866.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR022087"
FT                   /db_xref="UniParc:UPI000199B1AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C2"
FT                   /transl_table=1
FT                   /translation="MPSSPLAALEEAERRLGRLSVTPARVDGGALRCGGCGERVTGRYL
FT                   VAPNKKAFHPDCLRCELCGAECKTFASDPKRPNVLCCMGCYDDRYAERCTRCDRPLKGE
FT                   ILTALGGKHRCHVKCFTCDLCTEPIASKFVEHPPASGRIICERCHVDKVCEKCDGCGRG
FT                   MSGAFVRALGGKYHRECFRCRRCSRDVTSRYVEGPDGAPYCRGCHVKIFAPRCACGCGE
FT                   GLEGSVTSAMGRKFIEGHFKCTDCAREFRRGKFNRVRDSKDGKDERAVCEGCYQKTYAP
FT                   RCAVCAVAMASGESYVRNATSDEAMCERCDAAPGSVCDDCGFCVTKEFQTKQRRAGFRN
FT                   ETDGATRTARRASGGHAVIGQCEACAREAVNDDVVAAHLMNRVIRFCSHAGARYAPGDQ
FT                   TVAVQLVTADRLARAADKRHAGPNANGPRGVTRTKITLEGRAPPEEWKKIMLGWKLERR
FT                   GSGYELSEDNGSSPGDASCPTDRTPVKGSCDLADASPGSIQRAAQLARSHPDVSVEEKR
FT                   ILKGVVALKGMSSDALGAVLAHEYGHCYLFMRKFPLLPLAMEEGVCELFAWLWLGGGRW
FT                   DRGGVEGSNPKGDPRVAAWAERRRRQMEVRKDPVYGDGFRAALRGYEACGENLWTFLEH
FT                   LRVHESFPA"
FT   CDS_pept        complement(152919..157463)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631091"
FT                   /orf_name="MICPUN_57547"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62867.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR011124"
FT                   /db_xref="UniParc:UPI000199B1AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C3"
FT                   /transl_table=1
FT                   /translation="MSHASRFPGDGDLCIVNSQDGIWPVQARLTPRPVRSLLPATVLKK
FT                   TTSFSRPHALARSRPLLTFPPVPSISQVCMRSMHLHSKENHARPGEAFFRYLGYSDPYH
FT                   YVGAEEPCELRDIGADWRAYDWRGQLEEMRGTSTSEDQINAFVEAEKISRMDDVEIRTN
FT                   FDRWEREREISSAWQRTASPKAPPAKKRKTAAEPARDKKGKTKASTQSHAPAPWTDDKI
FT                   AALQSAVRKHRFKDEHGKWRGWTEMTQDPELSAALDPTQRNPEKLRKMVARHPELFPPN
FT                   AAAADGGGGERAKKGAKKGAKKGAKREEAKVGTDVDLPETLTSWCAGRTPRVVVVGAGP
FT                   AGLSSARALIKMGIEVTVLEGRDRIGGRVHTASLPARPEHNLPETKLDLGASFVHGCHK
FT                   YNPVYVMAKQKGAALDPGEGGYSQGWGGNANWYDTTHGGKVKPKCVQKGFQALYAVNAA
FT                   LPSVQVPKTEDEARRWIADEYADGDDASLALRAARAGLSQLEYLKRENGLTALRATAAR
FT                   EGAPPPAEPRDDVAREKWEGEHEWGSLDAQTVGEVRWATADIERDRVKFLSAKSADRRD
FT                   CSIAAATSRIYNSMFKGKLNTTEEAVYESARVLQWGYNAGLRAVSVKAKLAIEEDIQAS
FT                   KEQLKQPSKADDAEAAERAAKEAADAEAAEKEKAKKEKAKAAAAARKEKANKEKAKKEK
FT                   ADDCKSGGHDDGFGPPSDLKGGFEKTPEEIVATAPEGPMGNGNRHFTGPVWVRAIKRTH
FT                   GPKHFDAYFSLWRKVNSKKYERLEFENCGTTGEHAPGKNQKELRSKVAVRRFLERFEAT
FT                   RRKDRAKAKAKAATEKHSKAKPEPAAAAPRTPSPAAGAPEKEPDEKRSKNGPKTGVEEI
FT                   ESDDEDLDLRDGLVVGGYHDLVVATAAQDIPQACIRLSTPAASVVVRDGTGEWDANGEY
FT                   RCVVTSATGEEFLCDYVVVALPLGVLQGRARRSEVTFVPPLSPRKRSAIAALGMGTENK
FT                   VVLRFESCFWPAKARFLNCTDQRYRFINMHAYGKPNVIVAHVAPPFGEGFAGRSDTQVK
FT                   DDVIEILRKMMKLVNKPTPALLDWHVTRWAEDPWSCGAYSYMRVGSDEDDVRALGEPEH
FT                   GGKVYFAGEACSLEGAQCVHGAVLTGQLAAVSVAMRTGATPTMGHLLGGDVGLSHELPI
FT                   FEWVQCKERGCAKWRRLPAWVDPEALPDDWCCHRCDWHAGIARDGCGAPQEPAGPNDDF
FT                   GDLKWEGWSEEPAAKLDRTLKWNAWVRRNERQTCDDDDDDDAEEEEEDKKPRARRSRSP
FT                   GERVKVVMSTLRHHTVAPIEPKVETDRNVARPLTLAAVEAREWPPVGGPWREDAGWQPP
FT                   ISSRSSAAASNPAAAALSATPLFSQSSRGSSLGRSSTEILFERDRRAPLHAPLFPPLFP
FT                   PAHISAFSPLAATATSHAMATHRAAQSYEREADLANHLWMSGGGTAGGARLAPRVGKPP
FT                   PPTSTPPMPPAARERETDPLLQRVLATQRAFPWPTRTTAPDVDDEPIQLGLSG"
FT   CDS_pept        157677..166640
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631092"
FT                   /orf_name="MICPUN_57548"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62490.1"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013322"
FT                   /db_xref="UniParc:UPI000199B1AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C4"
FT                   /transl_table=1
FT                   /translation="MKAGFLGGQRRSTRATRVRVRDAPAADDDDDEDVPPPLVRDSDGS
FT                   DDDDDAASDDGPPSLVEFRGSGSDSDYSTVSGESPPPLVDDDEEFDSDADVSDPDESGD
FT                   GRARARGARVNGPGAGSAASRSSKSIERDGSYYCTWKIPGVRQGMDNPTRQQYHTQYVD
FT                   VGEMWDNLGGRWDDDTDKNNELAGLQPVQQRARLILYPSGDSASRRGWASCYLQMKQFQ
FT                   RVRTDGGDEWVEHNKGGMFFSNFAHYYVAPTQGLRDDEIPGFWEELPPAFYTYHRFNMN
FT                   RRSHGWADWCQEAKLREHLDPDGALWVTAKITILKERSQLFPDDRGRGVGGVGGEVGSG
FT                   RFTWHIENMDSFLGMMKQHKVTSPEFRCGVSDMPFCVSVHETDPMDKSGSNLGPADASS
FT                   KGLGIDPNEKVSQLSICLEVADAYTKERRISFTDTTWLLFRVTLHHIFDSKASIHRDTY
FT                   GRMARNNPMGDDESLGFRSFIPMEDFVESGYLGLREKENNTSITVTFLALREASEAKTS
FT                   SWYALPSQCRDPVLAAASQKPGGPSVGAQLSVGKPSTAPGSFTVTHAPVVKGIAGGIPD
FT                   EPRTAIKGKRPKGQRPQDNTDNGRMQCVGRFVWRIDKFSKLKDIVKKRKISNLSIKSPQ
FT                   FTVGGYSMRLIMYPRGMTNDNQDKPPTHMAVFLQVSPGRGHVGKGMFSYRYRESDNLQL
FT                   CNNSDDFVSSLWSCFVSHKLGLLNQKDPSKSISHNDQKRHSYEQSKWGYEEFVHLTRVF
FT                   DDKEGFLVDDSLVLTVETLVMAESGEATPGPRLWTPPRALWHFDPLTPKGRASRILNAE
FT                   LVKVFDWMGVKSAPDDEHYLNLDATLKEALEECRVEYPDDPMFSWTWDPTICDPEKVYP
FT                   DWEYAAKDDFFSVNAARSCFAMCCQLDWMDAEGMLNGERPVPTSETPRLWTLFGIALRW
FT                   DEASANPPESWRLSNQFHELLTDFMEAFRDMFAKIDQSVDQYKLAGFMDVFYDRENTKD
FT                   GDAIQTNKWLCFFRMLRIMSLQYLAFQFPDRKIRSKVISELRTPGAPALPPVFYERKEA
FT                   FVVHKDGMQLCVLDYPHLMFFFRWHPRTAYITHYPFGCMAMDFSWKIDNFTIFRDVIEQ
FT                   ERVFTNVINYKNLVDLELFMLANNGQLRFIIKAKPGRGYRRQISSAIVSYRIAVMNAKQ
FT                   PTKTVWLTGKLTTNDQDAELEYMPLTTLLDRESGFLQKESITVQMCMVDLLLHSGTTSS
FT                   SPATALAAPAEKATCLGGLDESHSETWHRMGKHKQRQVLMESLDGAFASSSLAPLLKSI
FT                   PSEERARFIKDAKEHIGDRFREIGVDDMGDRFREIGIDDIDNMEQYMEQFGHMTKFLEH
FT                   KLSDIQNAPDEIRPRLNLNMNEALQALKALDGISACKTGPAQERIEKLRSLFIEIRKDL
FT                   AKAANEEGPASAPNAIVSGEEEKTFLEILGRHTLEMNPEDPVSLAFPGQKVRLSLPWIW
FT                   DEPNPHEKLTHPAWNTPDAAVVSETLASSSTPTQDACMLLYSVPHEWIRDWHLFPEIRA
FT                   NPNPDEHRQDVDESNHRIAFRQLVATNPKAKKDIVLILHKLFRDSYTIWQIFGGGAAFI
FT                   ESLDYAFLDRDYYNDARIGRHDIAVPAAGETADEPPNNWRSYRKLLQILEVYMSVECLR
FT                   GFIFWRVLRAMKEMWHLSTHQFFPKNGEWPKDRTLPADFDYASHAVNPEAFWPDHAEFA
FT                   KSEGIFEGLAYSIVTMLVRAHELEIADHLDEANGYIGDHYPLEKLEWTESPPDEQFEEA
FT                   LDKCVGFGILCEIARLGIHLKHLQVKQKNPRTKINQFVADVCPSPAHLVFHKIVFHLPK
FT                   LTPNTPVWHTELMKMLMGLANASPEVIERQCRYLDLIAGVGLDDLDSDTAEKLRGRGCG
FT                   RLILIDPDWWRNTAFLGELTEHTVNEKYWTNARTTADQKKEDQFHASTKMEHFIRYLYP
FT                   LMPDDTRQHITKPEFGTLRPEHVQRIRGVYFEAMRRLVLDERSGDYLADNLCDFVSECK
FT                   YPTSELDAALAACLEVKQSFDNDKKNILRIRKMLIIGACHQESAHWYWQLVGESHWNRV
FT                   GLLKQEPDRHPRAGKLVRWLLQQAMARNPAAASEFVNDAFMKIDSYEVAKVAPWEICML
FT                   PEIDLPLLFECCRYVGVRDPKFPLADDDEKAFPFHRIYEKAIAALNAGMKEPEDQNPEV
FT                   RYTGGGFWFQPSVIRHELREWLLQSLQTLRTPWLEDHPDIPDKNIFRASGPLVDDNYAS
FT                   VGRSNRTKCRTDCPQFAAAAGHERLDSDFITTVMSVAELCLRDKDGTPRRQSQRVDDTE
FT                   RGYNPKSRQGRCSIHSRSFASMSRSARGVFNFSRIDLDNELQEMEWVHYYGVYKDLFEI
FT                   YGNPSMMRGDSPLPLMCDQRMKDPFVVYQVGDVDFNDPEVVKLEIINILCSKFRDLSSA
FT                   ELGSGLSTKFLPDVRGLAMLLLGEPFVDLRQGFHYRANTIRDPITDEDSVNYGHRYGYE
FT                   GVMKQDALHCHVDEIAPSDWLALFGHNPVLNNMVFALAALFSRLGVSESEMRRLKHSLS
FT                   MNQEKLDKTNASIAEKAAELGKETKKMQAKVIEQEKKLEKAVANHNNDIASLTAEKKKA
FT                   EAILRTAQSQLEILRTDSDKNTKEWLKKEKEFERRSKELQVQVTKLKKEKASEQQAQEL
FT                   KTANQRVAAAQAETRKKEQELVDARTAAAKFEREAEEATAANRNLTEKVKELKAELKGA
FT                   QQAATRAQREADAKASQQTAPDPNPILQQKAKELHELEREMKKLQVEFAKERKRMNWLC
FT                   GNKMQETSEDDLEQLQQVHRAGLIALADEWHRRRLPFDAWVFRDGLPEPYFPKQPPRRE
FT                   PQQQQPAQQPAASAATTVVGSITGTQYQTSLRPNPFQSQADRGLGPATVPIGGGGSGPS
FT                   SAVGSPARGAAVGAVVHGARMASMERAQTGTHGGGFFGSVVGAATDDDALEPGMSSTSA
FT                   GDDVDIGGGAGATGGSGSGSDGFLESSGFPRGSRFQGLGNGTWSGVNSTWR"
FT   CDS_pept        join(complement(168588..168634),complement(166802..168458))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631093"
FT                   /orf_name="MICPUN_57549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62868.1"
FT                   /db_xref="UniParc:UPI000199B1AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C5"
FT                   /transl_table=1
FT                   /translation="METSVKSIIDRLGYTWYTEMFNDEGIVSVGDLLESLGLKQKSTEM
FT                   GRRESDGSNKAGARDGLPPYFFLPRSASTQSLDSQDGDAPPRRLDVTAATIAIEEKLVE
FT                   KVGVGFSHAKEIAEEVLRAIDQTLSEVARVRRVESDQLFHFDTLDGMADFAKDFVPNND
FT                   TEDTAKAASPDRPRRDPAAAAATAAAIRANVEANMNGNKPRSEEAIAAAKERDTKIAQE
FT                   VVRSKSGGGFYSPAFLRAVAPLYDLHMGAENLGPLLYSYVRFTKPARVLEVGAGYTSMF
FT                   ILQALRDNAAELDAYRELRGAGLCKCGDVPWSVDEFFVGGQSGGGRYRGDPLPEKTSPG
FT                   GSRRVSRVSRQSSLDDGVSLDDEGLLGQSGDGSGPFKTLQNGSSSALSFSGWARGGVGS
FT                   AAPGSEDARVNEGVLHCIDNMAHEHTTAHVVTESASALGMSDRLQLHEADAYDGDLPST
FT                   LAPGVEFDFMFIDLGAANRVEGFMEAWWPRVRPEGGMVMVHSTLTNALSRGWLERMREK
FT                   GRSEPAPPYGAFETISLLEPHKMFQNSVTLFQKRGGPFGRYDEPVHTKFP"
FT   CDS_pept        complement(168894..172538)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631094"
FT                   /orf_name="MICPUN_57550"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO62869.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniParc:UPI000199B258"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C6"
FT                   /transl_table=1
FT                   /translation="MVGRSHGSHARGTRRRRGCVVLVCAAFVLAPLWWQHRGEGEGDGE
FT                   IPLLDVDDARVPSAGGGYDGSHQGGLANFVDDVDVGKGRRDPFDNPFDARHDHDHDHDH
FT                   DHDHDHGVPAVLAGRPPRDASPTAHRLAKLGIIDGWDLDPHLPRMANGEFAASPRTAVR
FT                   ERFPLSSVSLQPDAVPPANVLHGAGVHLDAQRLNARYLTAVVDPRRLLANFRVVAGLPP
FT                   ETIPDRHPTETVAPYCDVGSGLSYAEHPGACWEAPDCELRGHFAGHYLSALAFVAAGAG
FT                   DRPNTSPDRTSSSDHLSDPEYVTGHQSDVATARHAREMLDRFVDGLATAQASSGTSAGY
FT                   VSAFPEEVLDRQGAVGGAWAPYYTLHKIGQGLMDAHVVAGNAKALDVLKGLANAVLTRV
FT                   MGLIQQRGASHWFGGALEYSKAAFGAESGGFNELAWRLYQLTGNGDYVTLASLFDHPTF
FT                   LGRMRAGGDGLTREHANFHEPIAMGAYSRYEITGDTESRRAFRNFIELLRDTRSYATGG
FT                   TCDGERWQAPGRLERIIVSTETQETCTQVNFERLANAAVASFGEAEARDWADYSERASL
FT                   HGPVGLQRKPGELLYTTPLGVGVSKGRSGHGWGRPDAAFWCCYGTGVEALARLQDGVFW
FT                   RLEAGATVPGDDTSSTTATDVVYIARVTTSAVATWDEKGVTTRVSVDPFNVGGPVQREG
FT                   GRDGRRRRGTAGFFASAVAITVHAEGRNEPTSIRVKLPRWAGGGSRITLNGERVRCENG
FT                   GDSSSSEDSDSDSDSDSDSDSDSGWCDVTRVWRKTDLLRASFPIVVRAEPLLGSDLTPG
FT                   FGTGSNQRLDGKGARHAIVAGPYVLAALGPGAWIADLGVKRPAQETEGHSHSGGFHAGA
FT                   SEISSDDVSLLETPDPTECDCVAFAMAGGGDRTRYLAAVVARSDGTLPGDPPTDGGGGG
FT                   VNRGGPYARAAAVFAEPDLEPTLEESKPGGSGFFYAPRTCDRTSCAYAVADAPAVTWTR
FT                   CAVSSTNGERGGRGGGGGGIVRGGAFTLQPTTAPGLILKAGVVRDGRASLVLEASTGSS
FT                   TTTRPLALRLEAIDGTLGTHRVVVNDGELKGYALCRDAGSALDSPGACKDLHEKCPTWA
FT                   SQAACFANQGYMHAHCARSCGLCRPGGAVLVRPGGVGDGAECGVTIVREEGGRRKSAEG
FT                   RGGLLPWRPPRGSHVGRGPDPRWMPRVLLAPLYSLRDEVYTVYLRLAG"
FT   CDS_pept        join(172909..172953,173140..174216)
FT                   /codon_start=1
FT                   /gene_family="HOG000262768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631095"
FT                   /gene_name="HEMF"
FT                   /orf_name="MICPUN_104790"
FT                   /product="Coproporphyrinogen III oxidase chloroplast "
FT                   /function="coproporphyrinogen oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="ACO62491.1"
FT                   /db_xref="GO:0004109"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG631180"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="UniParc:UPI000199B259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E345"
FT                   /transl_table=1
FT                   /translation="MASACASMAAVRPTVARKVSLPKSRKAAVARRASVPVRAVGIEQE
FT                   VALDEAPLTLLREGGEDDASSMRARFEKMIRAAQDEIVSAIEELDGQKFQEDAWTRPGG
FT                   GGGISRVLQDGNVFEKAGVNVSVVYGQMPPEAYRAATGEGGGGKEMIPFFAAGISSVMH
FT                   PKNPMAPTVHFNYRYFETDAPEGAEGAPRAWWFGGGTDLTPSYIFNDDAAHFHGTLKDV
FT                   CDKHDETFYPRFKEWADDYFIIKHRMNERRGIGGVFFDDMNDRPQEELLAFATDMAGAV
FT                   VPAYVPLVAKHKDDEYTETEKEWQQMRRGRYVEFNLVYDRGTTFGLRTGGRIESILMSL
FT                   PLTARWQYDMQPEEGSREADALDAFRNPRTWVA"
FT   CDS_pept        join(174727..174775,174898..175496)
FT                   /codon_start=1
FT                   /gene_family="HOG000188310" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631096"
FT                   /orf_name="MICPUN_105388"
FT                   /product="Predicted protein"
FT                   /function="structural molecule activity"
FT                   /protein_id="ACO62492.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="HOGENOM:HBG591845"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="UniParc:UPI000199B25A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E346"
FT                   /transl_table=1
FT                   /translation="MSGGLQIQPDDELKFRLELKKQIPATIRLYNSGNEEIAFKVKTTA
FT                   PKKYCVKPNTGFVKKGETVNVHVIMQAQREWPADMMKCKDKFLVQSCPSGGSTEFTELF
FT                   VKGKEDIKEQKLKVSYSQPAPPPSPVPEGEEGPSEDATKAKSMFTAAETAPVSNDVGSL
FT                   QRELERFRAKNESLSKDLDMALQGGKRERSTGFTLFHLLLVAIVAFLVGHYS"
FT   CDS_pept        complement(175879..177198)
FT                   /codon_start=1
FT                   /gene_family="HOG000238755" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631097"
FT                   /gene_name="BAM1"
FT                   /orf_name="MICPUN_108038"
FT                   /product="Glycoside hydrolase family 14 protein "
FT                   /function="beta-amylase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="ACO62870.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0016161"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG747772"
FT                   /db_xref="InterPro:IPR001554"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199B25B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E347"
FT                   /transl_table=1
FT                   /translation="MVKKADLKLNAVMSFHACGANVGDYFRVTLPKWVLEAAEKDPDLF
FT                   FTDQYGYRNPECISLWADNAKTLDGRTPLESYRDFMQSFRDEIEARGLMDVVEEISVGC
FT                   GPCGELRYPAYPENKISPNSSQWQFPGIGEFQCYDQRALGNLARAGSEAGHIEWGGAGP
FT                   HDAGGYNNLPHETGFFRAQHGSWDSEYGQFFLSWYSGELVEHGDRMLRCARSVFEEECG
FT                   DCPTIAIKCAGVHWWYNSRSHAAELTAGYFNTRSGDNVPERDGYEPIVKICGRHGARLN
FT                   FTCTEMRDIEHPFFSRCGPEGLLRQIRAAAARYGVKVAGENALCRFDQDAYDKIITNCR
FT                   GEGSDRELWRQGALLPPMASFTFLRLSKELFEDDNFNSFVHFVARMANETRALGGNDED
FT                   KFVNGNEVLEALLNSEILSNLAEVRDETSSGFVAAQFSDL"
FT   CDS_pept        180517..185406
FT                   /codon_start=1
FT                   /gene_family="HOG000264736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631098"
FT                   /orf_name="MICPUN_57554"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO62493.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560964"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B25C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E348"
FT                   /transl_table=1
FT                   /translation="MARLSRRTRRVLGLAAGAAALGWAARECALRSDGWFVRADPARAG
FT                   RRGRGHRAAGHQRADETNRPRLLRLEREVVDADETGDDLGRQHHHHHHHGGDRSRSSAA
FT                   SSSCAGSRRDSFDHGSDVGGDDGTNTSTSGPSLNDQSQHGSGDAATPNFFASTKFFACL
FT                   ELEESQELFAASEEFDVPPNTVVFRQGDDSSSGIYIVVQGSLGVYLQENQADDGDGDEE
FT                   ESTGSDGKKKEKKEKERKVRGTKKTKAPLGPPFLTNILREGESVGDIDVLDNAPRGVSC
FT                   ITQDDGARLVRVKQATLMEFIRAHPHTLETYVQQAVARLWRVAHFVLVDFLGLPRGPPT
FT                   GDAVSLEEPRAIVRTPRHSSGGVEGNGSSGVSNGSSGGNGRAPPASLLLRHLPHIVACC
FT                   PRVEVPDDGAIHREGEQADDFLLVLKGTCRSDAVPWPKGNGARGPPARAPVLIGASAFL
FT                   TRSARQETLRVSLDDEEDDEEDEDSGAAVAGGEIRPANPKAPAVSSSSNPQECVVYSIG
FT                   ALELAALKERSPEAFIATVLAASCSLSPLLRRFISLGLNRVWLSAGEAAYLQGEEATSM
FT                   YVLISGRIRLLQNREKNRAIGAANDVPRTTTTTTTSRPGFGRGGFTHEERGRGETIGEA
FT                   PLLAGGRYPSTAMCLRDSELVRMSRGALTLVCARNPVAASRLLEAMARKLHATLKGAGA
FT                   KPDMVTICLVPATGAADARATATLARDLRRALRGFGPTLWLDEEGARQVFNDDTVGKLQ
FT                   SKFYRSKMTGWMAQQEENYRFILLQADASASPWSQVCVSQADKILVVARASNPDPNPQA
FT                   HEQRLLWRRRRGAATELVLVHDPGEAPRNLRRFRTTRPDVGRHHPLRLEAEEDLQRLAR
FT                   HIAGHAVGVVLTGGGGHGLAHLGALRALEDSGVPVDCVGGTSQGALMAALYARHASTTH
FT                   MLPRVKELVGALSSPRHLLTDLTLPVLSIFSGKGVDRILRTVLGDTDIEDLWLSFFCVS
FT                   TNLTSGGLSTHTSGTVWRYVRASMTILGMLPPVRDDQTGDLLVDGGYLNAIPVDVLRER
FT                   MGVETVVVVDVEDNDYTAFRNLTPHDGGLGGWRLLWERINPFGSWLGRWFLGPSIDEAS
FT                   PASGGGGGGGSGSGGNRTGDRAVTAAAPSYASLLNALTTAASSRHLAQARKEHAVNLYL
FT                   RPPGVSGWVAPLTPNRVDALVRRAHRYACGAIADWQRAASAERVRDANAARAEARDLAE
FT                   SRGAFHLGSPVRASSAGDTGVTTPSAGGDKGVTTPSAAHGDDDDLLAAARGGARGTKGT
FT                   REPNDASPGSLGDGAGRLRTTSEGLSVHVGAGGGAARSPRTSQGHQTPRRISATLPPQP
FT                   PGHQGLPPRESGRDWSESGRDDGGRSRCSLSSSSYDTAGSTHVFGSVGSSFASIDHHHD
FT                   AASEPRTTTTTVTKAVTKTSDDPSGGRNPSSSRLGGGLDGSGSALAALQDAIASGVIDP
FT                   PAATTTSRPRRRSEPEPMHLQSLLFSTMHPKDADDDAEEKPEPKRRSVDEQEFADRMGI
FT                   PPASNPGATTVTRQKTSRGLPVMTQLVDRRALAGETRWGEWLSRDKSPGAGAFDSFPDE
FT                   LPSASPRGSGEWRRRRSFSAGDMELRAAAMAAVKSVREDQARSRVGSPVA"
FT   CDS_pept        <185948..186505
FT                   /codon_start=1
FT                   /gene_family="HOG000010047" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631099"
FT                   /orf_name="MICPUN_81124"
FT                   /product="Predicted protein"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62494.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG303311"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniParc:UPI000199B25D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E349"
FT                   /transl_table=1
FT                   /translation="ISTNDFKVGVNIEVSSAPWKVVEFMHVKPGKGSAFVRSKIKNYIT
FT                   KSTQEMTFRAGEKLQTADVEKRKMQYTYMDGDQYVFMDMETYEETRINDDDFSKFLLEG
FT                   QTCDVLSWNGKVIGVDLPLTVDLEVTMTDPGIKGNTASGGDKPATVETGAVVTVPLFIQ
FT                   IGEKIKVDTTTGKYLSRVKEEK"
FT   CDS_pept        186694..>187407
FT                   /codon_start=1
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631100"
FT                   /orf_name="MICPUN_80991"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA methylation"
FT                   /protein_id="ACO62495.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0031167"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI000199B25E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E350"
FT                   /transl_table=1
FT                   /translation="MGSRKTADFFAREAKKLGYAARSALKLKEIQDRFGVMRPGDAVLD
FT                   LGCHPGAWTQVASERGAGSVVGVDLTTTRSDALGPRVDPRRTTLTVADVFDLDPPALRA
FT                   LCGSGGASPASRSRPFAAVLSDMAPSTSGDGVKDAALSYELAEQAVRLALGARALAVLD
FT                   GDDDDDDREGDRDGDGHLEHDPGVLRKGGSLVVKLLEGPGGGRDDLQRVCKPQFESVKW
FT                   FRPRATRRESREVFLV"
FT   CDS_pept        complement(<188778..>190082)
FT                   /codon_start=1
FT                   /gene_family="HOG000224768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631101"
FT                   /orf_name="MICPUN_67233"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA modification"
FT                   /cellular_component="cellular_component"
FT                   /protein_id="ACO62871.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005575"
FT                   /db_xref="GO:0009451"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG457663"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="UniParc:UPI000199B25F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E351"
FT                   /transl_table=1
FT                   /translation="SAVPGVAKVHVKTFGCSHNHSDSEFMAGQLGAYGYDLVTDPDDAD
FT                   VWVVNTCTVKNPSQSAMNTVITKGKAQGKKLVIAGCVPQGDKKAKELEDLSLIGVTQID
FT                   RIVDVVERTLAGDAVRLLEKKPLPSLDLPKVRRNEHVEILPLSTGCLGQCTYCKTKHAR
FT                   GELGSYSPEALVQRVQTAIAEGVTEIWLSSEDTGAYGIDLGTDITRLLRDLTAVLPTDG
FT                   SCMLRLGMTNPPYILAHLDAVAEAMHHPSVYAFLHIPVQAGSDAVLDRMKREYVVAEFE
FT                   KVADTLLAKVPGITIATDIICGFPGETSEDWEKTMALCRKYEFVELHLSQFYPRPGTPA
FT                   ARMKRVDTKEVKRRSRELTAYIESYRPHDALVGTTQRVWVTDVAKDKVSLVGHTKSYVQ
FT                   VLLPGGEANRARLMGKSAEVRIIDAHRWHVTGEVIE"
FT   CDS_pept        join(191884..191945,192128..192175,192302..192440,
FT                   192560..193192)
FT                   /codon_start=1
FT                   /gene_family="HOG000237920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631102"
FT                   /orf_name="MICPUN_105391"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62496.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG591154"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199B260"
FT                   /db_xref="UniProtKB/TrEMBL:C1E352"
FT                   /transl_table=1
FT                   /translation="MTTMDPFPNFSLDGLGLELGRGSMGGIDSVIPYEHWTVDEDKHFE
FT                   TSLAQIGDLDSDDMWGQFSAHIPGKSMVGLKRRFNLLQEDIKNIESGRVPLPHYENHDG
FT                   VLNTEGVVAPAKVDTAPVAPAPATQTNSGGSNGSKSSSKKKGGKAPAAKTSDQERRKGI
FT                   PWTEEEHRLFLLGLAKFGKGDWRSISRNFVISRTPTQVASHAQKYFIRLNSLNKKDKRR
FT                   SSIHDITSVNGAGDSAPNSSQNGQPMPTMVPMQPMASGPMSGNGYYGAPMGNSMGYMQT
FT                   PGMQTMYVQQPM"
FT   CDS_pept        join(complement(194117..194195),complement(193869..194017),
FT                   complement(193666..193803))
FT                   /codon_start=1
FT                   /gene_family="HOG000186416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631103"
FT                   /orf_name="MICPUN_57558"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /biological_process="proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase complex"
FT                   /protein_id="ACO62872.1"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016471"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="HOGENOM:HBG621942"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniParc:UPI000199B261"
FT                   /db_xref="UniProtKB/TrEMBL:C1E353"
FT                   /transl_table=1
FT                   /translation="MESQDGIQRLLAAEQEAQAIVNAARQEKTARLRQAKEEAEAEVAA
FT                   YRAQREAVYQEKLSKVNTDPARSPSSAQISRQSGDKSAIGAQLAQDADSQVKTIREQCK
FT                   ANEGVVTAMLKAKVTEV"
FT   CDS_pept        join(194764..194938,195292..195743)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631104"
FT                   /orf_name="MICPUN_57559"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62497.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniParc:UPI000199B262"
FT                   /db_xref="UniProtKB/TrEMBL:C1E354"
FT                   /transl_table=1
FT                   /translation="MPHDFPRGRSPPVSRPSPSTQVLSGSKSQFAAGQLTSKFQKMAVA
FT                   APVKAAKVNTTVESIQGKSGRKCMLTGKKANNGWTVSFSHIRNKKLQGVNLQYKRVYWP
FT                   EKQRYVRLRISTSAMKSINKIGLEAMAKRAGLDLESLAYSDASAERREWLVENGAEPQR
FT                   KNKRAPKGPKPVYIPKWKEAQMKRKGMNVEAETKRFAERWGMTVA"
FT   CDS_pept        complement(195903..198233)
FT                   /codon_start=1
FT                   /gene_family="HOG000100045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631105"
FT                   /orf_name="MICPUN_99875"
FT                   /product="Protein arginine methyltransferase "
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62873.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG560966"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI000199B263"
FT                   /db_xref="UniProtKB/TrEMBL:C1E355"
FT                   /transl_table=1
FT                   /translation="MALNFAVAAAELDAPKKTLPALRDRCRLDAYAAAAVRVFETVGDE
FT                   PALAVANGAGGVLAMTTAAAGFGTVFAVDRSRFHYRMAKQCIRENPRVQPSIVMIDQKL
FT                   EMCKVVPNPKAADSCEDSSTSKKKEANVTERCKVVITDLMDHSCLGFGLLSAIDHVGTN
FT                   LAAPDAVCVPGRVVVRAALLSLRTETVSGFDLRSLNQYRWHPQAAKFLNLADEPHDVLS
FT                   EHFEVADIDLTARLRAAAARGDTNEGNDKDKDKDKDKEKFGGAAAFESDVKIEVKPLKD
FT                   GVWNAVAFWFELDMGGNQWLRSATPPAVGGDGSGSDRFDRFVSDAESWGVAVQYLDELP
FT                   VGKNGPPVTVRVRRDAGQILFTSDPPPTRPRHSNIPQWHYDMLNDAGRNDAYEAAIVAA
FT                   VNRRKKSGGKIDALDAGSGSGLLAMMAARAGADFVAAVEKTPSMVDAGEENVCMNGLAH
FT                   KVLCLNRDVRRVFTKESRGLQPVPGEAAEGGGGLIKTDGSVPELDRKVDLMVYEVFDSG
FT                   LIGEGALHILANARYRLLRPDTTLVPASATVFAQPIEYRISTVTCGDLGAFEMKQSNRW
FT                   RWRDTYEGHNLERCKGDWRPLGEPFRVFDFDFAQIGPETLTPGHVAKDVAVTDPGVFNA
FT                   IAFWFELRLDENNVLSTSPHDGTKGQTWQQAVQWVEEMSVQVGDVLPLVASHDTYAITF
FT                   AVDDARFPQRGMRRTGVPLYDPSWGVQHERVKAVNHRMAPTLVQNPVEYRTMAETAVAA
FT                   GARPHDLGLDAESGSDFCLRMMG"
FT   CDS_pept        199187..200053
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631106"
FT                   /orf_name="MICPUN_52673"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62498.1"
FT                   /db_xref="UniParc:UPI000199B312"
FT                   /db_xref="UniProtKB/TrEMBL:C1E356"
FT                   /transl_table=1
FT                   /translation="MDDPELKAKARDVFTALTANGASFTEFLDADFSAWRVFFRGLKEL
FT                   SNDQTSALGELAAGGFLGRNDITMSNWGKSVKERSELFKEEFDRFIGLPEVRGALAKDL
FT                   GMASQAPPASPLAAMRAAASREASPAKENAGDTANDAARHRGTEHSPARAIDGGDGQGA
FT                   SAHHHGSHHPKPPSPPRAAPHPMPPAMMAKTPLRPDAAVEVVTNPSAAAVVVDISATHV
FT                   PVEHHRERIMAYLSGFENLLASLRVKTDALASAPLVDAPAAVEELRGRLDVALERVAGM
FT                   IAEESGA"
FT   CDS_pept        complement(<200271..>200462)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631107"
FT                   /orf_name="MICPUN_74778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62874.1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniParc:UPI000199B313"
FT                   /db_xref="UniProtKB/TrEMBL:C1E357"
FT                   /transl_table=1
FT                   /translation="LALALIRFYRTQISPLTPPACRFVPTCSQYAMDAFRTFGAGKGSL
FT                   LTFWRLARCTPFGGKGYDP"
FT   CDS_pept        join(201032..201123,201248..201626)
FT                   /codon_start=1
FT                   /gene_family="HOG000067103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631108"
FT                   /orf_name="MICPUN_106839"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62499.1"
FT                   /db_xref="HOGENOM:HBG559877"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniParc:UPI000199B314"
FT                   /db_xref="UniProtKB/TrEMBL:C1E358"
FT                   /transl_table=1
FT                   /translation="MGPPAIISSPALVSALLAFTVAQVAKVFTHWHTTGKLDYGRLVGS
FT                   GGMPSSHTALVVGLTTSVGLKESLDSSIFAMCLVFSLVVMYDATGVRLHAGRQAEVLNQ
FT                   MIMELPATHPASESRPLRNSLGHTPPEVGVGAIVGLVVGYLHYSIWITQWGP"
FT   CDS_pept        complement(201833..203299)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631109"
FT                   /orf_name="MICPUN_57564"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62875.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199B315"
FT                   /db_xref="UniProtKB/TrEMBL:C1E359"
FT                   /transl_table=1
FT                   /translation="MRTEEDVEVGRTHVGAGPGPASIGTSVARRLDLGKPTRARRARWT
FT                   FGVTNVSPESMLMATAAIWGSYHPTMRLMLTSEDGWETPTPAELNVSRSAITAAMCVAQ
FT                   HLVMRRLSREKNTPTRDGKPDDDDDDEDDDEDRERDRYPNARTPLRGEGRRGRRLVATN
FT                   GGGDAEGRGSDSEGGGSRRARTTPPTTRAPAAAARSRERSTKRRLFAASAELAALHALT
FT                   VGLQSCGVDHSSATRASFLATTSTVVVPLFATAFGTPVAKRTWASAAACVLGTALIVSS
FT                   RTPGSSDYSAALDEDAKDADTTLGDGLILAGAVVWATFLLRISKHARTLPVAPLVIWRN
FT                   VLMFACYACWWAFDERFFRGGSEHMGFRRGRFSRGRTGSVPIAREAFPWRDNSTTWGRV
FT                   VFLAVGPGFACSWLQTIAQAKVAAAEAQVLISTQALWGAAWAFAMMGERMAPMGWAGGF
FT                   AIVAGAVMVADGGRRGRRDKRAAPRGNKSS"
FT   CDS_pept        203534..207793
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631110"
FT                   /orf_name="MICPUN_57565"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO62500.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199B316"
FT                   /db_xref="UniProtKB/TrEMBL:C1E360"
FT                   /transl_table=1
FT                   /translation="MAKVAGLSEELRALDAELRSLGGGGNAAIAPAAVYCSVCPAPVRS
FT                   ATVGGASRHTDGRRGDDEPVPAVALLPGGDGVAVRDPSDDTSQEPRRYRMTAASDSGDA
FT                   PDELARDVCDWLMRGFDALVVTHGQSGTGKSHVTFGGGGMGVHPSPTGGFDKPGVITRL
FT                   FRLVFTRAAREEAAWRLAEDARMHAGAPESIADEVRHRFGVSCWEMSPDGRVVDLLDPT
FT                   GDARGLALASSASGLGDRYGDIPSGGGGESNRGTSSFESFRACAVEVSTAEEAEAVLAH
FT                   SRRASANWTLPRMRATAASDGSRDGPGNGLSVAPGPWAGAAARVRSNRSHAFVRLTVVR
FT                   EPEGVVSECHVCDLVGARALGLAELHDGSSDRSSVEGDRDRRGAARQLLAFSRVVDELS
FT                   RRAPKDGPDSSEGARESITARAVRGARDSRLTQTLAPLMASGARTFMLCTVSPLPDDHL
FT                   DTLNTLRVAQRCARIDAACVRRVLAPEHRRALRSRFTTLREAVARADAVADAALVSAAN
FT                   AGVVSTTEALARAAERAEWGDVVSDPPGAGVVSDPPGAGDVSDPPGAREPLLSPIKAAR
FT                   IPAGLMPGRTPPRTRPSNLMREFMEDVPESFRPADESVTTSSIDRDGDGDDGRGESSAE
FT                   LGARLAALKDEFTAMYAAVDHGRREGAVNVAATGGEDQTRARREGTGRAPDDAQRDERR
FT                   LRRTPPTSPGKYVGNRRVRWPDDSDAKDAHDRYFDEKENVPIAAEDPKPRPPPPSRGPI
FT                   PTNPEALRLEVEEQRRRYDALLGMLHAEESARLKAEEKAAAVAHDAAERVVAAEAAAAD
FT                   AARSSVEAKARVRAMEDGTDYAEIFARYEMDIDALDRECARLREEAFLAHVATQGDVDT
FT                   GGDEASRVLNASADVQRRVGALKRALRKSEERVDELERTLSELRRRERLMDLHSRQHDD
FT                   QIRRLQAHERQIVALRAELQRSQLSAARSEARREESQRDAALARARESGLREDNAQLAA
FT                   EVERRGRKMRAYENRVDELEQARRVGRPGGTKTTINSAASDFATRGDYDAIQSELELRD
FT                   VASQLRRAVPPGASARADRLFDALYGELDTLLRGTRGDEGNLGGAEGYAGTDGGRREPW
FT                   RDYLDPRASSYGGDGRDRSSSGSRPEAVRKPSSPSPERLNRAMAAHVERMARSRSPATS
FT                   PRREEGRPTGGEPRGRSRTPPRVVPKRLTLARKGADRTPSGRHHDDDDPLALAAEEAAG
FT                   RGYGHGHGHGHGGSGGAHSSRRRVAHRSPSPSPSPPVSPRAGSLPDYSSVPGGYVPGQH
FT                   SAARAAARAGLGGVTPSASPRAMAKTRGSLDADAVRALEAAARSRSPEEGGTPGATSPR
FT                   RTDGLSRGGWQSGPLAPPPTDDRANRHVLDSYASMLQSPGTYETGAPPSSLARSPPGSP
FT                   RPFYPSGPTPHPDGGFR"
FT   CDS_pept        join(208075..208219,208544..209181)
FT                   /codon_start=1
FT                   /gene_family="HOG000232762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631111"
FT                   /orf_name="MICPUN_90454"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62501.1"
FT                   /db_xref="HOGENOM:HBG634536"
FT                   /db_xref="InterPro:IPR017499"
FT                   /db_xref="UniParc:UPI000199B317"
FT                   /db_xref="UniProtKB/TrEMBL:C1E361"
FT                   /transl_table=1
FT                   /translation="MSCISASAATCRVAPAVRGQRFNKRAATVAPRAHNRRALAIQAAV
FT                   DLNAVTLADTKRKFVESYPYPIPSIWSVAVNELLANQHFVRYSTRYSYSKLSSLGFVSV
FT                   YDQLFEGFPSDEEKAKIFDCFVEALGEDPEKCRKDAAELAKFAKEAGGVDALLASPVLA
FT                   EIKSNGEANKFAYSRYDAIGLFRMLELGGATEPAALEKLADAAGLKLKKVNGDLGMYKG
FT                   LLSKLAAAKELQKEIFEREKRKTAERLAKKEAANDATA"
FT   CDS_pept        join(complement(210204..210282),complement(209447..210042))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631112"
FT                   /orf_name="MICPUN_57567"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62876.1"
FT                   /db_xref="InterPro:IPR007914"
FT                   /db_xref="UniParc:UPI000199B318"
FT                   /db_xref="UniProtKB/TrEMBL:C1E362"
FT                   /transl_table=1
FT                   /translation="MSQFGPRPGPGGKRRGFSKETEAFLRETLEASGASRRTVAGLLAT
FT                   GSVAAAPPKAPGFHRRNPGGVVVPVVGRRRPDHAPPDRFASGIRTKEAIAAANPRAPEP
FT                   WTGRGVPRGRDNDAEKARLQRRMELHGKETLPPPRRLSEMARDGRTLEPTPPRRKTRVQ
FT                   EMEEMFSAIVGEIEEREEFLAEMRELGRAERYEREIAAEVAARVNQLKGLDEALRSASG
FT                   LS"
FT   CDS_pept        210698..212377
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631113"
FT                   /orf_name="MICPUN_99880"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62502.1"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000199B319"
FT                   /db_xref="UniProtKB/TrEMBL:C1E363"
FT                   /transl_table=1
FT                   /translation="MRRAGQLAKIVLDEFTGVLKMVPYGIRAMRTHRSLPDARAPAGRD
FT                   GVSIARDVRYADAPRAVMDIYLPGGVSIDDAARAVSETVSETVSESTTATPRDPPADDD
FT                   KLPVALFVHGGVWAVGEKWQFAPMASRLAEEGVVTCVATYTLFPKARADTMWREVSDAI
FT                   TWTLDNVDRYGGDADRVTLLGHSAGAHICSMALLHRCGVTSDVTASKDVTGVTVDRRQP
FT                   KCYVGLCGVYDVARHYDYEDSRGVALVSTMGRCMGGAGNFERCSPLRVLRANAEVVGSN
FT                   PAFQICADADAEERRKERERAEAAESAAAAELAASIAATKKKEHHIEWAPMSMVMDTDG
FT                   DGDLCVPVADIVEEAAAVAEARLVDLEKKSDDGAADDADATRGSNKSKDSAATSHTVTP
FT                   VPGPPPGALAGDDAARMSGFWRLSGSSPGTDGPGPNDASSSAPDASAIAALSGTNAPGC
FT                   FPPTYLLAGCADHTVPWFESAEFHLALRDANVPSRLCLYLKESHGEFVVGWRPKPKPNP
FT                   VTKTSAWGDDAPVNAWGDGLDGDLEARGLSAHNRDVIRIIKC"
FT   CDS_pept        complement(212473..213531)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631114"
FT                   /orf_name="MICPUN_52676"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62877.1"
FT                   /db_xref="InterPro:IPR006786"
FT                   /db_xref="UniParc:UPI000199B31A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E364"
FT                   /transl_table=1
FT                   /translation="MASELEALKRELHALKGEQHDLHQRKSANRHPRGGPHGDRGSGGG
FT                   RFQIGPNREDRDDRRAGKRQRTSLDGDGDVNGDGGAPAPPGAYASAPSVDTRPKDAPGI
FT                   AKDEGEKRRGRRMLAGLLGTLKRHRDEEKAVAAVTAQRRSVIEQAETKAREVSEKLRQE
FT                   SFASNALRRARDHRRTAEIDLRVAEKELEVKRAARLEKDAKTAGCARTSKECGRPRVFY
FT                   RPKAHTKDTEAAVEVTAKEVAEEFDKTIANSEEKVERLKRALQEATRELEEAEANAPED
FT                   AGDDDENEGGNEGRNDANGRAPIDDDAAPEEGEVDASGSDGRGERSDGDEDMGDLEEGP
FT                   DPEGLEDMLAGK"
FT   CDS_pept        213741..214685
FT                   /codon_start=1
FT                   /gene_family="HOG000079133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631115"
FT                   /orf_name="MICPUN_57570"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO62503.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG560974"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B31B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E365"
FT                   /transl_table=1
FT                   /translation="MSVAALANPRVARPALSERVAKRPMGAPRQLALRVNNAARDTAGS
FT                   GGTKGKLLVLGGTGFIGSKICERALSSGYDVVSISRRGDPPGDPHRYPDGVWNRVDWRK
FT                   GDCVQPDTIATVLGEGGFVACIHAVGMLLASDINALASGSGSKPSPGATYDDVTRVTAL
FT                   NAADAAARLCTAVPNADTAGGGGTGGTTSKAPVPFVFVSAAEARWTFKAPVAWLEDYLI
FT                   AKRAVEARLREMTDAGEVRAACLRPSLVYCLDKPAAMPAVGAFYLGNLLGLPFVDRPVT
FT                   VDTLASAAVRCVEDGRSTGALDYREMERLAREL"
FT   CDS_pept        join(complement(215977..216344),complement(214840..215806))
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631116"
FT                   /orf_name="MICPUN_106840"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62878.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000199B31C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E366"
FT                   /transl_table=1
FT                   /translation="MGANQSGLGGPGGPGGGPGEEKKKEKKKWQPPPPPQRVGKKLKKK
FT                   GIDGATRLPDVAPASKCLLRKLKLERVKDWLLMEEEFVTNQERIKPHTERAADDQSKVD
FT                   ELRGSPMSVGNLEEIIDDNHCIVSSSSGPEYYVSIMSFVDKSQLEPGCSVLLHNKTNAV
FT                   VGVLADDVDPMVSVMKVDKAPLESYADVGGLEEQIQEIKEAVELPLTHPELYEDIGIKP
FT                   PKGVILYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDGPKLVRELFRVAEDM
FT                   SPSIVFIDEIDAIGTKRYDSNSGGEKEIQRTMIELLTQMDGFEARGDVKVIMATNKIET
FT                   LDPALLRPGRIDRKIEFPLPDVKTKRHIFGIHTSRMNLSEDVNMEEFVMAKDELSGADI
FT                   KALCTEAGLLALRERRMQVTHDDFSKAKEKVLYKKKEGVPEGMFM"
FT   CDS_pept        complement(216712..219468)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631117"
FT                   /orf_name="MICPUN_99882"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62879.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199B31D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E367"
FT                   /transl_table=1
FT                   /translation="MEGRRPVGGRRGWVLWAVLSAVLCPLTALAGSAGSTSATVVVEPR
FT                   PTVDVDGYVEWTDAVRATLRRRAPGLRNAGTRSDVRGSGDSGSAAASASSTTTRPRVVV
FT                   VPDPPRIACDERGCGGGACNRELGACRCPLSLDGARCETFAPARCDEDPASPRELVGVE
FT                   YKSRCAGECDLTAAKCRCGRGVAHLGRGDLRNAHPDWKTPDDVAPNGTAYAGPYAPTDA
FT                   PMSKFPERPMQGCYYEGIATQRTWHAKLDWDRAAGGKPNDFWRPRDDPGPRSDWCAWEP
FT                   GHPGVDPVVKCRCFDGYVGVGCQTIVKQFCLNDCAGAGKCEHGRCKCDEGFFGADCSQR
FT                   DGGGLVPTGAGHGYAAGGSDDPRRAGFVPDGGARRRHHLHAASAGLLGSGAAGGGAAVG
FT                   GAAGGDASATRRTHARRPLIYVYDLLPKFTTAQLQHRQDVRKCVTRFAEEGNATRFEDN
FT                   LYGAEVALHELLLDSPHRTDNPEIADFFFVPMYHFCFISRLQQPTPGHSQQLFSRTRGV
FT                   GCDLRGSHVDAAFQHLFVPVLEHLRRDYPWWNRTDGADHIVPFLHDEGACYAPREFGDA
FT                   TLLVHWGRRDADPESCTGFGSHDWGDRTRDETHASCVVKRAAMLAGHPRGKGVCYRRGK
FT                   DVVIPPWRTPRQFLESPLLAAAARGAEEAKRTASPTFEEALEKTAGAADVEAHVADVEA
FT                   HAARAMHRASVEATIRYARTTSRDGPFFLFRGSIRPNNPAHSRGTRQEAFRFYGPGKAK
FT                   SSPDVIVDEGAQTYRQELASATFCGVFQGDGWSARFEDAVLNGCVPVVVMDDVDVAWEG
FT                   YLDVDAIAVRHPSREMHSLVETLRAIPPETIAKMRVAGARAWHRFAWLGYFAAERERER
FT                   AGLVKLDDRFRDLETLGKIAGVHGADAFETLLQVLRHKLVERELAVK"
FT   CDS_pept        join(219951..220420,220628..221297)
FT                   /codon_start=1
FT                   /gene_family="HOG000197989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631118"
FT                   /orf_name="MICPUN_93904"
FT                   /product="Predicted protein"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO62504.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000199B31E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E368"
FT                   /transl_table=1
FT                   /translation="MVNHPVSILRREPRARILRHAHSHHRSLSAVSSALANITPPASPD
FT                   RSTDSEEHVEPPDVPDVASQIPGLFEESGCAVVAHRGLGMNLKPGKGIRENTVASIIAA
FT                   HDFGADWSEFDVQVTKDGVPVLWHDDFISVRRGDGEVENSAIRDLTIEQLKKLVRPITE
FT                   TEEPVVIYRKFAGTPEPAPWIMDVEDEIPTLDELMSVAPDDLGFSLELKFGTPEDFPGG
FT                   KKVDPARMIMELRATLAVCKSHPRRRVAFSTFDPDAATHMRALQGLYPVMFITNCQPGQ
FT                   DDVRRCSVEAGIKTALDADLVGLVIRADVLRNDPTVPTRVRAAGLMLGSYGGPNTDLAL
FT                   VERQVDLGVGYLCTDDVPAVARLMSARSTTRNAVLAGAR"
FT   CDS_pept        221712..222908
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631119"
FT                   /orf_name="MICPUN_57574"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62505.1"
FT                   /db_xref="UniParc:UPI000199B3C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E369"
FT                   /transl_table=1
FT                   /translation="MTYGDAIASAAPSPLEGFDRRGDADPPAAHEPALTSTSYAGTSRA
FT                   LPRGRPAADPSRADVPSVFLELLVAIRSERHELTRDERDALRRCEEQMQSRAVVAGYLT
FT                   GAGTNALLKTLPAFKTQPVGRYIAAVSFGVTGAFYGARSAARACLERIVRLEDSRLGEL
FT                   ATDAVRRSAPLDPMLAKVPNATGRVAVGDAAGGEVGGGFGAGGGDGRKGGGATTSTRAE
FT                   IIRAAAEAEASRRVRARERRPSPPVVDLSEEPKTSTSTSTSASTSASTSAFASASGDGF
FT                   VGFDALAAAGMRGGDAWATVGHVSDTSDTGQGRGGGASGARGRERGGTRERRLKAAEWA
FT                   KRRVDRAGAISPFLGEESRPTPEMFDASELAARRERERAGRARPRATIRTEYGDVMDR"
FT   CDS_pept        complement(223064..225187)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631120"
FT                   /orf_name="MICPUN_57575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62880.1"
FT                   /db_xref="HOGENOM:HBG559629"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniParc:UPI000199B3C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E370"
FT                   /transl_table=1
FT                   /translation="MGCGASKATSTADAPAEPPRGGKKASDSGNNIAPKGQTTTHSGAD
FT                   TDAPKKKPSKLDEADGIGANFDAAAAVTVAAGTATLVAGTVSSDARGALSSAASTAGLG
FT                   LLAFAKELPWVAPIAFLIAGVVTASAEVHTLKADAQVFCKNVQSCEAILNQVAAKGYLG
FT                   HVRESVEALQQTLEDGLAFCQRLKLQYFITQLIMSGRDTVKFREISNSMHRQVSVIAAA
FT                   ASIDVQAQIRDDFAQGEKLREKIESLGGFGEVASDPTKMTVAREFLKASDELLLSSVEN
FT                   VRDAVKAEAEKNRAAMEAMERRASERMDTLRAQSEAQAKVLQDQVAQLTSMMAAVLGQR
FT                   TGAAAETTGVTLDFGREDGGLGGGGPTASSPPEPESSPPEPESSPPEPESSLPEPHPET
FT                   PEQERETPDPAPEPRPRVATRDEADAVADSVYSGANVRDIMSKMDLYEDEAERRRVVSD
FT                   SALEYEEIGDLVDNDDLHLLTDACAKELGVTDSFIGIIDSKRQTYVSHSKFDVNTGEAR
FT                   AHGDGLYCANVGTVCKHVVKRGDAMQTNGPTHASMAGMPNFTDPEYEAICAVDHAQGAI
FT                   LGDTFAQFAEYVDANSDKPDDAKIETEYDRRGEAHPHGAEKVPTVGGMRSLADTFLGYD
FT                   HIHYTGVPIKLQGQTVATFCAIDRERERHDVDVEKVRLYAARAQAMLEKRAAEKKLARL
FT                   GVPAVPPTVAAVA"
FT   CDS_pept        226925..228181
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631121"
FT                   /orf_name="MICPUN_108041"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62506.1"
FT                   /db_xref="HOGENOM:HBG609132"
FT                   /db_xref="UniParc:UPI000199B3C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E371"
FT                   /transl_table=1
FT                   /translation="MSLAGAIRRAAEAVAAKEKELLRKEWSGHYAGTAGDAADTYESPY
FT                   GDGRDPVCELRWLDLGSNHINDPGAAALGDALGPKVPITRLNLRDNQVGVLGCRSIGYG
FT                   VVRCGATLRRLDLAHSGFGCQGAIALAGALATAHSPCALKVLQLGFNSIGADGAKALAA
FT                   ALTSGNFRRLEHLDLACNVLGPDGVAALAPLLEPIESGDATCSADDEVSDTLSDGKRGA
FT                   GLYSLDLAVNNAGGDGERGGIRALMKALESNTSLRMLNLRGNDLTPEHAGDVAEMLCEN
FT                   VTLTQLNVGYNKIYNEGAWELAEALSENPSLLGLDIQRNEISDDGAEWIRGLLASNCTI
FT                   EEVDMRSNQLSPEVVESFGKSFGERVNARWQQEPPKVEKNDENAAAQRTMVGEGGGRVA
FT                   AKKAERAARKAARQAARGR"
FT   CDS_pept        join(complement(228641..>229228),
FT                   complement(228390..228595),complement(228236..228332))
FT                   /codon_start=1
FT                   /gene_family="HOG000200799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631122"
FT                   /orf_name="MICPUN_70437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62881.1"
FT                   /db_xref="HOGENOM:HBG609138"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B3CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E372"
FT                   /transl_table=1
FT                   /translation="YLPPSRAWFSLYNQRVTVPVSPAEAARRRKLGLIQRALSDDVMLE
FT                   IFKRMSPVAVARAACSCRPWRLLAAHEDIWERAALDAWSGREPPEVTARVCRDRYHDSW
FT                   RRMFLDRVRMRTEGLYVSRNTYIKAGMTDLTTENVNPVHMVCYYRYFRFFGTGEFYCKT
FT                   SPHKLESVAKTFRDRRASAVDPNMYYGWYSIADCAPVERLTGDGRATASLHMWLRLRST
FT                   HPGGSNRLDFVKLASVDESEPVPAPTAEEWREIDDPEMAYRRSGLNTMVFVPWEDVHDH
FT                   VLNQGTDKMDFFVTG"
FT   CDS_pept        join(229530..229742,229966..230601)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631123"
FT                   /orf_name="MICPUN_99886"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO62507.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B3CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E373"
FT                   /transl_table=1
FT                   /translation="MGGSDDEMHDAVADEGAKAQAEDQPMDADSDTDDEDRRPKRTDGD
FT                   SEPSPPRQRTPPRERSPRRDEPKKEKQNPRKNPPMEMIIGAEDAAFLVGTGGKTKDKVA
FT                   RVAGARLDLLDADDGKHRLEIFGKDENRRKAKQYVEWVLRQRVGPITVDTSGARRDDLS
FT                   IVSVPLDCVAYVMGKNGVVLRNIEEEYGTLMFFGKPTSGAEEGVEKLMILGSRRSRRGA
FT                   ELKVMSAVEHKRRGFFVDEKKELRKRLEQVGDGEGDGWGYDVFPFHDDEFSYALGAQVR
FT                   H"
FT   CDS_pept        230979..231980
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631124"
FT                   /orf_name="MICPUN_57579"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62508.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B3CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E374"
FT                   /transl_table=1
FT                   /translation="MESTGLRMFSGSLPRAGMPSRGVEAPLSIRTFRNRFFPSVLAESL
FT                   VVVARSRAIFSTLSSQGSTRKKLAAASGCILEYIGDVAVMAGNRDERRRCWDYLNWLLK
FT                   QRKGALSVDPKGRDDVLELPVPSGKAGRLSGKGGNVLRSIEKETSTFCFLTDHRAAADG
FT                   ESRDELMLIFGRDKRDRYKAMDLMEDAMEGKYQPKGGGGGGGDRGGRDARGGGDRGGRG
FT                   GGGNKRSDACHDFSVGRCTRGDKCRFSHDVASAGGTRGGGRSDRDASPRRDGRGGPDRG
FT                   RGRRDRDRDRDRRGPYGDGRGGGGGSRGGERGGGRDEEAGARPGEDPRYDRR"
FT   CDS_pept        complement(232118..233107)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631125"
FT                   /orf_name="MICPUN_108042"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62882.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B3CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E375"
FT                   /transl_table=1
FT                   /translation="MFRVSRLAAVAALLAMCAHVFPRGAHALGVTDDHPLVARQGAPDM
FT                   ALCDRADAGHRRATQRGDQMLKLGRLEVAEACYLGALRQKNDFPMALYGLGEVHTRAED
FT                   DDRVDLAESAYKLALENWPQYVDAYIALGDLHERRERNDDAVAAYTKALEVAPGDVMAW
FT                   EALGRHHLATSDFDKAKESYEKALTTATNGESSPGLILGLAKAAWGAGSKLEGAEATKK
FT                   FVECVSHAEKATNLAPDFGQAAHWNGKCRTHLKQTKKATELLFRAVELDPEQPEHHSFL
FT                   AGELVKLGRVKEAREVIMKGMEWVEKDEAEKEKAFQAAAAEEDAKDEL"
FT   CDS_pept        complement(233272..233790)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631126"
FT                   /orf_name="MICPUN_57581"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62883.1"
FT                   /db_xref="UniParc:UPI000199B3CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E376"
FT                   /transl_table=1
FT                   /translation="MGRNRLCQCEPPREVVDAELAKPEDDRKVRKDPAGVWRWKQCGRC
FT                   GSLRKKRWRETRHRAFAERDEYVTRVLANMMRDDDEEEEEDEEAEDADADGDDPGAANP
FT                   GDANALVAATRVFAGEVRSAVREVAASPGGSRAALAMLRGLEEDLKMRWGVALGGYRGG
FT                   EGEGEGEQA"
FT   CDS_pept        234272..235447
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631127"
FT                   /orf_name="MICPUN_52682"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62509.1"
FT                   /db_xref="UniParc:UPI000199B3CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E377"
FT                   /transl_table=1
FT                   /translation="MAGSPKAGFPARRPGRLFGKKQMVMFGCIVLVLFVAPSLFGIGDT
FT                   TDSHGLDPDDRGLVRTDFDGDRKHRRRSSRRADAFDDDAGYRMRDADDLHAGHHGLGSS
FT                   TWSSSWSSSSSSSSSSRDRHERERDERHKRRARERRRHAGHGGLEHDIAKRASELAIPR
FT                   VEEYVNRKLVDPAVRAIERGDSVDPNDPSKGHKHGGVGGFFDAIAHPFGIGASSDSDAA
FT                   ADATDPNAYVPAADFGLPHHGKRHHHQKIPAWGEPPAPDGEDDFNDVRKDSIADRTRGA
FT                   FDDDDDTDDDDARSLRREERIGFHDFVPNDDDDASSGSGSKSGSWFGSLFGSSAKKAER
FT                   SGATVGRRERAGLKSTRGGRGGDDEDAEDEYGGGGRFDDPAPRKRSSLRGS"
FT   CDS_pept        complement(<236527..>236865)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631128"
FT                   /orf_name="MICPUN_74537"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62884.1"
FT                   /db_xref="UniParc:UPI000199B3D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E378"
FT                   /transl_table=1
FT                   /translation="LFVEAPRGVNAYLGDSRYAQENLDVTSSSADLGSRLRHLRRIHAG
FT                   LVSERPYEYSHCVSWAAARFREYFALLPNTMLKNFPPGQRTRDGSPFWSGTKRVPAPIA
FT                   FDPNTPSHV"
FT   CDS_pept        join(239437..239505,239596..241179)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631129"
FT                   /orf_name="MICPUN_57584"
FT                   /product="Predicted protein"
FT                   /biological_process="meiotic chromosome segregation "
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62510.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045132"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="UniParc:UPI000199B3D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E379"
FT                   /transl_table=1
FT                   /translation="MTPQAIQQRLIVANQELARHNGKLRADVNESRRRADMAVNAEKQA
FT                   AIVNAILRQQNDTAVRETRQLLVSPSPARSNNESAENPPPLRRAPPQAKLQSSNDEITR
FT                   LKIRLAAYERERERRPERPAPSPAPPEPKPEPKPEPKPEPGPELARALPKSSSRIDVAP
FT                   DPDPDDDVWAFVEDEQREFPRALPRTPANTPVQSFSAPVATFPVSALASNRPLRRPPAF
FT                   DPNATWADEENLVPPTRPRAATAGDTPQVAVRSGLRERSKNVSYAEPSLKAKVRRPWSP
FT                   TKPKRRSSKAKRRETEPAAAAASTSTLTSTSTSTSTQSATSAATSATASASTSSGVRSF
FT                   DAALARVASAVSFVTERKRGGAQKARRAKSPEEHPEIESSPEIDPNALARRGLTDSDSD
FT                   PNEEPTLPDSGSPARPSPFSNFTSRHVIRPGPTNRVLSFDNSPGSNEPFPTAAAYVRIP
FT                   TAVEIAPSFGDDPDSDSDSDDGGDSDGESEYEDAEGSAVDDDDVASDVASDVGDEVPLL
FT                   ARRLSQEEITDALLADAVATGMRLDPRPGARRG"
FT   CDS_pept        complement(241369..242496)
FT                   /codon_start=1
FT                   /gene_family="HOG000234777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631130"
FT                   /orf_name="MICPUN_108043"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62885.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG558486"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI000199B3D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E380"
FT                   /transl_table=1
FT                   /translation="MVPAPSMPDLQTEAMDLAEKGAKLACGSRFKRLPRLILRKLSLPV
FT                   VAVIAIIWFVYAEAMAVATRWMENSVPGVMNTGVLSFNAGVGFLMYLCCVYRDPGRVPT
FT                   AWRPPSLNDLETGELESGVDGGTHGHHGGLQELKRKGGARYCKKCAKYKPPRTHHCRVC
FT                   NRCVLRMDHHCVWVNNCIGHRNYKSFFTFLFYITVACCHAFGILAGDAIGRFSGDDDDV
FT                   GKSHADHRVNHGEDDGVAASVAEMAALILSLCLSVALCLLFGWHCYLVVNNKTTIEHYE
FT                   GVRSRLVGPKPGDVGQAGGDGYAPSLDGVQHPYSLGARANLREILGRRVACWLAPGCSI
FT                   AGDGLSFANVASMGYARWAKEKALRESELTLMGED"
FT   CDS_pept        join(243333..244574,244662..244886)
FT                   /codon_start=1
FT                   /gene_family="HOG000043114" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631131"
FT                   /orf_name="MICPUN_93908"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ACO62511.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG569300"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199B3D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E381"
FT                   /transl_table=1
FT                   /translation="MQTAALRGVADVPSQLAKQLQRAAAPPPAGFPPGPPDDVAVALGA
FT                   DPLAFIVDTQRRHGDVVGLSLAGERVVLVSDPKVAADVMIDRAGLFVKEGTAFFPGSSL
FT                   AGEGLLVSDGESWARQRRLSNPAFRAAAVDAYATAMARAGAELLRNEWGARSVRDCYED
FT                   FNDLTLRIVAEALFGADVRGKRAREINGAIKEAFEFFGRRSATGMIVPEWVPIPDNFAY
FT                   NAAVTRLDKAVYSLIAERRQKRVNGLESVENPDLLDRLLDARDDGEGGDGGGMDDVSLR
FT                   DELMTLMVAGQETSAILLSWCCVNVASNPRCAAKLSEEAAAVIGPDPLNDLPNASHYSR
FT                   LKYAEAAVLETMRMQPPAYMVGRCCAEDVFIAGGKYALPKGTTVLIAPYLLHNDARYWD
FT                   APGEFRPERWLEPGGGMGPGGVYVPFGAGPRVCIGTGFAMMESALLLAMVARAVDVRLR
FT                   PGADPPRPRALITLRPENVRLDVVPKRRWW"
FT   CDS_pept        complement(245032..246855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631132"
FT                   /orf_name="MICPUN_57588"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62886.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B3D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E382"
FT                   /transl_table=1
FT                   /translation="MRARRTLATTLARVSRRGLHGGPFGAAGAAGAVDEPPTEFFESIR
FT                   ALGGEHERFAEWLHARVSADETARGGRRNVHPAVTAARVPGMGVGLVARRPVRAGEIVL
FT                   RIPRDAYAPLSATHALAAAKAKAPAFVDHAAKVAASMGAPELATHAALALHVLFELGDP
FT                   RSEGFAYLATLPGLAGKASPSVPLLWTPTQVATLRGTPTHGRVLRRAKFVSDAHAALFG
FT                   SGGGGGVPLEKFAWALSSVLSRAASGDRMPYAFLPGVDLLNHGGVDANCELSAVKLAPG
FT                   GNEENVTWGDVEVTCVKDTPAGEQLTISYGDESDNCRLLRLYGFATRGNVHDRRTIELR
FT                   LTGDALDAWRAPRRWGPGIDAARRAILRLHGLPRLTAEFEHVDAGAGLDDREVGGSNPG
FT                   GAAVFRDPTLPRPETIDDDEEEEEEEEEPSRRRASGKEGEGEGTDAVRWRCVVAHPSKP
FT                   FPTVARAADSSTPAAHAASDAATVLAATYGVPPSVLLASLRVHLLTGFEPAGPDGAEPD
FT                   PRRPISERNEAAARAVLGEASERALRGMNAALRPGAGVDDAAGFELDELDAERAGAIQK
FT                   ELKSGEDWCASVMNLRRGQEEILEELLRHSR"
FT   CDS_pept        complement(246987..247217)
FT                   /codon_start=1
FT                   /gene_family="HOG000029079" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631133"
FT                   /orf_name="MICPUN_57589"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62887.1"
FT                   /db_xref="HOGENOM:HBG560530"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199B3D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E383"
FT                   /transl_table=1
FT                   /translation="MDLQGFIVRGQVLSLMRQLIRATRNAPSDARAELRAEIRRCFEQA
FT                   KGHADRVTVKHLLSDGRLKLKMLKEMVGFTT"
FT   CDS_pept        join(248094..248535,248944..249390,249862..>250274)
FT                   /codon_start=1
FT                   /gene_family="HOG000200800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631134"
FT                   /orf_name="MICPUN_81187"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62512.1"
FT                   /db_xref="HOGENOM:HBG743299"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199B485"
FT                   /db_xref="UniProtKB/TrEMBL:C1E384"
FT                   /transl_table=1
FT                   /translation="MADWDTSLVTDMSGLFSGKWSFNQDISGWDVSKVTDMSNMFNQAG
FT                   QFNQDLSSWKVGAVTDMSQMFQSAWSFAKTADMSGWDVSKVTNMQSMFSGAQYFNATGL
FT                   SSWDVSKVTDMSYMFYGASKFNDDISNWNVGQVQQMRSMFYDAMDMPSWDTSLVTDMSR
FT                   LFSNKWDFNQDISGWDVSKVTDMSGMFDNAGQFNQDLSSWKVGAVTDMSQMFQSAWSFA
FT                   KTADMSGWDVSKVTNMQGMFNYAQNFNATGLGSWDVSKVTDMSNMFYGASKFNDDISNW
FT                   NVGQVQQMRSMFYDARDFNQDISGWDVSKVTDMSGMFDNAGQFNQDLSSWKVGAVTDMS
FT                   QMFQSAWSFAKTADMSGWDVSKVTNMQGMFNYAQNFNATGLGSWDVSKVTDMSYMFYGA
FT                   SNFNDDISNWNVGQVQQMISMFTGASIFNADITGW"
FT   CDS_pept        join(complement(253387..253458),complement(252735..253210),
FT                   complement(252236..252674),complement(251384..252025))
FT                   /codon_start=1
FT                   /gene_family="HOG000191744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631135"
FT                   /orf_name="MICPUN_81047"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62888.1"
FT                   /db_xref="HOGENOM:HBG738660"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniParc:UPI000199B486"
FT                   /db_xref="UniProtKB/TrEMBL:C1E385"
FT                   /transl_table=1
FT                   /translation="MTQFSGAVKLGDLNDFINPSQACIDDIDVPAGGEMILNKRSKAPV
FT                   TEDLTYLFGQPEKPIGQWGIEKKNDSDAIKVSLSDCLACSGCITSAETVLLEAQSVDEF
FT                   KQQVAACAQSGGRRVTVVSVAPQSRASLAHAAGLSAIDAAKRLTGFFKSMGVVAVFDTT
FT                   AARDFSLLEAGEEFVERFRAQNQNQSQNQNPLPVLASACPGWVCYAEKQSPGVLPHISN
FT                   VKSPQQVMGTIVKRRVAASLGLDPAAVFHVAVMPCYDKKLEASRGDFRGEPGVGGGDGE
FT                   GPPDVDCVLTTGEVAELLAGAYGIAVKERDGYSTEAAGAREGAAALARGGGGSGGYLEH
FT                   VFRYAAAKIFGIEVRGALEYKIPRARNPDLREVTLEGPDGTTLLRFAQAYGFRNIQNMV
FT                   RKIKPTAHDIHLGTSRDGCGYDYVEIMACPSGCLNGGGQLPPPPPPGEIAGSGGARPRA
FT                   MTAKELVDELETKYRWGDGTVEPRPPDASPEVAEAYRDWVRGAVGSERARALFHTRYHD
FT                   RGAEAAAAAGGAVAAAAQLKLTSDW"
FT   CDS_pept        complement(253571..254503)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631136"
FT                   /orf_name="MICPUN_99893"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62889.1"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="UniParc:UPI000199B487"
FT                   /db_xref="UniProtKB/TrEMBL:C1E386"
FT                   /transl_table=1
FT                   /translation="MADLEALWADVADDDAVDVRAAGGRAVCEGCARPASACLCDRLPA
FT                   QPVETRGALVVLTHPNESKRALNTGWILPRCMRRCEIVRGRYPPQHLQDRMAGMAPDVP
FT                   MYLLYPSTSATNLDEVSVVDDAAAIVSASTGQVSLGPDDVLAGAAYVCVCIDSTWGQAR
FT                   EMAVPTLEKMPARTRLIQLPLTSTMDDDVDGSRVDAPGLRRFSEGDGGAGSLLTPPAPG
FT                   AMLTAEAAARAVAMLESTCPGGGGGGGGGGGGGGASVERWCVGAVSAMAGFQARHDPAM
FT                   SGGAVKRGGGRRQRLADPSRLEGAAGRAL"
FT   CDS_pept        254705..255388
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631137"
FT                   /orf_name="MICPUN_57593"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62513.1"
FT                   /db_xref="HOGENOM:HBG559961"
FT                   /db_xref="UniParc:UPI000199B488"
FT                   /db_xref="UniProtKB/TrEMBL:C1E387"
FT                   /transl_table=1
FT                   /translation="MPYRICEVSSLEQEHHEASGSGDTYGPEHDSLKIRSKFPKEDLRP
FT                   RGRLIYALLGIFYLPLVIDGFWHTWYGAIQPVDPNVTRKKSPFQDFLHSCDDCPLPIRC
FT                   LCVGFPILIFGPEILFMLIPAYVLITSAFSILFHLVYYVLWDVRYFGNDAFSMRETIIY
FT                   GEEVWEVSVGDTAKLRTFPKESPPFPFNLSQGDRIKVGFGPFEYWCLFRKQTQSDATAR
FT                   SPSPV"
FT   CDS_pept        complement(255465..259190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631138"
FT                   /orf_name="MICPUN_57594"
FT                   /product="Histone demethylase"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62890.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG560532"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniParc:UPI000199B489"
FT                   /db_xref="UniProtKB/TrEMBL:C1E388"
FT                   /transl_table=1
FT                   /translation="MWHKDTRAPLTIERCLSSMPSDTADLARESHAWLQKHGAINYGAI
FT                   DVPPPKPPTPEPEPAPENAEPEDASPPTTITDELLTERTVAYLRTADMNTTTEKQIRKA
FT                   IEAELGADLTEKKLVVRAIVTGFLEDPDKYRDVGKGKGAEERREDAAKAKAAVAKAKAE
FT                   IEAAKPKPTKPVIIVGAGPAGLAAARMLTSHGHACVVLEARDRVGGRVHTDSSSLSVPV
FT                   DMGASIITGCAADAKRRTGLPWLGVRADPSATIAAQLGLGLKTLGNKLPLYDGVTGELV
FT                   SDELDARVERHRDALMDRARLRVDREGDDATAKMSLAEVIEDELEQAFGENVAPSPAAA
FT                   AAADGAGEGEEDGEKREKVTLTARERRLLGWHWANLEYGCSAPLSKISMAHWNQDEPYG
FT                   GFGGPHCMVRGGYGQITDALAAGLEIRFKIVVKKVEHFGGEGDAGGVVVHVANGERFEG
FT                   SACIVTAPLGCLKSGDIEFVPRLSEAKSVAIQRLGFGRLNKVVMEFEKSFWDDGVDYFG
FT                   AAREHYAPDAQATGDDPIGGRGRMFMFWNLKEACGGASVLVALVAGSAAEAMESGDESE
FT                   SSLVASAMGVLRRIFSDRASDVTTPKKVAVSRWGSDPYAKGSYSYVAVGASADDYDELG
FT                   RPEESSGGRLLFAGEHTCKEHPDTVGGAMLTGWRAARHALHVMNGASGLPFDEVFKLVS
FT                   LEDIAGSDDSEDSDVSGSSDDSDDEDDADRGKKRKKETKKETKKRRGKKGRRVDGEDGP
FT                   EDDEKARERVRRRLEKEKQERMEQLAREQKEMTDGKEEVKRVLRLVSACPDGASAPVDA
FT                   VTFDGMLEMMPSLETASGRGAFCQCAVAKMPRAQLASLALKDEGACLAVLATWLEQVPS
FT                   KPSGKELSSKMLKLLLALDTDAVDARALKESGVARVVADRFNAHAIPEIRLLARRCAHH
FT                   WSKAASAAKARRDAQSSKAGLAPEDTPLGDFIDDDDASMDDSDSEREYDPDGKRRKKRA
FT                   EQKPPPKPMTVEEIIESAAGLQEGFAAAEAQRLKLEADAALAAAHAAAADAKAEAIRAE
FT                   EVAKERLRGVWDAAPRVGKKQKLRMKTFEDFAKHKTAKREHKKRQRLEREREDAEDARM
FT                   EAEEAAAAERGAGGSPGGGDTAGGGGVDLAAAAAEAARVASLGPEERYRENVKKAVRFY
FT                   VRKQLKQGIKEKKLRGLNKELCGKIEEKIAAKVVEGSTSLGAPGDSVEAFLSKQRREKV
FT                   KKMVESYAASYAKAKK"
FT   CDS_pept        complement(259380..259616)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631139"
FT                   /orf_name="MICPUN_57595"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62891.1"
FT                   /db_xref="UniParc:UPI000199B48A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E389"
FT                   /transl_table=1
FT                   /translation="MGQVKKYAFRRRLEKHNYSLLGAELSDSDADETPVTPAMEAAAAA
FT                   GLDASALSHMEERDFAHVTRGGAERIAQYLSVR"
FT   CDS_pept        259802..261004
FT                   /codon_start=1
FT                   /gene_family="HOG000264752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631140"
FT                   /orf_name="MICPUN_57596"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62514.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199B48B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E390"
FT                   /transl_table=1
FT                   /translation="MGGDPPPDPYEVLGLSQSDDPSPGDIRKAYHKLARVHHPDKAPAD
FT                   KKDEADARFKEIGAAYALLSDPKARERYDAHGHEDEYEDPREWMEAETHARMQYCAAMG
FT                   VPETVVRQLWCTLEELFTGTRRHERVDIFTVDTGYRGMPGKETMRFNVGVAPGWRDGRE
FT                   IRFGALGTNRLQSVVFVVRELRHPYFSRPRDKTSADVLVRFALTKAQHEAGAVVSVPTL
FT                   TGRPLKLSIKANSAVARSGGVKRIPGEGFPIAAETDAGADAIKPGARGDMVVKLRVQSA
FT                   FETWLRTGNRMRYARTLGYVVGGLGCTYVILGCLAYALDVEGCRTGRVRVPDELLLGNF
FT                   PGAYGLLGAFGTEMFGRSEARVSERIAEVWDPAELGMRVALECGWSSRAPAMNQLFRMY
FT                   V"
FT   CDS_pept        complement(<262890..263255)
FT                   /codon_start=1
FT                   /gene_family="HOG000044480" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631141"
FT                   /orf_name="MICPUN_81193"
FT                   /product="Predicted protein"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="ACO62892.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG621633"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI000199B48C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E391"
FT                   /transl_table=1
FT                   /translation="MSGRILEHDFASVVRRLNMLPENQVCADCPTRNPDWASVKHGIFI
FT                   CLNCSGIHRSLGVHVSFVRSATMDTWTQAEARMMEKGGNNRQRKFFDKYGLHNGTPHRE
FT                   KYNHQIAEAYRGKLKAEA"
FT   CDS_pept        join(263588..263668,263790..267284)
FT                   /codon_start=1
FT                   /gene_family="HOG000264750" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631142"
FT                   /orf_name="MICPUN_99896"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62515.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560535"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B48D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E392"
FT                   /transl_table=1
FT                   /translation="MGRYSDDGDTASIPDFTRGVTVTADGMVRKEDFDNAIKSAQEALR
FT                   AKTSSSQMMLEQASSAMRNAVSALSLSEQEVANLRAVVKELKEGQDGASGNEAVNRERA
FT                   QLRAAQQRVQELSQNFRALQNEVARMRYEQEGVDMPVAAKFPVRIDPMLSSKVVVIAQL
FT                   VMLGYSYADSEDAVDAVRVHDTELALEWLEGRNVRKTSMLPGTDRQSSQFKLGSAARHA
FT                   GAEAGQREQTHAQSPPRLLKAPTSPRERTSPRSILPTRGSRDDPDFANAAKHRRPEHRG
FT                   NYNPSDLYRARKRAVTVLSECAENPPPNLSRPNQLRRQTDALAALTRLTEGVGAHLLVQ
FT                   LGCIRVATRVMQREANNKRVVSLCLDMIRGLLVNPLSFVHASRSRGFEEMPRAICQVVD
FT                   KYHADDMDACGAAAATLWPAATVGKRPAQDAIVNAGAVDFIARALCRPKSDDPSGANVR
FT                   KLIGCLLALAIRNARVQEHMVKSRVRALIRKGLVEHAHISFKGEFSALRDWTKDEFTNP
FT                   TPLPNGVTIDPSGYKPPSRKASSPPGSPQAKRGAQPPNSMLKSPAGETPAGGRRKAPAP
FT                   AGPVAERLGLKPDQMYLVRKQAVTMLSAMAVNPPGKKSGVSPRESEETAYRCLLALARL
FT                   SAKDSAYIVLTNGGPRAAIDCLRLYPANMDVTYAAFKVLRGLLGNPSTMMKLRKQKRFR
FT                   IIPAAVIDGVYRHDSLDVRAEAAHCLWTYSGVGGVDAQDLVIGVDFLPVLKSGLEEARA
FT                   MDKGRSDARVRKFVGCTLALAKGNEPVQDLLVAEGMRALLRKSLVEFKTITFNGEFTEL
FT                   RDWIRGDRGGAKSATKSRESPNERRAAELRLAEDEREKAARAAGGRSVPGGGFKTPDAG
FT                   RRMMSTRQERERLRREDEAAMRTPTNGSNNERFVAPSTLDRGLGGRFQEATPFQSPPGS
FT                   KLVLSDEPASVASKPAARPDESGARFTPKPGGSGGSWSVEPAVLALDDATDARRHPAAT
FT                   EALAEMFAASPAAGVEIVMRGGIGALAHAVDVSPADGSYAPGGLALIHALASADATSRR
FT                   VKADESVKSGRALVAVLDAMDRFARDERTQQWGAMALWAMCRDNARAKARLIRSKSNSR
FT                   LRSGKSPAAVLLSALELHGEQSEPVAKSCIGAMLCVATNEPEFQSELAAVGAPRRILET
FT                   LETHRDMSFAGEFDALREWLRECAR"
FT   CDS_pept        join(complement(268055..268678),complement(267392..267985))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631143"
FT                   /orf_name="MICPUN_80602"
FT                   /product="Monovalent Cation:Proton antiporter-2 family "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62893.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI000199B48E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E393"
FT                   /transl_table=1
FT                   /translation="MEAYLVDIARLALTLAALALGGRLGALIDAPLVGEILVGMLLGPD
FT                   GAGFVPENSAVVLVGDFALCLLVMEGGLSIDIGALNSVGPIAFAIAVSGTMLPIALGVA
FT                   YMSACGYGVMAGVAAGTSLSSTSIGMATKVLQTLGELTSPLGNLVCVAAMVDDVLSLVI
FT                   LAVVSNVEGDDQGGGRDVAWMTSRPILASVGVGVLGAGLAVAIPRIAGTLFPTADDAVV
FT                   WAMLGLSLGVVVAAGAAGSTHLLGAFVGGAAFSGLSNARRAFARHAELNAWLTSVFFLS
FT                   VGTRIPLRGMFDARGVALGAGYSVFAVVGKLVTGAWCHPDWPKARAVGWAMVGRGELGF
FT                   VMAQSAHAGGLMGDAPYVASVWALLIATAASPVFMRRAIDVWKRLETLGNGLETSGNVE
FT                   DVEAVR"
FT   CDS_pept        join(268823..269118,269235..270111)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631144"
FT                   /orf_name="MICPUN_57600"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62516.1"
FT                   /db_xref="UniParc:UPI000199B48F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E394"
FT                   /transl_table=1
FT                   /translation="MSAFTSAFESLVGPTRAPNAARVSSRRATRGASTVAAAADSKSAG
FT                   KGEQAERARMNIAFPTEEQAEMMEKLGFDKPGQEDTVPLVADKFKWDEDRPFHRYRDLE
FT                   HFKHDLSHIQYGGKDGVDDRSPGANPRALPSPITYRVTVPNGYDKNRDVPYPTVVAVPA
FT                   DAGFGQALNATGATKVICDDEKFHDKNECVVVELGFNRPTWLADTVATNHESFFLDVIL
FT                   PRVLARYNVGTISLIGYANGGFGALNMLLRHPHLFHRVAVADVPVLGDFTGYMRPWGHV
FT                   DFGGDDDELKPPWASFADAFPHNAMFLPYNAGALATCEYVSGEMGFSASGEARIGMWSG
FT                   ARTRWEMEQLAEQFEEFGVPHRFSTEFDDTNADWNGEWLKEALAFLAADM"
FT   CDS_pept        complement(270201..272150)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631145"
FT                   /orf_name="MICPUN_57601"
FT                   /product="BZIP DNA-binding transcription factor "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO62894.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000199B490"
FT                   /db_xref="UniProtKB/TrEMBL:C1E395"
FT                   /transl_table=1
FT                   /translation="MDAPSDRDLTLAPSSSRRFTGESHAARSTAIPGTPEHGPAAHDAT
FT                   ASPDVSPAVSIDELPLPPLDPGMLDDHVDPLNVDVLDDFDVAGGSGILDDVFTLDPDQL
FT                   FVPPGMQQPAGSGAGSLQHSAPGGSLGGSDLEKGFENEDPEKRTARLARNRESAQLSRQ
FT                   RKKQQLSDLERRCRSLHAANSQMHQLVARLSHENHALRHHIASTGGAPLPPHLQMPATP
FT                   PPVVVLPPGATPPPGMVPLHPSMMPQATKVPLPTNGATHSCAPTPPEKPTPPEKPGTLR
FT                   DEVPGSIPPAAAAPAVVATGGGKRRKATGGGVAAVTAGALAVLSVVCLAGVGSRTGGSD
FT                   APAAAGAQLALGSSARMARHQRRLMSIDAVAKEEEKPIPMRGAGREIALRQPPGVDLWD
FT                   ARGKASYRREVLRDTAGEDSNIDASNGATALHRLSSRPPSSGPEASFGEADPLFAAFRA
FT                   AGLRADALSRVICQEMFRWTPGPGNATQTGNGVDVELARRVRVAMEEDEEEESGDGGGA
FT                   EDDGEADGTFEKIGRATSAGELLPAAIPLPPSVAPDGTGVALNVMGDASRRMTTSAAEA
FT                   AAARSISTGRFDGEDDANLVSVLFGRPQSASDADDDSRLFVVTHSPRSSEYVTYACRFP
FT                   RGTYIGSAAAAARS"
FT   CDS_pept        join(<273661..274122,274216..274524,274609..>275013)
FT                   /codon_start=1
FT                   /gene_family="HOG000200801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631438"
FT                   /orf_name="MICPUN_69006"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62517.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG611230"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B54F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E396"
FT                   /transl_table=1
FT                   /translation="GCHYAREPYKNPRGHATRLVALASVGNDRKERWLHALALLPASRQ
FT                   PPSALQQLPPDTTRSPYDVGPGAGANNEGTDGGFAGVRWEEPRAKRARVASQVRTDPLK
FT                   GDPDKTVFVRNLAFRADEGALAEYFAQCGEIVDLRLGRDVESGRSRGFCHSDEERNADR
FT                   DRRREEKRSRMPPPPPGGCWFCLSNEKDTHLVASIASESFIAMDKGGVVPDHCQVVPVE
FT                   HTPSFAALSPSAADEIWRYLGAIRSCLRAGGGGAPRHLALRSKGGNHMHLNCVPVPSDR
FT                   ARKARKIFEQAAKRLGFEWEVVEAPESALDLQTAIASHCGDGEYYAVHLPDGTVLLRKI
FT                   GRGEPHWMSFGREVLGHLLGCPERTSWQNCMETEEKETERANAFKASFEAFD"
FT   CDS_pept        join(complement(275788..276309),complement(275124..275630))
FT                   /codon_start=1
FT                   /gene_family="HOG000100023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631439"
FT                   /orf_name="MICPUN_57603"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62895.1"
FT                   /db_xref="HOGENOM:HBG560049"
FT                   /db_xref="UniParc:UPI000199B550"
FT                   /db_xref="UniProtKB/TrEMBL:C1E397"
FT                   /transl_table=1
FT                   /translation="MSVSALTLVARPTGTAPLRARPAKAGTRARTAPRASGKDEEESAG
FT                   GIDYASLERRVLNLKKQELVGHTGHLPVVVLDATLPNQRLALRFDAKDVSRRMHAGTEL
FT                   GKMAEVGDKFAMLGLAPGSRQVLPLGTEVVLSRISPWPDGSGDVEIELIGSRRIRIEGQ
FT                   PFNENGVPTAKVTFMEWAPEDSPPSKNGEGVIGGAHPSASNGGFASGTKPYGFNEKIVD
FT                   GDPMTSQPNAAKCFKMAEDLEPLVDEWYGLVRLGGWERIPGQLDLIKSHIGEMPPREEP
FT                   ARRATWVASLINPIPALGVAYEIRPALLMARDTITMLTVATEGIRLSIERLRQGKNPPK
FT                   SE"
FT   CDS_pept        complement(276654..278114)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631440"
FT                   /orf_name="MICPUN_99901"
FT                   /product="Predicted protein"
FT                   /function="carboxy-lyase activity"
FT                   /protein_id="ACO62896.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="UniParc:UPI000199B551"
FT                   /db_xref="UniProtKB/TrEMBL:C1E398"
FT                   /transl_table=1
FT                   /translation="MRGERPLFAGVAVGTLWLTRRCSGLKRLLLCAAVLGPWLFALPVA
FT                   RAHDTDYDAYRPARSHHRRVEDHHRDVKNAWNEHVVAPFEDFANDVAELFTPNEETPER
FT                   GETINPTPVEERCPWITEGVVGAARANPLTKALIERTRMSHPFGPGARDEAFKVASEEN
FT                   KDEKFGWENAVVLAATVKIDRAAADAWLPKPVLNISDVDEAILFVAWYPDSFCCGAYHE
FT                   AALLLKVTVDGRRALHCPWMLVDSDVALIAGREILGFPKKMGEFEFEVTPPGIEPTTAS
FT                   NGPTDTAGTAPDASGEDVSGKDFDPDVSLSPGARITARVSRNGAEILAISGVVSGRTAP
FT                   GSTIMPRSRNVVLNAQTSHPLPAPTADANADAACLGNRPRILRFAFDEVPTAPGPWTVV
FT                   DAKVDVGSTRTDPLGVPFGVPIDGGQRGEKASDGEKASDEAVGPAEVVDAVVGVTSFFT
FT                   GEEPTPRLFETIPRGWLEDDDVYWLRYQ"
FT   CDS_pept        complement(279719..281590)
FT                   /codon_start=1
FT                   /gene_family="HOG000007703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631441"
FT                   /orf_name="MICPUN_93912"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62897.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG477011"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="UniParc:UPI000199B552"
FT                   /db_xref="UniProtKB/TrEMBL:C1E399"
FT                   /transl_table=1
FT                   /translation="MRSTVVPQAVATEQAAAVKTADAPRWALETHFGYDSVYSSSIDAE
FT                   LDAIEQKCKELKANFEGKMGESLLDAIKAYEEVDIALTKALSYVSLSCDTKLDDDKAQK
FT                   RKASLFQRYSTISGNQLTFFSLELADMSQETLETQMENSPELAKYQAYIDEVRRSQPYN
FT                   LSKEVERALTVRAPFAGKGKVVEFYGNELSRLRFKDGDEEVNMEVLLAKMTSSKDAATR
FT                   HECMKALNTGLKEFERVAALSLNMVAGSWHAENTERGFEQLRSQRNLGNNVPDEVVDSL
FT                   LDAVKTTGVDYCKRYYALKKGILKNTAGLEKMTWADRNAAINIGTSSESYTWEEAVDIV
FT                   KAGYEKFSPTMAGLFQQMVDEKRIDVPAQNGKRGGAYCSSSYGHGPFQLLNFTGTQRDV
FT                   ATLAHESGHGAHFMLSYKQGILQFHPPLTLAETASIFGEMIVFRDLLEKAPTDEDRLAM
FT                   LMGKIDDIINSVVRQCGFDAFEEKVHSGRAAGTLTPDEMTEAWQQTMVDYYGAEGEVFD
FT                   SYADTSHLWTYVSHFHNVPFYVYSYAFADLVVGSLYGVYQKQPEGFEDKLLELLSAGGV
FT                   KGFREALEPFGLDPADPVFWKDSIDAHLGSLMEEAEQLAAQLGLSDP"
FT   CDS_pept        join(282056..282469,282641..282877)
FT                   /codon_start=1
FT                   /gene_family="HOG000265076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631442"
FT                   /orf_name="MICPUN_108045"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62518.1"
FT                   /db_xref="HOGENOM:HBG560541"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="UniParc:UPI000199B553"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A0"
FT                   /transl_table=1
FT                   /translation="MANRDTALSREQHAFLQALMAKGAMPEKSAKRLYAEIASMDPAEA
FT                   NKTFSRFWNPIASALGYLDLDIRVIRYQEDQQLYIGVVNKTGGEAAKLATRLTPEQIAL
FT                   FRVVLDEIMRDDGTVERGVDVITALNATQVAPTQGETQGDGGLSQAQTQSVAKMSKMEK
FT                   EATLKQLCKDGWLTQADDEAGFLKLGVRAFLELKEFLLEQAPERARAKWERML"
FT   CDS_pept        join(283026..283158,283270..283315,283413..>283512)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631443"
FT                   /orf_name="MICPUN_74175"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62519.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="UniParc:UPI000199B554"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A1"
FT                   /transl_table=1
FT                   /translation="MPVRIRLARYGHRNHPFYRIYVADSRAPRDGRHLEIVGHYDPKPE
FT                   IDGNKHLGLKIDRVKYWLSVGAQPSDTVARLLGQAGIIPPPPRKGGGR"
FT   CDS_pept        complement(283704..286070)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631444"
FT                   /orf_name="MICPUN_99903"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="ACO62898.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG607662"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI000199B555"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A2"
FT                   /transl_table=1
FT                   /translation="MAVDLSDAVIDLESARSAARDAILSALDARPGRKALVMDPSFAPT
FT                   LTSLCTMSELTEHGVDGLYQLEGGSVETECDEIVFMVKPRVALMAALNETVRGVILDNE
FT                   LDRAEHREQHGDDPALWDPRSETYNPDVPPPPRVPNMTVCFAPASTDACEGELRRLGVH
FT                   DLLIRRECAVDLVPLEPDVFVADCDEAWRDLTLEGDVSCVKQCARALHALQRRCGWATV
FT                   VKGKGTAAKEIAEAMERMRREAFASDPALNPSLFPGNGHASDYDSSSESDENDDPNDDP
FT                   NDDDDKGRERDRRGRRFRPAHPGVEDPAPPPAPAIDVLLIIDRDVDPVTPLCTQLTYEG
FT                   FVDEAVGIVNGAVEVTGDDGSSTRVRLNSNDALFRELRDLNFGRACDALKEKTSSMQRE
FT                   YETIKGGKVQDQTVGEIGGFVKKLGEKQGLELHSNLAKRCLETTRGGAGASADDNSAFM
FT                   RGLEVERMCVEGRDLDKILEHLRNLVHTSGDDPRRAARLLALASLTHGGIPAAKLEPVR
FT                   LDMLRAYGSRILTVFGAMEQCGWLATREDKSAHARAFPAIRKPLALVVDDVDDHDPSDV
FT                   AYAFSHSGYAPASCRLIHHALAGSFRLIDDVLRALPGPHFEYTQGFDPNDGSPAVTAVD
FT                   ARVFQRRRERAVGTAGGLGLDQHNPNPKPPRRGPGRRPTCVVFFVGGVTRAEISCLRFM
FT                   SSDKMRMGVDFVVGATSVCGGFDLVEQVMGPDVAAYFPSLDRGGSTRVGGGAAASGRGA
FT                   ATKGDAAGDESGDNVEDAPASSAFDAFVASFPKWM"
FT   CDS_pept        complement(286246..287313)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631445"
FT                   /orf_name="MICPUN_57610"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62899.1"
FT                   /db_xref="UniParc:UPI000199B556"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A3"
FT                   /transl_table=1
FT                   /translation="MSCKCCGKPADPEERRAKEMYAGPAFHLAPPPKPPAPRRLEHSWQ
FT                   HEWDASDRPPLYEAPKPNAFRPPPPAPRIPPAAAARMAGLDSPTVRAPTRDDDARGGDR
FT                   ADDGAAGATSPAGTADSAEAVRAALGLSPRSPGGRADAAGNPSSPAALGDVVTAKNALV
FT                   SASRAFADAPANARNAAEWRASLALDPAKARQERQIGDLMASLGLNTRKKRRNLVYPDA
FT                   FVASAAGTAVDDARESQSQQRREAAQTQAFELSARVDVASVSARATAFGPAMSPAVAEA
FT                   RASDYPEAGSWGIRAEVARYDAAHPGGFGSDGGSFAGVSSDGWGFAAADGRWSSPTGGA
FT                   RREGGVGAGLGSLRR"
FT   CDS_pept        <288277..>289273
FT                   /codon_start=1
FT                   /gene_family="HOG000027797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631446"
FT                   /orf_name="MICPUN_67391"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62520.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="HOGENOM:HBG595429"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199B557"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A4"
FT                   /transl_table=1
FT                   /translation="AHPLREELDDLTYSDDVTTAPAAPIAPAPTDATPCVFVDTPEALE
FT                   DMVAHLDKSNEMAVDLEHHSYRSFQGFTCVIQVSTRRMDFVVDALELRGLIRDALGPVM
FT                   ADPRVMKVFHGADMDVQWLQRDFGIYVVGMFDTGQAARVLELPSKGLAYLLDHYCSVKA
FT                   DKRFQLADWRVRPLSEEMISYARGDTHHLLYVYDRLRQQLDAVGRGDGSKPFRDLIRTT
FT                   LDRSRDVCATLYEKPVTHPLTYHADYRKNRDAGDLDLPRLAVYAALHGWRDERCRAEDE
FT                   SIGYVMPRALMLRLAREAPTNPRALLAVTRGDSPLVAKHSGELVDIISRAL"
FT   CDS_pept        complement(290616..291281)
FT                   /codon_start=1
FT                   /gene_family="HOG000262685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631447"
FT                   /orf_name="MICPUN_57612"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62900.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560543"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B558"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A5"
FT                   /transl_table=1
FT                   /translation="MDHDDRSLKSPIEVLEFWFTDAYTDAAKRHLLNDTAFMGKMAGTL
FT                   WYAGTRADASCMRFVSTIEAAAAGTIEDADPRWRDEPHASIAKVILFDQLTRNCFRGTD
FT                   RAFSCDHMALELSRRMARDDALVDSLPGAVLHFIGSPFLHSESLADHDLSLALNDVVMA
FT                   KDEACANFARPHIIAHRDVVARFGRFPHRNKAMGRTNTEEEAAWLASDEVPGWARSQG"
FT   CDS_pept        291502..293226
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631448"
FT                   /orf_name="MICPUN_57613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62521.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199B559"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A6"
FT                   /transl_table=1
FT                   /translation="MDDAEKQRRRKLALQKLARVFKGDEPARRPASNAYGVLAERKILT
FT                   TILRTTTQPEIASLVRDRLAVISLDSDSDADDAPTSAPAAAANEAKARLEAEKSAEVTT
FT                   WLREVANGTRPVPGILASPEYWEELGAPAKDAANARGRERYRARMKLRARCEPALAPGE
FT                   TIVWPHLGDDYNDERLSLIRQHLRENGYAQFPSFAVAAPDADENGGANGGEVVAGPDAQ
FT                   GRSATPGFEPPTSLLRERGSWRWEGARVPVKADDGARRDLLQSVVDRMRRFGAWSPAAA
FT                   FMYDATWQIIDAAFDVAGVLLDADPDDGEVTLEPSCFAWALRCVDEDDTAGGENGKNGT
FT                   GNVAGSIPGGNFSLPHRDYPASEAWNATSDSPNLVSAWIPLTDATTDNGCMYALPRYAD
FT                   AHWSDPTHPDHLAPATREEGGGTTLRFDVARAVPMIAKAGSVCAWAGQTVHWGGACGLR
FT                   SDECDWNTRAIPRRSVACTFRLANKDKSEGKGEGKGKGAAKKGTDFTQGSSALAPMTRD
FT                   ECRRLTLEGRFRLLAQSLLLYSGWHPVPGALRAETIELERRDGIRRLRLGGSDRRVE"
FT   CDS_pept        join(complement(294523..298602),complement(293265..294485))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631449"
FT                   /orf_name="MICPUN_99906"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62901.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniParc:UPI000199B55A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A7"
FT                   /transl_table=1
FT                   /translation="MDDPDGWDLSDGDDGTEPAPVDRTPSADHPTADDDFAREVLAAQE
FT                   RRESESQRPDTLGDPPSDDDADDDDADDEDDSEHHGGWDDFSIKTPWERAVHNIESVVR
FT                   RWLRLSDEDLAAQSSRCARPEHGGRDLRCLRTLIHHKMDHFRPDPYAVILYYPKHSPPN
FT                   VFHERRGDRPDAVASHESSAGPAESRGAESRGAESRGAKSRGAKSLLTHRFYCDAAEDN
FT                   AGGTSGIQRWLGVGCPFIVVEPPSSYSRCFSGGDETATVVSAVNIALVNTAAPSCWAIV
FT                   APTGGPSRGAFLGRAGGITKDAGGWGMKIETDSLAGVVAEKARGRSLAGLAKTLEETLE
FT                   HVDWDRATRERMAKARATARLTFPTNRRWAAERAKYEKRKKKSLKTGVAFDERRSRGTG
FT                   WGDGDGWGFSSDGSDTDSDEARPGAAFMALAGGQRVRGFGRKGANRAAEDKKGGSESDG
FT                   SDFGITLNEWDDEAPWAPWAALDDPWESVELDACWVDAPLGSLVDRDYIYLGGSGSEDE
FT                   DSDEERGRERRDGKDLLEPEKAPLWTLRAVPTGAFREDGSGGMAGELSAAAKRFDIGAG
FT                   IFSESSQTSNSFYDNKGDVDGRDDGPGGVGLAEMLWLFASAGGVRAAPGADTMSRLASP
FT                   EYWDEVGSRYDADDGFGVGVPPRVPPESVVQDVLRDVFDTGGPRRDAGRRAPAKSPETG
FT                   AEADADEAANDANDDEKFRRSGPEALFPTPQKSAPPDSLLARVALHAMQFGNVRAVAIL
FT                   WQRFVREVRFAHWDRGVPLPRMDGSSSGETAPDILACAMHQKLQMINACIHRRKARAEA
FT                   EFAESGVAKLGPTPLAGSVMQSAIVSQDSAGAQAWEDATADGWGDAEDDVWNDANANDA
FT                   KGGNGWADPDDDIDLTSMLGGAIADKTTRTGAAEGTKTDEKQIDEKPPVRPEESAGDDA
FT                   LDETRSEEYGSASDGETDGGWRWDDGDVDGDPDAPPEGVKGEMPGGLRMLKPPHRLMAE
FT                   PIAQLPPLYTEDMMREREAALSALGDTEDGRAIRLKMQSDMLVSDMSAFKAANPGSCLA
FT                   DFVRWHSPRDWISDENGDERVRKGSKSPLAPTGCLSERMRNEGNAWRTLWRDSPRLPAS
FT                   RQKPLFDPIKEGEKALHHLEQAPPPEIFAQLCAAATSAVGNLYARAKGATLAPCPRYLA
FT                   RAADVARSVFNNSRGSPATESDYASLAGELQRAERCVARGEALRHRLPGVSARLLEEVL
FT                   RVAAADEERRDEHNAAVAEKKKRAAAAAAAAAAAATRGPDARAEHPPVVRDGGGGDDDE
FT                   EEGRAEDEEALERLRSRPVEVSVLDGERDALARLLPPDLERRGARAASCAEYAVRCGGG
FT                   VEQIQRAHALAAPCFTRMHLRCTRLLEPLVNLLSSPVATVTRAMVATEARKARRMAAAA
FT                   AKAAAEGKTLDAKSLASAPVKPVPASAPLHGHRPAAHQNRAGAEAPSRAPHGASKEPIL
FT                   KGIGTKAGGKYTPPAILRAVANAARNKEARAGAGSGATATAAAVDASNPNRADWTCAKC
FT                   GKSNFAKRLACFKCASPKPGRVFTAAGMKGYEKRRARREAKRAASEAEGVIGSDPSEAG
FT                   RTQSAEDATSAPRKIRFRDGDEATTSSIGRTGTEGGADGGRDGDDANGGDGEKEKKEKK
FT                   EKKRKRVSKKASDAGRAPKRLRDPDAHLEYLARWSEATQERGDRPPEGFKPANGWKLDK
FT                   NVQNWLIHNACDESEVDDDAFAMFLLYAAGLRGGPLERMRDAAGEGNRGKGIGAERARK
FT                   VLRVLANVDS"
FT   CDS_pept        join(298781..298838,299015..302784)
FT                   /codon_start=1
FT                   /gene_family="HOG000264713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631450"
FT                   /orf_name="MICPUN_57616"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62522.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560547"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013932"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B60F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A8"
FT                   /transl_table=1
FT                   /translation="MSGSAALGAILEKISSHDKDYRYMGTSDLLAELSKDSFRATPEVE
FT                   RKVTEVVLKQLDDQSADVSSLAVKCIPPLVKGASEKTTETVIDALCAKLAMTAKSDAQR
FT                   RDAGVIGLKSLVAELGDSHPASGAVVASLAPKLVAFFAGKSTDEPDAAVVGDVLDILRA
FT                   AATSHGRAMAPHHAATRDALLAYLKSDGRVAKKRAAQCLAALAASFTDAAAAATVDDVL
FT                   GELSACTASAGSRGGAGDERALWAWLLGALARCANAGLEFSKKIAGATPAVAELCERAR
FT                   GEEEEPTREACLQALEAFAARCPGECAVHLARVQCLASDLTSYDPNCDDDDDDDDDLGD
FT                   SAADAGDDAADEDMDDDEYGDEEYSDDEDDSSWKIRRAAVKTVAAVARASPATLEQNFA
FT                   KIASKMLGRLRREREESVKLDVFEALEDIVRTCAGHGESLEAAARACAPRIARAATARL
FT                   LDRTSGAKVKTAALRLTRETAAALPGSLESSLQTLVTALATVLAPNGGPAAGGSALKVE
FT                   ALALAGLVFSTRGGQPTDPAFVDSLAPHIFAAAGDKYYKVAAEALRACRALVPVVERDA
FT                   RWHAAALAEAALSRVGATDQDQEVKDAAISCAGTCAARLGDVMGADLKRCIGLLLDRLK
FT                   NEITRLAAVKAIGAVAKSELRLDMGDYAATAATALAGFLRKTNRPLRLACLAALEALVS
FT                   KHSGSLSDAEVTVAVVEAAELVTDGDLAIAGSALSVLESVLESTAFPNAAAAVCEKALP
FT                   AALTLVRSALMQSHALHALTSFFAALVAANLPAVKADDLLARLMDGGSGSDGAGGSETM
FT                   KAEGEAAAVAGRTAAVCVAAVCAGVNDAKHTSATAAALVKQLGDPASLAEKDLLALFCL
FT                   GELGKAADLSNVAGIEAALLGALDAPGEELKSAASVALGGVATGGRGKFLPMILSHVAN
FT                   ESHKHQYSLFLSLREVIRNGGVDQAAEDASRTLEILFANAGSEEEGVRNVVAECLGLLA
FT                   VGDASSLAPALAEKVSSGDARTRATSVLAMKYAALALKADDSSNAVAVFAQVLPKFVGS
FT                   IPLRDEDRDVRRAAVQTLSAAAHAAPALARPILADALPAVFEQTVIDESGVRVVDLGPF
FT                   KHTVDDGLELRKAAFECCDTLLDACLPADSLANAGESISGCASGYVAALVTGLGDHYDV
FT                   KMVSHALLAKLATRPGASAVLLQRLKELVDPMGKTLTAKLKSDAVKQEIDRNEDLVRSC
FT                   LRAVDACEAHLAGASNDPAFAEFIAKTVNGERTAAKYAAIKAEAKAADKN"
FT   CDS_pept        complement(302878..303792)
FT                   /codon_start=1
FT                   /gene_family="HOG000264712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631451"
FT                   /orf_name="MICPUN_57617"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62902.1"
FT                   /db_xref="HOGENOM:HBG609086"
FT                   /db_xref="UniParc:UPI000199B610"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3A9"
FT                   /transl_table=1
FT                   /translation="MDIADDDDDDYPGFMGRAWADDDADDLGVSITPDQRRAAVRRGGG
FT                   VADDDGSNARAAGDDESDDDGDAANMWIDAATEMRKRIDDRERADMELLGRGSNDPRDR
FT                   DWTRDDIIADAGASWFENDEDWYEPEYKAVDAPDGSVLEKVQRLNLRQPKEFGFSDGEY
FT                   FDLTGYVKDNTDNQFALVLEVAERARERRIEHLESMNPAPPDQVLPPIQQAIVDLALEV
FT                   ETSGGKTSAFLAMREAADRARLRWELQEAAWAWDNYCEEQMPALGVSERAARLLHMGKR
FT                   VEDAMDFEKDLNMHNADYNIRTR"
FT   CDS_pept        join(<304916..305332,305661..>306539)
FT                   /codon_start=1
FT                   /gene_family="HOG000242486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631452"
FT                   /orf_name="MICPUN_67228"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62523.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B611"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B0"
FT                   /transl_table=1
FT                   /translation="QEEAANILRKTHKIKVAGAVNSCPPPLATFEDLRTVHGLGRAMLQ
FT                   RLRDAGFHEPTPIQRQAIPILLEGSELLAVAPTGSGKTLAFLLPMVTKLAAKDDEAGGP
FT                   RALLLSPTKELAQQSFRILKLLCRGTNTLRCVWSSATQNNEFAKVDILVATPLRLKSLI
FT                   EKNKVSLGAVRYLVLDEADKLFEMGFVEQVDAAVAACDGPNITRALFSATLPETVENLA
FT                   RSVMTQPIRLTVGERNSASGAIAQSLVFCGQERGKLLALRQLIDRGIKPPIIVFVQSKD
FT                   RAKQLAKELSGDGLHLGLIHAAMSDAKRRAQVDRFRAGDTWVLVATDLMARGMDFVGVS
FT                   TVINYDFPGSPHSYIHRIGRSGRAGRPGAAVTLFTEEDADRGDLRAIANVMKNSGCDVP
FT                   GWMLASGSRDPRDRRKKRKDGKEDNPRREPIDT"
FT   CDS_pept        306930..307778
FT                   /codon_start=1
FT                   /gene_family="HOG000265026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631453"
FT                   /orf_name="MICPUN_81207"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62524.1"
FT                   /db_xref="HOGENOM:HBG610041"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199B612"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B1"
FT                   /transl_table=1
FT                   /translation="MGCCLSKQTTDTSQNVARNASQREMAWKTTGIVGLRDARLTSLPA
FT                   KIFSADVAPKCRNVDASNNKIASLPPSIGTLVNLQRLTLTANALATLPDELAQCVNLRV
FT                   LVLDRNAISRVPDCVLASLTKLQTLSLAHNKLAAMPSVASLAKLEKLSVAGNALTSLPD
FT                   GVGRCAMLEELDAGDNPVDAIDASLGALTRLRVLNMERTRVSAVPPEVFKGCVSLVTMS
FT                   LHGCPVDADAIEETDGFAQYAERVRDKHGKKIHGGAMVGSRGLDDGVDRATGGRNIAPH
FT                   R"
FT   CDS_pept        complement(307874..309838)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631454"
FT                   /orf_name="MICPUN_57620"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /protein_id="ACO62903.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="UniParc:UPI000199B613"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B2"
FT                   /transl_table=1
FT                   /translation="MAPTRLTVVLVGQTGNGKSATGNSLLGRDAFVARRSLKSVTERCR
FT                   VRYAALDADDEPIVPGDPAVGVDEDAGGIRRPSTVLRVVDTPGTCDSGALLEDNLRHIS
FT                   AFLRGEERVDESTADDDDDDGAEAGAGDEGLHALVLVLSAATRFTQEEAVALERLVQRL
FT                   GEGVMRHSVAIFTRGGELAADDVRVDDFVRSAPPTLRQLLARMGHHADGTPPILVENVP
FT                   RDGSSRAATARAPLLTAVRELVKRVAAERRCDPNQATYDAKALTAASHAADADPSTAAL
FT                   AVLDKLKRQMASGPMAAGGGGGADPRRSAMAEAAMRAFSDLQAQFAARAGAGSVAAPAV
FT                   PPPGCGVFGGFGASSVGDRVTDRVVDREWMEWTNALADGGDGDAAGGPSLTVGLRGAGD
FT                   VHADTACAVHFAGGTCLLRFRAPVECGDGKDPVARFRSSGRVSAVGDGGFIVSASAPVG
FT                   SNAADAPAVTFHSPVFLQGPCHYAPTNPIVTDDDWVEEGVYKCELAPCADPFPAPFAKY
FT                   LFTDDDDDDEPPTHGRLDGPRVVCMLRGVKPGDAVNVRAVVGRKGTRFELQGGSMSLRA
FT                   CDFAMKPLPRALRSRESTSVSFAVDGVLDLTPGVNMALGAPVSQDPTENTTVQIPKGFE
FT                   WPWKRGEPGRKPGQGDPSK"
FT   CDS_pept        310168..313047
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631455"
FT                   /orf_name="MICPUN_57621"
FT                   /product="Glycosyltransferase family 22 protein "
FT                   /function="calcium ion binding"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO62525.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B614"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B3"
FT                   /transl_table=1
FT                   /translation="MAKPHSFMKGLFDSALGDVMGNIISDLGHELSDDVLSTRAARAFR
FT                   AFDTDGSGRLEFHELQRAMDTLPNSCRPAREADARALFRRFDADASGALDVDEFAALVR
FT                   CLRSRARLDRMPGVIYCGGVLMNPSSNPELARRLLYSKPYEPWSVLARAIAKPTRVVAS
FT                   ATNVVSNGDARGSSRKAASAMCHADSDSEDDSGDSGSERDDDSALEDPGGGGGGARGGT
FT                   HIVRASHKPRTSTSTASSSSKKTSRNRGSALYAALLAVRLLACLAPGYVHPDEYHQSVE
FT                   VAAADVLGVEVDHPWEFTSKNPARSALAPHLSAGWTYGAWRLFRRCRALFAGGFQKHPT
FT                   FDFFEEHEERVLPAVVFLAPRLGMFFLSLTLDAAAYSCAESCSKSSGTKSGQTKRSGQT
FT                   AGADARIALASSWPVLVFAVRPFSNSLEACLLAVAALVTLARPRWYRWRVSGTLGFIAA
FT                   IGIWTRFTFALLAIPLGVRNLESTLRFRVYPLASSVLVTCVGVSSFVATAAVLISADTA
FT                   YYLGGKALVDALNDPLNNMFNNVVVAPLNSLRYNANVANLAAHGLHPRGTHLAVNAPMM
FT                   FGPLAFFAYAALLRSIFSNHARTDRRKLLEGSGDDHRISIHLHAKRPAPTHAPKRRAAG
FT                   VGGSARATVRRSNRRALWLCTILYICGVSVAPHQEPRFLLPLVVPLAALFGAEVTRTRT
FT                   RSLAWIAFNLAGFIVFGVAHQGGVASATAAVPSVARDEWTRTLTNARAGVTNTNANDDA
FT                   AESLLNGLESESASTPPRVHAAFWRVYTPPLALLARRSPEEHAWETGATLASTPPLAAW
FT                   RRRNRVVSASDFSSSDDVSGDYAGDFSGAINPDLDETRPALDQKSLHRVHAADLTGLPA
FT                   AGVKYALRHGRCEGAAERGEPCVTLLVAPVTAVEADEALAAAVEAVRTFGPHFSGEEMD
FT                   AYVRAYRTGGARAVLEGMRLGVYRVKESA"
FT   CDS_pept        313226..313462
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631456"
FT                   /orf_name="MICPUN_57622"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62526.1"
FT                   /db_xref="UniParc:UPI000199B615"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B4"
FT                   /transl_table=1
FT                   /translation="MGCGASTSKHGAASVLTVQYQDSPAAPCVDAKTMRRIRRRSCAVH
FT                   KLSVSPAKSQRTVTRFVPTRDEEDGDDDDDDEA"
FT   CDS_pept        313737..314264
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631457"
FT                   /orf_name="MICPUN_57623"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62527.1"
FT                   /db_xref="UniParc:UPI000199B616"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B5"
FT                   /transl_table=1
FT                   /translation="MVRRRNFDDPSIFTSSDDDDEDDEEEPGVHFPVGRSRASGQRKGV
FT                   ETPSRSVCIPLGPSRRAARGAKAREVEPTHRITDRRGDDGRGDVLVELELSGSLASLER
FT                   DAWAEISHQKYSFRAGLGAPVVCTQSTFHLGVPGRFRANVQLPAKVREGARVVRASEGK
FT                   ERGRMVFVLPCC"
FT   CDS_pept        join(314367..314489,314584..>314866)
FT                   /codon_start=1
FT                   /gene_family="HOG000029472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631458"
FT                   /orf_name="MICPUN_72186"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62528.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG749867"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="UniParc:UPI000199B617"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B6"
FT                   /transl_table=1
FT                   /translation="MDRYVKVDAPSPSLPTDDDEVRVTTGGKIRDVVEYSLARLEDASQ
FT                   GRVTLAGVGKAITKVITVAEILKRRVAGLHQRTSLHTLEMDETFEPKDEGLNVVRRKRR
FT                   VGAVTVTLCGDISRIDAGAVGYQAPVPEDEV"
FT   CDS_pept        complement(315192..316421)
FT                   /codon_start=1
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631459"
FT                   /orf_name="MICPUN_108046"
FT                   /product="Predicted protein"
FT                   /function="cysteine desulfurase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine metabolic process "
FT                   /protein_id="ACO62904.1"
FT                   /db_xref="GO:0006534"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0031071"
FT                   /db_xref="HOGENOM:HBG635316"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI000199B618"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B7"
FT                   /transl_table=1
FT                   /translation="MKGIVLKGRPLYLDMQATTPIDPRVLDAMLPHFVEQYGNPHSRTH
FT                   MYGWEAEDAIEQARADVASIIGANPKEIIFTSGATESNNMAIKGVCNFYKGRKSHVITT
FT                   QTDHKCVLDSCRHLEQQGWDVTYLPVKSNGLIDLDELRASIRPETAVVSVMAVNNEIGV
FT                   IQPLKEIGEICRANKVFFHTDAAQAVGKIPIDVEDMKIDLLSISGHKIYGPKGVGAIYI
FT                   RRRPRVRMEALISGGGQERGLRSGTLAPALVVGLGKACAVAGEEMENDLAHVERLSKRL
FT                   IDGIAAKCEHIQLNGDATARYPGNVNMSFAYVEGESLLMGLKEIAVSSGSACTSASLEP
FT                   SYVLRALGVDEEMAHTSIRYGLGRFTTEEEVDRAIELTAEHVAKLREMSPLWEMVQEGI
FT                   DLKSIQWSQH"
FT   CDS_pept        join(complement(317405..317599),complement(316945..317163))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631460"
FT                   /orf_name="MICPUN_57626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62905.1"
FT                   /db_xref="HOGENOM:HBG756650"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniParc:UPI000199B619"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B8"
FT                   /transl_table=1
FT                   /translation="MALRRAAAIIARLPNTAAHTRFAPAGVHSRDMSGGLERFREGQPV
FT                   QSKRPAYDERDTAHTDKWLEAAVPSPMEMINEIEPIPIHADRVSCKSKGACMDRYGERV
FT                   GLGAPNTYYQLNSTTKDAPVKCKYCGLRFYGVH"
FT   CDS_pept        317971..318615
FT                   /codon_start=1
FT                   /gene_family="HOG000264721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631461"
FT                   /orf_name="MICPUN_57627"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62529.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG411886"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="UniParc:UPI000199B61A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3B9"
FT                   /transl_table=1
FT                   /translation="MGRIVREDVAHQRYLTVFDREVEFDIPGESAPTRINYDIVGHPRS
FT                   RFQFSVVFPFHPRDASNPLPTVTLIREYMQGSNAMGYSLPTGSFDPKKHANFADVAVDE
FT                   LAEEARLRGGVMTSLLPREDHPGFLESKWCANRFKPFVCVGPESYEGGGVQGGAAVGDE
FT                   PPKRDAEEFSITVHRVSLEKLAEIMNGGDMTPPSVVTSHMALAHLAKEGML"
FT   CDS_pept        complement(318728..320080)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631462"
FT                   /orf_name="MICPUN_57628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62906.1"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniParc:UPI000199B61B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C0"
FT                   /transl_table=1
FT                   /translation="MTSPYGGGFGAYQPGGGLGAGTPLGGAGAPGSLLGGDRYGGTPMT
FT                   GGQGAMGSAGRYGGSLLAGGGGYQGGGLGAGGSATLAGSGHDHGSYGDLRAAPGSGIGR
FT                   HQQPFAPMLFSSPGASAGLGGRGDGRDFVSSPAHAGAQGPAPGRTGTAGYFTGGGGGGP
FT                   AQGTPGSHHAGVSRSFFGANTAGGGDVTPASGRRVFGSNRENQPRTSDGAAGGGATNTG
FT                   GSLRSGAGGKSTALDSGHVGTPWGDKGKTLGGGPSPVRGLNMFGNEPGASGDGYGMNDA
FT                   DGSPNEAWVTVFGFPPGSLAAVLEAFQRDGDVVTHDSFASSPGANSSGATNKNESGPNW
FT                   VHVRFATSAGAARALRRNGTKVSGVMVGVRRLDDDARAVVEREHGGAGLLAQSSGDRST
FT                   LGQDGRRIVRPVAGMSAPGARPSRFQPSREGVALQPRRSVWNNIVEIVFGL"
FT   CDS_pept        join(<321042..321373,321441..>321906)
FT                   /codon_start=1
FT                   /gene_family="HOG000186561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631463"
FT                   /orf_name="MICPUN_80647"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62530.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B61C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C1"
FT                   /transl_table=1
FT                   /translation="KLSDAGVASCLAVIGTNPMDRAKTLTQLPGNKYGKDMVDALRLVC
FT                   KQEGLLPGLYRGLPVAMIRESSKNMFRIGLFAPILKAMHPDKDTPAPAWKRFLAGTITG
FT                   ALGAVSSNPFDLVKTRMQVPAALSEYTGMGQAMRMIVRREGFGTFYKGVGASVTRDMLG
FT                   SSVNLTVASMASEALAANGWFAPGSPALGAVSGILSAAAAVAVMQPIDTSRAYVYLKPH
FT                   LHKDVLHAARFIVLREGPMALYRGSRAHFFRTAPHYALMFALLE"
FT   CDS_pept        <322600..323022
FT                   /codon_start=1
FT                   /gene_family="HOG000250566" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631464"
FT                   /orf_name="MICPUN_81078"
FT                   /product="Predicted protein"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="ACO62531.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="HOGENOM:HBG648099"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B61D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C2"
FT                   /transl_table=1
FT                   /translation="LDERERDTLAARCARVTFQPGAKIMRQGDEGDKFYILLKGSAVAL
FT                   KRDGKGSGGDAAGGGDRDNRVYRSYGPGAHFGELALLTNKPRSATVVAQEKVVALVLDK
FT                   NALVELRSTVPSLEDHIVRGMRHYDHIEMFTSMAMA"
FT   CDS_pept        join(complement(324236..324250),complement(323371..324018))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631465"
FT                   /orf_name="MICPUN_57630"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62907.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI000199B6DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C3"
FT                   /transl_table=1
FT                   /translation="MALDLDRVYKQRIRIQDFFGDFDRLRCGSITPTQFARALALAGFN
FT                   LTQAQYRELSDAYPSTVEDRPVCYKDFCADVNGVFTKYNLEKAPTQEVDPAPASLLDTE
FT                   RFSAKPTRSLGDAKDEEVDALLDAIAEGVRKRRVEVKPFFNDACANQNSPMRVNHVTKA
FT                   QFKQVVRAHVARELGDESMDAVADRFSDDDGFVNFVSFSACVDPKEEAYHPYRRSLQ"
FT   CDS_pept        324663..326906
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631466"
FT                   /orf_name="MICPUN_57631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62532.1"
FT                   /db_xref="UniParc:UPI000199B6E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C4"
FT                   /transl_table=1
FT                   /translation="MDHAWYARDVADLLRWRRVATAVWGSAMSILAALAYLAFARFRPT
FT                   PWGVVAATLSPTEWTKRVAHALALALAQLPAHITAVALMRPSLAPLRIVGGDDDGAVDP
FT                   YGGFAEPGSAGRFAASRVPPHLFPAGFGPSRWCATPSPTNTAAAEAKDAIAHLTAFAAH
FT                   VLSGAASCVALRRGAVTSSSEGLVHAARFGAVLGALVAAHFAGTGARNCAFPAAARPRW
FT                   MRVKRCAPAAAWRGIWFSLAAAGAHAGLRVALTLRGEMATADGVVSLVRVVFDFWFREV
FT                   SDAFRMVPCGFACAGGWLAARAAANVVLTERYKFLPQSLADGPVSASAPLLASLVASET
FT                   PFAQHAAYQDLCAVCEDGGGGRRALLLADKRGDAYAPAMAAALAPVIAVTCAMRAALDA
FT                   AERADRGIVGGAWKSGSNKLATTGGGVKLRVASSRATGAADAMGAVDGGRSAPPTATAP
FT                   PTATNDAGGASAGDLAGAAAWSMIADEWGVSPSAPPPPAASRASRALDDATPATQGASG
FT                   PKMYAPDRASHSSAPTSGATLTARQLRHQMERPVVAAAEECVAAIAAYGRLASWGARAA
FT                   AALAGVDARGDPNGVVGARAPTAAQTVRVLLAATHAARECERAGAGAFGAGALGRGASS
FT                   SSSSRRMSPRVPHLAPAAGPAAALADAFQTALFGLVSRYGGDEVRAMAAGGDPAAVGEF
FT                   GDASGLNGETRGVDAVGGLAGLTGAARREAEIARGLRAPVELERTLEALLKWE"
FT   CDS_pept        complement(327037..328221)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631467"
FT                   /orf_name="MICPUN_57632"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62908.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI000199B6E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C5"
FT                   /transl_table=1
FT                   /translation="MRRGFLGAAPPKRAETPPEPRGDPEDGLGFDRAFERALLAQEAGR
FT                   ATEASSSSSSDATLGVTLRSSAANASSLDGALTRHWPHGHVIVPSADGHADNLMLMLHG
FT                   RGDVPAPFAKLARSMALPRTCCVALQGPHPIPFVDDGRAWFTFMDQETFEPIDGSDPTD
FT                   TRRVDSLDRVVTRLAKLIDALTSTAADADDAAPTPTWPRSRVHLFGFSDGGTVALTAAM
FT                   RAYAEGKGRLGGCATVCASLLPEQIRMLSKVASGTHDGSISGDDGSSNDGSSGDPTPVT
FT                   LTAGESDRVVSVSSVRETADALIDVNPGHVASVHAVPGKSHAMVGGTRGEGEMRHLMGF
FT                   WSLTLWRPGVGGDGGGGTEAGDFGDGVVEVDGTNVRVEKVESEEDGDDDPYALD"
FT   CDS_pept        join(328387..329094,329371..330042)
FT                   /codon_start=1
FT                   /gene_family="HOG000218626" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631468"
FT                   /orf_name="MICPUN_57633"
FT                   /product="Predicted protein"
FT                   /function="tRNA (uracil-5-)-methyltransferase activity "
FT                   /protein_id="ACO62533.1"
FT                   /db_xref="GO:0009021"
FT                   /db_xref="HOGENOM:HBG608402"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="UniParc:UPI000199B6E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C6"
FT                   /transl_table=1
FT                   /translation="MSSTARASHALCARTCRFLSGRTASRPGLSSASQAAAAAERAGGS
FT                   PAHRGRRGWQWRAVRARLDVAVRPDTYREELDVKIERARSHFAAAPAPAPTPEVPHPKP
FT                   LEEIHLPPTEVHESARSNFRMRAEFRVWHDGDRSYLAMFDSDDPKTPIEVPSFPMGSEK
FT                   INELMPAFIEEIGRSEVIRRKLFQVNFLTTMKGDALISMLYHKPVKTDEWELEAEKMRQ
FT                   RLGVSIIGRSRKQKVVLGNDYVMEEIEVDGRVLTYKQLEGGFTQPNAGISAKMLEWARS
FT                   AAVSDSADAVGEAAAPARRNDDLLELYCGNGNFTIAMAPMFRAVLATEVSKVSVAAAKL
FT                   NADANGAGNVAFARLSSEELTLALDQGKQFARLDDVPPLESYDLRTVLVDPPRAGMGEE
FT                   VSTFVSRFDRIVYISCNPETLAADVRTLRDTHEVARFAAFDQFPYTPHLECGALLIAKG
FT                   R"
FT   CDS_pept        complement(330152..332659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631469"
FT                   /orf_name="MICPUN_57634"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO62909.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B6E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C7"
FT                   /transl_table=1
FT                   /translation="MQYVGSPQTTFRFGSTPTRSMSISSLASMAESAEEPEDGDHGETA
FT                   AHYFSRRFSVGSFHQRRRSGSVQSLSSMDGARAGSVGNSLSILGSSAEGHHRARPPRPG
FT                   RAQSARGGMLSESLGRQHSSRSVSQSPTSSNPTSPHHSNVNLPHVAGHPRAAPFERRSS
FT                   LGRAGYSPETRVVGFGAGSTITTSPGRSLNAEEAETTRAQRAYLGASDDGDGDGDGDGD
FT                   EESAPGSHGGGGRGKGKRARGGDDVNSVHSDAEATDSPMNDDAYETASDFFPQPSVKSA
FT                   GALVSLLHCVSFTSALIIAAPLPLLPRAVDHLGYGPGWTGAIFGAFAVGTVAATKAFNS
FT                   FTNADGGRAALMIVGLFLQGAAGMLFGVAGELGFSDPADVLCMFFACRALVGVGVATTH
FT                   LAVYAAINGSMGSDPARLKRTLKVNELFVALGFAAAGPLVSWLSIVGDSYDAGASGASG
FT                   DSNNTGASAAGSGTTLGGNNPNGSATYLGMGGFRLPFQVTGFLVLGNAVWLAGDPGCLA
FT                   AGTRREWLDALLDEEFESVEARAAELSADRAERGEGGADGGAESIGRRDGGGGRDAGTE
FT                   VSTENAVTSRRRLLGSPRLVAVGGALFLACVAFGFVQPMLSLYLVDHRGFDAMENGWAQ
FT                   FAVAGGYLVGLLAADVERERDWISAETLTAAGVFVAGCSVAAIGAADALSDVTLFVTLA
FT                   VFGVANAHVLAPALEGMKRAASDAMGPGAAVTEGAVRLYNVFQDAGQVLGPLVGGLACA
FT                   GAGFEGAAGVLGAAVCLYGVLALSYAASRARPASLDGGPAGVGPVTAVTASRRLPRPAK
FT                   SDASLDERLLGYDYDGSAESSMS"
FT   CDS_pept        complement(335162..335998)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631470"
FT                   /orf_name="MICPUN_108047"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62910.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B6E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C8"
FT                   /transl_table=1
FT                   /translation="MAILTAVGAAGAILKRPMFAFFFVTSLSMVYGGLLLVPNTYAFCA
FT                   LFVIFPLVRQLVFSTFFSYCASVFGYGAFGRISGVASTLAGTIQLSMSPFIGVVEEGGR
FT                   WPFPDDMDLASRWRAADVFLGCVPVFLLVAPVYYMSRSAPSSRDGDDFDEAEKYSEAEE
FT                   PLLSGDDRDPEAGINVAVPRSASHMSINRMHRIGSHVSSVGSVRDKWEIYASVGSGAMG
FT                   VSPASFAPVGSWMAGRGERAGVDAGSGSGTRSALAGSAENGRQRRHSGFRSDSEEE"
FT   CDS_pept        complement(337489..338145)
FT                   /codon_start=1
FT                   /gene_family="HOG000218433" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631471"
FT                   /orf_name="MICPUN_108048"
FT                   /product="Predicted protein"
FT                   /function="rRNA (pseudouridine-N3-)-methyltransferase
FT                   activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62911.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0070038"
FT                   /db_xref="HOGENOM:HBG622807"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="UniParc:UPI000199B6E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3C9"
FT                   /transl_table=1
FT                   /translation="MRRGFLVDPRARRGPARSSHSSPARAQPRGLTPWVRVPTRSMATG
FT                   GNNVDIERRKANARAVRAVPIRVILVSKGGGKDMDNACGEWSGRIGRYAPFDEITVKTN
FT                   PKNAKDPKAQMEGEGERVMKHIDSRDLVVLMDERGKDLTSEALAELVAEAGDGGYGGLV
FT                   FAVGGPFGHGAAVRERADRTIRLSSMVMNHQVARLVLLEQIYRAWTILKGEPYHH"
FT   CDS_pept        complement(338369..340027)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631472"
FT                   /orf_name="MICPUN_57638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62912.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B6E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D0"
FT                   /transl_table=1
FT                   /translation="MRREYGALDGDADPPGPSSSSGGGGWPSWWRLRRQRGGALGGFAS
FT                   FFGGTRESVSVANCLMEMQAAVVVSACVATLSAGLFHRDPAVKVDPSLPWSAQGSHAGA
FT                   NSPTFVSLVHVMAHGGYVLAAPVVGVGVELLGFPVVTALAAALCPLVASGYAAVDFTAV
FT                   SRGLVRARLLAGAWKATHELSTASGNAVAFTPAASAQAFGRQAAVWSVVSVAAPFAISL
FT                   LVPTLGVPGVFIALSATGFVVFCAATILVLTPWMAAGGDLPPRAPCLNVLSEEEDGDGD
FT                   ERSAPGDERSAPGDGGEGGEGGIVSNEAKKKAAGLSLAAASSRDLSPRSTPTESSWAST
FT                   CVSMLRDPETRCVIAVSAAMGAAEYSVAGAVMMLLSGVMSFDASGCAMFLALRELPDVA
FT                   VQLSATAYLRVVSVPGTFAAGLALAAGATAALAALGEVAGEGAPGGVDRRLVFAAGCAH
FT                   GLGVGAVKVAALPAMSQLVEDRHGGMFGVGLGAQGFAQKLAGGAVGMVGLAVLIEVAGF
FT                   TKALATFAAALAVSACGAWWFARGIALRFEGLEEA"
FT   CDS_pept        join(340200..340661,340869..341468)
FT                   /codon_start=1
FT                   /gene_family="HOG000034586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631473"
FT                   /orf_name="MICPUN_80905"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62534.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG704164"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="UniParc:UPI000199B6E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D1"
FT                   /transl_table=1
FT                   /translation="MPPKKKREVEEGGVADLPAADEAGDGTRDSNDDAIEATTPAKKKP
FT                   AKKKPKVELPDVIPQSDAPRAEPPGSTPPGAKRFKAISWNVAGLRALLDKNSHTLRRIA
FT                   DVESPDVICVQEHKLQDVHVNDAVRRLGEILPEYRTVKFAVSTAKKGYSGLLSVVEGMG
FT                   DFRCGYTDEGRVLTLEFDAFTMVFTYVPNSGQKLERLEYRLKKWDVDFRAYLAHLDGET
FT                   RGKPVIVGGDLNVGHLDEDIYNVDAPHTKKQCGLTPEERSSWTRTLESVKLVDTFRAFH
FT                   PNARGWYSYWSGRAGNKPRNRGLRLDYFAASERIMSSGRDGGGVRVVDSFVLDKLVAEA
FT                   SDHAPVGITLALD"
FT   CDS_pept        complement(341558..344785)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631474"
FT                   /orf_name="MICPUN_57640"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62913.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199B6E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D2"
FT                   /transl_table=1
FT                   /translation="MWRRLRRIPVGWIDAATTEARSARARWGGAWRRVPAGGPSWSIAS
FT                   IASVAPSTSVATNRRAPAPPPPTTTTATAGSAGSRVACIRRPPPPPVDPSRGAPAARLD
FT                   ARRGFAASPTSSSDGTHNPVSSILPRKHFTDAMRAARDAGDVPAVMKHFAELCERYPDS
FT                   QGPGAFEILLSVAAAEGNPEAAVDTLEAMLSLGYPPTHHTHRKIIVAHNRGGQLDRAWE
FT                   WLQMLAESEGNEYLAHAEGNAGARLFDAILVGAGKVADANVFNECWRVMRSMGVDPTEG
FT                   TLEAHMLMESKVGWSEGVETAWERRDAGFEYLHPISKRSPRLFCRRVEAHARIATYLLK
FT                   PRDVRRGGRAVGVGGDGGGRAGGRNSRETRRAAWISRAAAAIALDELYARTTPEPATDT
FT                   AVNGDASGTHAVTHPRDVRDATTTLCNAYAACGDSDAIRDLMERAQLAGVAPDSHMFNA
FT                   LLRSEAADRSLAWDPAEDAGGNAGGGFSVGGSIPAGHVAGNGAGIGYTHAEELQDAVIR
FT                   VEEMMRDMLESGVRPDLHSFMALLAAYAKVGDVAAAGDALAGMKVRGIELDTWAFNALL
FT                   QACAAASDLDAASKVRASMKKSSVAADDITFLHLFTACARRTRQVAVALRDEEDWDEEW
FT                   EWGGDGEGGAWVDEDEDGARRHHLGARAAESHAKLAGALLVDPGVGGSIPGGDLRGTLG
FT                   RAIGVREAAAAAAAAAREGLSSVRGVFEDLRSDGEPIRLTPASVDAHRFPPSSSSLSRR
FT                   QHVHAASPELARARAALREFRADMDASGVAFTPQCATALVQTMGRLREFDEMMAFVRSP
FT                   PAGVPPDVYMYTQALHALAQDPFHWRRDGSTGDEGNDGPHDVRDASDGRVETGPKAALQ
FT                   LADEMTSLGMAHTRVTLNCVLLACAHLRDYDEAIRRFETHVNGGGEVGVDTYNALLRCA
FT                   WAAGVFSQNASSIAQALENEGLKPNAHTELTLRRCGGFGQGMGGDRDASDALLRRFGFA
FT                   VEAPAPPPREPMPWEKDDEDEKMPTSSSAYKGPPPRKPLVAEIGVDVEDDDDVDKLAEG
FT                   DMEEPLVYSRKDGKLTRAGRRWEKGRK"
FT   CDS_pept        345092..345760
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631475"
FT                   /orf_name="MICPUN_108049"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62535.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199B6E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D3"
FT                   /transl_table=1
FT                   /translation="MAAVKLEACQPDPDAPDRGFLDVVVEFPPMCSASTRPGRPNDDAH
FT                   FVARRIEDALLDSAAIDKRKLTIKEGLWAWKICLDVYCLDHDGSMLDAGLMAALAALRD
FT                   AKVPHVIVDDRGKITYGGRKTDTESSNNTAVEGKIEVAAAPVAVTTALYRKHLIVDPDA
FT                   EEEQLADATVTVTMDGATVVGVHKPGGTAEASETDLMHCVAACRLNLEARAKAIDAAFA
FT                   "
FT   CDS_pept        complement(345860..346852)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631476"
FT                   /orf_name="MICPUN_57642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62914.1"
FT                   /db_xref="UniParc:UPI000199B6EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D4"
FT                   /transl_table=1
FT                   /translation="MAADTALEWIEGGGLSFTVPAAMLDPSVPMSSVLSARTWQEQLSA
FT                   DERASLRRFLPDPTASEEDVRALVAALFGDGDGDGDGGGDTHVNMHFGNPAERVWREIQ
FT                   ARERDPEVMAHRNAIGVVERGAHELEVRLHHARVARAGMGMLRKFRDADADAAGGGDGG
FT                   GVTREDRLRAWHRREATPEPDRSHRVGGSDEDDSSNDETATGRDEVAASEEAAKRAMRV
FT                   AMEAADAASKLAATSGGPGAMAALRAAETAMAAAEAAAAEARRARTRWIEGGGAAGGNT
FT                   AVHGARRSSIGKGGVRASAEKKPKVANPHSMRVDGPIGLNRKFSTNEDW"
FT   CDS_pept        346984..347835
FT                   /codon_start=1
FT                   /gene_family="HOG000237961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631477"
FT                   /orf_name="MICPUN_80796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62536.1"
FT                   /db_xref="HOGENOM:HBG444493"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199B6EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D5"
FT                   /transl_table=1
FT                   /translation="MTDCAEEQEMEVEALLSILMDDMAVVTGSEAIAGVTHAPCYQIVV
FT                   SPLGDGEEEDPDGDESQRARLGLVFSHTPSYPEEPPLIKCRSLRGLFDAELVACKSMLD
FT                   ALAKESVGMPMIFDLAQAAKEWMRDRAGVVDVVEETPEQIQRRLEEEAVARLRAMRATG
FT                   TPVTVDSYREWVEKFDAERALKRLKAGQGGSMDDDADAAGGERRMTGRRYFEERTAAQL
FT                   EADEKAEGEEEEDDFDFGDSDFDDSDEDLIEFMKGGGDGDEDGEEDGYGDGEGGGDDGG
FT                   DE"
FT   CDS_pept        348039..350486
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631478"
FT                   /orf_name="MICPUN_57644"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62537.1"
FT                   /db_xref="UniParc:UPI000199B7A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D6"
FT                   /transl_table=1
FT                   /translation="MRTRRSLASRSFVASVATTTTTATTLLCLVGLLRIPRVGATDQLG
FT                   VTPYAHAARAALDRAADEDPLAKGDSYASLSESHKDVFRRHSSTRTLEEKTEALEAPIV
FT                   RHATVEVRLVGFDGDGVAEVRLTERDFAPYLDALRADVPHVSLTSPDDDDDDDDDDDDD
FT                   GRIPPGPITTRFRFHVTRASRRLCAEIAAAVDDALERADATRGALASITVESSAVTAIP
FT                   HDVVDALIAADHAKAAASSSYVIYILNPAPKAYASRKYAYSYDSAVGRPPGSTGGSGTS
FT                   TSGCVGQLWTGDSNGSIGSNNGRYAWFDLTAGPTSYGPSDGGEGATHALPRVHAAHRRR
FT                   PDQLAVAVAGLLRRAANHLLAPPAAHAVAPKVWRSTTVKIVRVTDTPRGNDGRVPPLGI
FT                   REIESALRKAAGAWEGGEVGGGAEGAEGAEGSAPAVHVTETEVGVGSCSLCVAAMHRAL
FT                   KATARSSTPGSSSDRGANGGDGGGATYAGAEEDGNGGRVLNLDVGRPAGGTHREFLDAA
FT                   ELRYWLREFRSRIAEEIEMDLGDANTGDDGDGVRVIPVFLFDLARTEALLLDGRDSAVA
FT                   YPDMAIAVRTKSPTRISPNGFQCQNLPVLVEPADVHRALLGAVLSAGWGVAPTHLTWSE
FT                   SRGAAARDHAFDVGNSPFGELSLVGRKGQISFAASDAAKRHAILAIVAETRHRASRVLA
FT                   ALARSRDGQGAMTPTAGLEFDGRWASMRRKHERALAAEAMHDHKRARHFAMSANVDLEA
FT                   LTKLVLDAGKKLEARLECFEEAKGSEGLVWRVLSAFAVFATAYFKGKDALGRWWNVKVA
FT                   KQF"
FT   CDS_pept        complement(350570..351769)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631479"
FT                   /orf_name="MICPUN_108050"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO62915.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B7A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D7"
FT                   /transl_table=1
FT                   /translation="MLENENVPITEEDATLLALGIHTDTGSLTFEATTPRDADALAYCL
FT                   RMGASQKVLAEYVNPSLTAEQREVIARGMTDVVKTTVEGITVSRVHVECEEYSPGMATC
FT                   AKEVLDLTDSDVLFMAVSYVHGKKNPYRHVSVIGRAKPVKTVDLGALLKTHLNGGGHPK
FT                   AASAAFRMDQEISSSSSLEAFRASGDVEGILDELVRRVCVEQVPPERKARDVMRHSRHV
FT                   VAATPEMTMAEVGEFLDVHDHRACPVISGEGILVGVVSVTEVDVATIKGQLDRPVSGYM
FT                   KLRSAVTPNTPVSECERILVEQGEGCIPVVANYDEPRRQWRMEGLVTRATILKTHEYYR
FT                   RNRLRSRNGGGLLAERDGDKAAPKVTVNPEVFFDSEMLGLAENTKTVPEADDSVADAGA
FT                   "
FT   CDS_pept        join(352904..352935,353172..354177)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631480"
FT                   /orf_name="MICPUN_90479"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62538.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B7A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D8"
FT                   /transl_table=1
FT                   /translation="MTVPSNVLLQSFRSVLDSPGMSVSHARRGRSIATGFAHPADSAFV
FT                   ASAAVEPQSALVRSAKDVFAGTCGGITVTLVGHPFDTVKVLLQTQSATNPAYKGPLDAA
FT                   SKVVKSEGFKGLYKGVTSPLAGQMFFRATLFFGYARAKEIVGVSPDDPMSYAKAGLLAW
FT                   MAGSFFESPIDLFKSQWQTQIVQAKQNPNYVPPYKTVGECVRASIKHNGIRGPYQAFGA
FT                   TLIRNLPAGAIYFGVFENTKNYFAAKHEDGKPRDWEIMFAGGLGGFFYWSLFYPVDVIK
FT                   SAMMTDSINKAERKYSGFLDAGSQLYKQGGVRRLYAGLVPCLLRASPANAGMLFVVDKV
FT                   KQLLG"
FT   CDS_pept        complement(354301..354996)
FT                   /codon_start=1
FT                   /gene_family="HOG000252803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631481"
FT                   /orf_name="MICPUN_57647"
FT                   /product="Predicted protein"
FT                   /function="endoribonuclease inhibitor activity "
FT                   /function="enzyme binding"
FT                   /biological_process="regulation of RNA metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62916.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019899"
FT                   /db_xref="GO:0051252"
FT                   /db_xref="GO:0060698"
FT                   /db_xref="HOGENOM:HBG668175"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="UniParc:UPI000199B7A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3D9"
FT                   /transl_table=1
FT                   /translation="MFYSGLRRAAALARFASSSRVLASSSSSSSSSAVEASFSARPILA
FT                   FRRAMCADPMHGYDASRAGTCEYTDVHYPDPLDVTVPRKMQVADAGYFRDFGGVTRFSG
FT                   PASTVKCYENNPLVREALGEPGNGRVLVVDGGGSMRCALLGDNLAGMAVSNGWAGIVIN
FT                   GCLRDSEDIGKMRLGVKAIAPHPVKSSKRDPGMREVPVTFAGVTVRPGDWIYADMDGML
FT                   VGGPEKFEL"
FT   CDS_pept        complement(355085..356194)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631482"
FT                   /orf_name="MICPUN_57648"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62917.1"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199B7A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E0"
FT                   /transl_table=1
FT                   /translation="MSSASAQPPSVCAAELAQRRLMECECLAAMYGPMAGDAGDRSSFE
FT                   VVNPDVERELRAAVDAWEASGDSVAAALSVRAVSAPLRVSLTLSVPSASGGDEPAEPGG
FT                   SGPDPCPERGTVTLVASLPTNYPAAEAPALELSATHLSRDAITRVLRELQSLASERTVR
FT                   AAPDGFECLSELAQAVSDLSAVEAAADDEARRRAAESNPGPNGDEGHAHAVVRIDHMND
FT                   SKGYTKTLRRWSRELGVDARVFYELPKSSGEVPKGSEVGREGPPSGGRVEGVYVVLGGA
FT                   GDDVRSFLTRLRTEFVDVDAKGARCKERKSTVMCLRQAGVVKPGEERVPEFDGFECEGY
FT                   VGADGLEDALARFNLLHVGAGAQRFQPAG"
FT   CDS_pept        356332..357960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631483"
FT                   /orf_name="MICPUN_57649"
FT                   /product="Predicted protein"
FT                   /function="asparagine synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="asparagine biosynthetic process "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62539.1"
FT                   /db_xref="GO:0004066"
FT                   /db_xref="GO:0006529"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199B7A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E1"
FT                   /transl_table=1
FT                   /translation="MTRSIAVGAARAFPAGTATRADASPFRGRHRRLARGERRRPLPTT
FT                   TKALARPRIAEEAAGDGDDAARLARELEAMVESTRAAGAGARIHVVAFSGGVDSSLVAH
FT                   VVHRAFGAGDDDDDRSDASPRCVAAIGVSPSLPQSQLQIARDVARHIGIPLWELRTNEG
FT                   DVPEYVANDGESCAHCKNTLYSTLRAVAAAAAAADAEAAPSDVAPSAEQHVVLYNGTNA
FT                   DDLKDPTRLGILAAAHHRVESPACHLDKTRVRRLARAAGLPNWNLAAAPCLRSRLAPGV
FT                   HATPEQLGAVEAAEAAVRVALNVGPTENMRVRVMSRAGDLALATLELDASRVQEVAVGG
FT                   DAFDVVSAELGKRGMWLSDVRAFESGSVAKRSSFAEEEEEDDGDAIAWSSLFLGFAPSV
FT                   ASFGAAPGPLERWDAEQCEIALAGGDAFVVSFGTTWCGPCHVLEPELETLAKLTWEFDD
FT                   SIAVAKVDAEASPAETALAGRLGVDAYPTTVWMRHGREAHRVEGALPAAALVQLTASIL
FT                   MDDEVAEVARATRPELFAPVPLEPF"
FT   CDS_pept        complement(358050..358466)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631484"
FT                   /orf_name="MICPUN_57650"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62918.1"
FT                   /db_xref="UniParc:UPI000199B7A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E2"
FT                   /transl_table=1
FT                   /translation="MWGVVARIAAAAAVLTLVQHNISQMYKAYYDERMKEEAGPTKLFP
FT                   KIDPEDRDGTARGAPRGGRRERGAGGGRSMSTATIASVGGAWAAAVATGDALASRRAPG
FT                   GVGGAASGGGDLTMTRDPRCVAAALRACRTLARR"
FT   CDS_pept        359844..361907
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631485"
FT                   /orf_name="MICPUN_52700"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62540.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B7AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E3"
FT                   /transl_table=1
FT                   /translation="MFVDVVSVIPYDTINVILSQGSSDPDDSSFKAVRIIRLLRLLKLL
FT                   RILRGMRIFKRWEARLTLNYAMLSLQKYFLTLLLAAHWIGCTLFLVHHILELDCRDDPN
FT                   KIDRCTFLYYYMDGKLVDADPAGKYLLSVYFASGELMGTPFGDLIPVRPEERLYFTICH
FT                   LTAGFVNAYLVGGMVAAITALNARNQSFYNSMDILNRFLTEKRLNARNPRLCERLRSYY
FT                   IFRHNEGDGDGWKDIVLRTSREMQGEVVQELHSDWLRRVHYFSGVDVEGNEWEVDDDFK
FT                   LQLSLSMSVEVVAPMETVFKEDSPIDQLYVIQQGVVGCKGHVLKKGDPFGEDVLVYYSP
FT                   EVLDEQEFRTRYGARWVCRPNGRGYRATAMTNVLLLAFPGDAIHELLDRPKYEYIKRQV
FT                   RRKMFVWQVRHVMLTMYRALKEAVAADTYADGMQVLLQQYGFEMMQNVPTINERYMIMR
FT                   EAKGDDEVKVMRLFRKMWNRKRFIAAVEGLVRKRRRERALVEVRDELRLNVLKPVGAET
FT                   YANALVAQGVTTRTVRDFSAMELVTSGLPVVLAKRVYKAARNLPETDVSHVGADGVAVD
FT                   SRFVAGKGCVAELERLDAEAKKKKRELMRSLLYADENDDDDDDDDDDDGDGRPPPAPPQ
FT                   MPPPAVPGGPMHGGRSLLAQHRLGGSGSGSGRSTPRSISRASSSNQLYGPAG"
FT   CDS_pept        join(362315..362436,362584..363433)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631486"
FT                   /orf_name="MICPUN_57652"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62541.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B7AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E4"
FT                   /transl_table=1
FT                   /translation="MGGSTLEVTNLPPDINDADFHHLFSLSGCLGSRLERDGGGRPVGY
FT                   LSFADEPAAMTARNYYNDTTSYRLEVMINQPNRGPPPNQAPVDEDRGGKRMRNDGGYDG
FT                   GGFGYQAGPPGPGPGSMPPRGGGGGGGGGNWGSTDNYGGGPMRGGPPPPMPMGGPPPPM
FT                   GHGPGGGYGPGPRGGPGGPPGSGMMGPGGPGMMAPLPPMPGPPPPMRGGPMGPPRGGPP
FT                   PPRLPDNASPTLHISGVPKDATVREICHIFRPFDGFQSARLVPSKDPERGPLCFAEFTN
FT                   PELAFVALETLEGYLIDRDDPDSSALHIAFAKNKPSGRMARK"
FT   CDS_pept        complement(363667..365355)
FT                   /codon_start=1
FT                   /gene_family="HOG000238129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631487"
FT                   /orf_name="MICPUN_57653"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="ketol-acid reductoisomerase activity "
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62919.1"
FT                   /db_xref="GO:0004455"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG743920"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B7AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E5"
FT                   /transl_table=1
FT                   /translation="MSAMSATRAFVAAPVAAKLSASRKSATGKPYKAGARRSVAVCAKT
FT                   SAPELDINTKVFEKELVDVAGEGEYIVRGGRHLFEKLPEALKGINTIGVIGWGSQAPAQ
FT                   AQNFRDSLKEAGMDTKICIGLRPSSKSNDEARACGFTEEDGTLGETFDIIAKSDLVMLL
FT                   ISDAAQAKMYPRILAAMKPGATLGLSHGFLLGVMASDGETFREDINVVLVAPKGMGPSV
FT                   RRLYEQGKDVGGSGINASFAVHQDATGNATDIALGWSVALGSPFTFATTLEMEYRSDIF
FT                   GERGILLGGVHGIVESLYRRYVKEGMSEEDAFKNTVECITGPITKTISTKGIKAVYEAV
FT                   SDKAEFMKAYSASYMPCKDILYECYEEVQSTNEIRSVVMACERFDTFPMGKVGTSAMWK
FT                   VGEKVRAERVEEDIPLNSFTAGVYCACMMAQIDTLREKGHSFSEVCNESVIEAVDSLNP
FT                   YMHARGVAFMVDNCSYTARLGSRKWAPRFDYNLEQQAYVAVDQGAAVDKEIESKFLNNP
FT                   AHIAIANCCALRPSVDISVKFGVGSARDVESADFKMGDKATADAK"
FT   CDS_pept        complement(365668..366807)
FT                   /codon_start=1
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631488"
FT                   /orf_name="MICPUN_57654"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62920.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B7AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E6"
FT                   /transl_table=1
FT                   /translation="MARQSYHAGAIRGEPRDRARESGTRMRAVLCRALGDPTKPRSEGG
FT                   ALGVEDVPSPRCARDGVKVRVEAASLNFADVLMVQGSYQEKPHMPFIPGGECAGVVTEC
FT                   GADVRGLKVGDRVAGVTMGGGAMAEECVIPERMCFPVPAGVSLAQAAAFPVAFGTAHLA
FT                   LTRYARVTPGQTTVLVLGAAGGVGLAAVQVAKALGAVVVAVANGAGKMRALEDAGADHR
FT                   IDATTLHSNGGGAREDDYAGLKAAVATLTPGGIDVMFDVVGGEGFAQGLRCVKWGGVAL
FT                   VIGFASGDVPRLAMNVPLVKNLSVRGVYWGSHAAHAPEELGKSLREVYSMLADGRCRVR
FT                   VSHAFGLDDAHEGFRTIAERRAVGKVVVTPAGKRAASRL"
FT   CDS_pept        join(366874..370313,370355..370373)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631489"
FT                   /orf_name="MICPUN_99929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62542.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199B7AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E7"
FT                   /transl_table=1
FT                   /translation="MEALYGSLPGFGSAAKNDVDAPIAFFDCIYVGTPGGDSASGSPKS
FT                   PNSVMASNGANGAAPRGGAAGNSRGLGQKPECLPPHVGRIGVYRKFAMFRADMFDLDDT
FT                   TVLLPRSQVRRVDANGKYAVCVVDWHGAPHEFQLPKLSKELYRVLVREWALTEGTFANK
FT                   RGASAVNDRVLDPAKDGPRTMLGELVEDGSLAAMKARADLDARRRSALRRIAASVGRGY
FT                   ERCANVYRRARDVYLEAERFLFPPEPPPPPELHTVDVRAKTDACMFLKIVAAEGLLAMD
FT                   AGGTSDPFATARWGSLECKTEVVYETTSPVWEETFVFNLGTSTSDVIEEDVNLCLYDYD
FT                   LALNDFLGFCRVDLRGKRVSQRGDWSKEPRWYNVGALPADYEEKSGFDWGRLKDQLMFW
FT                   EGKRTYTGRVKIACWVGSRTDLEMRTAEHPRAWRAVEASRSEPKYYVEPLTAALHVTVF
FT                   RAREILPMDGSRDDPGGLSDPYCEVTLEHEKTARFETEQTHFIDDTDSPEWDRKFSFVV
FT                   SRPYTASTLWFKVYDYDGGFDQLIGTVKIKCEDLDIHEGLAKPPPAKWYTLLDASGKDK
FT                   TKDGDPYGDVLIQAYIDEEYLHHMHLQKVRVSDEPDLGRLEVDVFKLHELDDGIKDVFV
FT                   VIKYGPYWSRLPTIEDADDARYDLRSIFPVIDFHVPVVIAAFAGVGDAPKLLGKIKVPV
FT                   AALESNQRYFKVVDMGAVNAATGEVEKGGKLDVALTYRRDAGTIASGVTLARQYVKPVC
FT                   DDKWYYNPIPETEQEKVAKRHKDLVIYQLGLSEPPVKVSIAKEMLDYNRHEFNARMIQT
FT                   SIARLQCVAAEGIAIGNAVNDLLGWKHFHVTASLQTVLFLMINYPRLIIPGILILIGSI
FT                   PLALYPTRRKRALDQISMDYDVSVGKLPPHLDILLNGDSLTNEEVKAREREQKEREAAD
FT                   KKAEEARLRAESEAAAQRAEEEAEAIAAILAEADAESEADSDDDDAAQQAPKMAGSMNP
FT                   FASLMKQYEELTTMIASIQTTMDDVATVLEQILGVLTWKEPRVTFVAMAALVGTGLAFF
FT                   ASQFVVEWTMFVVWLVGKKAMGATSGAASSASADAWAKVVDFVSECWEYLWDNYVEGPY
FT                   NAAAYTITVTMATTTNSVLCAWSFVTWTRVFKATRFVVSLREDGV"
FT   CDS_pept        complement(370852..371892)
FT                   /codon_start=1
FT                   /gene_family="HOG000234711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631490"
FT                   /orf_name="MICPUN_108054"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62921.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG331109"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B870"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E8"
FT                   /transl_table=1
FT                   /translation="MTSLFKKHKRTPKELALKLANALDHLKDSGAEKDQESCGKYLGDM
FT                   RAVMYGDGENPPDPALQSQLAEAVFASEGLLAAVVIHLPKLFFESRKDAAAVFNALVRH
FT                   PLEPDERLPFVAYLEAQPDVVERCLSGSELGDQTVGNDNTALTYGTMLREMARYEPLCR
FT                   RVLYCPGFAKMFEYMQSASFEIASDAAASFREILTRHKALVSEYLEKNFENFFGAYNQM
FT                   LEKGNYVTRRQSLKLLSELLLDRANLSSMLRYIGDVENLCLMMNLLRDEARSIQFEAFH
FT                   VFKVFVANPQKPPPVVAILKKNREKLMGYLANFQNDREDEQFAEEKAMLTRLLEQMGDD
FT                   DAAPAQ"
FT   CDS_pept        372272..373639
FT                   /codon_start=1
FT                   /gene_family="HOG000258801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631491"
FT                   /orf_name="MICPUN_80704"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62543.1"
FT                   /db_xref="HOGENOM:HBG560571"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI000199B871"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3E9"
FT                   /transl_table=1
FT                   /translation="MAPITLDMIRRRAEHNEGMVGNLEEIALHQQEIEKIEALGQICRH
FT                   LKILYMQNNLISKLQNLHRLKELEYLNMALNNVTKIENLQRCESLQKLDLTMNFITKAS
FT                   LLTVHTLDACPKLDDLYLMGNPCADFGGYRAFVIGTLPQLRRLDGKDVTPSERILSKQE
FT                   LPRVTERLMKELAADGVNIEEASRVSDARDLGPDEDDIAEVLAMPEDERPWTAATRVAE
FT                   QREFAKQRDANEESKREHNKRLFNPDGTKKHARREGFPDLPDDLDDVKQCNEPGLTFRL
FT                   DDGDDGNDVVLDCHVGKYMDTSLIDVDVQTRLVRVLVKGKMLCLVLPEEVKPDASTAQR
FT                   SKVTGALVVTMPKAFRKPKRGEEKKDEYVVDGGGGVEGSKGQVGGSNPGKGIDAKNKKS
FT                   LIKELGGVSIRGIVRDAHVADIGGFTIAESVKTAAPATPAVVTAVLDSDDDEPPPL"
FT   CDS_pept        complement(373753..374106)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631492"
FT                   /orf_name="MICPUN_57658"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62922.1"
FT                   /db_xref="UniParc:UPI000199B872"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F0"
FT                   /transl_table=1
FT                   /translation="MSCAASIVQTRVRVGAHIAKPVAHRRVASACAQPPRARSVVARNA
FT                   VGSAGILASSPVLAATPELVELARSDAWFGWYFAPGGFVLGPALLLTIFLVGGAVFEKV
FT                   TGKAVSAKPPKKK"
FT   CDS_pept        374290..376197
FT                   /codon_start=1
FT                   /gene_family="HOG000100046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631493"
FT                   /orf_name="MICPUN_57659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62544.1"
FT                   /db_xref="HOGENOM:HBG366219"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B873"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F1"
FT                   /transl_table=1
FT                   /translation="MVVATHRALVARLAPRLARARLAPATGARLPATREPISEGFVASR
FT                   GGASCRTAGAARTLAWTTAPSSASSTRGPALFRARASHRARHPRPRGVLATPLRASADG
FT                   PAAAPAHPPSAREISSSAVVCYGKPAPGVNVTHQLITFFRFTELKDPNAEVEAHHAYIA
FT                   ENKLEVRGRIYVNEQGINAQMSGKGTDGETYARWVESRPGFTGMRISVYPTDAHGHPKL
FT                   SLRYKPQLVQLEGGTAHLPLHDPNARAKPLKPTEWHEMLGKVIERQVDAPVLLDVRNGY
FT                   EWDVGHFKGAQRPVQESFRETVETNVDDVVGPLSGVDKDKPIMMYCTGGIRCDVYSTVL
FT                   KQQGYSNVFTLEGGVQAYFEEFGEREDQRWDDHLFVFDSRLAMTPGGLPASEAGAEAAT
FT                   LECYCCKEGKAPPPHRNCPNVDCNRLFLVCPACTSKYGGFCCPECGKASHVRPALLQPG
FT                   RYQRYVHYTEGEAMSRASRRGPGRQQRRERRRMRKRLEAAKRTAEAVARGETPRDLIRA
FT                   VRVLEKAAENPGEFGGPASGGGVVGEGTGTLAARTRTIIKAAGLDEESVGGYDSGAGSF
FT                   IEEGGGDDRYVIARARLREAAEAIAAGRVPGVDLRDLIGETAAPAEEAGDEAEAEANQP
FT                   "
FT   CDS_pept        complement(376414..378417)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631494"
FT                   /orf_name="MICPUN_57660"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62923.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B874"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F2"
FT                   /transl_table=1
FT                   /translation="MRGSSRNGSMDNLSSGPGSPAHGVSNGSQHSNVYVKNLSEDVDEL
FT                   TLKGVFDKFGAVESCCVIRDVSTNSSRGFGFVKFMQVHQAEAAIKEMNGKVIRGKVLEV
FT                   KFANSDSSATTAASGVGTISDNIYVKGLPPLWTEVELRAFFKIFGTIIECRLLHASGTT
FT                   TAGALIRFSSMEQAASAVVTANGRVPAGGQVPLVIRFADSHSKTRRSSKSERNLAALPG
FT                   GGPSGVGGGSGHGMNGLGGSIGNGLVDIPGANGGGSRDSSFRGGSQHHPGVVSPGTALI
FT                   SLIANNAAAAGGSAHGSLDIASMLLARQNAVTAAALLQQQQQQMAATADGSFRNGSFHV
FT                   GSVDSASSYGDDSFRRGSHSPYISNSGLGGGVNGGNASGFGGALNALQQQQQQQQQQQQ
FT                   QQQQQQQVPRGGGVNGGVNGVGGLSAMFAGGMDIAGSPSRATGPSTQGITFGTGAPTPA
FT                   SNALDKSSRGSSVRGGNAFGPGSFASASASSLPNVVSPVGSYDKGGLWSAMGAAGGGGS
FT                   AAAAAAGGGVGGGPGRSSLDPLDRAETPGISAAEAAHLLDSLEDAEDDVAAFVPFGGRP
FT                   AGPGVDRSGPSVADGPRALVVSGLPAGADELWVYKNFAPHGAVLEVVLEEGGGEATVKF
FT                   AKGGDAAVALRSMDGRDALSVVAAEASSPAAN"
FT   CDS_pept        379088..380548
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631495"
FT                   /orf_name="MICPUN_57661"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62545.1"
FT                   /db_xref="UniParc:UPI000199B875"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F3"
FT                   /transl_table=1
FT                   /translation="MDDYISTFPGISYDWLVTVRASFTLNKAVWSSGMIPALGAGGPEF
FT                   DPRLRPFCLCRFYLLCLLAFAPTAGTHCGSGGGGGRDMRTACAVAPTARHTYVHRPRRV
FT                   RAAAATSADWNGRRWATTASSVVDMLEMSDAPDEAMRALVPSAWREDDVATGHDRHPGK
FT                   PTTRPGSAILDPGLIDDAERPAFRMASRSRLTPTDARRFPGDDAFSTIARAVCDADALP
FT                   RKELFETWHAAIAITDALGPTSLDADAMTTKTTTTSTGPAATKRRRHRRVMDLAGGHGF
FT                   LAMCLLILNPRLTSAVVVDRRKPDSHERLVSSLAKAFPASRVHARTRYIEASIADATPT
FT                   RQTTLVSVHACGDLSDLVLKLAAQAKSPVAVVPCCHRGLAPARAFAARLNEAYGVEGTG
FT                   GSKPGVPICPSAAMDVARLELLRRAGFRVHARTIPREITPKNRVIVGSAAAAAYDKDED
FT                   DEDDASPGWRSVADTIPASPWKWHVVGT"
FT   CDS_pept        complement(380666..381577)
FT                   /codon_start=1
FT                   /gene_family="HOG000100047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631496"
FT                   /orf_name="MICPUN_99934"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62924.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560575"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000199B876"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F4"
FT                   /transl_table=1
FT                   /translation="MATSAGSAHVSSSAAAALRSGAVASASAPSVVARDLRCFKDGGSL
FT                   LRHGAPSRSRRFGYYRNDYRPPPPNNYRRAPPALPNMEGERMLWSIMGANAFVFACWHA
FT                   LDPRLMQQNFLVSEESVYAGRVHTIVTSAFSHYNLGHLGANMLALYYFGRDLSRIFGPK
FT                   YLLNLYLAGGVAASVTHVAWCRWERERRQSRRRGFISQRAGRWMENTAGYLTTPPALGA
FT                   SGAVNAIVLLNALVFPTNTIYLNFFIPMPNWLFAALFLSRDLYGAQLGLGGSSTGHAAH
FT                   LGGAGVGAAAWAWMRFGRFIRR"
FT   CDS_pept        complement(382266..384518)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631497"
FT                   /orf_name="MICPUN_52705"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62925.1"
FT                   /db_xref="UniParc:UPI000199B877"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F5"
FT                   /transl_table=1
FT                   /translation="MRDVEARRRAGGELGSVPAVDGSTASAQAEMLRTSMTLHSAGSLM
FT                   MELARLISSVHVNGAASEPPPFMSNFARQHEQAQQQQQQQQQAGGGDVTDALAPTLAAV
FT                   QGFLAPPLMYLDPRGGTQPLSGLSMRPSIQQAGLHNMPGVQMPASFAEAVANGVNARAQ
FT                   RMSVNVAAGRPMPATMGDANAEANVPGGGVEAFMANMIDQALDGMMRSAESMADRVQSS
FT                   VTAVSQANGELTDMLTQILQQRIESGALPARQEAERLRDMLQRHRDERRAAMDRERANN
FT                   HPPEIPANVATIQPAQLQQLLQRQEGVARTHTETLEILRRHQNELIGLVESTSLVNHPQ
FT                   VPDILRRTRDRLRAAFDSPTFADFSSGAGAGAGSDDRAGSDDRTAGEATGFNPIRRGFL
FT                   RRRPNPTPAADAQPTAPAAAPAAAPAAAPAPAQGQDRAQGRDQGQGGHGPIHGLVGALF
FT                   NNIFHRGRGQRQQQQQQQQQQQQRQQQQNHPAQAAHAQAQAPQHAQAQAQQQAQAQAPQ
FT                   HAQAQAPQHRVTVHRWEVNLPIGGNAQGQGQSQGQGQQAPVNNAPPEVLQMLQRFMQQG
FT                   QAGVGAAAQGQAGQQQAGGANGAQELFQSVISNLVDNLQNNQEVRQTGQTRLRLVPTPG
FT                   GGFTLLPFEGAAAPAAAATEPVPAVPVVDPAGPTSPAAPDPMVSEPAAGPTSPAADPTS
FT                   PAVAEVASMDVDAGEDGGDDAGAPRGGVGLGAQLPPRRSSARKRRAPHQHPQNDLD"
FT   CDS_pept        complement(<385662..>385817)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631498"
FT                   /orf_name="MICPUN_74882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62926.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199B878"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F6"
FT                   /transl_table=1
FT                   /translation="VLTLKGMIEPVCGVPAATQRLIHRGRVLKDDQRVSSARLTDGDTI
FT                   LLVQRPP"
FT   CDS_pept        complement(386491..390105)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631499"
FT                   /orf_name="MICPUN_99936"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62927.1"
FT                   /db_xref="UniParc:UPI000199B879"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F7"
FT                   /transl_table=1
FT                   /translation="MGKIVPPYGEGALGHLILQVLRDAGEDGLVVTDLIQATKDAGRRY
FT                   PSTGAERSGVTNVIVGGTAQQKKQAKAIFWCANPQEKFLEQRWALRFDDLDLAGLGETP
FT                   TEDTYVPAKGGRRKSSDAADPVEPTAAGASARPRRQRSTRLVDDDSDFEYGDGEDGGDD
FT                   DGEDDDGDEDGSSDDDDAPADPTSPVKPKKKPRGGRRPRDIDPNAPVPNDDRDEKFPKD
FT                   FHKEVGGRVLGGDVWVCFLPRGDESGQADKSFRLFHQDTKTRRWFRDVDDKGFHAPGTH
FT                   VAQLRSIVAVTRYLEREEDRGKLSDEDLVAKYSDPKKAATQPKPSTDNVRSKSLERSKS
FT                   ASTEPSAGKVKSKSLERSKSRSLPAERPAPPAAPPAAAAAEGAPVDKQLLRRMRWGWPT
FT                   AEAIAANKVTSGVPGRRKPGSERVPEDAAAYAFVLVRGAPEGSPPPAVTSPTGWVMCIP
FT                   GAVLRFNDECLLMLAEAWESAEGVATVSGRMVLTRRQLRETYHLGKGGPVRKMPGWQED
FT                   GDLTFATEEAADARQLFLTERVVERRLDDLYVSPDGVPGACLVRARDSRKPPSRGALRD
FT                   GDDVCAVIAKRKYDADWNNVALEDRGPWMRSNAEVFSPGDPPVPRVGATGAARIARGSM
FT                   DASGGGGGGAAAAALAAVAEKRRLKTEGSGEPKAEGSAEPEPMDIDGATKKEKRRRVDL
FT                   LRDDDGDDEGAADGDDGEEYEPEKKIRKKSFVDVVRSGTDQGRPESAPESSREDQRALE
FT                   DQRALDVHAQVRAKADELREQQAQKARAEAAARERAYEEKREREEKARKDREARQMQLK
FT                   QMMERQKREKDNAARMNLMGSAVEKQRKEKEEREKRAKADAERARRESEVESEAAAYAR
FT                   QKEKYKDWPVNPKTGKRSLLLEGARHPVWAPAPPPPAPPPPAPPPPAPPPIMRQSSMGS
FT                   MASMGAHMPRGPPPSWPPPGPPPPPPTAPYLAPTPPDKRDRNVRPGDRDRNRNVRDGGG
FT                   GHGGPGGWSEPRAGGDRERGDELPKDIDGGLIWVSRREGIDEAYAKKLIGMASDGGLVF
FT                   QKWITSPNTVIFLCDVSKNDDGHQILLDVFRAQPREGAGERRMYREELGDQPLDPTAFL
FT                   SSKPDGLPHQVKLVPWQMGSRPGKIGTIQRGRSSILRDTNFRDWLGKDLREKIRDGKDE
FT                   FPVILTKHMAEELALGLIKEGREQDKRKSRRPGNGGYK"
FT   CDS_pept        join(complement(392454..392515),complement(392211..392237),
FT                   complement(391237..391864))
FT                   /codon_start=1
FT                   /gene_family="HOG000264691" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631500"
FT                   /gene_name="LIL"
FT                   /orf_name="MICPUN_93933"
FT                   /product="Light induced like protein "
FT                   /protein_id="ACO62928.1"
FT                   /db_xref="HOGENOM:HBG412869"
FT                   /db_xref="UniParc:UPI000199B87A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F8"
FT                   /transl_table=1
FT                   /translation="MSMSIATQATLKVGKVAGLSRSVRSSKAKRAVKCAAAAETTTKKA
FT                   PGPLQRGGTLEGEKAAGKDAGVAAKTGALFANGTQEWSDPRWVNGTWDLNQFKLPNGET
FT                   DWNAVIDAEVVHRKALEDCPAVYDEDGLFDTSIVPWWVWVKRFHLPEAEKINGRAAMVG
FT                   YAFAYLIDAAGGAGLVDLHQSFLGKTAIFLTVAFCLTVRRLEDLDTLNVLADEATFYDK
FT                   QWNATWEGKERPSDSQ"
FT   CDS_pept        complement(393145..394563)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631501"
FT                   /orf_name="MICPUN_108056"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62929.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199B87B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3F9"
FT                   /transl_table=1
FT                   /translation="MEKELKETKSKLEATEEEAAKAADESDVEAMKKIEAIRAELETEV
FT                   AIASDRLQAMEAEMRAAQQARADAEKELSDVRQDMDVLKQMMDDTSRDSVQQNLDMEQE
FT                   LGRVMNEANELRAKLEAQAKALEARDGDAFKQLEKASGETAALKADLEATKAAAAADAA
FT                   LRADLEQAMVRAHEIAKENAIKMVKHNERMGRWRSYKSGDIDIPVKFEIAVETMPGQRV
FT                   AMVGTWNDWDISAAFPMVWTEGNVWTVTTPIHADDTYEYKYVVIDGEGPAALENATWQS
FT                   GNNRALGLNLSLHDEVALVEVVDTWRPDPKQAPVLLHMVDGTVKEEGSTKLLHDVVREL
FT                   RTEQALLDGSLNVKVLAEIAQAISAAAGDSIADPLDEEFFDAMERAAVEEATPPKPPKD
FT                   IFTTASSNIVATEEPEEHVPVFVDASDEFAPDGDVEASAMVNVNVTADGEQIATGTMAD
FT                   VDVGEEQDASAGPR"
FT   CDS_pept        join(397454..397508,397604..399177)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631502"
FT                   /orf_name="MICPUN_57669"
FT                   /product="CorA metal ion transporter family "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62546.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000199AD31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G0"
FT                   /transl_table=1
FT                   /translation="MEPPQARGRFQQAVQEIQATAIAPKKKRLFAPAQPKPKKITRSEA
FT                   KKEEELNTFTKLTVDYLNNKHADVEPESNPKVYYSEYANLRNTPGRLVEPETDEEVLAL
FT                   FDEVADAPPRPNVVSWFHVEGVNDAVIREFFVKMKLRLPSPSLSPPSPSSGPSGNGGGK
FT                   ATRKGDDAVALFFKRHREPRLRFFGTHMYLAMQLLDRNDSEGDIPMVSDQQVSVLFVPN
FT                   RRLVLTVSEYASPGTDFDRLREQLVQGSSACNHPNADATLLLAVLADKFMEDSFPLAEE
FT                   LGDYLELLAHALIMKPGLRYNIPADKVRTELWRMRRFALRTRRLTEILQEDPLQLFENA
FT                   RFQSFMAVVERQAQSLAELCHMYNERCGNIISRIEVHQTTKTNETLFTLTIITALIIPV
FT                   QFLTGVYGMNFENMPELRTTYGYYVFWAAVPTLCTFTYLMLRRKGLIEDDSDIRIAQLM
FT                   PAEVVSAVSFISKRAKRTVRAAGAGAAKVAASGAKAAKGVATGAKKAGTAVSVTIKSAS
FT                   PRFSGGGGSGSGSGSSMPPTPKNAA"
FT   CDS_pept        complement(<400447..>401973)
FT                   /codon_start=1
FT                   /gene_family="HOG000030517" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631503"
FT                   /orf_name="MICPUN_80758"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO62930.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG592342"
FT                   /db_xref="InterPro:IPR003191"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="UniParc:UPI000199AD32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G1"
FT                   /transl_table=1
FT                   /translation="FGRSPVSRPSETRRNSRRATMGFFSPSKSGKASATAPPPVGKPLH
FT                   LLQYDERTKKFELGSEALEALRQIRGDVGVLAVCGRARQGKSYILNQLCSAGNDAGFKV
FT                   GPTVRPCTKGLWIWSAPIRRVDPVTGKAFHVVLLDTEGIDAYDQTGQYSTQIFSMAVLL
FT                   SSLFCYNQMGGIDEAALDRLSLVTEMTKHIRVRSETGAAAPGRGGVRELGAFSPSFVWL
FT                   LRDFYLDLNDPDSGGRISAADYLESALRNVPTVDGGSTGAVAKNAIRESIRGLFPEREC
FT                   FPLVRPVNDEKQLRNLDAVPRSQLRPEFIAGLDSLVELLFDRCRAKRVGSDVLNGPALA
FT                   AMATQYVAAINAGAVPAIATAWQSVAESECGKAVEEGESAYAEAFFASADSCPADDAKL
FT                   SACHERAVERARLAFEQRAVGDTETRAAACAKLEHALKVRFGEYREKRRASAAARCSEL
FT                   LAAAATRVMGCANAPDAKIADVLKRIDSEVDAYLGEADGPSAHDRLCVFLR"
FT   CDS_pept        402435..>402671
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631504"
FT                   /orf_name="MICPUN_80563"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62547.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199AD33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G2"
FT                   /transl_table=1
FT                   /translation="MPAQHTTLAQHGALLHPHDRIRLRACPVPGCDFVTNQGRARLEKH
FT                   LATHGSEKPFKCEHEGCGKAFKTSEHLKQHARCH"
FT   CDS_pept        complement(403725..404618)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631505"
FT                   /orf_name="MICPUN_57672"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62931.1"
FT                   /db_xref="UniParc:UPI000199AD34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G3"
FT                   /transl_table=1
FT                   /translation="MRRRAPSLALLALLATAVNRVGASEETLVAVPLVVSGAAGPDPDP
FT                   VSCAAEFFPADFDRDGTLAPCFRVAALRDDDVNDGAEEEAQLCSACVDAVGDVLLPRML
FT                   AARMDPTIADAVTACLFAALPAATDAGVPVFAVVDRCDLLSLGAAGALSRNTPETDTPT
FT                   EPTAFEPTEPTELPEPTRPKPEPRPRDPRYPDTGLTAAADAAEAIDGDEERSKKATPGA
FT                   TMAVFAAAADDEKEEPSSPSPPPKRRRGLSDGAIVSIAIVCVAGSVLPISLLVACLHAR
FT                   RRKREEKLVRDLEGAG"
FT   CDS_pept        404853..405875
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631506"
FT                   /orf_name="MICPUN_57673"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62548.1"
FT                   /db_xref="UniParc:UPI000199AD35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G4"
FT                   /transl_table=1
FT                   /translation="MDCWQATQGTELDPAFKGDWTTRAVGVACTLDDVVPTWIALHPFL
FT                   GYRDLARSTAEEDSTGDGEKRWVYGPVFKVQDVPAEPLDLKAPLPKERDPRSEFKVRDL
FT                   LDGEKRTYPTIDALREALKPGDWPMRNVVSVNLGAVTPSEDLTKFVSEELGTLAPKLEY
FT                   LDISSLTHRSFTHVELAKTIKSAQCLRVLLMPRTFGPSFRAIEFHPWLEYVRFSRRCDD
FT                   VEADVDAILANCQKIERLDFTDFEDVEGAKKGARSARRKIRSAKAFWASGGGRVPPLAG
FT                   WRPETYAIWTDSVYATVGALKGERRLGDTDDPSRIVDCLDDAEWKRYVEDDYVEAAEDY
FT                   "
FT   CDS_pept        complement(405945..408122)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631507"
FT                   /orf_name="MICPUN_99943"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62932.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199AD36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G5"
FT                   /transl_table=1
FT                   /translation="MTHDDEVDATSGTPALAVERLLALEREGLKFHQMRERCRDILAAP
FT                   DVHVPSFAADAIAILANHPGRKTAAVDPIAHLIMECVPRVTAHIRERHDFPMMDDVSVR
FT                   ERFADAKDRSPGVRLILDALAAAAAVDDESAESAGGSIHRRVTGTTRLDPRTLLRVAET
FT                   YGVSLEDLIDAGGGDARTSLEAYARSLMYREGKHAPGVNLALWFSLDAFASVETVDELT
FT                   RCGAFGLASDVAACVAGSELKRRCVEACLELGDSGDHAGLRAAHAAAERFQLGTVFPTV
FT                   KRRYFESTIKRMVAKGQAEAALRHAGDDKDLIRCVIASLVASGDASTAAEYVARLGSDL
FT                   SPGEDFDVGDLLGTETELAAAQAARRDAHVQLPEGMAENGGVVWVDDEDGLRAACDALL
FT                   AADVVGLDTEWAADPDAERMKAERNRRRKGTRWARKRWRDQKKLAKKLAAEAEALEASN
FT                   GESDADDASSRDASSGEGEGEGERTGAGAGGEDEDAAERRAASVVALLQVATRDRVFLV
FT                   DLPALLRACPDAIAPTLGAVLADRSVLKTGFGLAEDLRRLARLHPPAFGAERLGGPSGG
FT                   VGPVIDLQHVWAAGTRIAREEAADGGRAKRGRRARAAAAAAAAAEGGEGGGGGGVAASP
FT                   PKRLVGPWSLKEHYQRKHLVGLSHLTAAVLGKPLDKATRMSDWSKRPLTPRQVTYAALD
FT                   AWVLVELMRTLRENHAEELERLAGGLTHVRE"
FT   CDS_pept        join(408851..409213,409413..410675)
FT                   /codon_start=1
FT                   /gene_family="HOG000264696" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631508"
FT                   /orf_name="MICPUN_105413"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62549.1"
FT                   /db_xref="HOGENOM:HBG560584"
FT                   /db_xref="UniParc:UPI000199AD37"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G6"
FT                   /transl_table=1
FT                   /translation="MTTTENDAPVNMDPVPADPEAKPDTVKDAPVADAVTDDATETKPA
FT                   KEIPKPENPRLPKPDRSAMDRKIQDLQEAADVKQARIEELKKLIGNRRDAQKNIMSGSS
FT                   GTRTRIGELNAAFQSLMDERNAIRKELQAFDAARERMREQVVSMKSKLRFTTVEAVDRE
FT                   IARLEETHAHTTMSLNDEKKLIAQIKDLNKSRDTVRDYAEAQGKVSGEDGVRKSIIERL
FT                   RAKDEAITAVKTEQNGFRETLNAAKEKGDKMFSDVPKLQEERNACYEVIKAKREEIRTL
FT                   RAEFKQSEDAYWTREREWRGYLKQEKQKQWEASQEERKAREEARKQWERENAPEPFEAE
FT                   VTAADQLIAYLAKWDPLSAKAADEKAAADAKEAEEKKNAAFAGLQMMNKKMKDEDEDDL
FT                   FSLSGTSKGKKAKKKGKSEAAGPAGPNPNERLNISFDAYQHFAKLSLAAPGTVGEVPAM
FT                   LTSLKEKKDLFLEKRKIKKERIAAGLDDEDEKKEAKEKKDAGKGGKGGKGGKGKGKSSK
FT                   KGPCSVKLEVDGDAVVVVIEVADE"
FT   CDS_pept        complement(410776..412458)
FT                   /codon_start=1
FT                   /gene_family="HOG000264694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631509"
FT                   /orf_name="MICPUN_57676"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62933.1"
FT                   /db_xref="HOGENOM:HBG560586"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199AD38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G7"
FT                   /transl_table=1
FT                   /translation="MALRLAAAGAAASAVGVGAYARYDEGTARSVTFWYHAFPVWAQYR
FT                   AVQWRNRDLAKIGVPSWTGLTLGDADADAAYERLHERHALKVRDLVFDMRGFYFKNAQL
FT                   LSTRDDFVPRQYLEWCKLTQDQAPTEMAPGQAEAIARAKLAEAGHPDAFEWWEEEPCGV
FT                   ASIGQVHRARLARRYGGKDVVVKVQAPGIERKFRSDIRTCIDFCRLAMPQHVPPLEEIE
FT                   RQFLTEFDYREEAKNLEEVRRNVMPRWSKKVEIPAPVRQLCTREVLVMDAIPGVKLVDG
FT                   IRARFRELAASRGVDPEELERVQKEKIAGGELRPARSARAEAAATRRANLALRLGDWLW
FT                   RRPRAFLIGAPYTPSPCLVNVGEVLQTMLDVHADEIFNHGVFNGDPHPGNILLMPDGRL
FT                   GLIDYGQVKRVNKGARVAYAKLTLAILAEDKAEVARLLRSKPPEGFGGESRDNDVDVAY
FT                   RLCVFWNDRDTPDVTGGLNLQEFIDEMEARDPVRVAPLEMVMIARVSVLLRGVANAFNV
FT                   RLRVARAWAGYAEDLVRREDPSYYLLAARGNERRAAAARGGER"
FT   CDS_pept        complement(412649..413233)
FT                   /codon_start=1
FT                   /gene_family="HOG000263533" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631510"
FT                   /orf_name="MICPUN_80573"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62934.1"
FT                   /db_xref="HOGENOM:HBG677020"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199AD39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G8"
FT                   /transl_table=1
FT                   /translation="MAPKRARAVASASTSTKKPKAGDDGDATGLWLVKTEPDEFSLDDL
FT                   RASPGGVAQWDGVRNAQARNLMKTMRVGDRAFFYHSSCKVPAVVGVCEVVKTAYPDPTA
FT                   LDPKAPGFDPKSDPTNPKWLCVDVKFIRAMRREVTLSELRREAAGDGVTGADGAKALAS
FT                   MTLLHRARLSVQPVTRAEWEHVLRLEEDEAP"
FT   CDS_pept        413417..413674
FT                   /codon_start=1
FT                   /gene_family="HOG000264693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631511"
FT                   /orf_name="MICPUN_57678"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62550.1"
FT                   /db_xref="HOGENOM:HBG560587"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199AD3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3G9"
FT                   /transl_table=1
FT                   /translation="MSGSTLRLYRHILKAAKTFPSKNRAGLIEEIKTEFRENAGATDAG
FT                   DVQKKLALARDGLDRMRAFTGLDQGASKWDVSLKGPYDGT"
FT   CDS_pept        complement(413873..414697)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631512"
FT                   /orf_name="MICPUN_108059"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62935.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199AD3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H0"
FT                   /transl_table=1
FT                   /translation="MDPPNTGDGANRAPQKLTRPGEVEVQAWLEKMEAKEQWFSIYKKA
FT                   TEKRASAVEGETTVIVVEFPTNLHTVNGQWLPCKIENQDEDALAKKAEIPGGIETMRKM
FT                   CRPERNDFWIAFSSTPDADPAWTRMQVFPGQNFDRFEQEEGKEEMFVVSKETLAALEAL
FT                   KGEGNDLFARGDFAGAAAKYGEVADELSPGMAKNGRLCAEVGVHRLYVVALSNRAQCRI
FT                   NAGDAGGACDDCEAASRLDSIETDAFADLRRKVYFRWGQAKEMAKAAGKGRR"
FT   CDS_pept        complement(414882..417224)
FT                   /codon_start=1
FT                   /gene_family="HOG000264692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631513"
FT                   /orf_name="MICPUN_57680"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ligase activity, forming carbon-nitrogen bonds "
FT                   /biological_process="tRNA modification"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62936.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016879"
FT                   /db_xref="HOGENOM:HBG560589"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199AD3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H1"
FT                   /transl_table=1
FT                   /translation="MATADDDAPVTSVASHEDVLEFWFDGDVDVSARQCPGPAPPTSEK
FT                   PPPPDSPQTFRPSVRPSPRAHLTCPRPTPDHASQENYKRKWFPAGDRTGEMQKRVDDAI
FT                   SHRFGATLAAAERGDLDAWADASPSHAVALVVTLDQFSRHVYRHAPDRDARVAKCDAKC
FT                   VGVVQTCVERGWDARVPTPQQVFLLMPFRHTQKDLPRLRLALGRLDARRETEAQCADLL
FT                   AKFRRTTLRCLQDLEGKQHVDGDDILEFHEFEPQPEVLRSMPSHPVYRTVESFLRRKLI
FT                   EHDVHTERGAEERPRSVAISLSGGVDSMVLATILKAAAPSFGDFDVVAMHIDYANRPES
FT                   GKEADFVRGWCERKGIVCVVRRIAEVKRGVTPREQYEAESRAIRYGLYKECAKTHGFPA
FT                   VFVGHHEGDVQENIIANIFRGANVLGMNGMNEEGVVEGVRIWRPMLPHSKDPVLDFAHT
FT                   FGVPYFLDTTPTWSTRGKLRNQLLPLLADMFGDGFLRNLSLLGEDSAQLGRMVEDSVLG
FT                   PFSKRMRLSDSGAYADFSGDEDKPMLFWKEALKRMCHGLGSGMMKERSVRELIDRFTLS
FT                   KRRCAKDGWITLKKLNKTFVTGKTLGMFSSEFFPHYPWTEKSVWSEPVGTTVGLDAAEP
FT                   TRVGPWTITARVVPNSIEGVAALESAAPLDVWAILRNEITYLLPLTESHAAPGAYYVDT
FT                   KARIPPLRGVDAQVARALPLVVPAGLGGVSGGDGVLEVGGSIPGGGGGGDGFRAKSWPP
FT                   SLLRGEMCVEVTLRFVRTRSHAVDGEE"
FT   CDS_pept        417459..418178
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631514"
FT                   /orf_name="MICPUN_57681"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62551.1"
FT                   /db_xref="UniParc:UPI000199AD3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H2"
FT                   /transl_table=1
FT                   /translation="MRRKEDPLDNIFAVIQGHTGPPLALLVVTAATVGSALTTLALRRW
FT                   GPEASPSSSSPRDEDDELEDLDATSVDSAPGRAMTSTMKRAEVEEWDRYFAMDAATPSD
FT                   REDRGRPHHDDSDLFDSDIDEETLWRGASEAMKTLSGDLGTSGFSNDRSSYDSPPVSEG
FT                   ARRRMDGRRRRSEDGIGQASASPRVETIEEDEREGGASWPTKEPTVTQKRLDVVFAAQR
FT                   EESPRTVLGDVTNARRR"
FT   CDS_pept        join(complement(420818..420925),complement(418290..420671))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631515"
FT                   /orf_name="MICPUN_57682"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62937.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AD3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H3"
FT                   /transl_table=1
FT                   /translation="MGADVGEASGHSPSEFSIVHDSIRRDREALFEGTRRFIPSIEADS
FT                   DDDDSSDGELPIFFTSTEPGAPSSSSARHGADSTSSGATHTARAAPVHRDESDELAAFE
FT                   RAASEALRREEERSARIVAAHLAPDEHHRPDDDDDPFDDSDSDSDSDAARGSVRARPRR
FT                   APRPATARRAPPPPPPTNVADAMSSLFDGWLSGAAGRLASGVRSTTEGRFDTAAGDPSS
FT                   SSSSSFDTVRVEREFASRATLDADGNLPGAVRAGMPRPSVRLNLDGSLGSVDLDALLAR
FT                   LATPEGLAELELGRARGDGDEKSAPGDGDGDAVRADDVAFGLVDDDEAVPGLVPAAATA
FT                   AARAEAASSSARTTATSHSTASSSLVGGRGGGWGGGAGRYESDEGWAREHARGRGRGSR
FT                   PRSAFVVAPSSARVTRPSVGGAGAPRERTPATDPYGRGNTRLRSARRSNAPAPVTSLGG
FT                   PGPRAGANDDDGESPSGLASTPNGFVPRGTRIDPAAAIRIDARGTADPADDETDGGVDE
FT                   EMEEWRRFRQTRARPESAPASRRRTTVTPTVTPASPGAVAADEAATAAMSAAASAKAAA
FT                   TRANAQADARESRRVFDSSTPPRGPDFSSDGEAAAAGAGRGFGPGRGCGGAGSTREDLE
FT                   TEAEREAGREADRASLEAAAESARSEAAASFRRGDYAAAIDAYTRALEASPDDATTLTN
FT                   RSAAHLRRGNVAAAEADATAALAIDPDRIEALKRRADARTAAGDLRGALADLEASHARV
FT                   PTDERVTALLADARRSVAHADGATAAEMDRHDEERAAAAAARAEAWEAKRAAGLRAHGL
FT                   RAASARASRRASETGKR"
FT   CDS_pept        421768..424113
FT                   /codon_start=1
FT                   /gene_family="HOG000076906" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631516"
FT                   /orf_name="MICPUN_80658"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62552.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI000199ADF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H4"
FT                   /transl_table=1
FT                   /translation="MGRGGGRGGFGGRGRGDGPSAFRGGRGGRGGFGGDRSFGNDGGGG
FT                   RGGADSRAKNFGANAPKGGRGAAAWRNKRGGGGRPRPSFSDASGSDQMARRRSGKAARA
FT                   AKRRETAEANKAVAVEILEIPPAGMDMDQLCEDLATTQAEVIKVLFMKGIAVQMGQVLD
FT                   KETVIAVAEAQGVEWIDEQERGVADAARKITSFYEDEDDDDLEDRPPVVTIMGHVDHGK
FT                   TSLLDYIRKSKVAAGEAGGITQAIGAYQVSTYVNDEERNITFLDTPGHEAFSAMRARGA
FT                   RVTDIAIVVVAADDGVRPQTKEAVSHARAAGVPLIIAVNKMDKEAANPDRVRDELAALE
FT                   VVCEEWGGDVPFIPVSAKTGMGIESLLETVALTAEVEELVANPASNARGTVVEAYLDKQ
FT                   RGAMATLLVQNGTLRMGDAVLVGSNWGKVRAIQDAYGNKLEEAGPSTPVQIMGLGGVPM
FT                   AGEEFDVMDSETEAKDIAAERASKERINTIEGNTVSLSNLAAAKDDEDGVQTINLIVKT
FT                   DVSGSVEAVKAALGALPQDRVLLRFLHTAAGEVTESDIDLAAASEGIILAFNTTVSEKV
FT                   NDRAKGARVEVRSYDVIYGLVDEVRAAMEGKLSGVKDEVFVGKAECKAVFGGGNAKVAG
FT                   SLVLEGQLTMGANLRVTRKNKEMYLGKVGSLRRIKDKVKKVEAGLECGVGAEPEWGDWK
FT                   PGDIIECFDLVDRVQTLESASDDLSKKVDEIKAAEEKAKAAAAAATAAAAKDKVEDEED
FT                   GDSSLGGQGGGSRSKGKSRSRQKAGTRR"
FT   CDS_pept        complement(427303..428859)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631517"
FT                   /orf_name="MICPUN_57684"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62938.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199ADF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H5"
FT                   /transl_table=1
FT                   /translation="MRAGPEEPASTLERTAASATRTTIEPGGMRISRSRAFVALCVVCC
FT                   ASIPVCVAAPFADKDALKTAVRNCLANVTSGANCCSTDPNCGNPSSARCGAAGCDDMPS
FT                   WDTSLVTDMSLLFRDCDGGQPWCGGFVFDSSSFNENIGSWDTSKVTNMQSMFVDTAAFN
FT                   QPIGSWNTSKVTEMSSMFSGAAAFNQAIGSWDTSKVTSMGGMFSGGAAFNQPIGSWDTS
FT                   KVVGMGSMFYGAAAFNQPIGSWDTSQVTRMDYMFSGAAAFNQAIGSWDTSKVTSMGNMF
FT                   YQAAAWQERYTNCGYSSSHSACGEFTSYTSSDAPDRGPPAAWVRKDNACDAAVPPANGA
FT                   AGTCSDTLASGSSCQPTCDTGYTVSGTSSCLNRVLTSATCSPNPCDASSPPVNGAVGTC
FT                   TGSLASGSSCTPSCDSGYVLSGTRSCSAGTLTDTAVCNTYPSPPPPSPSPPPSSSPANS
FT                   SSPANFSASSVPSPSPPPLPPPSPPPPPPPKLVTDDDDAAHAPRDVLGALLLACVTLLL
FT                   F"
FT   CDS_pept        join(429003..429053,429213..431789)
FT                   /codon_start=1
FT                   /gene_family="HOG000206817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631518"
FT                   /orf_name="MICPUN_57685"
FT                   /product="Predicted protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62553.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI000199ADF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H6"
FT                   /transl_table=1
FT                   /translation="MAPVAGNSGAPPLGELQFSADFEGGNLGDVRRVADNEYELTVRHD
FT                   TNNPRHRLWFYFKVTNARAGQRVLIHMVNFSKTKSLYRDGMSPLVRSSSSATWERIHPK
FT                   SVFYYKQKDRPTKKRDDAAVEDDGRDSPEDGGEGGKKTPCVLSIVYTFDTKEAHWFSYS
FT                   YPFGYTMQQHLLDALERRRLPYVKRELLCRTLQNRRCDVLTIGDDASAAAAGAATDAAT
FT                   DAGAAPCPPAASATRDGRRRPVVMITCRVHPGETPCSHTLRGFIDFVTGDSPAAVKLRE
FT                   RVTFVVVPMLNPDGCALGNYRTDSMGVDLNRAWRSADVRKGEWVGTGTFAEHKAAEKKT
FT                   EQFPTLRHAMALARKYANSDTHALEFYIDIHAHSTSKSSFFFVNNPHDEDDVERWERIA
FT                   ALPKLMDHNCAALEAPGFSLSSCRFCSNPDKAGAGRRAIGDMSRAAHVKRHGAATRANR
FT                   GEEDKSSEDKSEEDKSSPAMCYTLEMSFYNAPSRSRQWSTSTSNEEAYERHGVGLAHAF
FT                   VDYYRLRPPTEQRVEGILRRVDASAKVTRGSDQAAAWTKGDLMFGFGTQIFADGGGAQK
FT                   PWHKNGAKEARAALNAREPSFLRWIAQRVTPKNVTSPSPPPSAPPNASKTPGAKSPDKT
FT                   PSSGKKATSSVGKHRRNGSPAGTGAKKGSSPSSGTGAGKGKEGGGGKSPGIEPTAFEFV
FT                   AIPTAPAPTRDANLAGKRGVGRAKLRARRNAPTPSPEPAADDDDGGDGPPTETEHSAAR
FT                   DRDRALRIPSTISPFQTPGDVDAVADESYGLAADLARARVDVVGTFVPRLDGTGVESPG
FT                   PLVGSSAIAASVGVAIGVAGGSAEPSRRARPAPRPPPPPMYPWEEDVDRFGGVSADVRR
FT                   LRSA"
FT   CDS_pept        complement(431914..432819)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631519"
FT                   /orf_name="MICPUN_57686"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO62939.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199ADF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H7"
FT                   /transl_table=1
FT                   /translation="MTRTNPSQMSHARPHSNRRGRATKTTTITMHALVGTPVTLASTRR
FT                   ALTPRRGATEGRRAARRPSAPEAASSAKASGRPDDDGTIGRREGIGLAALAAASIANPQ
FT                   SARAAYGGATLGDVDVGPSVAATELSLYKRSFRERFETSISSGTHDYSFKYPKDSWKPD
FT                   IVSLNDGKLYGVDLRFSSPSEGKLCTHVLPFVDKDSLKDVGSPAVALDRFVELIGAFWD
FT                   ENGFGVPGGNAGVVKSTKTVAKDGVVYYQYELDKPHNLISAAVTDGQLYVINASAANER
FT                   QWAAGEANLRNIVESFYVPP"
FT   CDS_pept        432883..434286
FT                   /codon_start=1
FT                   /gene_family="HOG000264476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631520"
FT                   /orf_name="MICPUN_57687"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62554.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG557136"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199ADF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H8"
FT                   /transl_table=1
FT                   /translation="MATMRAHATFRPASARHRAPASGSKPRAASTASSRTSRANAPRRA
FT                   RRLLFGALAPDAEAVAGDGREEERDDATPLDNVCFVLCRPQGPQNIGGIARVMQNFGVT
FT                   DLRIVAPEPGALAPPFDAADEYDRAIHPPEVRARAPLSDEAHKFAVHADWLLRDARRCA
FT                   TADEALADVAFVAATTARPRENLSIADVRAASEVLRRHAANGTKVAVVFGNEATGLTND
FT                   ELARANLGVMIATSAATSSPASSRKRYTGAKGATSLNLSMAVGVVAYELFQAMGEGEVS
FT                   GFGSRLMTVDERARLADELAGARRSLDVLRRRHGSATASASASASPDSSATGDSIGDGV
FT                   GVDEDTTTSEEDRLLDEKEARAIARVLNAGPIATKDAAVLFQLARRTRSVEPYSGVDEA
FT                   VVDAATDLFARAAAAGKPRPGNKTVLNHVRETLGLSLTTRELERVVTAAGAVDQAEERL
FT                   NRRSEGEFL"
FT   CDS_pept        complement(434378..436693)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631521"
FT                   /orf_name="MICPUN_57688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62940.1"
FT                   /db_xref="UniParc:UPI000199ADF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3H9"
FT                   /transl_table=1
FT                   /translation="MARDGAQAPGVASYSVTFSDARVVARSERVRASNGNAPASSARTP
FT                   SRGIAVATTSNGVALAAYVVGGDVEVTRIRPADGVPSDPTRLRLSSAFDDDDDDGAPDF
FT                   SGAHVCWCAHGIDERDVAVLVATCAAGNIHVVDIIALDDGSIAIAGLTRLEMPHASLAV
FT                   CPAAYPLLAVSTRDSVEVLDLRLRRRGDDAMRREPFATVRHERGDDGAVEGGAAGGGRR
FT                   RELAWLTMRPSSDEYVGPMYAVASASVVGGGGSRRDRDGSRRDGDGDGDGDVLRVDVYA
FT                   WHEETVRKTTGPETGPRFLDAHKRIAVPLGSRGELRAMASSGDDVLYFTTDARTTMPTL
FT                   GGASSVVNAAFAESARTSFGPADISVSASGDDRARGDEDGEMPHIRAPVASNPNDDDDA
FT                   SGLPGAFPKSLVFPQLHRYGSGLEMPPFPSSSSSSSRPPAAAAAFAVEFNPGRRGDVSK
FT                   NGFVVRVVDLPRGLGRPDVLVPGRREVLVGSTVGAPRLVAIDASSFDESTNVDLIVDDS
FT                   DSGLGGGNGKGPSGGSVRGIDPGVRLRGACRAWRGAGWEGGLALTTTAAAGRSFGSFFF
FT                   GSVDAADADAAVSVFRVETTTSNPRRPSREATDDVQATPGVDLLESLSSRFEDVKIDVE
FT                   QSRGVKIDEQSRRGESRGTPTPASASSGESPARAPPRPYPAFEPEKARGDASEREGDRV
FT                   VTRADAIKSVAAARSALVDPGKDGVSASLAALMTGLNALGRSVEMRMDRVEAALQAQER
FT                   RLRRIEAAVTDTSDRGKA"
FT   CDS_pept        437124..437801
FT                   /codon_start=1
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631522"
FT                   /orf_name="MICPUN_108061"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62555.1"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI000199ADF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I0"
FT                   /transl_table=1
FT                   /translation="MPKKIGIICTSACTMGDHETGAWFEEIATPYYALKEAGMEIVLVS
FT                   PKGGEIPLDKGSMQGDFFTADCKKFSDDAEAMAALKSSVKLEESHADSLDGIYLAGGHG
FT                   TMDDFYSNALLHAVVEKMYAANKPIAADCHGPAALVKCKKPDGTPLMAGKKMTCFADTE
FT                   ETAVGLHEKVPEMIEAAFRAQGAEFSKADDWHPYAVTDGNLVTGQNPASSKPCVEQFIA
FT                   ICA"
FT   CDS_pept        complement(438012..439235)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631523"
FT                   /orf_name="MICPUN_57690"
FT                   /product="Predicted protein"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /protein_id="ACO62941.1"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="UniParc:UPI000199ADFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I1"
FT                   /transl_table=1
FT                   /translation="MISARTAARCSRGRRYASRRRLPTGVARHPSRHRRAFSPTRLLVP
FT                   FRAARLAPPRPERAYRVVVERGSERHATSSLRRSRPLTFDSRRSRTQPRVLGVIPARYN
FT                   SRRFAGKPLALLGGKPLVMHVYRNACKAKCLDACVVATDDDRIAKAVRDNGGEVIMTDA
FT                   ACETALERCLEVVRKLRRRRADGKKGTTWTAASGEFDVVVCIDADEPFVQPHHIETVAD
FT                   LVINSDAVVGTLVRRGLNEEDVASADTVKVVTDDRDYALLFSREPVPRRGSSAGGGGVV
FT                   RSAYDPGVAYKVRVGIQACGTDFLEKYASLPGCGGEGSIEQSRVADKENTSPRRTTKNG
FT                   DSCAIPPYEPPDEPEQNRVVFAGYKVKVDVVESTFVPGVKTPEDLRHLNAGLGAGLVND
FT                   LQLTFLVA"
FT   CDS_pept        439657..440757
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631524"
FT                   /orf_name="MICPUN_57691"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62556.1"
FT                   /db_xref="UniParc:UPI000199ADFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I2"
FT                   /transl_table=1
FT                   /translation="MPLAAHAGISVTRAPLRARLSSRECTRTVARAFTSRPNRLRRRSP
FT                   LSLRAGAASDEPAEEWTNSNDGFDEGEAMRGALDNPLFNDNFKKAFLEAQERLAEEQAP
FT                   MKAQIKAEVDEIMKQVEAERKVEELESALPLEEEEEVAQEVAQEVAQVEAEKAREEIAT
FT                   TYADALDNPLFNDDFKKAFIEAQARLEEEQAPMRAKINAEVEEIMRQVNAEREAEARGE
FT                   TYTPSADDPLRALDAFAGAMSGAGGGGGGGGGAARKPQPPPSTPPPPSRDEMAAAAAAG
FT                   LAGGEAPVDVSILNEMLSASDGQLASLRTALAGVEKALRAEAIQNQRIRLAIDKAKKMA
FT                   RYAEADRIAAERRAEQERLEREGEGG"
FT   CDS_pept        complement(440879..442537)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631525"
FT                   /orf_name="MICPUN_57692"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62942.1"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199ADFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I3"
FT                   /transl_table=1
FT                   /translation="MGIKLRVRIAGSGDTMRVEVPEVCTLSQLRAAVATKCLDGAVAPE
FT                   NVAVTLNRTDDVSTQGAGEGSTLRACGIARGDLVHVFVRDGPSAAATTTNAPADAPVAS
FT                   TSAPAQTDEEERRRRCLHAAEQRGDVAAAVNTASRDTPTSPADAAGRPGRGASVVATRR
FT                   PTPMPPALRSLLELREPATPVGLVACAVHASLVDAGMDIVDVTPCNIKRASFRPRWENG
FT                   AGAGASTAVPPPVSVVVKAQDVGGDHVVFAAAVNDGEPFVFRCAASAHVVAVGAHGGAH
FT                   GGAHGYEYVALPLLWRDAKDSLALPASIRARSAAGLPSPPPFLALPDELKLATLAHLAE
FT                   ARDVCAVGATCRELAALASSDDLWKPLHDAEFGAETLNDTAVNRTQLWPAAGPGAYRRR
FT                   YAEKHAERARRERERERRVAEMMRARERAARAGPGPYVPHPAGGGGFFASPPPGYVPGI
FT                   TGGDYDLYPAGGVGMPGFPGGYAGGFGGPLGGYAAPTPMGGWPTGGPPGVPGGGRGFGR
FT                   GMGGMGGMGGRGGRGRGMGGRGTGPPPAWDADDVI"
FT   CDS_pept        join(442826..443002,443293..443352)
FT                   /codon_start=1
FT                   /gene_family="HOG000264726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631526"
FT                   /orf_name="MICPUN_57693"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62557.1"
FT                   /db_xref="HOGENOM:HBG560599"
FT                   /db_xref="UniParc:UPI000199ADFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I4"
FT                   /transl_table=1
FT                   /translation="MAGPRIPTDVKPNKFVEANGYAREVVENTFRFSLKNLGKFAIFGI
FT                   AVPVLIYKGCVQEFHVADSKYGRPAKKFAMDGN"
FT   CDS_pept        join(complement(444189..444437),complement(443507..444052))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631527"
FT                   /orf_name="MICPUN_57694"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62943.1"
FT                   /db_xref="UniParc:UPI000199ADFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I5"
FT                   /transl_table=1
FT                   /translation="MSRELGAPRRRSDRGDRALVARAPDPPAPADARRDDAARSGRPGG
FT                   AGASTSAAASGDAPMAAFSAGRLVGLDGLLSLSWALDALPHKVKARKEIQAWPLKVKLG
FT                   AEYDLVAKKFQGHADCHDSLLGGELSFDILHSNVEYTKRFDLGEVSSIGVRARCDLSNL
FT                   GSPGRRADRGWDASLGFTIEPKRTHGPLGANTRVSNTRGSGYDIVTEVPVSQLVSAEVC
FT                   GHLTLPLPRAEFHARTGGGGRLTVGEGGLGMHVAQINAVIDL"
FT   CDS_pept        complement(444598..445500)
FT                   /codon_start=1
FT                   /gene_family="HOG000007924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631528"
FT                   /orf_name="MICPUN_57695"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62944.1"
FT                   /db_xref="HOGENOM:HBG560601"
FT                   /db_xref="UniParc:UPI000199ADFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I6"
FT                   /transl_table=1
FT                   /translation="MADDDGREEPNSFVKLPDPSAGAFADPGFRAQLQKWDLARNSRMC
FT                   RFRYTRPFHRRSPGAFLRDLFDSDAGRAHLRRVNAEGEWVAILPEGKCEEVRHRIVPCA
FT                   ATSMTHFDRLYEAARPPIVREGTQLLMKRVDEVMDGFTVTDRLREFILTANGDGEDYDP
FT                   YAIDDDDDDRSGESNYGELMTTEQRDEFLFRVFAHLALGGSMCQYEERMDAYTEAAKRA
FT                   YKSLVVARRDRASGEDGVAVASDVYRVDGFIAAGREDDDTAGGDSLFPGRSVQNFCYVV
FT                   VDPRKRHATVWYHAYRPYW"
FT   CDS_pept        complement(445922..449332)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631529"
FT                   /orf_name="MICPUN_105416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62945.1"
FT                   /db_xref="UniParc:UPI000199AEB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I7"
FT                   /transl_table=1
FT                   /translation="MVLGSRYRVKDAALLHLLPWVLVVAMIFGPSGCVGAEFFLDWEDG
FT                   FPDGSPGLSPALEPSFSMNMQSTVERCSESGGNEITECKCGVDGYSPRNCDRYWGISSL
FT                   HGHEVLTGLDWARRGQGVLKYWADGSARGLNDYVPSGQYASNRAEIGSIGYMYFEGDDV
FT                   YYTASFYFPSDSWNQVSKYSTIITQWKMTSNPHGALRISNYGDYKLYYEGIGDWPQTSG
FT                   SAGDGYYLGQVKPNAWNDVKIYNRKSTGSSGLARIYLNGEKVFDYSGKTLSGTRSSGGY
FT                   VKFGMYTEVRDYRVLYVDAVGMTTDLSALGFASEEAWVAEHRDKPTVAMSGPSDGSQMG
FT                   TGVGITLSADANDPDGIGGAGSVAKVEFFVRGDCLVSADAAYPYSVTFNPPSDGLYEFH
FT                   ARVTDRDGNTATSGSVTVRSGPTPPTAAISSHSNGDDVSSGAVTVSATVTPGDAAITDV
FT                   EFHAIQNGNNQAMVIGSTSSATSGSTYSIQWTPGGNYGYTIYAVATDGNSKSGESDRVR
FT                   IAVGGSSLTTTLTPTDDTTLLSGQRSTKTNWGKNEIYTKPEDVWITSIVKVDASSLESA
FT                   GDIRSAVLRINLYELKSGGPWNFAVWSTIGSESWDESSTNWNNAPARKDKLAVISISST
FT                   GWNEFDVTEYLNTRLQDGDSLGAVTFWLQGDDSNYERLQFYSISDASRKPQFVVQYSTV
FT                   AVPSEPAAAPPLACPVSAPTSTPATPTPPSEPAPEPALSDPAASATTAFGALHDASLQQ
FT                   AKPDLTGNWGNVEAYAKQPNLAIVGVFKFDVTSLSGKTVQEVKLQLYVNLLSPSGGATF
FT                   SVWSTQGADDWEESTVTWNNGPREDQMITSKLIDGTDQYFAFDLTEYFKTRVDAGSDLA
FT                   RISLLLKGNDQANEVMECHSNREGNAFPPRLVIKTGAEVAAPPSDPAPPAGPAPEPTPP
FT                   TSDPGPPTEPTPPAGSTPPAGSTPPAGSTPPAGSTPPAGSTPPAGSTPPAGSTPPAGST
FT                   PPANSAATPAGEAMTNTTNGACDADGRCVCTCISEECEAPAGAIAGAVLGTFFGAALSA
FT                   AIIVYVYRHGKDVGKRRLTKYLSGPGGGGGPFGSPSYRSGLAVDRVPEYLENVSVRGPM
FT                   QIYETPQKSGKQENGQRRKDDFGGNLPPL"
FT   CDS_pept        join(449803..449897,450047..454571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631530"
FT                   /orf_name="MICPUN_57697"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="carbon-oxygen lyase activity, acting on
FT                   polysaccharides"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="ACO62558.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016837"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012329"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI000199AEB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I8"
FT                   /transl_table=1
FT                   /translation="MVLGSRYRVKDAALLHLLPWVLVVAMIFGPSGLVRLFSLLCTFGF
FT                   IPAFASSGYADDILGHYFDVAPGSDPGTWVHGMLNPRRNRAFRSDPPIDFKFTLDDDGA
FT                   GVFELINHRDGEGRLFGAIRTKAPVGAAGTSYSLRTSLSRISTGATVSSLDFIVEVKDT
FT                   PMIEVIRTRALEWAFTEDKLWGRNEPSESALETQVSYVENNGGELRNNDLYAWSKYQKR
FT                   TKSTLADKWIQAVEDLGALGWAYLDRPKAWKWEQSAEVGQNAMNPLDSQLKTRVGAAIK
FT                   TAIVALAEAIPVDATDVFDSGDLSSLSHNGKDYHGEGFAGRPTMNTLSYNQVTHQWEFT
FT                   DAVGLAVMAVGQDLHAAALNGNANAVAAMDAIVRLGTPNFALTENRRWIDNPKTPGRAR
FT                   WGDLLSNHAQGVWMDANLAHRLRAWIAFAIAANDYNRPATYVDYWHDDFDFSAIRYEGS
FT                   DASSPPTSIPDGFRLIPGFKNEGVFGDVTALLGGGYVRPRRRGLSGYLPDGIISHHTDY
FT                   CQDAAMFAYGFEWLLEPLKVARIFKGTPFALASAALAVPARWLVYSYSRIVFKGGIDIA
FT                   LIGREYHAETCWTFWNKRAIPAAKYLVQDHASALDSDVLTTLQTWISGDTINGPPQETS
FT                   LGNTAFFNSDVMVHRASDAGTGDEWYISVRFKTSRTQGNEDFESTGKSWHMGSGMLQVK
FT                   VFGDEYDLVRARMDWHVMPGVTEEWRTDSISKSSEGRCGGSTYGGSVSDGEVGAAAMHY
FT                   TPHAADDDDYSVTSADKAWFFGSFGAVALGRGINRAKTGQGNEIVTTLEQARWRGPVTI
FT                   QVGSSGSSLTLPHDLNSGCSEDRTIPAGETAFLHQGGVGYVIVAPASSSVTLSIRCGNN
FT                   VIATDSSMAGKSSWGDRTDPENRDRWDPDAGDWYKSDRPFLAVLKHGTAPADAAYQYAV
FT                   LPAMKILDAAAKARAFAFFGSEVQVIQNDASAQAVVFPPTGDFRTFQCAFLSANEDVVA
FT                   PLSSSLTFTVSVDRPAIVQVRTLSDGRFGLAVVDGIADKTARVLKVHLGQGELLEPGSY
FT                   PYALPGVEPKTAVDAVDVSQSGGRTLISFGLPDATDDAVYGYQGELYVGAPVSVKVPKL
FT                   GGPCDASASPTNGGVGDCTNSLASGSTCQPTCNSGYTVSGTSSCSAGTLTAATCSANSC
FT                   TASSVLSKDGSDGVFYCINGGTVGGTTGSCTCTSCNEGYGGASCETAGACSTSTDPSKD
FT                   GADGSFYCINGGTVGGTAGSGSCTCTSCNLGYEGSSCQTASACAASAVSTKDGSDGTFY
FT                   CINGGTIGGTTGACTCTGCDAGYGGASCQTIGACTASTVASKDGSDGEFYCINGGTVGG
FT                   TTGACTCTGCDTGYSGTSCETEAAAAAAEAIATPPPAPGSTPPAGSTPPANSAATPAGE
FT                   AMTNTTNGACGADGRCVCTCIRKKCEAPAGAISGAVLGTFFGAALSAAILVYVYRHGKD
FT                   VGKRRLTKYLSGPGGGGGPFGSPSYRSGLAPDRVPEYLENVSVRGPMQIYEVETPQKSG
FT                   KQENGQRRKDDFGGNLPPL"
FT   CDS_pept        complement(454885..455742)
FT                   /codon_start=1
FT                   /gene_family="HOG000100048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631531"
FT                   /orf_name="MICPUN_52723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62946.1"
FT                   /db_xref="HOGENOM:HBG560605"
FT                   /db_xref="UniParc:UPI000199AEBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3I9"
FT                   /transl_table=1
FT                   /translation="MSTTTPERRSPARSMEAGSARAIARGCRGRTTAPRPRRNPAPTRA
FT                   ARGPPRAAAGRCRGAGSTATFTARGSRTRTRASSPSTRCRAMPPRVEDSDLLAGDVAVV
FT                   WLFALTQKTASVALSPSFPGWLAPVAVDPESLAGFLGESTWLATTWIVVSAAIGGYELD
FT                   DGVLGREEGEMREAVKGAALAWIAWAPVALLGLRWFERATGLRSSFPAGVTLGTVLGVM
FT                   IAWRAFAKVVGLMGWWRPGRVKGEREDDDWAFLFASLGGAAAVATGGAVADFATRWLVE
FT                   ADLG"
FT   CDS_pept        join(456019..456072,456121..456325,456418..458330)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631532"
FT                   /orf_name="MICPUN_57699"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62559.1"
FT                   /db_xref="HOGENOM:HBG707087"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR016060"
FT                   /db_xref="UniParc:UPI000199AEBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J0"
FT                   /transl_table=1
FT                   /translation="MTPRAASARRIQPYRAWRRRDSSSVPAYTGLSLVLILLLYHVTNH
FT                   RTNNITEGVYENLSIYVIGRISYGLFEYASEFVQLSHFAIYLVEFSKTMYVPVKEILSL
FT                   YTSQITLLYRPHRVERTAASAPGTTIEPGGMRISRSRALIALCVVCCTRMPGAVAAPFA
FT                   DKDALKTAVRNCLGNVTSGANCCSTDPNCANPSSARCGAAGCDDMPKWDTSLVTDMTSL
FT                   FSTCSGHWSCGGVVLDTSSFNENITGWDTSKVTHMNTTFWDAAAFNQAIGSWDTSQVTD
FT                   MRMMFRGAAAFDQAIGSWITSKVTDMGQMFFGAAAFNQAIGSWDTSKVTNMAAMFYNAA
FT                   AFNQPIGDWNTSQVPDMWYMFYGAAAFNQPIFSWDTSKVTGMRYMFQNAAAFNQPIDSW
FT                   DTSQVTDMGSMFDGAAAFNQAIGSWDTSKVTYMDSMFTGATAWQTRYANCGYSYSHSAC
FT                   GEFMSYSSSADSTSGPPRAWVRKDNACDAAVPPANGAAGTCSDTLASGSSCQPACDTGY
FT                   TFSGTSSSCFNRVLTSNATCSPNPCDASSPPANGAVGDCTSSLASGSSCTLNCDSGYAL
FT                   SGTRSCSAGTLTDTAACTANPCDASSPPANGAVGDCTGSLASGSSCTPNCDSGYALSGT
FT                   RSCSAGTLTDTAACTANPSSPANPSSPANSSSPANSSASSVPSPSPPPLPPPPPPPPPN
FT                   LVLDAVDAAHTPRDILGALLLACVALLVQ"
FT   CDS_pept        complement(458612..459211)
FT                   /codon_start=1
FT                   /gene_family="HOG000100048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631533"
FT                   /orf_name="MICPUN_57700"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62947.1"
FT                   /db_xref="HOGENOM:HBG560605"
FT                   /db_xref="UniParc:UPI000199AEBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J1"
FT                   /transl_table=1
FT                   /translation="MPPRVEDSDLLAGDVAVVWLFALTQKTASVALSPSFPGWLAPVAV
FT                   DPESLAGFLGESTWLATTWIVVSAAIGGYELDDGVLGREEGEMREAVKGAALAWIAWAP
FT                   FALFGLRWFERATGLRSSFPAGVTLGTVLGVMIAWRAFAKVVGLMGWWRPGRVKGERED
FT                   DDWAFLFASLGGAAAVATGGAVADFATRWLVEGDIG"
FT   CDS_pept        461566..462843
FT                   /codon_start=1
FT                   /gene_family="HOG000233857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631534"
FT                   /orf_name="MICPUN_108063"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62560.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniParc:UPI000199AEBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J2"
FT                   /transl_table=1
FT                   /translation="MDTGGATDKGDEREGKGGKESDEWRYYGRGEDMGASFGVLPGHEA
FT                   KVDGGGFSQMPAPPGESPPRASPAGTIAGRTSPAERQDSTESPEPSSSSSPASLLSIAV
FT                   DLSIPAEEIQLGERIGIGSYGEVHRGLWRGTEVAVKRFLDQDLSQHLMREFETEVDLMR
FT                   RLRHPNVILLMGAVTKTPNLSIVTEFLHRGSLYKLLHRPQPPQVTAALSEARRMRMALD
FT                   VAKGMHYLHSCDPIIVHRDLKSPNLLVDKHWMVKVCDFGLSRMKNHTFLSSKSNAGTPE
FT                   WMAPEVLRNEPSDEKSDIWSYGVIFWELLTLKEPWNGLNPMQVVGAVGFSGNSLAIPED
FT                   ARPEAKSLCEDCFRGNAKDRPSFLEIQKRLRPMQAMITRPGSGNGGAALGGSPAQFSDS
FT                   KPPASPSEPEKPPRAPPPKDEYPILP"
FT   CDS_pept        complement(462958..464958)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631535"
FT                   /orf_name="MICPUN_57702"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62948.1"
FT                   /db_xref="UniParc:UPI000199AEBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J3"
FT                   /transl_table=1
FT                   /translation="MGAVERMRLRAAVLSALVCLALGELYVPGSVPVDDDAPQVRVGEC
FT                   VPGDIPTDGPDPTDNCNAFFKSQGMSYDAYPIPPVCSTACTFEETSPPDEGRGATYAMQ
FT                   WQTRGLNRAVGASEGCGASLPFDPWTGAVTLRPGRYILQGSALGSTSNFMAARIARLDA
FT                   ETNEAETIALGTAQYAAEVDGAKAFANSVVAPVEYLACQETKILLQHWKHVKATGDWGP
FT                   LPSTGFDEPRTVHASLSVRRVGGEGGCASSDPDPDDDVEATRTCTFREAAAICDGNGFG
FT                   TSTADAWNERLLYDPETSGDAAKCGASVADDGRGIVVQPGTYLVSAVSPGIRSLIFVVR
FT                   LAKYDSNGAYVETVALGSHGFERVTDGHPETNALSVILGTEVTVTEPTRFRLEQYVDAS
FT                   ATSGDSKGRAPGYFINAGHFNDCDGDLSSYGANNVIPVIGAQLTVERLSRDRIGRSCLF
FT                   RETIDATTAQPDRFMVNSATGQDGIIAYTWNNGRLLNDHVSSPHSNATVNCGLMSSTVD
FT                   ADGTSFQLAAGNYLLEAVSMGYAMSYGAARLVAVNSTGSKFTVAMSTSTKDETYATGVN
FT                   GGERNELMFIGPVHITVKATSAGAGASEDLPVFRLEQYHFPTTQRYGAGYASGSYNAGY
FT                   KAQESVRIGAQVRIERLKEPEHGGDTTTCAE"
FT   CDS_pept        complement(465659..466702)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631536"
FT                   /orf_name="MICPUN_108064"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62949.1"
FT                   /db_xref="UniParc:UPI000199AEBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J4"
FT                   /transl_table=1
FT                   /translation="MHILFSLFYTRAFCEGEWTDERGHPECEFVNKWALMDPVVGQWDG
FT                   WDKWTFAYPFAQLWYLVSLFTKRLWRPFALEMRWTLLFHVVLGVLVGYTTIGRFLSIHR
FT                   STVHMPYFLCGFLMRKHACFFPSAKTPLAKAMAVAALVFNVGCALMASFTYGMRVEVWF
FT                   QSDPHDEVYGTRWAYGALYQLCLYAWTFFTMMTVFALIPEPEAVGVVYAGEETLPLKGA
FT                   DVEGQTKTPSAPKANARAGKYGKERDQATMAAKVYLRCAKWGARTLYPFVMHIAVLLLV
FT                   ARYTRWYDITWTTDGKDASVSVKAVWTLLMAYTFTIVLSLKPVVGLFKWLLEPNISPLF
FT                   NPELQKL"
FT   CDS_pept        467471..468358
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631537"
FT                   /orf_name="MICPUN_57704"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62561.1"
FT                   /db_xref="UniParc:UPI000199AEC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J5"
FT                   /transl_table=1
FT                   /translation="MAAALLSVVAPNRGRPAARLQRRAASASNAGSGVPSSSFEVTPAH
FT                   IAKGEVAREWIADVFENVDYELALSSSDAIEASGEYVRREDEDEELRYGEFDMGFFVAV
FT                   VEACEPMLAEMEGRMHPSGAPGAFVDVGSGRGQIPVLAAALRPWSRCAGLEYVPVLHAI
FT                   AEQAPTCLENLAASEAALFDESRAAERLNAMPSFDSPAPLSFTRGDMYDAGALTDATRG
FT                   ASMVFMFSTKFAVDGDGRLAVSPNLRPALASGAVVVTVNNELATADGFELVARMDGPDG
FT                   ERSGGSTAYVWRAV"
FT   CDS_pept        complement(<468648..>468821)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631538"
FT                   /orf_name="MICPUN_74715"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62950.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199AEC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J6"
FT                   /transl_table=1
FT                   /translation="CETCGKTFAEKRFLLKHAKTHDTDRPYTCAFEGCAMGFLDSSKLK
FT                   RHWLTHPGVGHLR"
FT   CDS_pept        470137..472542
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631539"
FT                   /orf_name="MICPUN_99962"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62562.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199AF7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J7"
FT                   /transl_table=1
FT                   /translation="MAAEEEKMPRLTTQLSDVSLQESVDSPPVGSRRSMWGGFSRGGKK
FT                   VRSPPAYSSYSAYSFAKGDHHGEVDHDKMRKHSVALAHRISVHTSRLATERELAKAGVR
FT                   PVFTTHDPLWNRRWAVFNPRHRYVQYWDLNTLVLLVITCLVTPYEIAFMDGQRGTNVEI
FT                   LFWVNQYINLSFVFDMLMICLLPFEGEDGQWVVDKKVIFWRYLRSMFFIDLMSIAPFDI
FT                   IERVHTANTGPEDGDIANLKAFRILKLFRLLKVLRIFRGLRIVRERECEYAIDYQALNI
FT                   SMLLVVLLVTAHWIACLVAIICRYDPASPDIEDFFPDLVTEAESPTKLKHYLYAFTWGV
FT                   QWIATGGGSGHDESLVSSGMRSFFIFLLIIGAIANAAIIGGVMTIIDEMNLQQREFYSN
FT                   LNALNQYIKAEDVTNREMSWRGQVMPGREFCRRLRKFYIFKFHSAQQFHNLRSVLQNVS
FT                   PDMRRVVADAMYGDVIRGCEVFRNASDDLVTAIAVGMDVQVFARGDRVYDVGQPADTLY
FT                   WTIKGTVMMPAKEGGHGLDLYRMGGEPFGQEVIYRLGAPRTRTAVCMSEVVLLAVSGET
FT                   VHSAIDDFAERGIRWRVMMTRNILRLSATMLQAKQEALHGHYYSGFCDADAGVRYLDGR
FT                   LGKGVLFMQDPAKNKVNNLLFHLKRLVTEELEKGGLAGADLEEKLKSFEPHEAQWHISM
FT                   RKMIEFNDKVQDLRALLESTVDEENRNMSCWFDTLVAERVETIDQVAEMSHTDFKLIGI
FT                   PLGDAFTIGAAVAKANKLMRDKGVEFLSELGGTGGEASGEGEVSHRGK"
FT   CDS_pept        join(472870..473080,473242..475169)
FT                   /codon_start=1
FT                   /gene_family="HOG000168085" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631540"
FT                   /orf_name="MICPUN_105419"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62563.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG619392"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniParc:UPI000199AF7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J8"
FT                   /transl_table=1
FT                   /translation="MSCCTAATRTAFGLLRRGSKLSLSHTGSSGSSRLPAVARRGRTSR
FT                   VPAAFRNAPAFTSRGGLVSLHRRHAEVLARSSRNNPVSRAVSSVASPPSQDASVSDAEA
FT                   KASGAEISRGGDGPVRPEFCDISEEEDVQKRRIVVMEPGATVVCTAEEEKIFGTLLDVV
FT                   KRYELPVTLRVAGGWVRDKLLGKHSSDIDIALDTMMGEEFAAKVNEYLQEKGEETHGVG
FT                   VIQSNPDQSKHLETATMRVHGQWLDLVNLRSEEYTEASRIPEMKFGSATDDAYRRDLTI
FT                   NSLFYNINLRCVEDFTGMGLKDLQDGVVRTPLPPRTTFLDDPLRILRSVRFASRFGFSL
FT                   DDAIVHAATDAEVQEKLLSKVSRERVGKEVQGMLRGPSPGDALSLLCRFNLFDTVFATS
FT                   FPETLTSRLPPTVAWGCLHSMRCLDAVLSSLANSRGDASFFTKELTCEEREWLVLAAFL
FT                   APLEGGEFQALGHPAGKKTKFIPVVHTVVKEALKWRVKDAEAVSLVLELAADMRWSLIG
FT                   RDGAELPKFTRLRAGKLLRRGKEYWRLALIMGAVLEMPGVVMLGEGDELEPWAVELAKG
FT                   PPSAEPLAESKGSPLHAFSATSLGEGERTKDGVLSDEADAAKVRVSAKKLSARVRDVED
FT                   AVAAMNLDGVWNMRPILDGGKVMKLTGAKGPVMKVLTERLIDWQLENPEGGEAEATAFL
FT                   ASVSEKIVGEYVQPPRGT"
FT   CDS_pept        478062..478436
FT                   /codon_start=1
FT                   /gene_family="HOG000079550" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631541"
FT                   /orf_name="MICPUN_57708"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62564.1"
FT                   /db_xref="HOGENOM:HBG560611"
FT                   /db_xref="UniParc:UPI000199AF7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3J9"
FT                   /transl_table=1
FT                   /translation="MASTGDASTEASTSDREYVSPGVIGACLTIIPNALMWYGAIKGKG
FT                   KLEAFVKAVVKSPVGPVGLLAVPFCGMAMEKCFYDTLVSLQGVNPNIQPDTRKMETWPA
FT                   GGHALPSFSVVPVKHIREYF"
FT   CDS_pept        complement(<480099..>481727)
FT                   /codon_start=1
FT                   /gene_family="HOG000238512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631542"
FT                   /orf_name="MICPUN_80696"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO62951.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG633461"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AF7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K0"
FT                   /transl_table=1
FT                   /translation="RVVANTLVVMGILYFSTMLGLVVEAVQAKMQALREGKSVVVERGH
FT                   TVMLGWTEKSLLFVKEIINANESEGGGVIVVLCKDGKEQMEKELNLFIKKADLKGTSVV
FT                   FRQGSRLMIGDLDKVSVSTARSVVVFSDTTMVPDQADAEILQVILNLNNMSLSGHVVAE
FT                   VRDKDNEALIHLIGRGNVETVVSHDIIGRLMLMAVRQPGLAEVYGSILGFEGDEFYTEH
FT                   WPQLVGTKWKDVQLMLPEAVPIGIRNSKNGEITLNPSHDHVMTERCELVVIAEDNDTYA
FT                   PKQRHRCDPGVVPILENEDDEKEYILFAGWRRDLRDILLLLDAMCAPGSEIHIMASVPL
FT                   SDRDALLSEGGLEVDSLRNISLIHHVGNTAMRRHLEYMGIEKFTSCIIFADEEEEGDIM
FT                   QSDSKCLATLLLIRDIQNKHKKLREQGFMAKSTVKRAAIGGTREDDTIPIVTEILDPRT
FT                   QQTIKENPEMRAVSDFLQSNDMVSKILAMVCEDRSVKTILDQMLAPRGATVACIPASRY
FT                   ALDDEELSFFQMACRCQEFGETLLGY"
FT   CDS_pept        join(<482828..483306,483358..>483679)
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631543"
FT                   /orf_name="MICPUN_70257"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62565.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AF7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K1"
FT                   /transl_table=1
FT                   /translation="RDVNSFTLLDVLGFGAMGKVRLVRHKRTGLHFALKAVAKDTVTHR
FT                   GTRAARLVIAERDALSALERSPHDRVARMFAHFQDATSLYILLEYVPGGELRSKMRRHG
FT                   RFSEQVTRFFVAAIATAIDHLHAVVGVAHRDLKPENVLLDNRGYPKLCDLGSCARLGGR
FT                   SYSAVGTPEYLAPEVIDPAAGRLDLSPTSRTSGYDARAVDWWALGVLAFEMTHGRPPFR
FT                   ARNVHALYRAIAAGDVKYSKRCTADFIDVVGRRGFMARDPSKRLG"
FT   CDS_pept        join(complement(484341..485207),complement(484140..484301))
FT                   /codon_start=1
FT                   /gene_family="HOG000242796" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631544"
FT                   /orf_name="MICPUN_80830"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62952.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG601038"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000199AF7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K2"
FT                   /transl_table=1
FT                   /translation="MASSDDEPGPSYGGPAAVDPPVLLSAAEKRLRKWRRMLGVTVDDW
FT                   KAYVRAKPQVVQRRTRKGVPAPLRGYAWQVMSGGRELRACHHGVYDELVLSTLDERDDD
FT                   IAKDISRTFPSHVFFAKPDGAGQRSLYNVLRAYSVYDREVGYVQGMGFVAGLLLLHMSE
FT                   EDAFWVMVALFRGAVHEPLEGLYSPGMPLVRRCLHQLEGLLGEHLPRLAAHFQRECVHA
FT                   SMFATQWFVTLFAYSLPLGVVERVWDVFMLEGVKVIFQVGVALLQRAEENLLALPFEVL
FT                   AANLRHFPVGGRADDDNVEADDLLERALALRLSRRLDELRAEHDYLNERMRDSGAERSH
FT                   PP"
FT   CDS_pept        join(complement(488168..488803),complement(485310..487856))
FT                   /codon_start=1
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631545"
FT                   /orf_name="MICPUN_96323"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="valine-tRNA ligase activity"
FT                   /biological_process="valyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62953.1"
FT                   /db_xref="GO:0004832"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006438"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniParc:UPI000199AF80"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K3"
FT                   /transl_table=1
FT                   /translation="MKVAEEDPEAAAKKAAKKAAKAAEAAAKKAKLEAKKAKLAEMEAA
FT                   KKAKEAAGGGDGGKKKKEKKGGVDEEDLAALKAAQAVPKGEYKDPAVVPMAKAYDPKNV
FT                   EAAWYDWWEKEGYFKPTMGTSKPKFVIVIPPPNVTGALHIGHALTNSIQDTIVRWRRMS
FT                   GYEALWVPGTDHAGIATQTVVEKKLQREEGITRHDLGREKFLERVFEWKEQYGGKIFNQ
FT                   LKRLGSSLDWSRERFTMDEMLSKAVKEAFVRMHADGLVYRDNRLVNWCCRLKTAISDIE
FT                   VDYVDLDGSKEMSVPGQDGKVEFGSIWSFAYPIEGGGEIVVATTRPETMLGDTAVAVHP
FT                   DDARYKDVQGKHVIHPFNGRKIPIICDAELVDMSFGTGAVKITPAHDPNDFQTGKRHNL
FT                   EFINMLTEEGMINDEGGDRFKGMKRFTARPAVIAALDELGLYRGKADNPMRLGLCSRSK
FT                   DVIEPMLKPQWWVACDKMAAEACDAARSKELEILPNFMEPTWFRWLENIRDWCISRQLW
FT                   WGHRIPAYYVKFEGEAEEECGMPGGSSEKLDRWVIGREEDEARAEAEKKFPGKAFTLEQ
FT                   DEDVLDTWFSSGLFPFSVFGWPDETPDLAEFYPTALLETGHDILFFWVARMVMMGMKLT
FT                   GKVPFKQVYLHAMVRDAHGRKMSKSLGNVIDPLHVIEGISLKDLNETLTGGNLDEKEVK
FT                   KAQQGQAQDYPEGIPECGTDAMRFALVAYTAQGRDINLDVLRVVGYRHWCNKLWNAIRF
FT                   AIMNLGDDYKPPEEPLTVNTPGLPPASKWALHRLNSAVKTTVDAMEVYDFSNATTGVYA
FT                   FWQYDVCDVFIELMKPVMNGADEAAKKATRDTLWTCLDGGLRLLHPFMPFVTEELWQRL
FT                   PRRAAETAPSIMVADYPAFTDARVDAAVEESMAVAQEIVKATRSLRAAYNLQPKAKAEL
FT                   FVVTRGDVATVAAKQFAEGIATLAGCARVDVIGPDDEVPPGCGVTVINESVSVYLMLKG
FT                   VVDPAAEIAKLEKKSSQTMKSIAALQKQMEMPGYEEKVPENVRADNAEKLSKLGAEVAS
FT                   TAAAMEDFKKLI"
FT   CDS_pept        488909..490357
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631546"
FT                   /orf_name="MICPUN_57713"
FT                   /product="Glutamyl-tRNA amidotransferase "
FT                   /function="tRNA binding"
FT                   /function="transferase activity"
FT                   /biological_process="regulation of translational fidelity "
FT                   /protein_id="ACO62566.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0006450"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AF81"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K4"
FT                   /transl_table=1
FT                   /translation="MATAIGPNPEDQVLRYQSPSNQPYEGLVSSTRHCDVHDGRVLAGP
FT                   IDRASTMSHVSSTAGRWSVARARAASDSAAKARSVRGNRPRRILHDGEHRRVGARVAPR
FT                   AIKKRKEEENPEWAKHWIDGEMPDGVDRELEAALLEMLDRRRDELFGEPPPGPSIEERM
FT                   KAALAEDTPLPKNPNPLELPPLPDLRELAEMSNLSLTDEEIEDFTPKVHGILNWFGKLN
FT                   EVDLDAMNKDVELYRDKWVTPLRPDEPEDFVNMEGIYENAGERWQAPYIKVPSVDKKEK
FT                   AAAAMEGAAAPEEGAPEEASAAAGGGAAELTPEVLGMELLVGKVIKCEKHPDADKLYVE
FT                   TVDCGEPGGPRTICSGLVPYMSAADIDGKNVVVVANLKPRNMAGLTSAGMLLCANNGGD
FT                   GDARRVELLLAPDEAVVGERLTWGDAANEPPHGGNKIAKKRIWEAVQPDLGVNGACEAG
FT                   WRGVVLTSSAGAVKCASIKDGGVS"
FT   CDS_pept        complement(490471..491661)
FT                   /codon_start=1
FT                   /gene_family="HOG000264716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631547"
FT                   /orf_name="MICPUN_99967"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO62954.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG747994"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AF82"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K5"
FT                   /transl_table=1
FT                   /translation="MSVETKHEGANAIGDAADALLKDLSLGDAAAGGDAGGAGSQEGAG
FT                   ATAAQHQEKAPKPLTDEQVDKIVKQVEFYFSDANLPTDAFLMKKVRADPNGFVPIGVVC
FT                   GFNRMKTLLKKHPPIETVAAILRQHSEALVVSEDGIRVRRATPLPDIDLEDVQARTVVA
FT                   ENFKTQPTIESVRDLFSAAGDVAMVRVRHPGMQTPAGATKPSGLDLIATPSNAVHALIE
FT                   FNTRDDAARAAETLNDDKDWRNGLRVRLLVRNVHKKKKQQKQQQQRLEDEHAEEDDANG
FT                   GGGGGGEGGGEGEGVDGDGAASKKNKKKGKWGRQGKKDYSQWASAAAFQENKAFLETDD
FT                   GGGDGEGGDGEERRTTSRSQAAADPAAPRQPTMPDGTRGFRPGAGRGKPQPPPPPA"
FT   CDS_pept        join(491850..491867,492067..493077)
FT                   /codon_start=1
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631548"
FT                   /gene_name="FPS"
FT                   /orf_name="MICPUN_104792"
FT                   /product="Farnesyl-pyrophosphate synthetase "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="ACO62567.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG328346"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI000199AF83"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K6"
FT                   /transl_table=1
FT                   /translation="MADDKKKFLEVFQQLKDELVQAEKDDAQVAIAVDWIDKMVEYNVP
FT                   HGKLNRGLAVVDGMRALNPAGVSDDQMHRAMVVGWCIEWLQAAFLVWDDIMDESVTRRG
FT                   QPCWFRNPKVEMVAINDGLVLECQIYSMLKKHCKAHAGYAELLEMFHEITYKTASGQLL
FT                   DLITAPIGEVDLSKYTEEAYMRIVTYKTAYYTFYLPAAAAMHLSGVTDPAAFAKANEIC
FT                   EKLGQFFQIQDDYLDCYGDPAVIGKIGTDIQDNKCGWLVVQALKRCSAEQRKIIEENYG
FT                   KKDAECEKKIKELYVALDMEAVYLKYEEESYAELKGIMESQTVLPSELFGAMLAKIYKR
FT                   QK"
FT   CDS_pept        complement(493173..494735)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631549"
FT                   /orf_name="MICPUN_99968"
FT                   /product="Predicted protein"
FT                   /biological_process="mitosis"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /protein_id="ACO62955.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="UniParc:UPI000199AF84"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K7"
FT                   /transl_table=1
FT                   /translation="MAPTYSFPILGNNDIIACLAEMDITITEKELLRPHPDTLFKVYED
FT                   LVVLLCGETREEMYTPNLEAAANCLEFPELYEEAIGALKFHRHLFKLMKNVGVNDFSMR
FT                   DMIKPEYARTRRNISAIINFAKFRESMLEKHEEMLEKAAEQEAAYEAALARNKELKEKI
FT                   AKLTAEREAKAAADEDKENNAEKEAPARESTPEELAEAKRVHDEAKANYEMWVKKKEEA
FT                   DAKLEAAKKEEDETKAAVIEAEAKKAELERQVAEAEEKAKGTDADRAAAAELAEEQRLV
FT                   DEAEAKLKALQEKERKGKEALAELKKLIEYVKEVETDIRKANEAEAKVKGLEAEVNKTE
FT                   EELFQLDQKIDDLTRQETNWKEKIARQKEQGELKRQAAEASLKAAKEELAAVKARNAAN
FT                   DAKKAEEENQAKQLELKMQQEDEEHEREIEALVTNFASLRDQVVKYHARLADEMGVAEN
FT                   ERVPLQRVEPENARRGVGDFTNTINWTNYDITKNFGGIGKGKPSLAAVGRPAGAEDTEF
FT                   TLS"
FT   CDS_pept        join(495091..495920,496003..496012)
FT                   /codon_start=1
FT                   /gene_family="HOG000182278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631550"
FT                   /orf_name="MICPUN_57717"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62568.1"
FT                   /db_xref="HOGENOM:HBG735894"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI000199AF85"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K8"
FT                   /transl_table=1
FT                   /translation="MAGVTYFERDFDFESHAREVEATWDPAVGGGPAPSPSVTALDGAA
FT                   TVGQVGTNRRGPPGDEDGATPTTSEAQARAWDDFHGTHDSGVFFKERRYLLAEFPALLD
FT                   VGCVLEVGCGSGSSALPVLAANPSATVLACDWSANAVRCAERAVASRARDDADRFEAFV
FT                   CDPSTSARGALAAEVHRRLERRGVHRGGVDAALLVFVLSAVPPGTPTVAFLRRCVEAVR
FT                   PGGLVCFRDYGAYDLPMLRFPPSRRLADRTYARMDGTLARFFTVDEVRTMFREAGGS"
FT   CDS_pept        join(complement(498940..498972),complement(498517..498795),
FT                   complement(496099..498360))
FT                   /codon_start=1
FT                   /gene_family="HOG000012952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631551"
FT                   /gene_name="KAP"
FT                   /orf_name="MICPUN_96325"
FT                   /product="Kinesin associated protein "
FT                   /function="kinesin binding"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="ACO62956.1"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="GO:0019894"
FT                   /db_xref="HOGENOM:HBG381067"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR008658"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B030"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3K9"
FT                   /transl_table=1
FT                   /translation="MAEEKKYIKKKQIRPGAIVLADDDTAILVHYELEGQMYAADGVTV
FT                   VTERSNATKRIKVKTIGATTDIEGLAAEIVDKCKLIHHSKIPKVEGLLRDLRDREAGGG
FT                   HQPVAVVRGAPTAEAPANARRGTAPKPSSMSSMSSPSSSSSIGSKRAGVGAAPAAAARP
FT                   QPRDEDPTSPTLRQMERLAIAEDERVLRETTAGGASMDLAYANARVPSLANVKSHAEDL
FT                   DDYLERLYDDDMNARVDATARIAALARRVENLPMLLGHDTLVQTLARVLREEGRKSVDL
FT                   ATNVVSVFFAFSNYSQFHPAILENQMGDATMRIVDLETKRHDDRLETIKEQGELDEFTE
FT                   RRLALAERKQDRLLYVCFYMLLNLSEDPSVERKMKKRNISVYLCKALERRSVDLLVLCV
FT                   TFLKKLSVYRENKDAMKQCAVVDKLARFVPGQDVLLLATLRLLLNLSFDEDMRKSMVER
FT                   ALIPRVVDLMKNPHFQHVSMALLYHVSVDPGTRGMFAYTPAPKILMDFILQVEDLHDAP
FT                   ELIALAVNVTSNAKCAEIMCEHVVQGPKRERGFDALVRRGIRLRDPLAFKVIRNVARAS
FT                   DDARRNFTPYVVDLIRLMKEEEPGSDLMVEVLGTLANLNCDALDITETCQEHGLLEYAA
FT                   ILLSPGEVDDDVALEAVMFVGSIVCEFNAQHVVDCGLVERMYTLMSDKKEDDEFVLQIA
FT                   HAFGAMLRCEATRERLLRGTQVVHYLVDLLQDTNVEVRKCADSALDAVMDYEEDWAVKI
FT                   RRLKFESHNREWLDATRDGPGDGDVDGPDGYRYDPYHEGPGGGGYRDDEYGDYPDEYRE
FT                   SPADMGMYSPGTVLDNPQEYYGEEEEEVHPNGVGYGGYRRENEYY"
FT   CDS_pept        join(499190..499285,499420..499509,499633..500358)
FT                   /codon_start=1
FT                   /gene_family="HOG000012410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631552"
FT                   /orf_name="MICPUN_105420"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62569.1"
FT                   /db_xref="HOGENOM:HBG560614"
FT                   /db_xref="UniParc:UPI000199B031"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L0"
FT                   /transl_table=1
FT                   /translation="MNYFTRQEMEGSVRYSGKCRIGNWNENDILDEVRLKDYIAKKEAG
FT                   TLRMDKFNKRMATALQPVELTKDASDEYVHFGDVVQLENVTSGAVVAVDVESRDPRPAE
FT                   NACAVSASFHVDACARNTFTFEPYVPRTAKAAAMLPTYDDDVLHYGQKVKLAVNPAAIE
FT                   GSGWDVATCRLKSFTVSQTHFAKFSRRCEVVASGNDSYECVFEVLTPDPAKRLVSEGVP
FT                   VMAGAPIVLLHCQTNQCLCVGTHGFANDFGKELEVCGHTETSVGNSYKMEGLATGVPKS
FT                   LKERAPQDCNVFAIVGKPTVVA"
FT   CDS_pept        complement(500455..501216)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631553"
FT                   /orf_name="MICPUN_57720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62957.1"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000199B032"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L1"
FT                   /transl_table=1
FT                   /translation="MAAPLPHTVVLQPGVQSQWQVDTCDCNNDCTNDLCCKAVFCPCLI
FT                   LGANESMLQTGVPAGWLLSNGSRPDDNNSECMISAVLNVGNFVLGWVWLFVCCPAANPF
FT                   TINCAPFHSHMKRLQIRETYGIEGNQCQDFLCHYCCTPCSLAQEYRELKSRLMRGDRGT
FT                   MGTSPVAAMAQQHQVLQQTVQQTMYPAAPGAVPAQVPAPPSPAPTTMATAPAANVMSPP
FT                   KQGQNKKFCGKCGHAQKAGNKFCGGCGASVS"
FT   CDS_pept        502265..>503074
FT                   /codon_start=1
FT                   /gene_family="HOG000233857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631554"
FT                   /orf_name="MICPUN_81229"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62570.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B033"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L2"
FT                   /transl_table=1
FT                   /translation="MALDLKSAGGGEDDVLGAGGFGEVTKMRWVPGGSIDVAVKRILQR
FT                   KPSRKALEELRREAEAMHAMRHPNVIQLYGASLTPPHVCLVLEFAPHGSLMDLLEQEGA
FT                   PSGRTKWRERLILASDIVKGLTYLHYRGMLHLDIKSGNVLLFDGKSRHVAKLSDFGLAY
FT                   IKNETSAGSTVATRTGAGTINWKAPELFRKTGKATKRSDIYSCSCVMFELASGTIPWDG
FT                   EGPGEIAGMVSVGERPDKPEGCIDAFWDLIEAGWRATPEDRISLADSL"
FT   CDS_pept        join(complement(505964..506587),complement(504944..505888),
FT                   complement(504134..504904))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631555"
FT                   /orf_name="MICPUN_80765"
FT                   /product="Predicted protein"
FT                   /biological_process="Golgi organization"
FT                   /biological_process="protein transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62958.1"
FT                   /db_xref="GO:0007030"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609081"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="UniParc:UPI000199B034"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L3"
FT                   /transl_table=1
FT                   /translation="MEGLSENPTIEELIEHLQIDTSVPDYDQEAHVFPDWFDQTPFKSK
FT                   DFNVDEWVETMHSRGHTMEELQVQLDAYGKVVEGKLVEITARDFDKFLALSDELPDIEG
FT                   AMKDWDAPLDKLIAQITAQRDAMQKELDEMEGALKEKKRLADERETLELMLETHNVVAK
FT                   VERLLHEVGAGPAGKESATDLETAVDDSLGVADVLDDDDDDSDGDASSAHVVDDRAQVL
FT                   ERVASEMGRLRFLQNKGKKLPFVQSLAARIDACEASLGAAAAKTLEEALSAPAPRDRSR
FT                   IEHCLRAHVAMDRARDAEEAIGRVLVEPAVRRVVDAATAATSFPELLHACVAAAIASCE
FT                   VEVEASGDKEFGMDAKMCILANSVLAKVDEAVHAARPGEYGPGEPDRFIRNQKAAMAAI
FT                   RGLEERTSSVANVTAFRESEAFAAYHKRWNLAAYFNVRMGEIAGEMTSFLDDFSLVRAV
FT                   EGQTGGFALAATAATWKALERSWSDDVVCVHAADKFLRFAAQIVARYGSWVKMGADAVG
FT                   TEPPAPPRRVVPEHSWGCAATAEDLAAIRGDCEALSAKVLDSFVPGMSDTLRTAFGEPA
FT                   ADAARECMEEGVKELARGPAADINGALMRIIGDRCVETLKQMKGITATFRMTNKPLPTR
FT                   HSHFVPGAVAPLKLFVEQTARKKILSAESATQVAMAVGEYVAGKYAEMASELVAGVKKT
FT                   EASLNRLKDRRAAKDGGSAAGGGDDGEKGPSDTDKICKQLLLDVVEFGTQLTKLGTDPA
FT                   RSEKFKELWSLVAPEGEKQVPVFLTA"
FT   CDS_pept        complement(506988..508523)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631556"
FT                   /orf_name="MICPUN_57723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62959.1"
FT                   /db_xref="InterPro:IPR014848"
FT                   /db_xref="UniParc:UPI000199B035"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L4"
FT                   /transl_table=1
FT                   /translation="MARRELRLQAELLDRVVVPGIDFYVRLAVDAVGGDGGDDEAESVS
FT                   VSAITCEWHGTERLDPAWVRPARGASSAPASSGGGGLAPGERFFARSPAAKVAADVVAR
FT                   AGETLAFRVGLCLPPGMPPSFRGAVARYAYAVTFVATTGGDRVVHRMSLPVETVSGVAD
FT                   GGAAGGGRGWGLAGGGIPQASGGFLGAALSPSSSRHVLRNSPDAGSPTGRPAVGADVPS
FT                   SPTHRLARSDSLPPPESPGSPLAALSLGFAGGGVDSPASCGSSPFGRAAPATAPAAAYA
FT                   IALDDGSRLLRVIPRAPTPRCVAGGAFEVALDFGTEDEPSAGAAGRGGGGGGDSGGGDS
FT                   GGGYGGGGGGGGGDGRFRCERVSVSLETEEVVVHSAVDDLRPGSPPVKSLEDRERDGEC
FT                   VVTRKVWCERSEWTSDTRETHFCLASPTDAPASFRTSRAQLRWIARFEFTASAELGGGG
FT                   RRVEKKVEWRMPVEMSGAHALGLGARVGTARGVPAGWDGARGSMTRESSLLAL"
FT   CDS_pept        join(508779..509266,509384..509885)
FT                   /codon_start=1
FT                   /gene_family="HOG000233026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631557"
FT                   /orf_name="MICPUN_81249"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62571.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015746"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B036"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L5"
FT                   /transl_table=1
FT                   /translation="MSHFEVIQELGDGSFSEVLLCRRKSDQSVCALKVMVKHHILKEKK
FT                   AEFVKNERVAMDRCADVPGVVRLRFTFQDCNSLYMGMDYCPGGELFDQIRRRKPRGLPL
FT                   RHVRAYAAELLDTLDAVHTRGIVHRDVKPENVLLDERGHTLLTDFGSCLDLREDGDGTP
FT                   RLAFVGTCDYVPPEILGEPGGDEVGWAEDLSRPMPPPASMDWWSFGCVVYQMLTGTCPF
FT                   RGANEFLTYNNIVARNVAPWPDWLADETSDADATDAAKDLVEQLLNPDPFERLGSGPRG
FT                   ADDIRAHPFFESVCEWGAPLRSRSAPTPMSRSRRNSSSSDSSEYDCAT"
FT   CDS_pept        complement(510018..510968)
FT                   /codon_start=1
FT                   /gene_family="HOG000225879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631558"
FT                   /orf_name="MICPUN_99974"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62960.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG289372"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199B037"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L6"
FT                   /transl_table=1
FT                   /translation="MAAVALNPNGIAAVRPSRKAKRPASRRRLLTARAAGSNEDKPTAQ
FT                   SVLSFLCPLLKAFGGGDAAAPRNRTLEVATSGFASIARLPFGSKVDEACIARPASAAPK
FT                   ERIVLYEFEACPFCRRVREALSQLDLTVEVRPCPKDAVKHRAEVEAMGGKLTFPFLVDP
FT                   NTDAGKGGMYESEDICRYLYDEYGNGAEFPEGIVSTTVLTGWMPTLLRAGRGMTRYANA
FT                   TTHRERDEPIEPLTLYNYEGNQFARLVREALCELELPYVLFNCGKGSPRRATLTEVAGQ
FT                   GASVPYLVDPNTGRGVGESEEIVAYLFQTYGAANS"
FT   CDS_pept        511092..511574
FT                   /codon_start=1
FT                   /gene_family="HOG000232014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631559"
FT                   /orf_name="MICPUN_57726"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62572.1"
FT                   /db_xref="HOGENOM:HBG299597"
FT                   /db_xref="UniParc:UPI000199B038"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L7"
FT                   /transl_table=1
FT                   /translation="MTSFEIGRDPAEDARIRASAAFHLAFPVRSIQEAKTFYGPDGVLG
FT                   CIEGRSTDRWVDYNFWGAQLVCHLVEGYDAAANHNNVDGDPVPVPHFGLAMTLEAFEAL
FT                   ARRVEEKNWPFQIAPHLRFEGKPGEQRVFFIKDPSGNALEFKAMTTPENLFARYRA"
FT   CDS_pept        join(complement(513649..517187),complement(513266..513426),
FT                   complement(511956..513178))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631560"
FT                   /orf_name="MICPUN_99975"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO62961.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B039"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L8"
FT                   /transl_table=1
FT                   /translation="MGGDGAPAKGRGRFRKTGWCYPPESLLRAEADSGGDDDGPALVRP
FT                   GASPPRSPRGAAPSGVERWPSARTPKVGGDRSAPRVDRFVLAPLLKIMRAALARRDHPR
FT                   AAAAAALVLTATRGRDGEPRDDDPNARSVTVGHWTRGSRERAEYGEAEHAAIHAAIEIL
FT                   RETGGAPPPEAPAPDDGGGASRLGATSASGQTHRRRLLQPPPPPNTANNKITQPAPLTR
FT                   LTPEEEIRLLELARRCTKRGTDANEEDLVSIATVYDEKLNDPDRAVAELSRDERATVPP
FT                   KGSKGGARRVPHSYKRLRCVALIRHRAWLRQSRFVNASAGDADEGENLRVPLNATGSTA
FT                   PKGPPGGRTWSHFERVRIESLAKDAEDAIGRAEEKADETGERGDPRLASARAQIRMAAG
FT                   DVVGAREVLEDLAAREDMRGCLAAQTMLADLLDEIKAAANPPERSIAENPGSESGDSDS
FT                   SGDSDSDSSSDSDSSSSEESDDARDALLQRLGDVPDAHAMAERHLAVLAIDPKRVASIL
FT                   GLTRAFFEAQADEARALLHPDHVASQDAWREVSRTKRATSRAVLEALCRWAEAAPAEAA
FT                   PWRALTVAITGLRWPSLDAHLKYGGGSVADPVTTELRLRTQCGEVVGGAEDIVHVFRGG
FT                   GDGSRDAGRLATWRRSFIPTNVEALKAPPDTTPEGIAALASRAAAFAALFRGDDAVDAF
FT                   VNEAESAVNKALARAHGSKRARRHPERARGVCAFRARDVGSRAVVEEALLAAKRDAVAA
FT                   AARRHEETGDGDGGDVVLAERLEAAPSSEEFRAVSGWVHDRGLAMHPAARNKEPEKSSR
FT                   VRTGGYKSKRVRLQELVDIRDGVVLRRGMKKRKGDPNAVRVLTEGERAEIARLQEAVDA
FT                   EERAREERRVAKAGPRPECLDEKPVSKREVEAAVQAEASGGRAFTKAVKLLARRNALLE
FT                   AQLAALKDWKRRGGDLNGHDERTLLRLDRWRSNLTIARNRAVVTRRRREVAAGMAHAVR
FT                   HHATNPNRPRVGETCRRCQSQPGKRAKYCGSDCAAHGCENAPASSTFLPHRYGSISTHL
FT                   ILDWEPSWMHSRRRIKGKAVDGGGGDGGGVEIDGRVARGVRCAGCRDGQGSAATCGTRF
FT                   ARACCIRSLDVTVLSMPPPGPNEKARRRCDACRAAGITPRLCGTALAEPGCARRIAEGD
FT                   GAGEAAKRRKTSAAFWLERAFLTRIAQPLQIRTRSGAMAAEKEDATKADAEEAPAPAAN
FT                   EDTPAPVEVGAKRTAEDAEGPTPDSAKRSKVADDSDDDDKTPRGGDVHEGEATEAEPEA
FT                   AADAAEKKDDDETPPGGTDAHAPEEAAADAPAPAPANEHEPTAEIGADPADAVAAAAAA
FT                   AAAHAAAMAPPAPVVHAAPAPVEPVVKEIDCPATMVGRVIGKGGETIKGMMAQSGAHIA
FT                   MNQSLEGDVKKVVITGAAPCVAVAEALVTRLLSHPPGLAVIDPAILGPGQESRIVECPK
FT                   NMVGRVIGKGGETIKGLQAHSGARVQVDQTVGDPCHVVIAGAPASVAYAAEAVAAIIAG
FT                   GPTAQYAVPQAGAGYGGGYGGYGAIGGYGGYGGYPQAAAAAYAGYYPGYGAYPYGVMGG
FT                   YDPAAATAAAQQTAASAAQQAGTQQADATAGDWRAVDDGNGKTYYYNGKTGVSQWEKPP
FT                   GL"
FT   CDS_pept        517341..517949
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631561"
FT                   /orf_name="MICPUN_57729"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62573.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B03A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3L9"
FT                   /transl_table=1
FT                   /translation="MPCSKDSLQRCWEECECECYDDDGEPLETCECGHLAHQTVENGCP
FT                   PDGSGMAYCPDSWCGNPDCKLTPCMMCGTGGLSSVMNCHSGLCSAVCAMTMNLGGPVSR
FT                   AGTGDCPICLEDPIRLVKLNKCGHTMCYACRAKNIQAQRDIATGDGEEFLNFLSMCPMC
FT                   RAPNAQALDRENPYANFREAAFAQYELRENRDYVPPSAE"
FT   CDS_pept        join(518416..518422,518586..518707,518812..518916)
FT                   /codon_start=1
FT                   /gene_family="HOG000265374" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631562"
FT                   /orf_name="MICPUN_57730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62574.1"
FT                   /db_xref="HOGENOM:HBG560619"
FT                   /db_xref="UniParc:UPI000199B03B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M0"
FT                   /transl_table=1
FT                   /translation="MEEFKAGKLSKVTFKYGFPQYAKPAAAASKQLGFKVGKEHETVVI
FT                   VNTAYLKQAAQNAMKYGWAKEKQSPGVQKFMR"
FT   CDS_pept        519185..520483
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631563"
FT                   /orf_name="MICPUN_57731"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62575.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B03C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M1"
FT                   /transl_table=1
FT                   /translation="MLRAAARRALPAALARGARRYTGHAPSSTLALVYDNHGHPSKALR
FT                   LREVPVPPLGPDDVLVEMIASPVNPADLNVVEGTYPIRPGTFPAIGGNEGLGRVMRVGE
FT                   RVRAALATRYPTESNNGDAFSPESLARGAPLHVVTAEPGCGTWRAHAVIPARKLRTLQR
FT                   GTEPASVLPGASAHEPYLEELAQMSVNVQTAWRMLEDFVRLDYEQATVVLNAPMSAVGR
FT                   AAIQLCKHRGVDVVALLRPRPSHEAFAADANRLVELGASLVFDDDGAAHRTTDARSRLA
FT                   NLPPIKLALNGVGGASCVNAASMLARDGVVVTYGGMSKQPAGIPTGAAIFKNVAARGFW
FT                   LTRWLEDRRMEEEASVHTDPSVVPWAHGSFMPPSDSAYAKGKRHAMATECERLIRAGTL
FT                   NLPTRRVGLEEAVDVIGEGASVGAGKTMIWMRE"
FT   CDS_pept        join(520631..520744,520849..521895)
FT                   /codon_start=1
FT                   /gene_family="HOG000242496" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631564"
FT                   /orf_name="MICPUN_57732"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62576.1"
FT                   /db_xref="HOGENOM:HBG716844"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B0F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M2"
FT                   /transl_table=1
FT                   /translation="MSSDGGELCSARCAEQPFDVAFHPGNNGIFVSGLITGAVEVWENK
FT                   GERVRKLKTIDAHTESVRTLGFVNDGALLLTGSSDRSILALDTATGKPLAKLEHAHKSA
FT                   VNRLKVLDQNLVATGDDDGVVKVWDTRQQTACGSFVPFVDFVSDIAHVPPDDAVAAGAN
FT                   GPSGSLVVTSGDGTIAHLNMANWKELGQSDNQEDELLSCVVMKNGRKAVAGSQTGILNI
FT                   FNYGQWEDISDRFPGHPSSIDAMVKVDEETLLTGSSDGIVRIIGILPNKMLGLVGEHGE
FT                   MPIERMALSGDNQFLATASHDRTIKLWDVGYLWERDLRAEAANFDGVGGELDEDSDSDS
FT                   DSEEGGGGKRKRKQKQKRKKGGKIQDSNAAREAVKKAAAKKFFDGL"
FT   CDS_pept        522230..523567
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631565"
FT                   /orf_name="MICPUN_57733"
FT                   /product="Ant-like protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62577.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199B0F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M3"
FT                   /transl_table=1
FT                   /translation="MDTTPPDGGQAADSLDPFGWMDWLLDGPFKGGSDQLNLTGSPAGD
FT                   DGDDFALPERFEDAELSIIARSLLLDDAPAPQQSVPSRGTAATATGPRAGARNAHHPYP
FT                   SLDFRATPAQRSASRALEVFKTDSILASMGAAKERNLKRKTAAAHPPIGSLADSVPGRG
FT                   RPRPSPAKPAPLSNKPPGSVPPGRSSKFRGVTKHRWTGRFEAHLWDSASARTNPQPGGR
FT                   QKGKQIYLGGYSTESEAARAYDKAAIKYWGQHAHLNFPWATYEGEMDEIESMSASALVA
FT                   QLRRSSSGFARGASRFRGVTRHHQHGRWEARIGRVLGNRYLYLGTFATEELAARAYDAA
FT                   ALKYRGPRAVTNFERPSGGDGVGEKDASTPPSTEPTEPPPAPPARAESGIVVLQSVAVV
FT                   GLVDDGEGNRPTLQGTAVVAAAAAVEAASPSDSRDSSLGRCWVEAK"
FT   CDS_pept        join(complement(525070..525450),complement(523817..524878))
FT                   /codon_start=1
FT                   /gene_family="HOG000240550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631566"
FT                   /gene_name="ALB3.1"
FT                   /orf_name="MICPUN_96326"
FT                   /product="Cytochrome oxidase biogenesis family "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62962.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG560622"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000199B0F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M4"
FT                   /transl_table=1
FT                   /translation="MAACVANLGGIARSNALTPVGARGASSSRTAGGLLPLRRAGSSGR
FT                   AVRRVRSSVAVRASMAGAEFPSFDQVQGAVANVHASFIGNDAVASLFQVADAADAAAPE
FT                   ELKGLQKGGWLGPITDLLESILKGIDSGFVGLGVPYSYGYAILALTVLVKVVTFPLTKK
FT                   QVEGSLQMQAIQPRVKELQAMYANDPERLQMETARLYKEANFNPLAGCLPTFATLPVFI
FT                   GLYRALSNAAVEGELTDGFYWIPSLGGPTSIEARNDGNGFAWLFPFVDGAPPLGWHDTI
FT                   AYLVLPVLLVASQLISQKVMTPDQPKSDDPAQQQSQAILKFLPFMIGFFSLNVPAGLTL
FT                   YWFANNIFSTAQTVYLRKTTKAPEMPAAVAGGMPMPGTPASAQPVRVEYVPKSQRKAQG
FT                   SVPAPKPAPPKVEPMPESLAAEFGDFDDGPAKIVEPVVVEAKVVADTTGAAAAAAAGEA
FT                   GGKKGGSRKGSKGSRKRKGSRK"
FT   CDS_pept        join(complement(528760..529004),complement(525704..528449))
FT                   /codon_start=1
FT                   /gene_family="HOG000259587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631567"
FT                   /orf_name="MICPUN_104793"
FT                   /product="Predicted protein"
FT                   /function="oxoglutarate dehydrogenase (succinyl-
FT                   transferring) activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO62963.1"
FT                   /db_xref="GO:0004591"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG289950"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniParc:UPI000199B0F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M5"
FT                   /transl_table=1
FT                   /translation="MYRSGAPSQWTPGSTAAIRTFPARAFSAVPPAHPAPTPNSKMQDE
FT                   FISGTSAAYLESLEDQWREDPGSVPASWASLLRQMGAQSIQESMRLLLLVRAYQVNGHF
FT                   MASLDPLGLEVRKVPIELDPALYGFSEADLDRQFFLGTWQMKGFLSEDNPVQTLRQILN
FT                   RLRDAYCGNIGYEYMHISDRDQCNWLREKIEQQERAQYSKSRKKVLLDRLAWADMFENF
FT                   LSNKYTAAKRFGLEGCETMIPGFKESIDKAAELGVESITIGMPHRGRLNVLANVVRKPM
FT                   QSIFNEFKAGPKPASDAAKGGSTYTGSGDVKYHLGTSYDRPTLRGGRIHLSLVANPSHL
FT                   EAVNTVVVGKTRAKQFYENDGNRKKHMAVLLHGDGAFSGQGIVYETLDMSQLPEYTIGG
FT                   TIHIVVNNQVAFTTDPKYSRSSPYCTDVAKCVDAPVFHVNGDDVEAVARVMELATEWRQ
FT                   EFGRDVVVDIVCYRKYGHNEIDEPMFTQPLMYKKIKTHRSAHEQYCDKLVAEGTLTREE
FT                   IAQMHEEILRKLDQDFEDSKDYRPKPRDWLAAHWKGFKGPDQLSRIRETGVKMDILKQV
FT                   GMAATAIPESFTPHRVVKRVYDARRKMIETGEGLDWAMAEALAFGTLLNEGNHVRLSGQ
FT                   DVERGTFSHRHALIHDQNTGERFVPLRNVYGDSRPNEFFTVSNSSLSEFGVLGFELGYS
FT                   LENPNSLVMWEAQFGDFANSAQIIIDQFISSGEAKWLRQTGVTLLLPHGYDGQGPEHSS
FT                   CRMERYLQMSDEPPDKIPADMTLDTRTQIQEANWQICNVTTPANYFHLLRRQVHREFRK
FT                   PLIVISPKNLLRHPKCVSPLSDFDDEEASQTEQGIRFKRLIMDKSAKSRNKVDPGVEPD
FT                   AKRVVFCTGKVYYELDAEREAMGAEADVKIVRIEQLSPFPWDLVDRELRRYPNAEVVWC
FT                   QEEPMNMGAWSHVSPRFQTLFKEPHINRRLDALRYAGRAPSASTATGYGAVHAEEQVGL
FT                   VKEALMD"
FT   CDS_pept        complement(529467..530261)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631568"
FT                   /orf_name="MICPUN_99980"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62964.1"
FT                   /db_xref="UniParc:UPI000199B0F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M6"
FT                   /transl_table=1
FT                   /translation="MSTRARDEHARDAPGDDRPATQPESAVAFSPFLEPRSPPPLKPLK
FT                   LHAASSPTSGASSGAQTSPPDPPRFARLSQGFAFELHVHSEMTTNAPESTRGCGRPPLA
FT                   AAPRASPSRSPERNCPRCAELAAESAAKDLSVRALTQKLSRTRALLDAIQDLAEQQATH
FT                   EQRSDSRMTSLEEKVARYREALRSVDGGDALAESSGNRRHDIAEIDYELSDSSRSSSIE
FT                   RNYTHRRRNSVGRHKVHGGSVFGFFGGCGDDVGQARDEDARC"
FT   CDS_pept        join(complement(535624..538175),complement(531725..535016),
FT                   complement(531360..531542),complement(530404..531207))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631569"
FT                   /orf_name="MICPUN_99981"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62965.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B0FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M7"
FT                   /transl_table=1
FT                   /translation="MAEWEARWAEQQVPVRTPVRIRNPREALEKQHLMGRLHRIEQEGA
FT                   HDDGDDVAGPYGKPKAVGTTDMDEFTSIFARAMAESDSSPEPASPSSPDEPEPRDPGSM
FT                   LADLALVDAVWERRSMIPERRDARGATKIPVADEDDDDAPAAPVAPADRWGAPMVEPAA
FT                   RVGITDAASKAVVGSRAMDAIAGNLERLLRDSSEIEPLEPFESLPLHFASKGRPLYEAW
FT                   DFKPLAPPPPRPSAVIAGALDVRGVHGMDGITNVINVAPRETEPDDPLRFDVVGDRFGD
FT                   VARADAAERRRNGERRAKVNYLGTVAKVLTSEMDDLLENLRRREANAHREISKEEAAFR
FT                   RRHAEAKEAIGSWHEQVVISWDADLRAEFDGAVRDACEAVMDDMMEELRWRFGRDIRSA
FT                   ALKIQSCFRGWKARRLAKIRRKGLAAGLAYLRNTALYVRFGFWRHNAAAMRRSRLMLEA
FT                   ADKRRVFARRHKVFLGWRDAARKDKAFRLQCEELGRAMAYRRVAPAFREWRGAARRAVR
FT                   QRVTAVRLLLSVERRRVAWAFRTWSHNAAGCARARVLDTRAHAVASRAAAAAVELAERK
FT                   ATEAWEAAKESSLKASCGRFKEARELAAAAKALAVESEAAEREAAEQARRAGPSLGADG
FT                   KRAWAAYGAVHGASARAAAAAAAANAASEFKAAAKAYCNRILLRKVFRAWAEYSEWLKP
FT                   LRAKAGRALSLFKNNSVGRTFYAWMDHAKEERARREVDAVRAYMDIHQGLISKHIRRGR
FT                   APLGEKVNVASSARRGAYGSSVGEKRPAKSTGAPSNAADRAERRRVAAAAAAGKSARRR
FT                   AAGFEEGDAGDGRGGGSWVAGGVDAWVATTARITDRSRIGIFQVTDPSLTEVEVLVVGG
FT                   GGGGSSIDGGGGGGGAVLYSASKTLSSSSITVTVGGGGTGGWSPSEGGASAFDGMVANG
FT                   GKVGTEEGGHGGASGSENAGGLGDSAGGGGGGAGGPGEVGIGTDAGDGGPGVQSAISGT
FT                   SNHYGGGGGGGGAYGGTPGNGGLGGGGSGGYGENGHSGLAFSGGGGGGGGGRGGPYVGG
FT                   SGGSGVVVVRYKKKSTGTPSCTTSQYLKDGSCVACPPSKGATPSHPSATSTGGSATFCT
FT                   CPENYYAYAGMNAPSMYDWACQECPVGSSFIKNGSAIPTANGASDTCDCKAGYYLDNTG
FT                   LNCHVCAPGTTSAGGRVTECSAIPNSDARATGGTTIITVGDYVIHNFTSNGTFTVTDPS
FT                   LTEVEVLVVGGGGGGGDDTGGGGGGGAVLYSASKTLSSSLITVTVGNGGTGGWSPGEGG
FT                   ASVFDGMVANGGKAGIGAANGGNGGASGSGKAGASGIGFRTGGGGGGAGGQGEAGTNEK
FT                   GGDGGPGVQSDISGSSNSYGGGGGGGGSNYYYTDPGNGGLGGGAPGAQGSASLASQGSA
FT                   FTGGGGGGGGYMAIGGSGGSGVVIVRYKKKAASTPSVGSSDTRATGGKITTVGDYVIHN
FT                   FTSNGTLAVTDNSLTEVEVLVVGGGGGGGDASGGGGGGGAVLYSASKTLSSSSIPVTVG
FT                   TGGTGDWSPGEGGASVFDGMEANGGKAGKPNGGIGGASGSGNAGGSGASGALGTMGGGG
FT                   GGAGGPGEAPIGSDAGDGGPGVESAIHGASNYYGGGGGGGGGPSATPGNGGLGGGGQGR
FT                   YGKAYSGSAFTGGGGGGAGGPYPGGTGGSGIVIVRYKKKATGTPSCTTSQYLKDGACVA
FT                   CATGTTSAGGNATECTASSSGSSPGPPTSSPGPSSPSPSPAQEKKETAEKTRDSILADI
FT                   ADPAVKKKAKLLADAAIAGETVQRLSAKLSAADADAACASAYSKAAVSSGKGACVAKPD
FT                   TSAAAGRRRLSATTYNVELMFKSSEVSDDALAAAANELKANGVEGVTSQTSVDPMQELK
FT                   VIPGIDTNKLQTFDREAKAAAAAAPSPSSEQPPPPPPPPSPPPPNLVEDDDDAAVGQGG
FT                   RLVACVAAMLAIVLVAGMPRARSHYEVLGVSPDAPSDEVRRAYRRLALVLHPDKRAVGV
FT                   SEDEAKERFQRLVEAFKVVGDETGRREYDESHASEIFAAEATAPAGGGVHDRDSWNDVI
FT                   AKLNAQRAKRNKTADKERGKKASSSGAPDAAEVGAKLPFPAAPRPLGCLPEEIVLEVFG
FT                   CAGVSRLVEVEARPRKTAAKAGSITIPDGDWRRVLRMTLKETEISRLCVAKGLEPSTCY
FT                   TFRTRAGVRTEDLGEEWRGEASRLVPEIFGPWSDESAMAKTAALSEKEAIRRMRAEKRD
FT                   EARAIAKKSKKSKSKKEKKKKSKKETRKSRKRKRSSSDSDSGDSSDSS"
FT   CDS_pept        538856..539176
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631570"
FT                   /orf_name="MICPUN_108070"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62578.1"
FT                   /db_xref="UniParc:UPI000199B0FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M8"
FT                   /transl_table=1
FT                   /translation="MLDPRFDNVLGCLRHELAHALVGPDEDHGPAWVRAATALRTPKDW
FT                   ATDTTGSFYNRPMVVAGWSAHDVANAAGRAFRLPPELFEKNVWAGDGTRTVFTDQDGNV
FT                   VM"
FT   CDS_pept        539337..540479
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631571"
FT                   /orf_name="MICPUN_57741"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62579.1"
FT                   /db_xref="HOGENOM:HBG560627"
FT                   /db_xref="UniParc:UPI000199B0FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3M9"
FT                   /transl_table=1
FT                   /translation="MQALTQCAPASMPSVRVRVNARGPARSAARAMVIRARAISTSGGG
FT                   SPVDAAWRGNTPKQSTLPVNPDGSVDYARIDASPISKVLTATIRKLLVEEVGGVDKDPR
FT                   PWTEFGGIMNAVREVNDMDGTARDVQIRAKRVFAGILPALGIGWVPPIWKKFIHPNAPD
FT                   WFSNWAFVLVFTNLFPWLMGPMEGVDHVDVPTPAWIRKTFANFPKTFRVPQAVKAERCR
FT                   FLEMSQCASVCVNTCKAPSQEWLSEDFGMDLHIQPNYDDFSCQWKFSVKPPPLYEDAAV
FT                   MVPCFSKCDSEHKGEKDAFRQQVRVASGVGVVDGVDTYTGETLEQIAKRASEAAVRDAR
FT                   AAYADGTAADAESFGARAGEVKKGGKCWSVDENRQVMGGL"
FT   CDS_pept        join(complement(542012..543300),complement(540649..541945))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631572"
FT                   /orf_name="MICPUN_57742"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62966.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B0FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N0"
FT                   /transl_table=1
FT                   /translation="MIRALERRTPTRPAGGRSHASPPEAARPAPTPTPPRKPRASYSYF
FT                   RTWSFFAGSRKHQPVHPSPPDRPAPDVEREHRMDALEKIRSRSSAASRIAASLRSLRDR
FT                   FAGPRTTNKVSPMPAPRPAVVTTLPSPKRTPSRRRDPRSPRPTPPRPPLSFEPNHSTPS
FT                   TAAASAPPSSSPVAAAAAITPAPTPPARPTPPTTPRPPASPLRTPAPPPPRRRIHVRVG
FT                   TPPRESVETRPPPPPKEEVEEEEVEEEEAPPAAPEPAAPKSPPARRKVPIREMKAALAA
FT                   AGLDASHCVEREDLEALYGTVGKRPRIEITEEREEEEEDPPSASSFDLFDSLPTEVNEL
FT                   ILRELSPRSLAAATGVSRAWRDAAGDDELWAAHLARAPRFSKNEKPVPFPSTSARHSSR
FT                   RGRRELMRTYAAARELGRRWRDGKYARCDLRDHSRPVERVEFADAVGFGRAAVTAGWDG
FT                   FVFLYLCDENAVRGTGWRLARRFKGCEGAWVVSLATSPRAVVAGDTDGRICAWTFGSST
FT                   PARTLRQDGSVTKVRFVPNSGGENDVLVASASTLGDVAIWDLAAGTRLATLRGHAEAAW
FT                   HVHPLAPNPDGILTVLTSSRDSTLRMWRFDEVDRDGPLDVPRGEGGERLISPASTWRDH
FT                   DDAILSLAVSAPPSRSRVCDKQLCATCGADGVVVVRDVSNGEVLSRLTVDRPDSAPMCA
FT                   TFFERPEDPADFVDDSPISSVPRVSGVRGDARDGARTHTWLATGYRTANDGGELRLWDP
FT                   LGGGVAAVLSDQSRPVSDVIATAHALVAVAPGDGVVVYAGVDDDGRGDARDGTARRTRG
FT                   CPIAAAVTVLDGAGADGFSSCAGACDDLLAVGSKTGSVQLLDFRVQAGR"
FT   CDS_pept        543492..546938
FT                   /codon_start=1
FT                   /gene_family="HOG000265660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631573"
FT                   /orf_name="MICPUN_99985"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="ACO62580.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="HOGENOM:HBG560629"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B1AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N1"
FT                   /transl_table=1
FT                   /translation="MMNARDQPPLGGWDFDFVARNARDAPKGPAVCEVCDDSAVGTRTL
FT                   SWLELDAAVEACAKAIRARTPPGTRVACIARDGVAPLVALHACYRARRAFVAMDHASWP
FT                   EGRLRAIAVDARCASVVCADDDEARRARGWFGDAIDAYLSLESLNARRDDHDDDDGDGD
FT                   GDERRSPDDRNPRVRSLAADDPASSSSSRELYVAYTSGSSGFGAKGTVALHDAVMSYCA
FT                   AKIAVERVRRSSRVCLASNTTFDIYPSDAYVAAVRGACAVVASRTLFQADFAAVLRQGA
FT                   VTHVCCTPTLFALARLPRGWEDAPCLRRVSLAGERMSAETLERWGGDPLGDGDEHGDEH
FT                   GDEEDEEDEEDGDGDGHEDENEEDSSGIRDFSPRGRRVLFNVYGATEATVLQTYARMRR
FT                   GDDPGRVGRAYRRGGFAAVHVVERTGEGRLVFLEPGATGEVAVSGRCVCRGGYLNDPER
FT                   TARAFIDVGGDVGVVYATGDVGRVDANGHLILSGRADRQVKIRGVRTELDEIESHVRSC
FT                   VDLVENAAVDFDPTTQTVTAHVQVRPEGYDPATQEWMVARAVELHARRLAPAHAVPTRY
FT                   ALYARHSWPLTSSGKTDRCALTAGLRSGTKAAFRPQRVAPRPGLETALAAAWAASLGLS
FT                   SEDVGASDGFDALGGNSLNVLDVSRRLAADPRISYPRGLGFRTGDDVEPPGFDAEIIDG
FT                   EAAALLRRGDADEPAACAAGVVRGPFAPCEILARPVLRDYAEYLRAEGVAFTNLDGDGG
FT                   AVDDASNRGEAIEDGSNGGEDGDGSGGGRRLGADPIDVGDSLERCALAACSLGAASVVR
FT                   SLLKSGVKPRGSHLRAAAAAVSPAAALETVAALLAAGADPNEASAKGTLATHVAAARGN
FT                   SAVLVALLEAGASAGAKDRDKQTALHLAARSGDVETVRAAAGFAARLRTRDGGLESWDR
FT                   WKRTAAAWALRAGDAECLAALADAGAKLTGLERDVSERWRHGELSERSATQLRSRPERK
FT                   RSAAAEVVQALSARLAADADEADAAEAASALRELVCADAGNRRAAGRAGAVPRLLDRIR
FT                   RLTCVDSIGALRNIANDAAASKEAGELGAVDVLADVVRAAAASGDRGGVDRRVVFAAGS
FT                   ALRSLTLKDAANAERVSRLANVLDLVNAAGSGDARDPEDPD"
FT   CDS_pept        join(complement(547972..547994),complement(547853..547910),
FT                   complement(547146..547514))
FT                   /codon_start=1
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631574"
FT                   /orf_name="MICPUN_57744"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ACO62967.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI000199B1B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N2"
FT                   /transl_table=1
FT                   /translation="MYALVSGAIKAAVAHRGGPFVPVSDRSMSAPYKAPGAKGDEGDAP
FT                   RVHRIRITLTSKNVANLEKVCADLIRGAKEKRLKVKGPVRMPTKVLRLTVRKSPCGEGT
FT                   NTWDRFQMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIVDA"
FT   CDS_pept        join(548181..548228,548389..548493,548622..550079)
FT                   /codon_start=1
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631575"
FT                   /orf_name="MICPUN_93952"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62581.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000199B1B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N3"
FT                   /transl_table=1
FT                   /translation="MSLAFDEFGRPFLIIKEQGSKSRIRGIDAQKANIQAAKAVARTLR
FT                   SSLGPKGMDKILQSGDGDITITNDGATILQEMEVEHQIGKLLVELSRSQDYEIGDGTTG
FT                   VVVLAGSLLEQAEVLLDRGIHPLRIAEGFEMASKVAVAELERVSETFEFSATDAEPLIR
FT                   TCMTTLSSKIVNRCKREMAEICVKAVMAVADFERRDVNLDLIKVEGKVGGKLEDTVLVN
FT                   GIVLDKDISHPQMAKVIKDAKIAILTCPFEPPKPKTKHKIDIDTAEKYEELRQQEEKYF
FT                   KDMVQQCKDSGATLIICQWGFDDEANHLLMHEKLPAIRWVGGVELELLAIATGGRIVPR
FT                   FQELTPEKLGSAGSVKEVSFGTTKDRMVVIEDCAASKAVTVFVRGGNKMMIEETKRSLH
FT                   DAICVARNLVRSNKIVYGGGSAELACGIAVEEAADKIPGVEQYAMRAFAEALDAVPTAL
FT                   AENSGLPPIETVAMVKSQQLKEKNPYLGVDCKETGTNDMKEQGVFETLIGKQQQMLLAT
FT                   QVVKLILKIDDVITSGKYD"
FT   CDS_pept        join(550545..554458,554920..556138)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631576"
FT                   /orf_name="MICPUN_99988"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62582.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199B1B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N4"
FT                   /transl_table=1
FT                   /translation="MELYGDDDPGEPGEAEPEPEPEPSPEPEPEPSPEPEPEPEPSPEP
FT                   SPEPEPEPEPEPEPEPEPEPEPEPAPEPAPEPVPEPEPEPEPEPEPEPEPSPSPEPDPE
FT                   PSPEPEPSPEPEPDPEPEPEPSPEPEPEPPTPDPPEEDPAEDIDDLLDDLVLQLEVDAA
FT                   RMDAAVKIQALTRGRATRREMRERRRAATRIQAAQRGRAARKEVAARRREETGDGTGGD
FT                   GGDAADEDEDDAAAMDRSRDEDDVDELASALVDTAAMDAERHAAAVRIQAARRGVVGRR
FT                   IAAGVRAAGADEEEEEEEEEEEEEEEEEEEDAGEAAATSELDPVRRAEMELERLMSPDL
FT                   EPLPEPGSSVDELTGELDQTSRSAIEEATRFAEDLAKEADEDASAGEDDREEEEEEDEA
FT                   GSEIEGVIVQREYPPPARPELGEEESFEYAAMRYDGGEVAAPVSAVYSPKRREPRRMFK
FT                   PKKSAAQRRLERLGIKKPEEDDENGAGAEVGVLRDANRVLGTAEELAERRRLMAENFER
FT                   LISGRDAFILEDELLGGGSPTFQPTQYRPSPTKPAPRKIPVYQDPERDAEIAVELRARE
FT                   RELAWRREKREREEKALEAERRRFEVLKRELEEIESRRREQTYEKERRKEEEMELRRMR
FT                   MENRRLERLVANDRAELDNRHVAGDNRKPGHGRHDRVRHKNAPLFKRMEKAYHFNVEME
FT                   IERERKEVLEKRRAKMYGAKPGLSYAQLQFHREQEAKQPTWQKNRSGLGVPPGGLPAIG
FT                   GARASIESLDGVGPRMSRFERMRREEKARARREEIAKYELAERKRQYGEMVKKQYKPSV
FT                   SEKARSDLLKRKDVARPGFEDYHAESLDALSPGADDVAPPPLPRIVPNREVAAERGQEV
FT                   FFEYDVHGRKVLVDPYEEHDMNSPFRPQRPGAKLAPSPRRKKQKPKREEEPIVKNPRRE
FT                   EESRARQSQQEMTPAEHLARLSEERHRLERELLSVEYTYRNGRLIGRPVERRSFGSPVA
FT                   SADPRVQRQGRAPVPSRGHPSWPDSAGTDGYVGGGEFIPRDYVPQAAYDEIPVGGGGMV
FT                   GGGGGVLSETAVNRHAAREDQGRRKGKGFRTMLRERQIAAVEARMSKETSAPTEPVQFT
FT                   PTPPPPRTEPVQFTPAPRPARPPVAAHDPPVPPLAPALTPEELEEIIANAGPDDVPPMN
FT                   VRVGRYSFGAVYDESPAPKPRRREAPPPPQLSPTQLAEIVEKAGPDDVPPIVGSVGAGP
FT                   AVSWEERPAMSRANFEATRAQAAEEEAARRRAEEEGERVARLSGGDDDDDDDGIGAETL
FT                   VAADTLPPGVGIGGAETDAEDSRYGSALLLALGMLSAHVADAYYYGGYRYYGGPAVVRR
FT                   TVVVRGRRGRWGRRLAQVDDEDFDALAFLAESPATSPSMAPAASVAEEEDDATECDTIL
FT                   DIVETRPEFSSLAAALADLPLLREAMATPNRTDTFFAPTNDAIESLLEWGGFVDRAEVR
FT                   PPRTGVLKTLLDLVTVVSSDGSRAVFNLFAGTSVPIALDSLTSPSSSQRRRDAQGIQEM
FT                   LGNVSLKALIIAYHAVPGAVYSAEDLKTIGADGPPENYLDTALARILAAAAELEDPDAA
FT                   DSLDPVATSAASEPLYIDEFGGDVYVKGIGSEAKVVTADIEACNGVVHAVSHVLLPLDG
FT                   DGELSEEQKARIAEIRERSDRLVAEKLADLDDDDDEDEGAAPEAAPSDDDDEDEAADDD
FT                   EADDDDDDDDGED"
FT   CDS_pept        complement(556457..557359)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631577"
FT                   /orf_name="MICPUN_108073"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62968.1"
FT                   /db_xref="UniParc:UPI000199B1B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N5"
FT                   /transl_table=1
FT                   /translation="MLPADDAKAEEARRLAEKKRDAYFAELEKESSTAKGKRSKKGAAK
FT                   DPAAKPAAKPLGGTKMAFPVGLKKTSTIAMKGVAAPVAVEKKGTGATVAGDLTTITGIP
FT                   PPPEEDPPEEDDEDGGTDTYVRFTVPSGCGGEDGATHVRVQVPAGPAGGAGPVVEVELP
FT                   PGVGEGDAVEAVIPAWGASDVPPPPPPRTMGSAGVSEGVAPPPPPRGIPPPPPVMAGGG
FT                   YPPPPMMGTGMMGMGQTVGRPGPPHPHMGVGMGAPPMMPMGGVMPMGVRQPPPPPPPGR
FT                   TGTPPVSGVPPPPPPPPQV"
FT   CDS_pept        557410..559707
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631578"
FT                   /orf_name="MICPUN_52745"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62583.1"
FT                   /db_xref="UniParc:UPI000199B1B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N6"
FT                   /transl_table=1
FT                   /translation="MSSCDFLETQSNGAHGASSRGFGRLADRQTDLFRNRTGWIRPLAI
FT                   SSQHRFGLRRHNAPALIMTRRVHRTMRVSALCVALLLVVSGGFASAEEAAACSPSGDDP
FT                   SCAAPRQNVAPDAAAEAGATLLARANEENDRLKTRLDAALEASKQWQTKAVEAEGTVAS
FT                   LRSRADEIEQASSGLSAEIAQLKPQLDAALETAKRWESKAAEAEGVASELKPQLDAALE
FT                   TAKRWESKATEAEGVASELRSKFEATAQATSSLPAKISELELKLAEALSAKAAAEEALE
FT                   DFDRVITDAWLPHWLNRDIEYVRGELRQLWRAFVKVSRDAMASWGVLERFDELYAKLTA
FT                   AAAPHVAHVKDILIACYGRVVEQIDELNARWFKARDNVVNLIKKFKEAGKRRREHEAKT
FT                   RGVNPDRDRREDEKAAYSREYWDRQRQRLGHLGEDASAVAKYARAKLGGWYGQGSEKVR
FT                   ERVAHVRTSYKHRIMPRVAQWRVALAKNSRPVAELIVAKYPSFPAWLKEALASVRFPHG
FT                   DVDDVSIVVGDLLGYVLAAMGVSSFLYWTVLRRTWVDDLPDEAEFSLKHVPANDGTIVG
FT                   RAIGGGADIRIVLPSVKSAAECDILVSDEKVLVNAYKMEDGTWYHEVKVRVPKECRGFG
FT                   WQDGVDKWDMSARFELVGEALTVSLRTPTRALRAAAAKAKGDDPEEGEIIASPPPVLAA
FT                   KPAGGKKKKKKSGGASSEIPKPRPADSGGSAVTAAPPTPPESPEARSVPFSPVIPTGRT
FT                   PVAARTRASTSA"
FT   CDS_pept        complement(559837..561807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631579"
FT                   /orf_name="MICPUN_57750"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62969.1"
FT                   /db_xref="UniParc:UPI000199B1B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N7"
FT                   /transl_table=1
FT                   /translation="MAQSGKDAILAAARRIAELDSDDDDTADDGDWANWGGIDWKNLDV
FT                   DDEAEEHAARETSAESEARTAEALGIPLRLARWLARHKGGDVRRAFHVATRNRSTGAPT
FT                   PDADGTIALGNRRPKYVPLEERIVAVKPAAMPTKRPEDFEALRHAKDARERTEARRREV
FT                   AAGCARAIAEEQKKENVAMTPVARAAVAQALVSREQRPDRAPGAGPAGRHEPSVVGARR
FT                   PVDATSAVGANVSAVMSLMGVGAAAGADRRAAGTPGSANEPARRRLTGAERAAADNALL
FT                   RLLPPGERPLVTNLLSAPSAASKIPKPTRQQTLDGFAAAALRAEARTRFDGADPDATWI
FT                   RAHAKAVRRAMTRAVDAESRVAARAGSKATYRNLSAQALRVVDVGEVAGSNPGGDGDGD
FT                   GTGEWDRNDAVDPADRDAVAFANDVAARSRRIGVELTPVGLAGPKPGALLQGYRRPAAD
FT                   AVRLADARVVRGDAAVAFFTVAARLARPVLRLCDRARGMLERRRAAAKRGAGEEALGGG
FT                   AGKRAGLTETTEGKRARLTETTEGEKAAVDEGAIPGRPHVVAAVRAFVDAYMEPLVDVG
FT                   AVKAPAARTIARKATAKVMAKHERAKDAAPILARESDAIKKLVKAYVRRGQKEGGRGGN
FT                   EPPAREAKGCQGGFRWDDDVW"
FT   CDS_pept        join(561955..562278,562392..562646)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631580"
FT                   /orf_name="MICPUN_52746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62584.1"
FT                   /db_xref="UniParc:UPI000199B1B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N8"
FT                   /transl_table=1
FT                   /translation="MAAVAGFTVSARACVTAARQTSIARKSTVVVAPPARRGSSVVTNF
FT                   NPAAGDFSVTLSQGVGAGVAVVAARVVLFSLAKAGIGKNVEKWSAKCAEYGIDCSDLYH
FT                   TEDQPGDAWYLIGDWKPAKAGEPKHSDTTLVGILTTRAKTHELVNECESNGISTSDVVA
FT                   ATYRPDNFISNEKARFNELTKRLKEAGLR"
FT   CDS_pept        562912..563802
FT                   /codon_start=1
FT                   /gene_family="HOG000260873" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631581"
FT                   /orf_name="MICPUN_81116"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO62585.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG617986"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B1B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3N9"
FT                   /transl_table=1
FT                   /translation="MLAGGVSGVAARLLTHPMDTVKTQMQVQGAVAAAGGNRALHYRGV
FT                   ADAVAKIVANEGVRGFYRGFGAVFTGIPFASGAYFGGYEGAKMLVPADAFGPTATYIVT
FT                   GMLAQSLAGVVYTPLDVVKERLQAQHVLGAASAGNYKHFANAYATILRTEGVGGLFRGY
FT                   WASNFTWWPWNVAYFVAYEHGRDFVAQHAMGLSTKDELPPWASSGCAVAAAAAATVATT
FT                   PIDLAKTRLQTMRRGVSGGTVEGGVFGIMRDVVRREGLGALWTGASARVLAIAPGSAIS
FT                   FYVYETIKDWCTGAG"
FT   CDS_pept        complement(564001..564783)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631582"
FT                   /orf_name="MICPUN_57753"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62970.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B1B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P0"
FT                   /transl_table=1
FT                   /translation="MAAAVTTRTTWVPARLARPTAIRASRHRASISSRRVRAQIARASK
FT                   NDEPDLDPEEPGFFGSDDWDGNEGPFIRPEGSPFFASYTDPTVWKLMQENLVAGEVEQI
FT                   LPAKAKLMAENDGWTLIDVRPYPDYCEAHAWGAKSAQLYVPMEVDSLAKGAKAVASVLL
FT                   FPERLGKKYVNVECNEDFLDEMQEELEWGAKVILYCATGGVIGDPELNYADGQQSASLI
FT                   AAHELAMRGWGTDNIKHMAGGLGMWDAIEGFDLGAVPE"
FT   CDS_pept        565150..567513
FT                   /codon_start=1
FT                   /gene_family="HOG000198016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631583"
FT                   /orf_name="MICPUN_57754"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62586.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B264"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P1"
FT                   /transl_table=1
FT                   /translation="MRRRALDIAATALRRGRIAVRVSSTEAGGGLGDSRGRSGGARAAG
FT                   GSRGGGWGDEEHTAAIRERIRAVRASYAGDDGRAHSSSAASASSSSPSTSGRGAVPPWS
FT                   RPDRHAVYDPAAFDEYFSRRPLKVMYRFLEVVTRLSDVGARVYVKRGTIEERAARMRRH
FT                   FTELGPAFVKLGQVLSTRADLLPASYCEQLGQLQDNLPPASREHALALLRRELDAPPEA
FT                   FFERIPETPVAAASLAQVYRARTVDGGLDVAVKLQRPGLAESVALDATILRLIARIVRR
FT                   FVRLRSDVVGIVDELIGRIFDEMDYRREADSIRRFRDVYRVGGGAGSGLEGLVRAPAVL
FT                   DELSTRAVLVMEWIDGARLTDVDAVAAAGLTPSDLLERGVRCSLHQLLETGFMHSDPHP
FT                   GNLLVAPDGSLVYLDFGMVVEVSPGTRRAMIRGLVGFVNRDAQSLVGDLRTLDFLPSDV
FT                   DHAAAGAALRGVFEASSAGRAARAGEDAGGGGVVTLPSGSAVRGTNDFLGVVSQLSAAL
FT                   LAHDFRLPPYFARILRALAALEGTATGIDREFKVIERAYPYVLAQLLADKDPEMRDILR
FT                   RLVLEPCGTSVRWSRVRRLLNAYVESGGGISGGKRKANAAGGAARSEPFGGCRAAETAA
FT                   GLAAGARALASGADYSRHEDDDAAAAAAAVRDALAYVMSPSGAPLRVTLVRDVLDALDA
FT                   YLEVMEGPSEDRGFGGGDAFFGAEDLKRLAETGRAVYLRAPTAWAPVVVNAVMREEACE
FT                   MAGRVAQGVSERVTRDNTRRLVKRVVEHFFASKP"
FT   CDS_pept        567663..568097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631584"
FT                   /orf_name="MICPUN_57755"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62587.1"
FT                   /db_xref="UniParc:UPI000199B265"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P2"
FT                   /transl_table=1
FT                   /translation="MSRQPDVSVGGHSFRLFLLFLAAMCAVTVASGARRTPTGVVLRKP
FT                   LQILKESKTDFAPGTSGGGPTYWLYRDFHREVPAQVEATGWILAGNMADRAERVAAHHA
FT                   LWSEAAPDDDDAPPALPNVARASLLENIARLLTSVSAVQY"
FT   CDS_pept        join(complement(568720..568974),complement(568261..568563))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631730"
FT                   /orf_name="MICPUN_57756"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62971.1"
FT                   /db_xref="UniParc:UPI000199B266"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P3"
FT                   /transl_table=1
FT                   /translation="MAGGRGGRGNGRGGRGGGGGNNGRRVVQVVSPQPGAKNKTGGAKT
FT                   LDARFTALNKRRAEQVQRGTTARYAATMAKRTGQSAKKFAAPVAVAGKGKKIVVAKKGV
FT                   AVGKKKVTVAAKKAKLAAKKDARKAKAKGTAAPAKKATPAKKAPKKKKTKPAKPEYKPE
FT                   DLDKDLDSYMAAAPANPEAMAA"
FT   CDS_pept        569357..573847
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631731"
FT                   /orf_name="MICPUN_57757"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /biological_process="RNA processing"
FT                   /biological_process="guanosine tetraphosphate metabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62588.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0015969"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B267"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P4"
FT                   /transl_table=1
FT                   /translation="MATLGGTAAATALAPPSCGARSGARFAGVGGRRMERQLSGSVAAS
FT                   SGKGMGVGCSPRAGSRRCARTVRRARPCDRDVKLRAASGDGVRDGDAEMDGEAPEREAT
FT                   QSGRGSPGARGRKNGAGGSSPSSALVASNSLASSSRVVEFVAAWDALSPRLAAAAASGT
FT                   SFSARTPLGETVPVSAAGNREMLLSALKLAIPRLQMIPDQQTNPGERPVHERAVEVTLA
FT                   LVDIGMDAECMSAGLLREALVAGTVSLDEIESHLGAGVMRLAHDCARLHALPRRVGSYD
FT                   DGAAEKLRTFCLTFHDVRAVVVELAYRADQLRRAESLPPVRRTALALETMQLYAPMAHA
FT                   LDAGPLCAELEDLSLQWLFPSSYKSLEQWLRGEGPADRSALDRAREWLTEALCADPGLM
FT                   TLVGGPAGVAVKARRKSLFSTMRKVLRDGRAREDVHDLLGMRVIITPQPGAPSHSRAGE
FT                   TNEDDVAAAERSAMAACYRAQQIAHGVFDVVAGRTKDYLQRPKSNGYRSLHSTLTLPED
FT                   WTNADGTVNNAGGGSKVEDEPGMDANGKIKERSKEKSGKEGGKEGRRVELQVRTAAMHA
FT                   AAEMGSAAHTAYKGGFKEDPGAADALAELVNAANAAAEERFGSFTEAGLADAAGSDADR
FT                   MFQMFDLNGDGAVTREELRSVIGDLWQGTAGDGEESELRHSADELIELLDVDEDGTVSR
FT                   EEFAKFRTSVAVLGSLPDADAATAAAIECKFTPRVEAEILEDEDDVNVDEDDDDISAAD
FT                   ISKINFEDDTVAGQASWTTASGADAPAVDVSIVSMEKARSMAAKIDEEADEDSSFSEDE
FT                   VEDAVAAFAAAQAMSPPPLPPAPPAGRIRPADETLREASRQLKDKQGGDVQWQLVWDLM
FT                   RAGRPETARELFYQRTTKNPSSTTLWEQWARFELLQGDAERARGLYRAALLHAEGRPRA
FT                   RAESLRKWGVMEFGAGEPANAVGLFERALNVLQDAEEAAAAAEEAETVEHLGTGSASSS
FT                   TDASSDWSDGIGETAVDACSDLECVPRLVTSESSASLRRAQTVVLCAWAQVALRSGDVS
FT                   AAQALLEDARTRDGDNVRVLHASAQLAEASGDVEGARKIFAAAAERAPRDPHVALSRAR
FT                   LQCWKLDDPDGAREIFTAAAAANPENYRVLQAWAVMESRRPRGGGGKVADYAKLTFEDK
FT                   VAGMAAARPLFQRAADVAPWATKVWAAWAQAEFDATGDVDRARELYTRGLASDPTSVVC
FT                   LRGLGRVERTAERFSQARDYLERALDLEPRNHMCVRELAMIEEKSGNKARAARYFNVAK
FT                   ALVKEEKAARDKKGGPPPPKSGKGTWAPAEAAAAARGYAAMVKSQSASYTVRYPGGGEA
FT                   GGGSHSFRSVLAAARGEAAAARRDKGRAGGAAARRGRAAYVRSERIRGTREADASTAPA
FT                   DGERVWSGRVDGRAPLRVRSRGGDGPSPVGSSLDGPGSSLDPLGSSLDASGSFDMGESR
FT                   DDAYAAYMSDDVEDSFEDDSYDEQVAKSMLRGYAD"
FT   CDS_pept        complement(573909..574481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631732"
FT                   /orf_name="MICPUN_108076"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62972.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199B268"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P5"
FT                   /transl_table=1
FT                   /translation="MGVFGVALLTNSGGDPTYADALCVLSATVFGYHMHVSGNVAPKFE
FT                   DQELPFVAMQLTVVGVEAGIFKLGEIVFEAANGGPDLMTVIANVPATTGDVPWAPLVYM
FT                   GVVTTAFTLFIEFIAFQSIPASLAALIYTAEPLWGAAFAWHFMGDRWGGIGWAGAGLIV
FT                   IATVGSQYLSFKEDVKTDENAAPAILP"
FT   CDS_pept        join(576651..576935,577105..585162)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631733"
FT                   /orf_name="MICPUN_57759"
FT                   /product="Predicted protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="zinc ion binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62589.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="UniParc:UPI000199B269"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P6"
FT                   /transl_table=1
FT                   /translation="MTRGRPTTGCIATRPDSALTDTFPTSFPTQRSTLLNSAGSSICEA
FT                   CTNPRASGGDGADASPPEVAEEAPPENMWCCAVCTYHNAMFSSRCVICTQGTRPEHLTG
FT                   DATQVDPAAEFTRVFGDADASDAALEAKLQELCTYLLAFEERGEVFGRRNDRRIMECLA
FT                   KLLSAYVDPPVEPTRPGKEKKGAATEPAAAVAAPAGAGGGAAGGAATPRRGRSARGGTA
FT                   GASASASPTEGGATREAHSLPLREAAPTPPRKRGVNVMELVCRALWTYEEVTELHSEEG
FT                   YGPMLAEAPMRALLSVLEPTPAARTLAAARSEAPATEKPKGKDKGKGKAKAKEPEVEVP
FT                   FVLPPPQSLDPDRRLAAEESVKLIMLLGQVRRGGATASRRDMLIRRVFPGTGGLEARRI
FT                   VIRLGGLAVLGEYTRACYKDGRTANALDALTLMQGLCQVSREQPGEALAPTLVSLLRDD
FT                   SAAALHHECLRCLASVYAACGEREGAVLALVDLCLPALLAKTLGRGVTTEEPAGGSGRG
FT                   DESGGDASTSATSASTPVMDTASRLVLWFFSPNTPRVAHLCFKEGVLDLLSDAEVLTRA
FT                   CAMDGSGATTSAVTLLLQATEKALAHLFAPDVSADGAKKKADDVAKSAAVAALEASHHG
FT                   LQIGDRVRDIHHDTIGEIISLMSGGRCLVAWDERTDESDEDDEEEDEDDDEEDDMDHDG
FT                   DVDELPGHGDVPSAYLELVDDDGERGPVGHAAALAAGAPPAPRAPGDPIGFRGGPESGG
FT                   GAFAAALPGSREFWIGAGVSASAAPSTSGDPVRAAKEASAVESAELVPLARRLEMARVF
FT                   TARLLPALLAAQRTAAHEPTKRLMLRLVLSLLSHVGDSRLPGDDFASLLSLLGTTLSDA
FT                   QSSGLLILALQVVDSLIRLDAGNARELRRHGLLRRIEQLASKGAADGEKEGRTSPRRRT
FT                   PSSLGAALQAATGAPPTGGGITGAAREQEQVYAMARQTLDNARAAFKTRDGAPGTSGVS
FT                   ADRLALTAAAVASGDASAVRQLASMLVSADGVTVYEMEEARLATALLHYLVGDGAATTE
FT                   PSTLATRRDAFRIAFLEPATPPRTDESRRGEREDKANAAIGGSSERTAFAVLLRLLHST
FT                   LELNEQLPVFRNLALGHRPPADANRPGGPLGAVTGVDASAKLASGLNMLAAPLRLTLRR
FT                   SPLATRGVTDLAGAPLHAGPLTPSAAVEHHILRRVVILDPGYRRWCDALVGGRIWLWIP
FT                   GTVNREDVDAVEDGEEPLAVTSPRGRRRRGGAAAASPAEAEKAGRWAAADVKRYNPTTG
FT                   RHALIVEGGAGFRLEPAARPALQHVALVERKYRVIHRPEPTPTPEPEKPRPGKDKKKRS
FT                   KPDANADKADESSRKRRRKAKSPVKAIRPEDAFKDTFRVILLQPEADWDVDTFVENHLD
FT                   QLWNILEEEASKFAPAAPSGAAAPPAETPEDAAAREITAAVASRLDRALGLSPSQIRSR
FT                   HRRVNADGDVDDGEVETDDEGIVELHEEDIGSRAALGWDSFAHFEEEVMDALEKDMAVP
FT                   VVKRASREVCDAIAAAVTGHSASLTPAVRLNPRANAPPQTHACRPPLGARVVIEPRAAE
FT                   EARQRARIAMQGLPAPPPPVPRGGAGESRPDPDDTWLAGTVVRHRAADSMDVELDTDGA
FT                   LVENVRLENLRMGDEEEDRTAAALLPVATAGASSGGGTAGGTAGGTAGGTAGGFRVGDN
FT                   GEIQLDVHLGSSREQVHSAVGEMLRGGVSRDEILEALLRASGVSSGPGGSITFRRLPGT
FT                   DNDVGVFSVVSSRSPIPPGVGGGLARSWSGLDISEAGRDGTRIMRSDISLDQLRRRGDE
FT                   EAIARAPSQPPSRPASRGPPRAPSRPPSRLGGPSSLSPEKASVPPPPPPPRRCEKPPVV
FT                   RVRFALATPDDSGAMAASLFAAKPPGVPNGSATRVPTLSAPPFPGSTAGIYAARARAAA
FT                   GSPPTTLRAAPGSATLFHTLRSLAAAATTAARNAGDGEDNTANVVVGSMDHDRWFARSV
FT                   LHYDVRVEGLPAGMASTAEEISAATPEPPPPLPAPRPPPPPRAKSEPDLWAVSDVRERL
FT                   VGGRSPKLTKTTVVARLRAVCGSDVLAKRDLRGSNKAAANRVSASKLADIYAELHDEHV
FT                   KALASPVRMDDGDGNGDGDGDGEVEMPTVPDPSPPVEGARVEEDAWALYWELLRAGVGG
FT                   EGRGPPEPAPIRALAPSAASGDIDERPTPGSSIASSWIACGGGRDPTAAAAAVALLAAL
FT                   HRRFGPVGGSTAWENSRVAQKLQAQLEDAVAVASGAVPAWTHTLLRGAWFLFPLEARLR
FT                   HFHSTAFGTSRSVTWVQEHAGAGGGVGGGDGDPARPRGGARRLGTLKRERVTVRRDRVL
FT                   ADADVLMRHHARHKSVLEVLFTDEEGFGGAVTKEFYNKVADALQLRSENTATMMWVPDE
FT                   DGDDGPEHLWQTRGLFPHPLPPRSPESELARRRFRFIGRLVGKALLDGHILPLPLNPAF
FT                   VRVAILRETLTEEDLPAVYDDRCAGGAVARWLCGAVRDVRRHRECERRVFKIGSSGDCA
FT                   DDTDDASDAHLRMGLGDGDEAVDAAAVDTHLERLSYLSYACPVSRVPLTAEIFECGDAD
FT                   DENDSPATRAARRLARHVDAGEHEVHVGNVEQYLADVVRYWFADGVAAQVEGFREGLSE
FT                   IFPVDALKAFSAEEITELVCGKDAIEWTREELRRSVLPGFQYTAESPPYLWLLDVLVDA
FT                   PDHERRGFLEFVAVCPRLPPGGLAALPRGPIRVNRMDPVDKLPEGRTCSQELRLPAYGS
FT                   KEELARKLRLALQWRNHLGIQ"
FT   CDS_pept        complement(585355..586128)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631734"
FT                   /orf_name="MICPUN_57760"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62973.1"
FT                   /db_xref="InterPro:IPR008496"
FT                   /db_xref="UniParc:UPI000199B26A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P7"
FT                   /transl_table=1
FT                   /translation="MDDTLRDTGADVSSAGTKSLPPVESRKNRFPMCVVWCPLPMITWL
FT                   FPPIGHVGICYSDGLITDFLGSRFIHRGSLGFGAVARYWRLDPTKVTDGAGGVHTFDTS
FT                   VRRAESLFNTCEYYNLFGNNCHQYAAHAMNLAGYQGKRDWNMVHVAANVLLKGRWVSPW
FT                   AAVKTWGPFCVALVACAATGAWGFVQGIFGAFLLLVVYFSSYSFGYADPARKLYQTPNK
FT                   VEQYSEDEVMGMQMHQAAGGGDDEEPPLPPGRSIG"
FT   CDS_pept        join(complement(587980..588179),complement(586259..587744))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631735"
FT                   /orf_name="MICPUN_57761"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62974.1"
FT                   /db_xref="UniParc:UPI000199B26B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P8"
FT                   /transl_table=1
FT                   /translation="MSARGSPPDASRSRHQGDAHASRGSGHHHVPMVQTSAPHRAESPI
FT                   GVKTRTREGVVLTKDHESRHARPDGGGGSPKSPKHVTNKTYQPTPVHATGWSSHHVASR
FT                   AHGARDGDGDRDDPRGDPPHRLPSPSSAKYSRPFRGAATAAIEDQPHQHPGGPHRVDAT
FT                   AQTDALPQLPSLAELGFGSGLGSSGGGASLGGPPAGEAAGFGSSPETLRNLERLIEAQR
FT                   AQLVSKGLISDDRGRRTGHGGGHGQGQGQGHGQGHGHGHQPPSPRVGRRSPGSQPRSRR
FT                   NNSLGGDGDLVFFESPMPNPERRGGNPSPVARPRGPTPRKMRTGNHARSSTKQVSPEKN
FT                   EPPGGLVGSGYGLNPDLSSLFSPSPPVKTPASSRADRGDAKLGTSPTANRTLHFSTSLA
FT                   PRLTGQTSSVSGVAKPRPRPLSHAPAVARHLGVLEDDSALASPESGFSSDGSGGAMGPT
FT                   VQAGGGGAGGGIAPVRVGSQTGLGLGLGGQTGRGAFRVVGSFTPAPASAFVAGEKAELR
FT                   RGSASDVEAARERVGRGDGPSGGVGGTRGSSVLTQSLRKEDAFE"
FT   CDS_pept        join(complement(588972..589501),complement(588443..588941))
FT                   /codon_start=1
FT                   /gene_family="HOG000242852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631736"
FT                   /orf_name="MICPUN_97246"
FT                   /product="Predicted protein"
FT                   /function="ATPase activator activity"
FT                   /function="chaperone binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62975.1"
FT                   /db_xref="GO:0001671"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG407506"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="UniParc:UPI000199B31F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3P9"
FT                   /transl_table=1
FT                   /translation="MAKIGQGDERWIVADREDGTNVNSWHWQEKDAFEWSRERFADLIG
FT                   AIEFEDGGVRCRCTGVTALTGEAYVNRRKGKIICGYELDLKIGYEGTILDGGKTVTGNV
FT                   HFPYIADENAGEEHEAKVLAAGEGPDDRKVKEIMRLVALPKMAEGVAKFEKELAKGGPG
FT                   GEGADPNEAKNASGDKKPGDVQSNAEKERESRTDKTAPLSQKSHTIRITERFYCRPRDV
FT                   CDALMDGQRVMHFSRSPAQVRPEPGPFMMFDGNIHGETLEYVPGEKIVQNWRFRNWKEG
FT                   HFSKVTITFREPEPGNCFVDLVQTNVPETDAFDNETVMDTTEVGWKQQIFERIRQVFGY
FT                   GA"
FT   CDS_pept        590332..592320
FT                   /codon_start=1
FT                   /gene_family="HOG000027493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631737"
FT                   /gene_name="ASN2"
FT                   /orf_name="MICPUN_100000"
FT                   /product="Asparagine synthase"
FT                   /function="asparagine synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="asparagine biosynthetic process "
FT                   /protein_id="ACO62590.1"
FT                   /db_xref="GO:0004066"
FT                   /db_xref="GO:0006529"
FT                   /db_xref="HOGENOM:HBG752912"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000199B320"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q0"
FT                   /transl_table=1
FT                   /translation="MCGIFAVIGLTGDPLHNRKRVYGLSKRIRHRGPDSYKMDVSIKED
FT                   GKQTYMVHKRLSIVAPGPSGEQPLYTDASHDTTFIANGEIYNHGHLREKYNIVSENKSD
FT                   CQVIGHLYEQNGPEFIRELDGMFAFVIEDRKTGTIMAGRDHMGKIPCYIAYGKDGSVWF
FT                   SSEMKTLVDDPGIAKYEIFPPGHYYIREKGETEGKMVRWYDPKWVTDVEYIPDRKADYT
FT                   ELRETVVDAVKNRLMADVPYAVLLSGGLDSSLITSIAVRHKKESKNTFGADEPVHSFSI
FT                   GIKGAPDLIAARKVADALGTVHHEIHFTPEEALDALPDIVWHLETFEQVRASVPMYLLS
FT                   RAIKSYGFKMVLSGEGADELFGGYLYFHKAPSAAEFHKECARKTTRLHQWDVLRANKST
FT                   MAWGIEVRTPLLSQQVCDYAMNTDPEQKMIRMNETDEDGHPFLEKYLLRKAFDTPDQPY
FT                   LPDEVLWRQKEQFSDGVGYDWVDGLQDYANKMVSDEQFANREQRFPLNPPTTKEYYLLR
FT                   EIFEEHFVTGMENGDCAYATCPFGKSIACSTPEAVAWDPEWEKSVGDISGRAVKNVHVA
FT                   GDKFDLKKDGAGKDTKSSAKEKKPAEAASVMAIIGGHAGVRGSVAVKAAKGPVKSGARA
FT                   LGGRGRAAVKSRFVGLRAVRASAVAFA"
FT   CDS_pept        complement(592558..592977)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631738"
FT                   /orf_name="MICPUN_57764"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62976.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI000199B321"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q1"
FT                   /transl_table=1
FT                   /translation="MPRAPPAPKRQATLHDMGKVVSSRAFSYYNVSSEDVDRYKATLED
FT                   ADTTKEEFLTALRHLSSMLMTRDLLTSSMIGKVVSRLRRKHPDEEVRKLAGAMVDKWKL
FT                   EVIRQVDVDRRVERRSRGDVRTFIEAGRGGSGWRR"
FT   CDS_pept        complement(593094..594113)
FT                   /codon_start=1
FT                   /gene_family="HOG000246879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631739"
FT                   /orf_name="MICPUN_57765"
FT                   /product="Metallo-beta-lactamase protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62977.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324401"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000199B322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q2"
FT                   /transl_table=1
FT                   /translation="MSQFVASNFARPKPRHLPDLPPIKRVSDRVVRILGMNPSEFTLQG
FT                   TNTYLVGTGPSRWLIDTGEGRREYIPLLRKAMEDEGVTGLEGILLTHYHGDHIGGLRDV
FT                   RALMKDLGVDEPVLAYKRIRAGNGERAVRTDDNPHGDVDDPERSRCYVDVRDGDLFRCE
FT                   GATIRALHTPGHTPDHVVFTLQEEGCMFAGDCVLNGNTTTFENLGEYTASLRRMAEALP
FT                   RGGALYPSHGDVVEDGHKKLEEYMRHRSMREEMFMEALKEDWATRPERGGMTASELCRA
FT                   VYAHQVSYLVLVTACEGITRQHLAKMTEEGRVIAEGGRGGWGWPGEVRYVPAAGEMAR"
FT   CDS_pept        594401..594865
FT                   /codon_start=1
FT                   /gene_family="HOG000264667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631740"
FT                   /orf_name="MICPUN_57766"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62591.1"
FT                   /db_xref="HOGENOM:HBG408952"
FT                   /db_xref="UniParc:UPI000199B323"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q3"
FT                   /transl_table=1
FT                   /translation="MAGLTLGKGAWDCDNNVEIPPDKEQIVFEEVATREFLAFGVLPTV
FT                   PRRKDNDHLAFFCDGCRYRIKASVHDDTVRDIRRRLWEGGLGRGGAMQTGKRDIIERWE
FT                   DVMLSYKFKMMVDDDANLAEYGVPPGCKCLIAVDKNKLGKPPPFKSDYWA"
FT   CDS_pept        complement(594922..596727)
FT                   /codon_start=1
FT                   /gene_family="HOG000230811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631741"
FT                   /orf_name="MICPUN_57767"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO62978.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561587"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199B324"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q4"
FT                   /transl_table=1
FT                   /translation="MTVARGGPATTSGCRPTSRPVRARPVAVRTVSRRTRLARPDSGRL
FT                   PGLAGRRRAERNPRRGPGSVATRASDSGGDLDVDDDRLEARGVPDAFTSGSAASSSESR
FT                   FVQKGFDAGRRARPLGGFDGDDDDDESDAPIARRPRVKPDAAAAANGADGEFPAWEPKF
FT                   PSSLDDLGERWRSMPSRYRILLGTCCAFVLCNMDKVNISVAIIPMAKDMGWSVGTAGLL
FT                   QSAFFYGFALSQLPGGYLATKFGGARMLPIGVFIWSAATMAVPFVAGDTTALFISRVLV
FT                   GLGEGISPAAATDVIARSVPLRERSRAVAFVFNGFNIGSVLGLSAAPLIIEAFGWRTVF
FT                   EVFGALGVLWVMSVGFGIYARGGATPGTPAGASGDLAPVEGLTGQRKLEPGAEERDGVP
FT                   WGQIFGATPLRALAYVHFCNNWGFYVLLAWLPSYFTQELGVNLTNASLFTLLPPLGSGL
FT                   VASAVGPLADNLLERGWEVSRVRKTAQAIAFLGPASAMTAAAAIDDPTLTVGLLTVGLS
FT                   LASFSYAGLYCNHQDMSPRYSSILLGITNTVGALPGVIGVPLTGYLLEMTDNWELSMFV
FT                   PAVFFYVTGVGVFTKWGRAEKQSWG"
FT   CDS_pept        join(596892..596989,597108..597282)
FT                   /codon_start=1
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631742"
FT                   /orf_name="MICPUN_57768"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="ACO62592.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000199B325"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q5"
FT                   /transl_table=1
FT                   /translation="MSVNVGKLSAEEKEKMYSAATTEMEYRVELFNKMVGSCYEKCIDK
FT                   KFKDGDLNVGENSCVDRCTSKYWQTVGIVGQMLGAADQAAMQQGR"
FT   CDS_pept        597478..598590
FT                   /codon_start=1
FT                   /gene_family="HOG000009912" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631743"
FT                   /orf_name="MICPUN_57769"
FT                   /product="Predicted protein"
FT                   /function="aminomethyltransferase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62593.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="HOGENOM:HBG700628"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniParc:UPI000199B326"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q6"
FT                   /transl_table=1
FT                   /translation="MLARGVSLASRRVLRIAGEEAIPFLQRILTNDVRSLADAGAAPVY
FT                   AALQNAQGRVRHDLFLHREFGGALLADLPADGFKDALDALVKLKLRSPVTLDDAGEELR
FT                   VVVAGGERSDRRDPTADGSAEWVPPVDAESADDDILSFLQPDPRWHGLGLRGVIPAAAA
FT                   AELLPAGADPEEAEAAYAQWRYTLGVAEGSEELGGLLPLECNLAGLNAISFDKGCYIGQ
FT                   ELTARTHHTGVVRKRIVPALFARRSQWIAKDSAGVGGRASTPQEKWSGHEVPTRNGDAN
FT                   TNEQQKPRARPGMDVFLDGAPTTGKPVGKVIAARGDVGLILLRIEHLAKADSAEDLALV
FT                   AHGNDERCHVDARVNIPDWWDDTWLQSSLR"
FT   CDS_pept        complement(598655..599296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631744"
FT                   /orf_name="MICPUN_108077"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62979.1"
FT                   /db_xref="UniParc:UPI000199B327"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q7"
FT                   /transl_table=1
FT                   /translation="MPGSRDPTPPVASSLWMDVPYRLFFAHSSPTWAGGGVAFVDVTSL
FT                   SPTLPTAFRLYRITLEQFNDVLAQENGMEPGAAGCRELTGDDAARLVRHWRTEASSLAA
FT                   TGPDEVMHAGTTGTTGPPAESRAPSELWYGYVKCVGVKANEPVLTFTCDADELSGFRSG
FT                   DIPTNPPCEAYVDVIAAGLVQCGLGETEARGYLEARVEASMTSDAGAAAV"
FT   CDS_pept        join(599787..599816,599970..601385)
FT                   /codon_start=1
FT                   /gene_family="HOG000264666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631745"
FT                   /orf_name="MICPUN_57771"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62594.1"
FT                   /db_xref="HOGENOM:HBG560649"
FT                   /db_xref="InterPro:IPR021261"
FT                   /db_xref="UniParc:UPI000199B328"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q8"
FT                   /transl_table=1
FT                   /translation="MAEAVMRRRRRGEENGYMSPTSDGEDSPREWRRRNPLAPFFKRPR
FT                   RPSLPEGARAIPEGARNFVRAKLTGDPRVRVRDYVKMPRTIQTIDKVSFTLGVVGLMLT
FT                   QFVATEHPEYFWFYYLCSAPLVFIYRIIMYRMIKYHYFLIDFCYYANLACFVHILGAPT
FT                   SGRLFRSVFAYSNGPILWAIPLWRNSLVFHSHDKVQSVFIHTAPAILTWCTRWYGQGDL
FT                   TWSWWGLGDATGWLFAAREGDHGQAVAPGLMYADVAAVHRAPNRLTVEQLTMSYDVVDV
FT                   VREFYVYPVVGYLIWQVIYLVITELFYVKRLDNDPELVTSLRWLANDYKAPVTRWALRT
FT                   SRRVGLFAQDELFDHNSLKTKFVFVSLQLVYTMVTFLPIPMCYASKAVHTTVMLLVFLS
FT                   CIWNGAEYYIDIFSRRYAKKFDDGTFMGSVRDDDNADAAVAEAVLAAGSGDLARRSGGG
FT                   DLARRSGGGDLARRSGGPQKSLR"
FT   CDS_pept        complement(601603..602457)
FT                   /codon_start=1
FT                   /gene_family="HOG000238034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631746"
FT                   /gene_name="LI818"
FT                   /orf_name="MICPUN_96328"
FT                   /product="Chlorophyll a/b-binding protein-like protein,
FT                   chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62980.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B329"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Q9"
FT                   /transl_table=1
FT                   /translation="MTLAIRTLRVCASSTRPTAKSTATTDKKKAVVTAGKTFSDISAAV
FT                   DAGLVKGCAPFEDGLDAFGFFNNIDQAEAQRYADVEITHGRVAMLAAIGVLVGEQVEGS
FT                   SFLFDSQVTGPAINHFQQVPGLFWGLLGAFIFVVEASRVQQAWQDPFVADRLFLLKSDH
FT                   VPGDYGFDPLSLGDGISDEELARHKMGELNNGRLAMIAISGMVGQELVNGLNLLPADDV
FT                   MGLGFRLPGAQAGFRALEQACRGAPNEAECAKAFDAAERGGAAALENLLNQGSLLTSIF
FT                   SAN"
FT   CDS_pept        602721..604787
FT                   /codon_start=1
FT                   /gene_family="HOG000264665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631747"
FT                   /orf_name="MICPUN_100006"
FT                   /product="Predicted protein"
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62595.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560650"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000199B32A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R0"
FT                   /transl_table=1
FT                   /translation="MSPYMAYWVSDEDHDEDEEHDDDVQSVPAPEREAAAYTSRRPSLS
FT                   HAHGHRRPLMFALLWTLLRRAAGELGTSGHDLSNFQGKHACDARVRMAAPRTALEVSEV
FT                   VTRFPRVRANGVGHSWHRGLFCSGEDEDSVNVLTHRLRSVGVGASPSDRGRRLAGSGGA
FT                   AGRSPVADRVAVDTESMTVKADAGVTLRELLDHLANHDDLTREDGPPGAPTMLSFGDAL
FT                   FRGTQRGYTLPAFPWFIDQTVAGAVTTATHGSSLRHGSLSSQTTAVTVVLANGTVASYH
FT                   EGNPAFDAVRASVGRLGVVVDVTLRIVSNLAVRKSSATLTPDELVRDVQLASDAAARCH
FT                   ERFPTPGYVRAWECTRAAPDVRRLDETQVFWHFPLGKAVRTDFTRLDSIPGFPTPANPT
FT                   RRRTRRNSNSLRSAWMSTDTSRDRDASVVRAQPPDAPRDITDGDFPLMANDTFSRFWSR
FT                   QWDVSTALNTMSGVDDARDSYLTMTEEQYDAHDNYGYDQYEVCVPLRLAGACLRKIADD
FT                   MVETNPAWDPVGILTPQPGGLAHGFRSPALIRFTSPDTALLSPSNLHAAGACMYVNVED
FT                   YVRHATTPAGRNAKFQKVFEHLRGPKCDGRLHWGKAGWPTEVTGGAFDGAREYGSSWCS
FT                   FGCAAAALDPTGKFAGTSGAMTWPSLDVERCCGGDGGVQYLAGDDGCECARTG"
FT   CDS_pept        complement(604822..605226)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631748"
FT                   /orf_name="MICPUN_52755"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62981.1"
FT                   /db_xref="UniParc:UPI000199B32B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R1"
FT                   /transl_table=1
FT                   /translation="MSVDAEAATSSPSPDYDYKMILAGAGCVAAMSTYGAYRTKWTNVF
FT                   KASYASTWLTLGPATLMYVTPDEATQRERIAKASVGRATSVEAGGGRIGQTAEERRAQI
FT                   ETIRRSVEGGRREAKAELEAEAKKGWWRRR"
FT   CDS_pept        join(605891..605926,606083..606148,606282..606950)
FT                   /codon_start=1
FT                   /gene_family="HOG000264390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631749"
FT                   /orf_name="MICPUN_105432"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62596.1"
FT                   /db_xref="HOGENOM:HBG560652"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B32C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R2"
FT                   /transl_table=1
FT                   /translation="MATIASANVAPQRAALRATKAIAPSRAAFVAKPQRAKRGINVQAR
FT                   AALYFADDVEYIQQIGAEYPDKGIANWEEARCLFSDHGYHVLDIRCDDELDVIGNFPRD
FT                   QSAATEHRGTNWFHHIPIINAQYRYDSEAGKKLMKNQEPNRAFLDQVQSKFPDKNTRII
FT                   ISCSDGRNRAIQALEALDEAGYVNIVGLRGGYNMWNRTWDAKLRRRNLPGGFQEEWQHG
FT                   ADGCGVHATGASFQNQDAFQYADWKDETDWIDWR"
FT   CDS_pept        607373..614398
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631750"
FT                   /orf_name="MICPUN_100008"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62597.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B3D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R3"
FT                   /transl_table=1
FT                   /translation="MSDDDSDGETEAARRLALPREQALESAAHEFFSSSLLAPGLPRHV
FT                   DSPGGVRAVLRSELMSTLDEHVRSLGPPHTLVLTGVEGCGKSTALAQLCERVETMERRW
FT                   EERRRGGALDPSEAPPFILKHSFADPSFPRDVSHFLERACLALRRRFNIREPIPADPAD
FT                   LPEAFAAFLEHAALFRRVLVIVDAAESIAVSPYASFPAAAIAGLDPRDGHALPELLTLR
FT                   GDGRDATADSDAPPFDVADSSAHFAWIPNSPPLAVRFIVSGRDSHDSFDSLKGAPEVEG
FT                   APGKEWAPGGVVQGVLRAVGAASARVYPTPPLTTEETGAMLAMFSPRHPGSTPRDSHHR
FT                   GKEISEVVNAVWPHGATPLWVRTAAGRICATVEETTHGAWVSTGAGVGPVDEWGNAGEK
FT                   DEWGNPVEAPVRNDPNDAGHDEALECPRTVASAVHDMPGTARGLFWEALDAMETRHGEH
FT                   AVAATCVALSVARFGVTRYELRGALRCRFERERVRVRFGPGGAKGANESLRKLDDGRLD
FT                   AVVDDLAPWLAPWCAKEAWHAELETFEGDRLGASREESEARAARHERESRRRRTLSGPG
FT                   GPTYKPDDWYAAELPMRFRDDAYRAAALERYAPPRSASLREEFHADLAAYFLDVAAGSG
FT                   SRALRADTRRALRAGLWHAAAGRDVNSVADVLGRRGVMACLSRPGARSDVRAVCCGEVP
FT                   LELWGAWRDRMATWMSADDDDAPGDVAGAGLTIAGLLRWIGVPTLAAEIIDRVRSSFGP
FT                   PRGRSPLSIALAVAHARLTLVGAGDVRFAESEAGRARAAADLSVAARDAGRDPGRNPEE
FT                   IRVDGDGDDGRGDESDAGAQGTIPRPWLDALEPCGGFAAAIAFPDSLYAEAAAVVAEIA
FT                   VARADSIVQATRGDAAARAADDALRCVGLETDAWLRAARERAPPAVVDAVSDALSDGGN
FT                   VDDLGVGAREDPGDDVLGLVRSLRRQRGACVRFSRHVDAGVVAGRLISVLTAALGANHP
FT                   QCGAAKLEAAESAAAAAESSASVPGYDEASAWARPAYDFAAAFYGSQSLPAARAAWCVA
FT                   EALRRADGAAAARPMYAQALGATASVLGKAHRGVGAMLSETAELSRLERRLEEADALAR
FT                   EGLDIASGELAAARRGLEEADAAAARAMQRREVTIGEHGVDYLPSELLVAMDHGRELAR
FT                   ARAADAEAEYAERATQVARVIHAMGRLPDAESFLRRALFAGEKAFGPANPSLAATLAAL
FT                   GRCALARRRPEEAEACFRHALGVDERAAMLTAATAAGIAATGIAAAGIAPVRGFRHPRS
FT                   AAHLVHIAAQHRSGGRASRAEVYFHAALEALETCDGSLPLPLADGFEESVADDQTLAPA
FT                   PDPGSILNVLAMMYKDQGRMAEAAVRYERSIALGAVAMRAATRAGDRRAWRVAASAVSL
FT                   RLCNLGALRARQNRSGDAAACFHRAATFAKNNLGDAHPQTALCRAWLSSVGGEDAADAG
FT                   VGKAAGVMLDAVVAGDFPQLARPFATAWGALASEETAVKRAAADKMVKDIEASKPFPME
FT                   TSSGPASRPATARSRPATASKPAAALALEPIASADPPPPPEVYRALDRYRQVDEAKRAW
FT                   SAWAHDVERAGGGDTLADLFDGLEVDDCLASVVDDVAAIARTSLIEPRNIVPTSHMFVD
FT                   GATKAFRAAAAARIKAGLAGRVGDGWAAHGDGGDGRILSDVLSAASRGEPIALPPPPPV
FT                   EQPLSGDRDGAKEGAAEHARRLAIERAELDAAASLPGSVRAKAEIEDFEMAEERRRANA
FT                   EPLTNYALRELDRDDDDHVFEDYYRQKLGVRLMESEERAAWQKKVDEIESRRAMEIFDA
FT                   QTDPAKLKKILARERDPHLPELIADKIRNGLEDPGGRGHDFWVPGEFEKAAREQDDIRA
FT                   MMKAAREERDAIKRELLELEAESLSRAASRAQSRHQSRLATPAKTKHGDRRREHRDRDE
FT                   SRDRRDENDEERERRRRRKEAKRSKANSRAHSRRESTRTTPHKRPTSDPYASDDGERRH
FT                   RRSHRSSKHVTPKKKTARASLKFGQRFEEEDRRAAAAKATAAARDLAAQAAERFDRAHA
FT                   AMVAASDAALEARIRAATASPMKPQPIYARPSSASRSVRDKLAAFRSRRQNRPASASAN
FT                   PVESQRREDRLRRVKLYGDDDSVEVGSAFGADYQDIDDVAYDGENRFPLNSRGGSVRAS
FT                   MESLKPAGMTNIPVAVPLYRGDSRGGSVRASMESLPPRRPNVEKDFEFPRMLEEERASA
FT                   GGGRARPASARIARGIEDLDASAALHADLNNARRRNAYAAGAGAPLLERPFVSRSVNVP
FT                   PASFSSFTATGRPSTSNVRTGGRGGENMDDEWYWKMKKRVEQRRKELFSAPAQK"
FT   CDS_pept        complement(614446..615210)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631751"
FT                   /orf_name="MICPUN_57777"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62982.1"
FT                   /db_xref="HOGENOM:HBG560654"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B3D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R4"
FT                   /transl_table=1
FT                   /translation="MRAPPEAASGDDDATKQKRELWKTWWFEARNAGALDVLAKMPDAK
FT                   IDAKTSSRIDPRAKQAWVPGGYTAVTLAAQRNDAESIALLASLGADLDARDDNGAAPLH
FT                   HAAYENAVNAIEALLDGGCDPNIKDDRDGSTAVILAAYGMRRAALNALIDKHPAVDLTL
FT                   RDVGNATVAGHCAQRRLCEELTKILKLCGPGGASQLRRGQKDYLAKKKQLTGQLEVLTD
FT                   EQLREVARSWRARAKDDDDKKAIIVKLLQATP"
FT   CDS_pept        <615842..>616520
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631752"
FT                   /orf_name="MICPUN_71523"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62598.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199B3D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R5"
FT                   /transl_table=1
FT                   /translation="LGEIAVLKKLESPNIIRLFNVVDHPDAPTVSLVLEYAPGGDLRTY
FT                   IGRGHLDTDGKPRPGIDPERMWSWSRDVVNGMAYMHRAGVIHRDIKPENVLIGVDSSAK
FT                   IGDFGSAVIVDPGRHGSDVMTDQVGSPAYMSPECAGGDPYHGFRSDIYSLGATLYHCLF
FT                   GRVPHEAPNAAMLFEMVASAGEVDLMPRGRALDPALTSLLRKCLARDPHRRATARQLLE
FT                   DEWL"
FT   CDS_pept        complement(617838..621998)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631753"
FT                   /orf_name="MICPUN_100010"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62983.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000199B3D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R6"
FT                   /transl_table=1
FT                   /translation="MRGLKMRGLTGSGAEEVRATMRFGRAPDTDGTDDERILLIPSEHA
FT                   SIKLRRPWHQRPCAGCFVMLLLCLFGLACVSLPSFESPGTITVLRVSEADVKIRDVAGW
FT                   REVADDPPETARHAVTLAVRQDRDAILKALARVSDPDSPSYGKHLTRRQVAELAADQKA
FT                   VAFVRAYLKKVTSALSVQTRWSPGNDYVRVEGSLGDLNRIFNADFRRWDRRVNGRTVHA
FT                   AFRTREIAVPKDLERHLDGILGALHLPSGQLRHDSRGVGIDGDDKDDAADADEALNDVA
FT                   MSGLLDGDDIGGGSGPTGSMYSERPPLRIGKPPMRRKIDAKEWLLKEAENLAAEAGNDP
FT                   FAVEAFNVATGERRGRGSGKGQKKASADPVAAVGLRGDMAADERDSLIERAARYAAYAD
FT                   ERSVDSSWAEKDAGRRLEGALSASALGSARQPRRGLKFASVAAVNRLGRDEGQFVAVQA
FT                   APSDAYGVTGLAGHRRSATAKTSGDEVQSAADDAHGKTAPAAAAANSVVVTAKPAGQVT
FT                   EPPTASKREQRAAESAGAARTSDQSSEKSEQDRLAAEAKQAAREASEKAKAQKAAREKA
FT                   LKTEEKQKWEDKANLMFEKMETEFKEMKTFMAEVVHRDDGDDSSSDADTTESGVPSGLD
FT                   YGDDDVKKINVVVKKGPVDGKLDTKVASLDVSRTLSGGGDSSSLTEDLPGIKPEGKSSG
FT                   GVSAVEVDVQDFLSEPGHYEAGYYEYSAPYEDEDSSDDDVWRFHLDDDEEIRASRANAT
FT                   LRHKLMLEERLKSLVTPDKVLSYYNVPRGSKVTDPRASVGVGMIAGDTRRWSATVWKYS
FT                   QYFNLSLGEVNAAPRVDAFLSATTFNDEEEDATEEKVQTDSSFKTRGGRRAGPSSKTSR
FT                   KSADSIEKQVKDEVKDMVSGTVNAAVGALDSAAAAAGILTDAALPKESKAKLAASMVDP
FT                   SLVVDTFSGAGSSFDPSTKATASLATAREIAGLESNGVADLGWHDAGARRIETNLDVQA
FT                   ATSVAQGADVDILLTTHEQHYGWEALDVLLNVAASESPQSVLSLSFGGMEKVRTLDEDG
FT                   KVTQPTVNPVAGGNASASAVMTDLFGSKQREAEASYVRESHSWDTYERMDTEIAKLGLR
FT                   GVTVIAASGDNGPFSYGIPNPYLTWAMHDSPCAFGPSFPASMPHVTSVGGTTGGKDPFK
FT                   PERAAAVELGSKISSGGGFSSIFPQPEWQKGAVGRYLEEYAYDLPPESFFNASNRAYPD
FT                   VALAAEDIAIIFASIGEEPKPTPQLNTQPAKLGESGELGKIRVDLGGELAQVRHYLTES
FT                   SGTSYSAPLFAGMIALINDQRLAQNKSTVGFINPVLYGLHRTAADVFRDVKEGSSKCPN
FT                   PAMTGAMVGCCKHGFRTGKGWDPLTGLGSVDFSRLRDELLKLP"
FT   CDS_pept        622732..624000
FT                   /codon_start=1
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631754"
FT                   /gene_name="SHMT"
FT                   /orf_name="MICPUN_104794"
FT                   /product="Serine hydroxymethyltransferase "
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="methyltransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="ACO62599.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG301263"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI000199B3DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R7"
FT                   /transl_table=1
FT                   /translation="MEALGSCLTNKYSEGLPGARYYGGNENIDKVEILCQDRALAAYRL
FT                   DKSKWGVNVQPYSGSPANMAVYTALLNPHDRIMGLDLPSGGHLTHGYYTANGKKISATS
FT                   IFFESLPYKLDPATGYIDFAKLEEKAMDFRPKMIICGGSAYPRDWEYAKFREIADKCGA
FT                   MLMMDMAHISGLVAAEEQAQPFEYCDIVTTTTHKSLRGPRAGMIFFRRGPRPSKKGEPE
FT                   GMTYDYESRINMAVFPALQGGPHNHQIGALAVALKHASGPEFKRYQQQVKANARALASA
FT                   LMSKGYKLVTDGTDNHLVLWDLRPCGLTGSKMETICDMLHITLNKNAVFGDASALTPGG
FT                   CRIGAPAMTSRGLKENDFEKIADFLHKAVELALEVQASHGKMLKDWKLGLEGNPAVDTL
FT                   RAEVEAFAESFPMPGFTRESVDI"
FT   CDS_pept        complement(624178..625086)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631755"
FT                   /orf_name="MICPUN_100012"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62984.1"
FT                   /db_xref="UniParc:UPI000199B3DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R8"
FT                   /transl_table=1
FT                   /translation="MSGTSRSRAAAPREQIGVANRRLGGDELLDLLGLRSRRDVENVDP
FT                   EAVVHKASRDPAALARALRDESVTTCAHIARNGTGNRSRRPRLLRAVHRGHERRATSST
FT                   LYCGECEDRLVAKGLVDPERAPALAPPRVSARGPARVSARTETDPPPSEEEEGFSEETE
FT                   RMLKARRRSRLALLEAQLALVKRMEGRDTAESNAESNAAPTTPAREQPGEVPEPKDSER
FT                   AEPEGAVSTHTPRRAGTRRKPRTPIASPGADRMHDALVAGSMSDTSLLADIERLMRMSS
FT                   SADAAPATPGEVYELSPSPSR"
FT   CDS_pept        625074..>626196
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631756"
FT                   /orf_name="MICPUN_52758"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62600.1"
FT                   /db_xref="UniParc:UPI000199B3DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3R9"
FT                   /transl_table=1
FT                   /translation="MSRSCRVARCGMRQLGLNLPVLTTAPGRAAFSFIGGDPQPTVNMA
FT                   PLAYSAAVEQAARGTPVPVEAMSKPVWHAHVVMSPELRVQMNRTQRAAQASAERAAAAA
FT                   EKGRARSRSLMMSGPSTSAGTGATFSVSEGDAMDTSSDESSSSDDEPIALIAETLKTSA
FT                   SPRAKKPRTNDDDGPATSTAPEPRERSKLVEQSDRDVVAASLHNPLVLTYDPNAAARDA
FT                   AANRARIKALQRRLRELGAFDSPMARYAPVFLNMVFDPAQPAIADEFLWDVLGESVKSI
FT                   GRFACGIVADLNVPDFAAGHVEAKMLRDVRRHCESWTAGLERMSRDLNGRSKGGEGEGY
FT                   IEGREGSEGREGSEGREGSGGREGSGDDGGEGTV"
FT   CDS_pept        complement(626671..628221)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631757"
FT                   /orf_name="MICPUN_100013"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62985.1"
FT                   /db_xref="UniParc:UPI000199B3DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S0"
FT                   /transl_table=1
FT                   /translation="MEGLVRCLRASVRPDETSAALVAVLDGPASRVGPEGVESFVSLVA
FT                   AHGAAASAGRAHARRTLVLAGAVEPARYRAECPNVVVVDLRSDPHGWVRDARAESGVAR
FT                   GGGDGSAEGAWRIASHDLADVGALAAALARALGPMPEKRTDDGDGDGNGDGDGNGDGDG
FT                   NGEGGGEGGGDEDANADNNDVDVGVASASGATRPKGRRSALHGRQPAPSARTCVAVDCL
FT                   AELVAHNGVDETMELVRSIRADPRVACVAAYLAGGGSAGFKSAGFGGHDHGTDSPLAAA
FT                   SLAVRTASSAYAVVSAAPTLTLVPDRDGEGGDTRGGQCGQPGQPDAVLVATHNRPTGRG
FT                   RSETDSVFTAIAPGGDSVFRPTFVPASAAVMDALTDAMATAKLVDGIGVETGEGIGGGD
FT                   IGAASSSSAVLAAEAEAEAEAEAARRLQASVPFNLGVNPSREEASAKASVVLPFEHQGA
FT                   GRDYDEGNFLAYLPRDAGGARKEGGAGKARGHIMYVRDSDDDGEAPDSDEELDEDIDI"
FT   CDS_pept        629088..631250
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631758"
FT                   /orf_name="MICPUN_57784"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62601.1"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniParc:UPI000199B491"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S1"
FT                   /transl_table=1
FT                   /translation="MSSSSAAVAAAANAFETAADAGDAIAAADALRAITQAARTPGAAR
FT                   DAVPALASRLARIAAEGPEGSNEGSEGWDSQGYLPGYLPDLLRALRNACAGDRDATDAT
FT                   CLGVAPVPNALRRLIPVLAAEAERQSTEAGRTGPECDDASNASNGSATNPNPAATALVV
FT                   ATQLAANAHAAGSDAASSRLWSELWPRAASYVAQSRRGFVANGAHPPLCMMAHDRVRRI
FT                   IGSNGAKGSDASTSWGGWSAPEPPTNVGSVCGFEAGRTVWIPLLEASCDPAMAPWPGAG
FT                   GGEWLHRFVARACVFSGEFAPQLCRSLAPRAEETAANRDNRLRAKILTAGGPDGSDEDE
FT                   DDARRRRRAAAFGDAALGDDEDHSESFSSAQATLLHLIREEVSSAPAIDPDASPDAGHE
FT                   SHLVLCEGTLSYLLDATSRAAGAVEAVASAKLVEESAEANATAARCVLEECLGIWRVVT
FT                   EREVKPRIVQTPGDVVSAACAMGLPRLLLALVAAMPPPRGAGQTSKASGPAAAPRLNPE
FT                   HVTPAALADGHPPFPRARPWPGYRVDCVAPLANAMFARPLVCNQVAKLGGVAIVLAATR
FT                   GEDGDDYLREWALWGVRNLCAGSDVARGEIERMQPQAAADSQQLAAMGLNVEVDPGTGR
FT                   VRVGSVRREKAAGGDGGGDGGGPTAGAGSVPGGLLLGPEGARTPAGRAAVAALMAGLDV
FT                   SREAGDGEDDDDAFEAPPNWKVADLS"
FT   CDS_pept        complement(631321..632097)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631759"
FT                   /orf_name="MICPUN_57785"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO62986.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B492"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S2"
FT                   /transl_table=1
FT                   /translation="MAPFSESRRRTSRVVQHDSMRVRRCDHEGVRAYAAGVRRAHALCF
FT                   PEERPEGDDEIDDEFFDRVTFTHDEASVTWFLLCDEDDDESDEEEEQIAPEDRHVVGFA
FT                   AAVVYATSVYGMHVAVVPSYRGRGLGKWLMREVQLWAIVDKGKDQIQATVDASATRLLR
FT                   YYEECGAHTERTGFGSADAQTPTVVRIARTFTETIARREVESSRGRRGRVGKRFYGEGI
FT                   REQKPVRGFGNEALFAWFGWLPVGFLVAMAAARLSK"
FT   CDS_pept        join(<632252..632533,632585..>632869)
FT                   /codon_start=1
FT                   /gene_family="HOG000282015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631760"
FT                   /orf_name="MICPUN_76427"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62602.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG317534"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199B493"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S3"
FT                   /transl_table=1
FT                   /translation="YGSKAYWDERFEEGCTVGASSERGEVNNEWYAGYDELEPIIERFT
FT                   RRNHRVLILGCGTSTLGEELAVRGFSRVEAVDYSENAILRMREVQEQRLVDYRIMDVTK
FT                   MTYPDRSVDCVIDKATLDTMKQLDDDDDDDDLENFDPGATKRAPARDPESHAARMLREA
FT                   CRVLKPGGHYVCVTYGEPATRLSLFD"
FT   CDS_pept        633345..633971
FT                   /codon_start=1
FT                   /gene_family="HOG000264427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631761"
FT                   /orf_name="MICPUN_80898"
FT                   /product="Predicted protein"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62603.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="HOGENOM:HBG407761"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI000199B494"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S4"
FT                   /transl_table=1
FT                   /translation="MPGHDWESMWAAGLEPGQAFDASRVEPAFLDLIMTGTLPKGDALV
FT                   PGCGRGYAVAALGSAERKVTGLEISATAKAAADTYLSTAKAGDGSAASEHCTVVVDDFF
FT                   THTGRYDLVYDCTFLCAIPPSRREEWAAQMSKLIKPGGEIVSLVFPLGDYEGGPPFALS
FT                   TTIVEDLLLPAGFERVSLTKVPEEKLARTAPRGERGEYLYRWKRL"
FT   CDS_pept        join(complement(637196..637439),complement(634036..637094))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631762"
FT                   /orf_name="MICPUN_100015"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62987.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000199B495"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S5"
FT                   /transl_table=1
FT                   /translation="MEDEGGDAEAPVSLAERHHRNPDGALRRDVWPRIVDSDMRIPNHY
FT                   AALLALAGETPETAQQIEKDLPRTGATFAVQGLLKPGLPMWESLRNVLTAYAAHDPVMG
FT                   YVQSMNFIAAFLLLAGLKEEDAFWCLIALVDRVVPGYFSEGMAAAKLDQRVFARLLHIH
FT                   LPAVGLHLETLAPDNIVCGIISSQWLLTLFVNVLPTDVTMRIWDRVFATGSRAPLFAAC
FT                   IALLTPRSNDVLGCNEMGECIELLQGLGDDLGDADADAFLAVVDAHLANELSPPKVLLE
FT                   TARERGRCRRPSDAGLPDSVLAIAPVTEIDELTAGLCSDLEDVVGRRALRRVDAEDGKA
FT                   LPTEDLECDDWEMAGDLAADDGASEGRDLAGEIEMLRDMGEGPSRAASPEEYGDESDSD
FT                   SPRRSIDETRRREESQSMASGLRLSVAEVDSLASRLCALDERIDALPVYSLEYRRCVKT
FT                   LALAPLSTVHSSRLDPLRDEFVRGEADFRLLMQRALALGSEGLAWRPGVGVKLCEFNPG
FT                   GGLWSSWADSLFEHVVLRADGLLEILERIALELSWIVDAVRGGGDEKVGGAAKRVDGRK
FT                   GGEGKEGGSSGLSTEGSPPRHGWEEVSSGAPATAAGGRRPNWKREPEPPPSASAIAEVS
FT                   GSHATRVSKELKVLLAGVAKVAGLARADLPSLASNTADVRAGLRRQSDALATAVSEWAA
FT                   AAESRRRRKTASTLRAVTAAARDATGAFAKAAGDEDEDGEELEAFEDTPEALEAAYDDE
FT                   AARLTAAEAAVAAAAKSISRRKTAVERDSKAAAEVREHAAAKKAAADAREARMEKVAEA
FT                   VRRALDGRCAQSHLDECDALAEDIESLARESLRLWSDQMSRWADFVRKATAEVAMGYVT
FT                   VVDASTQCAQDLIEENHKLAATKAAAHANNHGIGGMLSDAAEFVAAEAGLVGVSSPAAP
FT                   GSGSGGLGSLRDRMREQSKKAMNTMNSLGGNLTHTLQGATGGFGFSRFKAGGGGGGKDP
FT                   STPAGAPGGGSREELKDAGGSATPEPTQQPKGTGGFVSPLDAGIGELVRAVSLGSSDAD
FT                   GAPKPRAESRQLQTLRADIGKLEERRDTLVRRKQALRELIVSQTRAKLMSGA"
FT   CDS_pept        637633..639660
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631763"
FT                   /orf_name="MICPUN_57789"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62604.1"
FT                   /db_xref="UniParc:UPI000199B496"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S6"
FT                   /transl_table=1
FT                   /translation="MPSPELSSGHFALTGMVSRPPLCVNIVRLKNALSDASELSRRALK
FT                   LESVLLGELLAEEYPEDDEKPPSSAITVVPVDFSTLAVVSDEEHESAVGLYLARIAASG
FT                   LADFLVHAARNADDNEQAIRSLLPNLLERALEYLPSERWTILGRAPDGLRLVRRRGDAA
FT                   LTSSPFHLLENPTLDVLNFTATPALDWGGAANGGDRVVFPAIRPATIRMQPLGSIVAML
FT                   QNAQVSQTVIDTFRAGGDAQLCENEDLVAVTAVPLLHKEARILSLLRRIPDAYGFESLD
FT                   AYYADFSARYELVDGVPEMTWHDDDNGGDLFAELRFCDDDDERVRRLWPASLLLGRAGA
FT                   TEIPASMNDAEAAAMLTDLADDLRGCPDRLGIGMNLDGHAAGTSGKGRSRGGAVATYEV
FT                   PTTTPHDATFRLASQSKPLAPLKPRLEVIVEDESPSPLPVLVEPIQPGTAPRAVKVASF
FT                   KTSVPTRAPLQPVTPTDANARDDDGDRLPSVDADPKAVYPKPKVRKLVMSKHANSAPQT
FT                   PAKPMAKPADETADEAADDVMIDEMAAYLTEMDAAQPEMAGVKRKAYSAAMPPAATKAP
FT                   KKPNIPRPVPAVLPTKPSPEVKEPDRTKAKRAPRKVVDPDEADAKIRKEHSEGGDLNKI
FT                   TGDEFKAFLTKAGEKPKGGLSKMPKPKLRELVDAVLARSQ"
FT   CDS_pept        complement(639748..641730)
FT                   /codon_start=1
FT                   /gene_family="HOG000264673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631764"
FT                   /orf_name="MICPUN_57790"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO62988.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG560665"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="UniParc:UPI000199B497"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S7"
FT                   /transl_table=1
FT                   /translation="MPTAGVSLMSPASLFATVARRSTRHASSTVASLTTRARGYPPARP
FT                   GLSQLAGRLAAPRAVSTVTAEIEPPEEEVAFQRGPASVHAVEGPLAVLSGVGADVPPGT
FT                   LVRMGDAVQGFILSHREPKTFALMYAAGQGAGGAPSVGAGSGVAVSPGDAVEVLRKRHF
FT                   RMPSDDDLRGRWIGALGQPMDGGDAPGGGDRDLACGEDLDGAIIRDPPGVEDRKPITTP
FT                   LVTGIKALDVLTPLGRGQCMLLTGEPGTGLTRLGVSAVAAQAGSGVRCVYGATGAAAED
FT                   GGKGAVEELRAAGAMGHTTVVSVDGDASLAERYAATCAAFAVAEGARAKGEDVLLVLDD
FT                   FTGLVEFTKDMARLSPQLDNPEGIIDEEKMVEYEGMIINALLAERRRFLGTTLQRVARM
FT                   SDSLGGGSLTLLGIMYHEKGAYRGRKGSNKDSGAVGSSEGADGTLQLPAGFDQMAPEMQ
FT                   AKITAALEKKRDAAVKAAEAREAEAAAKRPEDAYTQPRSLVEEFMSITDGQVMVENFSE
FT                   SNGWGISVKDSVSRIGTPGAAGPLKSLDMMQLRLDVMQADDMQAFGNNGDEKVQMRNRS
FT                   SAIRGVLRQRPGETAALSAQTVGLFALQKGYLKNMNADEAAARVNEAVTKAKDTIPEVM
FT                   DALDTNPSKALSAENSEKLASLFAA"
FT   CDS_pept        <642366..643205
FT                   /codon_start=1
FT                   /gene_family="HOG000200802" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631765"
FT                   /orf_name="MICPUN_80526"
FT                   /product="Exonuclease"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62605.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG756502"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000199B498"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S8"
FT                   /transl_table=1
FT                   /translation="AGERTGLPRSTHADPTKPKKPMPTGRNTALTDIIAMDCEMVGVGE
FT                   DGRRSILARVSVVNEDGNVVLDTFVAPTEPVTDYRTRVSGVRPQDLRGAPPFKEIQRKM
FT                   ADILKGRTLVGHALKNDLRVLLLDHPRRQTRDTALYRPLTRPLRANERAQDTGIARGRG
FT                   SRSLKELCAQHLGLEIQGGEHSSVDDARAALLLYQKNQRNWEREFAAAQQVGGKGGAGG
FT                   KGKGSAGVGSKGALKSDDDGEERPTKRGKKAKKKGGGDEVGSAGGLKLGKVVNLFAR"
FT   CDS_pept        join(643374..643524,643769..643866,644025..644975)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631766"
FT                   /orf_name="MICPUN_93957"
FT                   /product="Proteasomal ATPase"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62606.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000199B499"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3S9"
FT                   /transl_table=1
FT                   /translation="MGAAEVLTNAGGDGLRSYYRAKIEEYEVAVRDKTQNLRRLEAQRN
FT                   ELNHKVRMLREEIQLLQEPGSYVGEVVKVMGKTKVLVKVHPEGKYVVDVAKDIEIEKLS
FT                   TGQRVALKNDSYTLHLVLPSLVDPLVSLMKVEKVPDSTFDMIGGLDQQVKEIKEVVELP
FT                   IKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCCFIRVSGSELVQKYIGEG
FT                   ARMVRELFVMARENAPAILFMDEVDSIGSARGSGGGDSEVQRTMLELLNQLDGFEASNQ
FT                   IKVIMATNRLDILDSALLRPGRIDRKIEFPNPTEDSRVDILKIHSRKMNLVRGIDLKKI
FT                   ASKMGGASGAESKAVCTEAGMFALRERRVHVTQEDFEMAVSKVMQKDSEKNISVAKLFT
FT                   "
FT   CDS_pept        complement(645039..646484)
FT                   /codon_start=1
FT                   /gene_family="HOG000213905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631767"
FT                   /orf_name="MICPUN_80764"
FT                   /product="Predicted protein"
FT                   /function="orotate phosphoribosyltransferase activity "
FT                   /function="orotidine-5'-phosphate decarboxylase activity "
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="ACO62989.1"
FT                   /db_xref="GO:0004588"
FT                   /db_xref="GO:0004590"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG326699"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniParc:UPI000199B49A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T0"
FT                   /transl_table=1
FT                   /translation="MAVNEEKIDALILRLHEIEAVKFGEFKLKSGIMSPIYIDLRVIVS
FT                   YPDVLASVAGCMWDVLKANGAEFDNMCGVPYTALPIATCMSLNNDCPMLMRRKEVKDYG
FT                   TKKAIEGAFTAGQTCLVVEDLVTSGASVMETVEPLNQVGLKVKDVVVLIDREQGGEARL
FT                   ASNDLRLHAVLPLSRVLKTLEKEGKMSADLVQSVKAFIAANQTGPNASGNEMGAAETPK
FT                   RLAYAARAELTANQCAKDLWNLMETKKTNLCVAADVDTAAELIELADKLGPEICILKTH
FT                   CDLYPDFDDTFGSKLLELAAKHKFMIFEDRKFADIGNTVVGQYGSGVHKIADWSHITNA
FT                   HIVPGSGIIDGLKSVGLAKGRGLLLLAEMSSKGTMANGAYTEAAVKMAAEHPDFVMGFI
FT                   STRPSAWKAEWSKGLVQMTPGVQLGGGGDAMGQQYNTPERVIGECGSDVIIVGRGIYRA
FT                   ADPAAAAAEYRKAGWDAYTAALA"
FT   CDS_pept        646863..647759
FT                   /codon_start=1
FT                   /gene_family="HOG000225260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631768"
FT                   /orf_name="MICPUN_80462"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62607.1"
FT                   /db_xref="HOGENOM:HBG575564"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniParc:UPI000199B49B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T1"
FT                   /transl_table=1
FT                   /translation="MATREASHAGSWYSSDRARLSKELDGFLDAAGSHGSTPRALIVPH
FT                   AGYSYSGPAAAWGYKNVDAGAGVRRVFLLGPSHHVFLRRCALSKCAAYATPLGDLAVDR
FT                   GVYEELRATGHFVDMDVDVDEAEHSLELHLPYIFKCFEVLPERDRPTLVPIMVGALSTN
FT                   AEATYGEILAPYLDDDANLFIVSSDFCHWGKRFGYQPWDEGRKDVGLHEQIEEMDRRGM
FT                   EIIESKDADAFAAYLKETGNTICGRHPIGVLLQTLRRSGGFDKTRVEFTRYEQSSAATG
FT                   WNDSSVSYASAVVFRDA"
FT   CDS_pept        join(complement(647996..648747),complement(647880..647910))
FT                   /codon_start=1
FT                   /gene_family="HOG000104694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631769"
FT                   /orf_name="MICPUN_57794"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62990.1"
FT                   /db_xref="HOGENOM:HBG690672"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniParc:UPI000199B49C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T2"
FT                   /transl_table=1
FT                   /translation="MCGRVRSTLGADQVAAASGGAAWKNPDQYEPRYNASPGASLAVIR
FT                   RAESGESTSDRVVETMRFGLVPSFTDPGAKVDFYRMFNARSETIAEKGVFSRLLQRRRG
FT                   VVLINGFYEWAAERAGSSQVKQPYYLHLEGKGGGSEGDVLRCAALYDRWKGAAGGELVT
FT                   VTIITVEASEPLRWLHDRMPAVLRTDADVAVWLEGSDDRPSSALRPYGEADMKWYPVTT
FT                   RINRGDFEDPSCCERTRRAAEKDTGSVAKNGRVRRHPR"
FT   CDS_pept        complement(648837..650309)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631770"
FT                   /orf_name="MICPUN_100022"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62991.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="InterPro:IPR006759"
FT                   /db_xref="UniParc:UPI000199B49D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T3"
FT                   /transl_table=1
FT                   /translation="MPLLPSELQGRSRRPTRGAGGGAGRQSRKDTRRVVRLVLANLALV
FT                   ALLYWMLFARGGSTSASSRAPARHRYSNGWMSRKEMLDMQRPPGAMDLAESAWNTAQED
FT                   IRAMRESLRHAGQNLHQVRKARHLGDDDDDEGAWDSQGNPRVRGARAGKRGARREGSGA
FT                   SSLGEVTEPWLVVGVPTAPRAGDADYLTETLETLLDELPDDARHPLFRRVLVVVMNAKP
FT                   GRHEVFDRVRARFGSSGSSGSSGSSDDEFAAKAKTYVRFMDSPGTYGDPTPNKPDPDDL
FT                   DNPGNIPGHAVRQQTADLATLIDAAAAESGPGASAPYFMFMEDDFRTCAGTMKALTYLV
FT                   EKADAVYPQWLGVRFSYGMNGVVMRRKDLPPFAEYLATHVSRQPPDILWREWVEGRRED
FT                   VRSHTLGRKVLVYKWNLMEHVGEVSTFAVRPNRPKWPRCYDQMKEVWSLSTAEKFDGLR
FT                   CDDVDVSPCVKRLRVNMEDWRGATPSFPWTRQ"
FT   CDS_pept        join(complement(651487..651576),complement(651140..651187),
FT                   complement(650618..650932))
FT                   /codon_start=1
FT                   /gene_family="HOG000270244" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631771"
FT                   /orf_name="MICPUN_100023"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /function="tRNA binding"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ACO62992.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005731"
FT                   /db_xref="UniParc:UPI000199B55B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T4"
FT                   /transl_table=1
FT                   /translation="MASSCAGMVSAASLSARRGVAGNGVAARKAAARAPVRAAFAVRAE
FT                   AASVAAAKIRIRLKSFEVNHMKAACDKIIEAATSTEASISGPVPLPTKRRIYCVLRSPH
FT                   VNKDSREHFETRTHHRLIDVHQPTAQTIDALMSLELPAGVEIEVKL"
FT   CDS_pept        complement(651978..653039)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631772"
FT                   /orf_name="MICPUN_80902"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62993.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015740"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199B55C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T5"
FT                   /transl_table=1
FT                   /translation="MPPTPPISTGAHDAKYEPVDVKTLGQGNFGTAKLMRHRASGQLFA
FT                   IKYIERGDKIDENVKRELVNHRLLDHPNIIRFVEVLLTPTHLAIVMEYAAGGELFDRIC
FT                   GKGRFHEDEARFFFQQLISGLEYCHGHGVAHRDLKLENTLLDGGEVPRLKICDFGYSKH
FT                   SLIDSEPKSTVGTPAYIAPEVLSRKAYDGKAADVWSCGVTLYVMVVGAYPFEDPADARN
FT                   FRKTIMRIRGVNYAFPAHIALSEECKDLIKRIFVLDPVHRLNIAGIKQHPWFQRNLPAE
FT                   LQNAVVNDGPDPNQMQNLDELMSIVDEAKHRPGDGAHGAQGGMMGGSADYYPDEDMDDD
FT                   MGAGLSGDYGAYD"
FT   CDS_pept        join(653223..653287,653348..654674)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631773"
FT                   /orf_name="MICPUN_57798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62608.1"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI000199B55D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T6"
FT                   /transl_table=1
FT                   /translation="MEWPVKESHKNVVWLSFSICTMHSHHFLEPPRSPSWPQVRAQSKY
FT                   TSRACMPSKYVKKKKGPGCPSKGLARKAELKNKAYWAEVKARRQTTATNLSAIVKKEIK
FT                   EEFPSSIPAQDRSAMSAGPRITLRGLTRARSTLYDFVSSYFMFHGLDPTKTADVFAHLP
FT                   ALTFTEAVIYELDDANECAGRMEGGETRGGSGTARTLEQLVCRLEEHFGAEHFRRVRSR
FT                   LQWELSRGSAYWETERRLCGKLAAGTKLTDEDARHALDALKKKSFDYRVLNLVLLASVR
FT                   KQRREARDAERRRRGTGCEIKREEEEDEEEEDKLGDAEDVPYGDLLAASELLVELSDDL
FT                   YDYEEDVASGAFNFYRCLVNHHGPERAPEEMAAVIQSAEREYARLEERLSRDDPELARR
FT                   YRERCAQATEEGLPGRQVRSDPSSPAEMTVDSRGKWEVPPPIADERAWRERTDDVAHPR
FT                   GDRGP"
FT   CDS_pept        655454..656542
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631774"
FT                   /orf_name="MICPUN_52762"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO62609.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B55E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T7"
FT                   /transl_table=1
FT                   /translation="MKAKAQAIADKAAAMSGGDDDRGVKRDREGDDMLPPDAFENPAQR
FT                   QRTSGFDAPPAEGAAPAAPVADAPGAVEGPAPITLQTAGHEGRIIGRGGQNIMRMQDQY
FT                   QVRIQVKKDQGITEVSGAGAEQCAAEIRSIMDAANAALAAGGSGYVVGDAPGQAPAGGG
FT                   ASRIIPCAGVESRIIGKGGQNIRALRERTGAQIKVRNETRDVEITGHPQAVEAAAAAIE
FT                   EIIHNFNTTGSAGPGPGGGGGRGGGGGGYGGGYAQPGGYQQQGGYGGGYQQQGGYGGGY
FT                   QQQGGYGGGYGQGYAQGGYDQGAQYGGYQQQQGAAYGGGGGGGPAPTGATGLPPGWQEL
FT                   SANGQVYYWNTETNVTQYERPQ"
FT   CDS_pept        complement(656660..657943)
FT                   /codon_start=1
FT                   /gene_family="HOG000264674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631775"
FT                   /orf_name="MICPUN_100026"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62994.1"
FT                   /db_xref="HOGENOM:HBG560670"
FT                   /db_xref="UniParc:UPI000199B55F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T8"
FT                   /transl_table=1
FT                   /translation="MPRVSSDVAPRRCSVPRARSRWALVAGSNRTAEGSSEGRSIPKWW
FT                   DVGGRLNDAVKRDQRSEHGYLEHESTPVVLFDKRSNFNGRVRVVAHGPWRSLRFNDVEQ
FT                   GLTYIRGDWSDAQAAGDGEADTEVLGYFYLRTMAAAAAAMCRLDGNLDLTQRGGRVVCV
FT                   GLGTGALPAFIARKFPAAVAEVCEIDPVVVEAVRDFHGLPKLPKLPGPWGDKPVPGNLP
FT                   PGVGVCMGDAGEFMERAARAVERGDAPTASVVFLDAFDGDGEVPSHLSSRDFLAKCDRV
FT                   LAPGGCLIVNLFNGPEGSKQRARIEDVALNLEAAVGLVTTFPVEFPVNVVLAARKERTD
FT                   GFGDQEDPRFTRKELKTAGREISKELGFEWDAGDMLAKAYWVETDGGASFKERPAGLSL
FT                   NPLSGFVNRMGTTMPDEWVEEDNKEVYY"
FT   CDS_pept        join(complement(658926..659265),complement(658458..658708))
FT                   /codon_start=1
FT                   /gene_family="HOG000264671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631776"
FT                   /orf_name="MICPUN_105435"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO62995.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG560671"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000199B560"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3T9"
FT                   /transl_table=1
FT                   /translation="MVTAGLHATSMGAKSNGSTNKQWYSLVKLDPYGLGHGACDGELAE
FT                   LEELILSEPDQRGLDDGTFTGFHGSDGDANSSLSDDAEDDSRDDYRVYKAMPPVHQKPG
FT                   GPCDHCGAVDSPQWRRGPASKPMLCNACGTRYRRTNNLGPSTPMGRVGQAALPKKRTPP
FT                   GSPTSSLNPAKKNRCAPTEITGIENLRPNAVRA"
FT   CDS_pept        join(660080..660343,660460..666696)
FT                   /codon_start=1
FT                   /gene_family="HOG000264670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631777"
FT                   /orf_name="MICPUN_57801"
FT                   /product="Set domain protein"
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62610.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560672"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR000770"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR011124"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B561"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U0"
FT                   /transl_table=1
FT                   /translation="MEGDDEPPPSPLFVEGGAPAFTSELVPSGVGVDEGGAHGSPNAPA
FT                   FLQMGAPLGGAEPTLVQPTLFSYNANDLVWARAGTKGNQPFWPGRMIDVMEAPEGVRRE
FT                   AVPNSVCVQFYGPSASKGRDRDYCWATAEQLAPFGENLALLEQQNIPKRLRPTAYREAL
FT                   VEAKELYAELGNNVSAAVAFDPEEAAAEAAGDGDDLEDADAPRCSSCSMALEAPGGHKD
FT                   TGRCRLCAKLHREGQYCPVCDRVWQWANCPAMVGCDSCDFWVHCACDEPARTVMEAQER
FT                   GDEVDYHCPRCRVKADEEEDKRREKEVKSAEKAAVKRAKLEAKHATKKAGKAEAKALGV
FT                   SPSGKVKKKKKKNKKLGRPPKDENVPARGRPLGTGKSKASIAARKIKEQMGHVKPPMRH
FT                   PKAPGGIPRRPKSAWQLFGSDFFKRYKEEHEGEDIDFSNVYKLQGQAWRDVSKEERTRY
FT                   EQLAAKETVKFRKYKQQLEQSGLAVDEVLPTNHRPKSKTPVSSAVKQKAVKAVKVRPQG
FT                   AEADKDELDENGRIDMGGGVTKDPKTGKLYNFEGKPLVGKEAEAAEAGWRPRMDRRASH
FT                   WSQHFKVDDIMSRPERVDVVCNGVRATFLVREFKMLCQCSQCKGQGKPLSATEWEKHAG
FT                   MGQAKKWKASIRMVDPARMPIGRWLDGGKRTGKSGTTDDADGKVRKGKSAKSKYPALGG
FT                   AKKRSYQMVRVQWSVDRCAVCDDDRDFDFDQLVTCDGCGISVHQSCYGIPEIPDDAVGF
FT                   LCNACEHTGGDTSETPLCVLCPVEGGALKPTTKPGVWCHSACCQWIPETTVVDVDRMEP
FT                   IDQIHTIQRERWELLCTVCKQRMGAKIQCDHPGCYLSYHPLCARAAGLFMEANLDDDGD
FT                   EDSPLQMVSYCHRHCRVDTERAALYSGGEGKSIGRDGKLVEAREDHTKKLTKGVKRRIE
FT                   EEKRKAEEEEEERKAREDESLDTPEDDRGAARCREYAPQGHPRTEAGDEIIMALDSGPN
FT                   MRRALQHGLGHGTGRKNKGPRRREREAWVQCESCNKWRRVPQSQAEEFSRADAGEWTCS
FT                   VSSHPRINSCDVPQELEDDDIDARIAMGDQCPFYDDNDLNPPEIIAEEEEPAAEDDEEE
FT                   EEEEEGNEESSSEADDDDEDDGVKELQDVENDDWDAEDNGKSADPEEHLAIAAAGGYGG
FT                   ADSPPTKRVRFEDALAAVEEDDGDLPSAVFSDNPIVSEVKLEAESPRFPEAMIAAAMMV
FT                   PSPIEESPGVKREAPAMTPEQALAAAMAASDGENDEDAADGQDDEDEDATDAMDVDEKD
FT                   ENTDTEVKAEGTEDGDGSKEPPDEPAQPLSDLPDVPVICKSFRGVFRPRDNLIECECGR
FT                   CVREREEPKGKTGERLGIFEPNRWEMHAGMAHAKKWKQSIVVIDPKLQPEAAPEGEAEP
FT                   DRIEVPFGQWLDDNGLHVEVIQKSRKRGRPKDDGKPKAPPKPRVPHQKANRGKSALAGL
FT                   TIDLDLDLQKASDNIEEKARALVGRRIRINCNAGPKGAQLILGGAPNKPPVWISGVVQD
FT                   MKSSRGGCRHLVLHDDGTHEWYALNRVQTEWPGGEEGDDDEPDLTFMPAPEVPAKASVQ
FT                   GSRRGLTGLQSMLALSKAAPAKKGTHQAPVVKEEDGEAPEVKPEEAPETPGRVREKEAW
FT                   LRCGNVECCKWRRVPESVVAELEREKATAAAAALEAKQAADRGDAGAAARAAARAAPPA
FT                   PWTCRRSGDPTRNTCEAEPEFGEEEVSVRIAAAERGEAPLSMYADGTVCGDGEEEEEKP
FT                   VIDNGLEGVLPDDLPDVVTVICRHKVGDYHPRTGMIRCLCPTCVIATEEGRHEESLQEP
FT                   NRWEIHCDMGQAKKWKASVRVVLEGHKTMPVGRWLEGFGIAVAARRAPRQVRQFGPKRS
FT                   KLKQMKERGELEEEEETYRRLKPMKGWKKGDEVHRGPPPRSGKREFVELIPYKVNGAKL
FT                   RSKGGNNSHGYAAPGAGGVGGGVKSGKDPARAEGVGLPESTVFTPSEWEAEVASRLAAK
FT                   TTGAVAVAAMAEAAKIVDEGKGVRERVAECLRLRRERLTFGKSNIHGWGLIAKQFLKAG
FT                   SMVVEYVGERLRPSVADLREKVYERTGHDVYLLAADDKTVIDTTVKGSIARFTNHSCTP
FT                   NMYTKLVALDGDSRIFFFTRIDVHPGQELTYNYRFDAESGKVPCYCGANNCRGFLC"
FT   CDS_pept        667786..668088
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631778"
FT                   /orf_name="MICPUN_80643"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ACO62611.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI000199B562"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U1"
FT                   /transl_table=1
FT                   /translation="MSVYEKTFTLKDEDHTMGNAVRYMLNKNPQVSLAGYSVPHPMEKS
FT                   VNVRVQTTGEVTATAAMRDALLDIISVCDHVHDTFDTAVADFKAKQPAPMDADSK"
FT   CDS_pept        join(complement(669525..669527),complement(668240..669361))
FT                   /codon_start=1
FT                   /gene_family="HOG000232704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631779"
FT                   /orf_name="MICPUN_57804"
FT                   /product="Zinc permease family"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62996.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG620552"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000199B563"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U2"
FT                   /transl_table=1
FT                   /translation="MGVAQGNVGLAFGLVIFAGLTTTIGSAFVYCTSYANTKALAAALG
FT                   ASAGVMLYVSFVEIFAIKAIEGFEAADPEHGSKLAVLCFFCGILATFGLDALVHQIGKT
FT                   QQQWTGADDEADKVCVCHADPNDVIDMLSGERAMWSDAAAATHDVILEADGIKVTTPKG
FT                   GSGANHPFGRASEAPMHEGMNGHSKEGMNGHSKERGSDSDFENMLSNAVIDSIDTPSKK
FT                   HLKRMGFLTACAIALHNFPEGLATFVAALADAKLGVALAVAIAVHNIPEGICVAMPVYY
FT                   ATGSKFKGFMWSFVSGISEPIGGLVGYLILYGNGMSDRAYGALFACVGGMMVYISLKEL
FT                   LPTALKYDQHDHYVTNCMFGGMAIMALSLILFQI"
FT   CDS_pept        complement(669836..672223)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631780"
FT                   /orf_name="MICPUN_57805"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62997.1"
FT                   /db_xref="UniParc:UPI000199B564"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U3"
FT                   /transl_table=1
FT                   /translation="MSGRTATVAALLAALLLARCPACSSTVSSPGAPPAREHESYFEGW
FT                   GEGYDADDGPRAALANAAQIAADVDPSPVEDDIDALDQPAAKLEVREVRWEDEEATRSK
FT                   LGRAEFPDGDGDGFRSVYPLTPTPGVDDVSTPITTEEWFRRPRVPPTPVRRRGGLSDPP
FT                   SGTLGWDPSARAALEAELRRLQFPASCDDAAVLAVPLEMCPLGCRVHIFLQRALIASVT
FT                   LGRTLVPLPPWDAGLDHLFQPVTNCSLRPGQKGATEGARRELGEAMEALTDLFILSGAP
FT                   HEKLEPLEASYRGDKKNPARAVDGWLAGLRELMREQHASEQFLGDEHWNKNSPRWKRAA
FT                   ATLAPYTVGRASVKDDGNAAEANDIIVCSNGRCDNAATARGACVRPEGCPGIGLNNDQF
FT                   PDVLWRIMRNPAAGDAPGFWLSNQPEGEPAPIEYSPTPEDAARIIEAFDDQRASVAGEV
FT                   QAMLRGDDEEEPGRGLLPLPGYPYPRAVSVPELPPRITVFPPGSFADGCNDWPSACQPH
FT                   FALHAMLTSWILTRPLAAVAGFITPATFRNLDRIAHPVVTLQVRRSDKMGEDPFYNIHE
FT                   GYRDLATYVRALDDAATATGKCFKTVFLMTDAKHAVLELRRMHAAGNLTVCGEKPALVF
FT                   SDAIAADREYSVPVFVDSLVGRRGNESAVEAVRRERLFAAELWVAAKFSDYVVGDASSN
FT                   VFMLLLEAVAARKGIADIPRLVSWAPGEEHHDHVARCPRHDPVTHRCYWMSSIGASLQE
FT                   GWHSVLLANPWVNGESRAVRYAMREGPEGVERLLGKRTERER"
FT   CDS_pept        join(672316..673407,673440..673571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631781"
FT                   /orf_name="MICPUN_57806"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62612.1"
FT                   /db_xref="UniParc:UPI000199B565"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U4"
FT                   /transl_table=1
FT                   /translation="MEEYARRCSELIRPSTGPYLEVPHMGPEDARRVVSQLRSGLSGPI
FT                   AAAMNALTVISADATDPMSTQDWPGLAGALCEVVRGGLEFDAGRGGTPGWAAAGAGRTA
FT                   AGAVEDHELWAEVEALAGTNEPERALAGELAAAALNVLRNLSLTPGNRAAMAMDADGAL
FT                   APLLVRYVAAFNAGSDAETGGTIHGGERRADPRAAADAADVLVNLAWLDDDAPLNAPCL
FT                   LRPTQRLADAALEALEAPPPSLSVDEAPGDAADDQRETAAADADLRCAAAGLLGFAATG
FT                   TIEGFSGWRDDSWTSRAVGALASNVNAATRIGGFGGFGGDRGGEDAVNNARMCAACVRA
FT                   LHAMASSGGDGAGASAAAVASHPSARRGVEGVSSRRAGRRGRRGALGGGQAEAIGARGG
FT                   PAAPRRGG"
FT   CDS_pept        complement(673686..674789)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631782"
FT                   /orf_name="MICPUN_108082"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62998.1"
FT                   /db_xref="UniParc:UPI000199B566"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U5"
FT                   /transl_table=1
FT                   /translation="MEVERYQLVAELQAKSRKLEEAKAEADRLRGVGDDAAARANKAEQ
FT                   ERDLAVAKIESLASELEATRESQRRAAADAGDVAEALAGERKKLAAAETRAAEAERELA
FT                   SALAALADAASPVGQHRSDAGDAGVDRRPSTVQEAVAAVRRDADARIAAAEEVASTAAA
FT                   ALKAERLERGGAEEALRSKIRTMDAAQDRLLAEIDAATGELERLDAELDATEERARAAE
FT                   EREREALGGVAAAAMKTDRLMEMLTEQEEWEREAAEAAAAAAREGAANGAGVSASAPAT
FT                   PAKDSGVQDGDEDSTPGAARTVPATPAQGHQGAGRASTASVKLAADILQGSDLGRAYHP
FT                   LLASIEARLLHLQSEKLDVPLADVPVS"
FT   CDS_pept        join(676342..676365,676515..677243)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631783"
FT                   /orf_name="MICPUN_108083"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62613.1"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI000199B61E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U6"
FT                   /transl_table=1
FT                   /translation="MSEVMISQVSAGTVVRGTVLVAFVTLATTYTIAVLHRDAPLVPMI
FT                   SDTFVYAPESYVSRFGVVTASAMLQLVVWLLRSYLCAFASGHRAWRWFATVHSLCGAVA
FT                   SAAMGLVGAINDQENLKYHLSAATVFFYSVILWQVGYTAQLAAHPSATSFRSVALKAAC
FT                   AVSAALALTAFFAFAGLDLMRYYTRIAACEWVLAAATGLSVYSLGFELEGGASGREGGI
FT                   GMELGSLWRGPAPGDDEEDKADEDYHPL"
FT   CDS_pept        complement(677387..680446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631784"
FT                   /orf_name="MICPUN_100032"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62999.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG562665"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B61F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U7"
FT                   /transl_table=1
FT                   /translation="MEGSNKSRTMSETKLRSKTTSSVGTSASRSALTSTARMNIAPLSG
FT                   SRASRSSSKSRSAGKVPMGRLLSVPEKRELGIISDDRDDDDDDDPSRRKPRRKPPARPP
FT                   PRKDDSAGNAPPFGVPKSRILELEQAMREELRRVHTAARSSKVHLTEAFEEMDELGIGM
FT                   VSHKDFQRVWDYLGVDLTAEETRAMCRFNGGGAEGEAMPYENFIKRMVRGAARQSAEKP
FT                   VCRGYPVVDDDFKRKIIYPRCRKGVNAPSDFDVALADRSTLPPEAKLELEFVYGYDGVT
FT                   SHAQNLFFVNGAGRPSAGREAASSKPKLGDVVAYHAASLGIVYDRARDTQRFFTGHTKD
FT                   ITCMTTCAAEVEVGGVTYPPLTLAATGQKKPVEDPDTEDEERPFVAIWDVRTCEEVARV
FT                   PLETNFRSVAAVSFSPDGSKLVTVACDNNHTVQIWNWRKPGIGEARPGGKVVGLVGEGP
FT                   GFKERPVGVFGVKWDPFAKPGLERFCTWGKKHLKQWTMNPATKRWSAITMSFGEFGVGN
FT                   VLSCEFLKPPELSKTSAWDMPVTQGAVVTGMPDGTLLLWRGGKAVKRVEAHGRGQRTIQ
FT                   PDGTVAWGGGVRALRLRDDGLTLLTGGADGCIRQWDARKNTVGDQVTDPVSLAKYSARM
FT                   ETPDDDEEQDEVNDGEGGEKKTRALPPVAIRSIDCYPGSDVVVAGTDKCDVWECNVEDE
FT                   RAKMVMKGHRADLRAVCWHPTAPDVFISASESGSLYLWSAAETKVLRCADVGFPASAVA
FT                   CSNKALAKTAGDDERSHHIAVGGKNGEFAVFDEETLRPIFSTVVSKGASVEDVKYSPDD
FT                   TRLAVSTRDSSLDIFLVRGRAGRGYALQSKCEGHSAAVRHLDWSEDSSVLSSDGADYEL
FT                   LYWDARTGRQNLDSQMDTGWATWTRVLGFPVMGIWPPGSDGTDVNACDRSPDGDFLVTA
FT                   DDGGAVKLFAYPAVVEDAAHRTYRGHSSHVTCARFSPDGERVISSGGRDRCVFQYRVWP
FT                   VEAPEPRPPTPEKQWLPLDASGKNYGWRLP"
FT   CDS_pept        <681055..>682416
FT                   /codon_start=1
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631785"
FT                   /orf_name="MICPUN_68004"
FT                   /product="Predicted protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="ACO62614.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000199B620"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U8"
FT                   /transl_table=1
FT                   /translation="RNVAARAEVKEIHMPALSSTMTEGKIVSWLKGEGEQISKGEAVVV
FT                   VESDKADMDVETFYDGYLAYIAVPDGEMATVGAPIAFVAETEAEIAEAKAKAAAAGGAA
FT                   PAPAPPAPEPAAAAPPPPAPAAAAPAPAPAPAAAAPAPAPAAPAPVQGRADGRIIATPF
FT                   AKKIAKKLRVDLATVQGTGMNGRITAGDVEKKAGVPSSAPAPAAAAAAPAAAAPAAPSP
FT                   AAAAPAPLPAAAGTAVPLSGMQKAVAKNMMPSLQVPVSRIAMQMCTDELDALYKKVKPK
FT                   GVTMTALLAKAVGVALAQHPIMFATLSPAGDAIIYNEKVNIAVAVALEQGLITPVLQDT
FT                   AGTDVYEIGRKWKDLVKKARGAGLGPADYAGGNFTISNLGMFGVDCFDAILPPGQGAIL
FT                   AVGASKPTVVPVNGMIGVKTLMTVNLTADHRHINGDVAAEFLKTLKAVVEDPKDL"
FT   CDS_pept        join(complement(684076..684151),complement(682812..683980))
FT                   /codon_start=1
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631786"
FT                   /orf_name="MICPUN_100034"
FT                   /product="Predicted protein"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /biological_process="sulfur compound metabolic process "
FT                   /protein_id="ACO63000.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0006790"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000199B621"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3U9"
FT                   /transl_table=1
FT                   /translation="MASVIRLNVAPIVGARRGAPQKSRNAAPIRAAAAAKKSDAAAASG
FT                   QYARELEVATDAVRMASTLCQEVQAQLMRQDEQAETKDDRSLVTLADYAAQAIISWRIQ
FT                   QEWSDFTMVGEEDAEALTEGGEGGALTLSKIVKLVNKTLKLHKGMDAPELTSTEVVDLI
FT                   NKGGGAGGKGRHWVLDPVDGTLGFVRGDQYAIALAMMEDGDLKVGVMGCPNMPKIGEVL
FT                   EYDSSYTYGFSPRLVSKMLAGESLGWYKGCIFTAVKGGGAYMLPCDPAIKADPLPVAVS
FT                   KEFDPQAAKFCEPVMKANSSQGFTASVADNLGIESKPLRVYSQVKYGSVARADADVFMK
FT                   FPKAGYKEKIWDHAAGVIIVEEAGGKVTDAGGAPLDWAGGRYLESLDRGIVATSTALHQ
FT                   RLMDAVSKSWSSSQL"
FT   CDS_pept        join(684435..687047,687106..687255)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631787"
FT                   /orf_name="MICPUN_100035"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62615.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B622"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V0"
FT                   /transl_table=1
FT                   /translation="MGMGGSVDDVWEKLKASSAPSQHALKAKRLLRGAHAGESTSRHGA
FT                   QSSRSSSQGTGRGPTAAHGDGSLEAFSAPSTSDSTSEPTPDPELESPSPASYADLEDLA
FT                   RGLARDLNSLADTQAPASTRLRSLRVLRGVIDTIDASLLREASLDSFAKPLLRRFEDAS
FT                   EQCREEAAEAFAALTRRMESAMDLLPYAMAVLRVRLGPAVPDGKDPKEPSEEVRAKLHA
FT                   VLVSLLTKGEDECVSCAPEAVDILEFAVEDSHADVALLACESLETLVHNLGRKLAPVSK
FT                   NLAWMFFPNLTHRRAKVRVATLRAVRGLMHCGAHETILDLVAFQHPNLVPVKAFYGEDQ
FT                   KVNYFGKLATDGSVQVRCEFVRVIGDWMTTLIERLDHESRLLPYVISALTDEAELVQKE
FT                   AMDLMDRLGIQYEKEHEKDLKQTMYYMPEAFGEDIYGVGEDALTLPPPFTRRPRLGSRI
FT                   LVKNNFTSVVNPVIGEMSSWQIELRAKAAVLLRTMLVYLEDNATQHVHHLCMAFISASR
FT                   DDAVGRQVRDCCKLIGRFVRPGDWMGTLLEKVRGSGFTDTASRVGALAVLTGCLSGAAK
FT                   EAMEELDEEGGERSNCDDVLEALEDRSVSGSSDTKLRIQLCKLVAACAREKPATWRSRA
FT                   SRLCALAIRAGGGEIGRLDGSAAHMESAVAELAAACGLASGADLIGSIRSELVAPLRLL
FT                   PARGWRAADAAVLAAAAEAPGTCTPADAADLVRLSSLVAEGPAAKGVRSRLLAFPFVSR
FT                   GRLSAPLEDGDVQLLLGAALPPVAADPGGSFTVAALAAAAAVLEPVNSSDAAAREAASL
FT                   VACHVASILGSEAAPANVRADAARVLEILAGRRGAMEPRDVVASALPELRSRLDDPNAG
FT                   LTTPSEPRFSRTWSMPATRRREMSLGRRSCRIRPRALLPCTRANCHQRL"
FT   CDS_pept        complement(687524..688798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631788"
FT                   /orf_name="MICPUN_100036"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63001.1"
FT                   /db_xref="HOGENOM:HBG608095"
FT                   /db_xref="UniParc:UPI000199B623"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V1"
FT                   /transl_table=1
FT                   /translation="MLRASLTPRALVPARALASRRARARPSHSSAAASVVSRSAADSIF
FT                   SRSRFPRDGRARVVVSANAVSAPDAPLRPPAVPSHVIQLAAAVAAPAPAAPAKITLGLK
FT                   VLLGGLATILLAVFTACIAGFLVAVREMVRACREATIASRSVANACESVSQACLSLRET
FT                   LVQADSVLYNAEVLSSGGASISKEIGVLQRRLSDLPNTASRTLMEAITRQYSSPENPAD
FT                   PKQQGGAWVGGVRVEIGDVIKGERVGARWIGGKKGCNFVFDRANRFRVGEYCAVPRNDQ
FT                   TYTWGVIELNDDDYSVEKSSDDDDAGLSCDWPPQDSGDPALSCEWPPRDIDAIPDTAAT
FT                   SSSFDDGDEDAAKAAVGLGGWFERGVVAVLGPKRAYTAEGYLREVTGLTTVEEREYKVV
FT                   VELDTSVYSFKIMNAGDLGKRSASE"
FT   CDS_pept        689154..>690020
FT                   /codon_start=1
FT                   /gene_family="HOG000200805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631789"
FT                   /orf_name="MICPUN_81276"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62616.1"
FT                   /db_xref="HOGENOM:HBG286982"
FT                   /db_xref="UniParc:UPI000199B624"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V2"
FT                   /transl_table=1
FT                   /translation="MSLLRVAGQPVAGRNPVSRRPSRRKQVPICSRASAASAVASAVAS
FT                   DEPLAKLKGVELKRATDGQTVDAASIVPSSGRVVVPFLTQFADFDSWELAQKLVDDIPE
FT                   LDANGVTLVAVGIGSVEAAKEFSRRTNFPLDRLYADETAAAYQALDFAPGFGRAGGELG
FT                   WIGEKLPFVNGYAKLLVMCAGIGSPGTLGAVFGGYIGSKYRDPIFREGSNYDNPTIRKL
FT                   MDATLGGGYQRPFELATLRLTNMTEILSNWEDLAPVDDNLLVQRGGSLVFQDGACVFRH
FT                   NDAGILGY"
FT   CDS_pept        690836..692311
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631790"
FT                   /orf_name="MICPUN_100038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62617.1"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000199B625"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V3"
FT                   /transl_table=1
FT                   /translation="MFSGTDAVLIPPRVRDGEPDVATVAIGEGAPGELVVTCRVCQRAH
FT                   AKYTCPRCFMRYCGLPCYKAHDGRCVESFHGENFGDALKGTRAEDEGKKRMTEILARFA
FT                   KMDAGDAGFQGDKVDSDDDDEEGDEDDAGASAPSSSGACILSEANLEKLARGEELCAED
FT                   LSPEERAAFERSAATGELSHMVEPWKAWWTLPEATDIVLASDGGRLVREVGSRVGSAVN
FT                   DESPAVPPPPDESLPPLSRLTPVKPSLSLRWHLLDVLGAYTLTLRAHDGDWSADPLAAV
FT                   AALLSLSAVLAAGAARPSRGTGGAGDAASTDLPCTAAAALHGVGSRAASSASGVMAAAA
FT                   AAVSAGGMTRDILSLLRGGRGAVVVALADTRRMVLAAAAELSERGAVDDVNVVRGRGGR
FT                   LVRGAGGGRSRLSRGALSRLERKVFFLLCWVNGLTDSARGGEDDRADEGVFEILRGRLE
FT                   HELRAKKEAEEVAATRAAVVHTSQKLVAEVVQQ"
FT   CDS_pept        694043..695470
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631791"
FT                   /orf_name="MICPUN_100039"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62618.1"
FT                   /db_xref="UniParc:UPI000199B626"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V4"
FT                   /transl_table=1
FT                   /translation="MAVLLVVIMILMLVVYIVATLCGLTFCKCCNGAYKPRRFSKKDLK
FT                   INKLVCLVFCAVTAAGAFTVFAETPPLLENTKDLTGAMADTISELTKNVTKIADAMDAA
FT                   ASDPLLKIGDVSKTTTSMKDAMKSVDNTVQKAQDQIEEYVDMSGLYVTIAAGVMFGITF
FT                   IVFALGFIGFWRLLIFFTIILSIMMVVGWIVWGLLSLLTVFVDDLCWAMNDYLRDRYNS
FT                   DLSQLIPCMDPNVAVKTMNVAREQVATGIAAVNDQLEEYAGSNPYLKYLCYNYAKIPLN
FT                   DLCKNPTIYHELSYSRFVCEAENKKKLTSKNTWASWDATVNDLIMFPDAFCPYPTNFYS
FT                   VPLGNFSTGLRPLRCPFKGYNEPAMTTVNEFAMGQCYTMKQLPSDVFDAKAKTAKLAQY
FT                   VLDVVPMIESLLQCELVSTAFSRMVGPCDGMATALTSLYAGFLLVAMGYFLLWASTLVI
FT                   ISRLQYYRSYCVDADKY"
FT   CDS_pept        complement(<696035..>696400)
FT                   /codon_start=1
FT                   /gene_family="HOG000225288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631792"
FT                   /orf_name="MICPUN_74025"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO63002.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG380826"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="UniParc:UPI000199B627"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V5"
FT                   /transl_table=1
FT                   /translation="EGLRYRLVDARGEVVGRLASRLSILLQGKDKPTYQPHKSEGDVVV
FT                   VVNAAEVTLTGRKMDQKKYYRHTGYVGGLVERTAREMMNQEPTFVLRKAVERMLPKNKL
FT                   RREMMRKLRVFPGERHAF"
FT   CDS_pept        <697067..>697726
FT                   /codon_start=1
FT                   /gene_family="HOG000226075" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631793"
FT                   /orf_name="MICPUN_72552"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62619.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG533000"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B628"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V6"
FT                   /transl_table=1
FT                   /translation="NLCMFLDSASEEEWAKWLPSGIFAGVTTNPIILERDGRECNIAAL
FT                   TELAKEALAYDAVQEFQVQTWGKTSDEMWKNGIALAKYDPDVIVVKVPGTFEGIKAANA
FT                   LVTDGIRVTITAAYASHQAVLAAAVGANYVAPYLGRMNDAGRDGFGTIVEMQKTADKLD
FT                   SDMRILVASVRNVGDIAKLAAAGCDTFTISAKVAEDMFGDPLTNQATLDFEESATRI"
FT   CDS_pept        698093..699118
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631794"
FT                   /orf_name="MICPUN_57819"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62620.1"
FT                   /db_xref="InterPro:IPR008833"
FT                   /db_xref="UniParc:UPI000199B629"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V7"
FT                   /transl_table=1
FT                   /translation="MTQNDGGDIEALLREFPSLARLEDGRVRCALTGHVMAPRVEAVQP
FT                   YVRGKKYAAALAKDKHMESLKEFEPHIVRSKYHPDKLFCRITGRLVQAKESAVVQHSTG
FT                   KRFERGIELLTSGEGKLLDERPPEELLAERERSEEARKVASEAKRRAAAEAAAARKREA
FT                   KVPDEDDESEEKIDPKVAAERERIRINGGFSKEMGCWVPPAHVLESESESDESESESGS
FT                   GSDAEFDEFPEGSDSEDDVLNPEVRMPNLAKIMNRVKNSGKKSRDAPVAVAEGKQRGKV
FT                   TAGGGDAFDWTQSSGDARAGVGGKKVTHKAATSAGVKRSAEGGVKRGKKASSKPAVRRR
FT                   T"
FT   CDS_pept        701006..702367
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631795"
FT                   /orf_name="MICPUN_108084"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62621.1"
FT                   /db_xref="UniParc:UPI000199B62A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V8"
FT                   /transl_table=1
FT                   /translation="MDNKIVANLAPSEAENVENAENAENAENVEEEGGDLDELAAAGLL
FT                   AVAASNMVPTPRKRKAIATTRVTKIEDTSGGSEEDKADGQRKPLESNASPETQNRGKGW
FT                   KRSSSWDAQGARLGDGAMDSQMTPREQENIYASRRVEGSDPSLPGVDSQGQEKAINQTY
FT                   GERNLLNYLPYQQPSPHLASLSKEAAAASRAVVQAFAISAQLRRSTVGDIVSRFYNHQP
FT                   PSVRAGEGERSFHNDPTSAFKRPSRGWCSAVSVPKAAAAAVRAGYSGDTPSGTVGDEAM
FT                   NPMMQRASVNPGSRANSQALWQWQNEQASLALSNQHHHSWGGFVGASKDERFNLPVSRE
FT                   AFKKARRKNSIEISKLSSVMEQLRRVVSSIKEPLPAKTRAIVISRAQRILEGICKKAEC
FT                   IPISERAPLSAAVAEVQTWVHQQLDQRFDLRIDHDDEAVMEGLASLVAAADLAR"
FT   CDS_pept        702772..703500
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631796"
FT                   /orf_name="MICPUN_57821"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62622.1"
FT                   /db_xref="UniParc:UPI000199B62B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3V9"
FT                   /transl_table=1
FT                   /translation="MRLDELRRISQRIQLKSPPSAPWQKVSSGIDAEVEKQNLAVEEGT
FT                   AERLQELARERAEAERMHEEWMQESRARIERMKAETEAEVHRVESARQTLRGTHTAKCD
FT                   SAFHSEVSSNAESTKQHREEEGENNLTPCDDSVDAKGEASWIDSLVVPSLSAVRKHSFQ
FT                   RSSRPLQPEKHQKLPARLRRAFGFILRDRILLHILAVVVMTKAGRKNGRISKRSAESPT
FT                   ESPCAKPVHLVSHLRDVFAA"
FT   CDS_pept        704108..704995
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631797"
FT                   /orf_name="MICPUN_100042"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62623.1"
FT                   /db_xref="UniParc:UPI000199B6EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W0"
FT                   /transl_table=1
FT                   /translation="MADASTHELVGCEVTLKGLNAKPELNGRLGKVKAWLPDRGRLQVK
FT                   LLDDDGVEDRREAPLAVKPDNVEKVDIADKFRNMKVNNGRTGISASAAADLLYTGGSIK
FT                   PPADWDGKGVTDFEKRRPLYDELVLSFTLRVDDEYKFAGEMCGLFNYMADGHSRAPEKG
FT                   SRGNSVFREFMRYVRRARKVGLLGSSWFTDENMEELATYAADSGYLYQAWEKSDVTAHL
FT                   GGGGFTSMRLRGYAESVCKHGFGNEWFSDDDYSDGYYDSEDDDGEYDSEDDDGEYDSED
FT                   DDGEYDDEYDSEER"
FT   CDS_pept        complement(705182..706702)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631798"
FT                   /orf_name="MICPUN_113379"
FT                   /product="Sugar transporter"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63003.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199B6ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W1"
FT                   /transl_table=1
FT                   /translation="MLRHGHRYGYQPRSSMEPNDSELDESDSGDRVGLLQPRPGGGGGR
FT                   PDQVDWRATGLAFLFPAIGGLLFGWDIGTTSGALTSIMDPNTSGVDWYALDSFQQGMVV
FT                   STSLAGALLASAAAAVKVGDEFGSKTELQLAALFYGAGAIVQGLAPSLGVLIMGRFTYG
FT                   LGIGFAMHAAPMYIAETAPPSVRGLLISLKEGFIVGGIMLGYLGSYVIFGQDEGWRSLL
FT                   STPAVPAAVLMLGMSRLPDSPRWLLQRGRPASEAREALEQVRGKKANRDIVDAEMARMV
FT                   SSDHHVGGINELFRRENLRPLYIGISVVLFQQITGQPSVLYYAEQVFINAGYDPADGAG
FT                   VAVILGFFKLLMTGVAVAFVDSAGRRPLLLGGVGIMTLSVLTLAVCSETMASGDVAGTS
FT                   FTARASVAAIFAYVGAYQVSFGPIAWLLVGEIFPQRVRSAAVGTATLTNFFSNFLVSLY
FT                   LPTLNENLGTAGTYYLFSVMSVVALSSIYLTVPETKGKTLEEIEESLR"
FT   CDS_pept        join(707313..707440,707543..708611,708876..709026,
FT                   709279..709949,710025..710891)
FT                   /codon_start=1
FT                   /gene_family="HOG000179829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631799"
FT                   /orf_name="MICPUN_81085"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62624.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG522881"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B6EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W2"
FT                   /transl_table=1
FT                   /translation="MPSALTIVEFEGKFEWKLAEYENEQTFSHVVEIAKSGRARCRKCS
FT                   ELIAKDSVRIGVPIKWRGGLFGWISSWQHPACLRVPGVTRDELRCELHGVDALTDEQAD
FT                   EVLDQLTSDKGVELEEVDPNDPAFTKREDPVPELPAPAALTRPLLQFQKEGLGWMVANE
FT                   AGAVRGGILADEMGMGKTIQTISLLLHAKAERAKAAVEAAKEGKALTAAERPGPTLIVV
FT                   PTSALVQWEDEIRNCTQPGSLSVLVYYSDRKTMSKETLEGVDVVLTTYPVVEGEWRKVI
FT                   NRAMVECEYCGKKLLPRSLVVHQKYFCGPDAVRTAKLAMREKKQNVANEKAMRTLKIKQ
FT                   GKASDVVEAALPTPGNLYRELMSKAGRPAMSMYDSAIKARQNPKDPTAVESVDDASDSD
FT                   ATQMKKEEQDDPIVTIGQHTNDVKGKDTRQGVKPRNVNENINKAPVTSRGHDDVDLSDS
FT                   LLHTVDWNRIVLDEAHKIKARTTNTAKCIYALKSTTKWCLTGTPLQNRVGELYSLVRFL
FT                   RMDPHAYYFCKVKGCECKSLCWNFGPNQKACTQCGHPSPRHFSHFNQHVINPINRYGYV
FT                   GDGRKGFLTLRKDILLPAQLRRTKAERAEDVKLPSLTIKVHVCQMDEVERDFYESLYML
FT                   TRAKFDGYVKKGSVLHNYAHIFELLSRLRQACDHPYLVASDNDEAIMVAAVNEPKYWCG
FT                   MCQEEVDAEDAALSGCKHVFHRECIMQYASCAPEKGKKVTCPVCRVALTIDLQPSDLSG
FT                   ANKPPRNAAAQHKKDELPSKSILSRIDLSQYTSSVKVDALLKGLNDMRSGKNGHLNKAI
FT                   VFSQYTSMIEIVDWRLKKDRFTVAKLLGSMPITQRAANLKAFREDPNVSVILMSLKSGG
FT                   EGLNLQAANYVFVLEPWWNPAVEMQAIMRAHRIGQTRGVTAVRFSTKDTIEERMMQLQE
FT                   KKKLVFEGCMDGNQEALAQLTEEDLQFLFKR"
FT   CDS_pept        join(711735..721412,721582..722511,722630..734521,
FT                   734533..734535)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631800"
FT                   /orf_name="MICPUN_57825"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62625.1"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000199D57E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W3"
FT                   /transl_table=1
FT                   /translation="MDCRFPSKASVSLISPSSEPARVCSGIYPAPRRPSLSDGQTPLGA
FT                   SCKTWRSTPDPSRFLCLSHPYRFSGSGRARSDRDAGGLARVPVDFGDLSSEDDDVGPGS
FT                   SRVKVGAPPGKSLDKIQPSHGWDVDGGASDSDSDLDREAKTKIDGDVSVIAAELRASLR
FT                   EKRKRNIGYMNLCQYLFFCLFYMLVVYIQSDALNAFNVLSSVRDAVVPMDTDGRPLTKM
FT                   GSPVDILNWLVGTAYPVWIDEVCGDGVCNEPFEFPAYGRFGCRSDCGPNTNLTTVLIQV
FT                   RADFRDDLYSPRALMSAVTWNLCRRDEEAKKAGFPDICWWEEDRKFTKIKENHLETVNV
FT                   PPDTLWFIAIKGDYMGRVVGNIFLTERDDLPWVGTMPEWKACKRNVIGSRRNIESRRRL
FT                   LAVDGTESETFDMNAESLKTQMSTHKRIAEPGEGQRLLEEAMKHARTPQPRGSRGFEKS
FT                   DIANDRVAVASDVEETVDEVFDTMKQVDARDRQRRGLLGMNAVRFDGVNAGVISQGELN
FT                   WAISEELTFEAWVRPETSGRMQTLAFVGTGDSPSWGIMLMCPAGDGIGCCGSHKLNSVA
FT                   FFVPGTSSNEACERMPSSDKGLELDVWSHIAVIVSETNMNVTFVINGVYAGHNDTNVII
FT                   PDNSNGPFTLGCMKLESNCPSQGCGCFVGMIDDVRVWNKAVNVPYIQRWMMRMDNTHPD
FT                   YSNLQAHYDFNTHLVNEEGHTEVAGELVFTSWSALMHSKDRHGWSLKFDRNEHSIATTS
FT                   GDGIQPVILAGKLTFEAWIKPTSIDVSQAIAALGTDGWQVLLMCGGPGLGCCGDHVNGS
FT                   IGFWMDSECKSTPSSKVGVQENEWSHIAVVVDVHQRQVSFYVNGEDAGSTPHASKIIIK
FT                   DDTSNGSFSLGGIASCGGTSGSQCLGYSGLMDGVRLWNTTRSIVDIREDRFFVASYHMS
FT                   DYAEASLILAYDATNATVEALQDGSATGADANLVNVKFAFDSPRSGLLTNFYSQRDESN
FT                   ASISFDGLTAYGHVPYTSDLEFDDELTFEAWIKANDHKPGTIAAMDENGWGVFKLCSQG
FT                   SHGIESGCCQERTHNSIAFFPGQSTSTDGICSSAFSTEDPILIGQWTHILVTVKSGSYV
FT                   HMYIDNKLQQLSDATGSITDPAYSRPIFRTRGENATTGNGLFIGALPSCGSTCMMLNAT
FT                   LDKIRIWNAAVDKDTIANNYAYLPASVNPNYEHIVADFEVKGKHDGIVENLAGMAQDMH
FT                   LLGAASLDYENFAMVDHPVHGSALYFDGHRMFMEVRDREPGWFNSDNMTFEAWIKPNDI
FT                   SRGEILAMKDLWGWSVMLMCSGTEGENCCVDGDHLQDSIAFHPFDGQGPCSEYPSSTLP
FT                   VQRGVWNHVAVTTEKLSGGGLTVKFFVDGMAAGKFSSFDYTVSGTGSHNGTITFGRIPD
FT                   KSSACEGGSCMQYIGHMDNVRLWSMTLGGDTLAHYKDVRLGQLHPYWLALVFGYDFDIG
FT                   AAGNGIAVDISQKFNAKIEFTGEEQDLIQGQTTHWHADELNVGEDFFPSLPRSMYFDGK
FT                   SVYGVDFHPELAPPESMTWEAWIQPDKIGIDEHRAEVLTSLGDPHMGWGVMLMCGKGAT
FT                   SPGCCENGDHIKDSVAFFAGENDGDCKDYPSSTGHVNRGDWNHVAITVSHIGNGKQITF
FT                   YINGTKSGSYFSDAYRIGDGGGENTDEDVMLGFGGFSSCEMIESEEESCASYRGYMDNL
FT                   RLWNASLGQVAIMTNMFDYIHEDNIYLPYLIAEYLFDGGSSNSVGDKHDLNVPLFEWHT
FT                   ALSTSETRELKTGIPAESADAAALFSGSIMYTGPYTDALSQLKTSDFTLEAWIRPDAGI
FT                   EGQMIAMLGDFGWGVMLTCNGTGNGCCSGSAHMDNTIALVTDASCMDFPTSDAAVRRNE
FT                   WNHIAIVVTPSSKHVDFFINGTAAGSHTGDFTIEDGNQTGIFIGGTPECQLTSHTCMMY
FT                   SGLMDNVHIWSTALTPKAIRVVMNHEIPEDDNIISSLIASYAFDGHSEDTAGEHHLNRT
FT                   GINIQHLWPFSIDENRELGPKKTTNPTSDALYFDGVETLVSVPFSENLVQSSMTFEVWI
FT                   KPDEKARGGLIASMGIGGWGVMLMCNYDASYADNAGCCEGGNHIENSIGFFAYGNSDTD
FT                   CVSVPSSSLAVEPGEWNHVAITFAAPFSRSNPRKTDPELCFYVNGEQAGCSSDPGYIVS
FT                   KGAESSDFTIGGYDDSSCGSGSCAGPGSRYKGYMDNLRIWKAPIDAKSIALYMQRDAES
FT                   KHPYFDVLVADFNFWPDASDHTKLDDKTGQFHATVTAGAFFDPEEDQYLWNPRYTDLVG
FT                   LPKQGPSAMYFNGVDQYVKVPNSAKLAFDDFLTFEAWIKPMSPTPYSEPIVTFGDLCWS
FT                   VYLLCGGEGHMCCGNHTDGSIGVLSHNGDDANTCANAPSSTQAVKYQEWNHIAVTLDNE
FT                   FKNITFYVNGEFAGNQVSWDASICSLTSTSRGDLVLGNFEACPDCSPFLGYMDEIRIYK
FT                   TIVNVDALDLFRTIPVSAAHPNWNELVAYYRFSHGNSSTVYDSSPAGGLDGAIHSGVPV
FT                   EYLVWRSDHDQVSAPGLPAPPPSPPFPPPQQGPSSLYFNGRDTYIKVDRSDYGDSLTPH
FT                   GAITFEAWIRPDMEVRAQTIAMLGDLGWGVMLMCGKGQGVGCCGNHLESSLGFWTANIF
FT                   PNAGACASIPSSNKTVTRGAWSHIAVVAETKPFNENSVTFYINGIVAGRTIGSSVSVND
FT                   GIGDFYIGGLGERCPLCVMYKGHIDEVKYYTAALTAEEIVFLKDFAAADWHPEIANLAL
FT                   YYKFDSASGDAVIERRNPSAPPLSGEIVSSDADHVIWDTELLKDALDAPAPPPMPPPPV
FT                   SPPPGQTVDASLYFNGHDTRVMIPFHAELVPQDFLTFDAWIKPDMDVKGEVIAMMGTWG
FT                   WGIMLMCPGGTGKGCCGTHVTNSIGFWSENVTSPRACERQPSSTRGVTRGTWNHITVAV
FT                   NNSNEVHFYIDGTHAGSQTQNDLTKIAINMGSLRRDLKIGGGPCPDGCLNYKGYIDEVS
FT                   IFNDLWSKEYIWDRRGMRLDPSLPNAIAAYTFTRTEYKANGTNIQELYGRQGFDGVLLS
FT                   SDLPQFVWSNDDYVSLTQIPPPPPSPPPFYDERYRGPSSLYFDGVDVSALIREQQNDPL
FT                   EFNFSGGDTFFADEPSGYMTFEAWIMPERVDKYQFIASVGVSGSDDVSNWGIAIMCGRG
FT                   RGPGCCGDPKYTDGSIGFVATKSSTELLACSLAYSSNSSFPDSDKLQSNTWQHIAVVVD
FT                   AHATPENTRPEFLVRSVHFYIGGKPAGSYTTEKYERIHFPMSKDYNKVGYNDKSGLHLG
FT                   HGFCGRYFSSAFTGKTEKNHCWHFKGHIDELKLWKTAMSTTNVETHHLNPVLSWHPDLS
FT                   HLMYYFRFDHGSGVNIVPKNYTVGQHVQSRGTNMILYPEKKLELIWDNKTHHPALPEGS
FT                   IHAPPPPPPSPPPPPPQEGKAVMSFNGYDTLLATPFDSALAPSDYITFQAWIYPKEINR
FT                   AQVIAMMGIDGWAVMLTCPEGSGAGCCGTEDTHASGSLMFWTSPFPGEDNCEVAPTSTK
FT                   QVKLRQWQHVAVVADVYGGTVSFYIDGESAGMSYVHINKEAWEFTTEESKRKQRGLHIG
FT                   QSGRCKCLQYKGFIDEISVWNAAISPADIRLHWKTEPVEWHTNFDDIIAYWKFNTAHRL
FT                   PSGNITSEYAVEGSGDKKINITIVESSDQDQTLFFNKTQMMGIPIPTYFPPSALAPSPP
FT                   PLPPPSPPPQLGPSAIYFNGKDTQVKFNFSSNTDEMINHFAPQDAFTFEAWVKPSTIDK
FT                   LQFIAAIDNYGWGISLMCNHGVGCCDKHQPGALSFWTHEGPDPSNCENSISSNRGLTVN
FT                   KWQHIAVVVSIRPTETDDAGWTHKLPSSVKFYIDGEPAGWKETLPAQPQKDQIRILNGT
FT                   DYKLSKPSAMYFGRFGTCQCMMYKGFLDEVRMWHASLAGETIKSFKDLGLVNWHPNFED
FT                   VLAYYKFDRSYGSVVYDRSALRNDPYNVTEDAGYQGVITSTDAEYSMWNNSTNVNVPDS
FT                   APSPPSPPPPGMTASDGASLYFNGEDSMGVVEYHPAMTPEEVFTFEAWIRPENLDRYQQ
FT                   IVGISNDGWAIDLTCNLPSNNATDYQNTMCTNHSDGTIIFYQGRESVGCDAVLASNFTV
FT                   MKNAWNHIAVTIVRGESVKFYINGTSAGTYTTSPGAEGTRVVTNDCLAMSNGTKYIDPR
FT                   VGELHSYLTFGGYHGKCADDKIRCLFFTGHIDEVRFWEAELARKDIKFFMNYGVVSWHP
FT                   NAGHIIAYYKFDRGYEIVAHEYFHTRGFDVELRTNRTDQIWDTNTSVAAPAIDSPASPP
FT                   PPPMPSPPPPEPSLPPAPPPKPRGMYEPRENEGNTAIYFDGSASYGEIHSTPRLTSFAS
FT                   TQALTVEAWIKPDTSGDEFARLQTIAMLGNLGWGVQLMCPHGSGFGCCGDHKMRAVGFF
FT                   MDSKPNELTCKDTMSSDVGVDLNRWTHIAVVVNPRGWVEKFYYDVEAIAPSPPPPSPPP
FT                   PPPSPPPPPPSPPPSPPPPSPPPSPPPPSPLAPGEGFGGCECTCEGKIVADINVTDDQG
FT                   GQGVSESFCTASWGPEQCEFMANQTMISTCTSNFTVNWVYNSSYTGANFDGSGQTNGRR
FT                   LLTAARSAYQAASQGRRRMLSYESSASWSSRETFIGEDIGTVPDPTRVDQTYTELVGIY
FT                   AVCDYPDVRVDPDLNTARTRMWMIEVEVTMANFTRRSVVRPLAAGYKDDVVDCMYASPS
FT                   EIEAAWNSKSDVSLAPKASEPPGIGIREMFLMPYSDDFPYAYPDAHETTHNFTCNDCFP
FT                   RAESGEWDGIAFAVHSTAAADAMVGESFKLTHVSFGGDEMGGVEKEADFVKLPEYHNTT
FT                   SAKYIAYRCEPGATAVDDMLYMVGFKFTVESAVVRVSSADLTGNALSPARVQNQTCSEL
FT                   TTGNINDYVNIDTYRAANETDLALGVKQPGVGVSDVRISTRMDVRALRINPHPWDDVGS
FT                   AVPTHGYQIAANDQMVPYFVEIVGSNLTKSPHKNLAKFHQIGTRRKQRLEYHTTVSFYV
FT                   DGSKAGAFLNHSMTDDTGVPSEFKLRMMQPLTIGREKDPSLWIGRLGSACDDPGCIHYK
FT                   GSIDELRIWEDAVTQSNLNFWADYKIKSWHNNFQDLVAYYDFTYNPASPMSVRARSANM
FT                   TVLHDAWHDNTTGIIDATVDEDMTLRLIDTKWLYNGFAKDVSVDVSSDAGSMAPPSPPA
FT                   PQPSPPPSPPPPTNFAAGYVCPFKCSDRVDYECPCYSQACQMQILEFGKADVACLQIIT
FT                   GYCLAGGQVEEKEPCAKFVERPVTIRKASPLAPLTLSPDTAPGGISMDFPAGAFTSEVD
FT                   VAISAFSDFSEIKAGTGPFPDKPSSDMIVLQPHGTQLAEPVRMSIPFEMGSGGNFSMGK
FT                   TASPDSTIWNVLEVNVTNACDVPGQTKCDVATECGTPRQCKWGFAAGFISSFSVVAVFP
FT                   APQPLPELGDITLPDGYTCPFTCTGTKEFDYVNKRDNICPCKLSKCADNRLDIISADFP
FT                   CVQGMIDYCAVAPGWFYEPANCWPYHARNISIDVVSGIHHTYKNTPVLGDRHVAISWPD
FT                   VPSPLEILVTEVAREDLENFKDKLPDDYAEAKSDYIFIRHNGTSQDDVKFTLRIPFDSR
FT                   LIVNTDYKEAFKLAYLGSTTASKWEEVAETDVKFYQRGEEPKHWSLSGQDWYNQNTWTN
FT                   WYDQSTWTEEEVKASYKGRYEEEGSFNTAYSESWTSWFDEMYDKDPPKHFDNTSVIWYM
FT                   EANVTKFGVYCVMELGYNKPPPPPPPPQIPPPPSPPPPSPPPWPDVEQGSTELIFNLKF
FT                   PGISRNRIYEEKAAGKSLSGRRRQLLAPSFGNHDMVLNALQQHFGNLISDEVRTGRRLL
FT                   NDQNQAFIFLQALKDAMMDRSGLTSDYVRNGAVSPADDDTSITVEFSLVFKEIRAGQPG
FT                   RITPGMVDELTSGSTMENSVLKSSIANKLSEYGFSSDFRLAAATWGLDGSPKEVVVVPP
FT                   PPPPPNPPPPLIKRVVAPPPPFPPPLPVYKLPDFPSPPPAPPPFPPPFPPPFELFAPKP
FT                   PPPLPPPPPELTPPVITLKLGDSCVPDDKELYTVVCTLTQTVISNIWSDPGFTAIDNVE
FT                   GAYPIERVTVQGWPALGESKLGQIDLSLEKIDTPYTITYDVADGSVNKNQAIQMTRKVY
FT                   VLPPCEVTEKCKPKLCKALSTATEIVCETCDASGNTFCLVEQEVREVADLRPPIITTER
FT                   QLKVNDGPDKRYSFRSTDESGKEMVVNYVEQGQTFIDPGASAVEIVTSTDQKTQVATVT
FT                   TSDISGDITTKIIGNKDTELLQPGVFFRYKYEITQTDGTILSAIRPVIILNPCVTTKTG
FT                   SFGDIIGSKAVPMYKGPDGKDKEERLCEDAELELKTGVKRYKSTAACSINGLCIGLEET
FT                   QVDEVEEKPNEPPVVKLYGANVVEILAGQAWQICLPGSSADALCDRGIDEALSFDPEQG
FT                   KITNKLIKVCAGEDGKGGAIFADSHESIKGGQSLSRVCGFNTFNPGTFTVDYSFFDNEG
FT                   LSSRVFRQVIVKPDCTKLRAGNGEPEFLCENKVLDENGLEAYVCSVNNYCVGDLVETVV
FT                   ELVESPPVIELNVVPGVVDKTVNVRKYQPYKPCEVNPATGEMILPENTFFGDGLCDPGV
FT                   TAYDIKQERGQGGEILEVRKNLTTEVLSCPPIECQSLEKCDDHLYTNKGLDGCIDTNVE
FT                   GEVQIEFTIRDDASQISKVYRTINVIGPCPIGYEYCPGVQEDQACQLEEVCQNAAALAA
FT                   AAAATEEVADTEAPKFTRFVPKSAIMLEYGIDYVGTRTPFKPCYDADDRLTANDMLARG
FT                   TANATEYPCAMRATDNQEGEVSQYIQVTQVITGSESFFAIDQHGTGVIPPGQYTYQYTV
FT                   SDLAGNDATETLIINVVLRKFVLLPDIAINRTLFEENNFQKNFKESFAKDLIDYGLPEN
FT                   VIFNGYEDLELLNITDSGTDKKFTVKVTYFELPAGVNANGTPSSSSRRRRLLANTIAGG
FT                   ATSGVSSSLSSAATASSGTNQTINVTASATEGSDSPTVDMDAAVLASIAGEISVISNQI
FT                   SASMAGLDDMITAVAASGGNPSAYKQRIADYWKSLLVAADETTKGLQSQAEETLRVLDA
FT                   TISVQQEALNSVLELEVLLKKQADELKAALDALGEDTNNELGKACQFRSNIGGAEIFFN
FT                   VTKYSPLGMPPPAPAPPPSPPMPPPPPPSPPAPSPPPSSGRRLLEVTEDEERLHHLVAG
FT                   LLEVSDDMEIDQFGDQHHESGRRHLLATPSSGSSPSAGWTAAKSSVTDWKGYDVLQGGP
FT                   SEQYKAPKSYIGRRFVSNTNRMVGGLLIHQVRSEFSECEGTKFKHIASSCRSDEPSVKP
FT                   FGVDPVFRRPEAGQGTLESLYNVKLEDFVGDYYNTSQASGSLRASTSEKGGVPYGFIHR
FT                   EVPGYQPGFPVYIDIAATRGHVANLIQYLKEGLFFDASTRSVTAQAVTYNPNLRQLANV
FT                   MVIFNFTEAGDLSVSHKITNMNVKWYTEWNDQNNDGLNDGLVQLTLEIILVGMITYAAS
FT                   LELREFVSVCMDERSVLAGMQ"
FT   CDS_pept        join(735815..736206,736376..737123)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631801"
FT                   /orf_name="MICPUN_108086"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62626.1"
FT                   /db_xref="UniParc:UPI000199B6EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W4"
FT                   /transl_table=1
FT                   /translation="MEQLALAEKQGIGLLVDVMSKTEDVDSDSDSSVDEDTKARRHHQR
FT                   AVRGEARATAWDAVKAYSNPPQVNPNDNDWQSLMDDSWNEFMSNVKDKQARKTSARMFR
FT                   LRGLGLFTEAEVTQWLLDADDSAQKNGYFGYQPPSRKTVKSIIRSIADNKVQQFGAADS
FT                   DEEEEEAELNQLIEMTRDIKDNAIGKMQRYIQREITWQQQTLAWQQRVTAATEKMEEEL
FT                   MMTHQTMSDLRKKSTAYGVGELAGEEPVDHAVVRERMWATLQAKRALREALLHAPGGGL
FT                   GSAALEILVGKDNTPMGRSTEEPESVEESLASERESDPESETEQSIAPSTASGRGAGGK
FT                   KNKGKAASEGERTTTTSSMRRHRVAKKEKAAKKSKYDFD"
FT   CDS_pept        737374..737739
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631802"
FT                   /orf_name="MICPUN_57827"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62627.1"
FT                   /db_xref="UniParc:UPI000199B6F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W5"
FT                   /transl_table=1
FT                   /translation="MFKMIKDMFATFRRQKQVCVPSHSCAVSELRASAFFYCWTTRSWL
FT                   KRLETPDVRVQELDVIRAQRLKLQSQMETFKADSAEQLRQQEEQTLAMLEKVVERMQTE
FT                   RGRLLTDQRLMQVRSTS"
FT   CDS_pept        complement(737980..738945)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631803"
FT                   /orf_name="MICPUN_108087"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63004.1"
FT                   /db_xref="UniParc:UPI000199B6F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W6"
FT                   /transl_table=1
FT                   /translation="MDKVAALQALEISHEKAMRALQADLVDRLHKEKAIALANAENEKI
FT                   AAVAAASESNTRDAVLKLKEAHAEEIRELEMTHAEVLAKAAEEQTRAASIRLKEAITEA
FT                   ELRANTILTKQRETLESAAKAGMRAQEKMLASAEEKLTCLKAELTAAKEAGNDAEARAA
FT                   KCEAAAKAAVIAAKAELDLLREESSKAHAAELDALRASLEEEAKLGHRSAASSDGKVLE
FT                   LQSIIARLSGELAAAKNSADVAEPPKTASKRGRSKRAATPEPEPNDVKYEKSVTRSVSK
FT                   SRKPLSSVSANVDVGEDNASDELVPTKRARGTPKTTMRAS"
FT   CDS_pept        join(complement(742193..742354),c
FT                   omplement(<741103..742125))
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631804"
FT                   /orf_name="MICPUN_80653"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO63005.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG633506"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199B6F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W7"
FT                   /transl_table=1
FT                   /translation="MDIGPVEHTVRGGANHNIQVLVRVRPPNSRELDQVSAVLRDRTKK
FT                   CRTFPCAHPIASKSNATYSYDHVYDHDASQADIFESVGVPVTDAFLEGYHGCLIAYGQT
FT                   GAGKTFTMQGPDEHTETDNISGDTGVMNAAEDPEQLGLIPRVLKRIFAHIESELAAAEN
FT                   KENARDVNIEKPELEFTVKCSYLEIYNETMADLLSDPGSAVQPNIREHDKKGVFVEGLT
FT                   EASVQSAEETYDLFQRGSHNRRVGITEMNRESSRSHAVFTVNLESRRRAFAGAALQKRS
FT                   ALLHLVDLAGSERQKSTESAGVRLKEASAINKSLSALGNVIKALVDVSDGKDRHVPYRD
FT                   SKLTFLLKEALGGKARCTLLACVSPAAGQIEETLSTLKFAQRAKLVKVTACKNEE"
FT   CDS_pept        742775..>744124
FT                   /codon_start=1
FT                   /gene_family="HOG000189714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631805"
FT                   /orf_name="MICPUN_81269"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62628.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG716564"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI000199B6F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W8"
FT                   /transl_table=1
FT                   /translation="MSQEGRGKGSQSMRSAATVRRLLMYKQKPVRDKKGKLIKQDLQSK
FT                   ELPSTRIVPDRRWFGNTRVIGQKQLEEFREDMAQKSKDGYTVLIKQKKLPLSLLADPEK
FT                   GRTRRVNLLGTSPFSETFSAGRRQKKPKLATDDLATMAARAAAHNEAYAEGVEAGAITD
FT                   RDLVRQNDGVVDAAKGSLFEKGQSKRIWGELYKVVDSSDVIIQVLDARDPMGTRCHHLE
FT                   YHLKKDAMKRHKHVILLLNKVDLVPAWVTKRWLHVLSREYPTLAFHASVTNPFGKGAVL
FT                   SLLRQFSRLRMDKQNISVGFVGYPNVGKSSVINALRTKKVCVTAPIPGETKVWQYVNLT
FT                   KRIFLIDCPGVVYHDTEDSDTDAVLKGVVRISALEDAWEHIPDVVARVKPDYLRRAYKV
FT                   QSWESPEDFLQQVARLTGRLLKGGEPDLNTAAKMVLHDWQRGRIPYFAPPP"
FT   CDS_pept        complement(745002..745925)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631806"
FT                   /orf_name="MICPUN_100046"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63006.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG748543"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniParc:UPI000199B6F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3W9"
FT                   /transl_table=1
FT                   /translation="MNVISVPSLRHNAELSRAVRRAGLAKATRTSACALVRTAAGVKAE
FT                   SLHVNRRRGFRGRAVNMPLHAVGEEDGTDKKDTLSSLSSILGEDLEADAAKQREEEERI
FT                   EREVMAAKKEQAAAREEREKASGAKDVFKRAVTPSASEDDDIRGSERAIAAICYLLPLL
FT                   DGLKYSKFLLLQFPLFGLLLLPIKPAIDLWYSLGFLQIFVFFGMYLGVVNNQEFRYFTR
FT                   FNAQQAILLDILLIVPDVLIRLISGLGGDDALLTGGPGLEAQVLLYNTVFLYVYLTSVV
FT                   GAGASTLGKTVKLPIVGDASEQQTMR"
FT   CDS_pept        complement(746451..747530)
FT                   /codon_start=1
FT                   /gene_family="HOG000049094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631807"
FT                   /orf_name="MICPUN_108088"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="microtubule-based process "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ACO63007.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG478075"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="UniParc:UPI000199B6F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X0"
FT                   /transl_table=1
FT                   /translation="MSGVSEARIKVIGCGGGGGNAVNRMINSGLQGVEFWSLNTDAQAL
FT                   VQSQADNRIQIGKQVTRGLGTGGNPELGKKAAEESATEIQQAVRGADLVFVTAGMGGGT
FT                   GSGSAPVVARLSREAGNLTVGVVTQPFTFEGRRRFIQAQESIEQLRANVDTLIVIPNDR
FT                   LLDVVMDDAPLQEAFLLADDVLRQGVQGISDIITISGLVNVDFADVKAVMKGSGTAMLG
FT                   VGVAQGKNRAEEAATAAISAPLIEHSIDRATGIVYNITGGSDLTLQEINTVSEVITSLA
FT                   DPAANIIFGAVVDDQYKGELQVTVIATGFATPSSINSGKGGDSGGPPPPTPPAGGGGGL
FT                   PWQRESGARRGSFLDNYGR"
FT   CDS_pept        join(complement(750525..750543),complement(750314..750370),
FT                   complement(750123..750223),complement(749909..750054),
FT                   complement(748032..749727))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631808"
FT                   /orf_name="MICPUN_57832"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="heme binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="ACO63008.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniParc:UPI000199B6F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X1"
FT                   /transl_table=1
FT                   /translation="MAGILAADRGALMMKIYHASGFALAGLVPAAMVIPGGVLPIDLAL
FT                   GVALPVHSHIGLNFVISDYVPKAVAPATRAGLLGVTCLTLAGLLKLNVQGEGVTKTAKR
FT                   LWTKREVSVTWSGGTEGLPSRGAVVRGSSMICSLVRASSFGRGAAVSASIASSCRLAHA
FT                   LTSPSSSEDTRGRSVAVGWALGPQGEFERRVQAGQIVGGDCQQASALSALQRLRDRLLG
FT                   ENPSGLTAESVSEAEQHRHRRGVYLHGGVGRGKTMLMDMFYTTLPPNVARLARRVHFHD
FT                   FMAEMHHRLHAKRGREDPLSAVARDMCSVHPVLCFDEVELADVADALVFKRVFERVFDF
FT                   GGVLVATSNSSPEELYLGGLNRSAFLPFINTLRNQCEVISLNASDGESNDVDYRRSDVV
FT                   LRGSHSVSTKRSATEILPSATAGVTSTLISSGDGTAELDRLWHEVVAVDRSLRGVNSEE
FT                   KVTSSARIPVASGRWVTVPKLSGRCARFSFDEICGLPLAASDYNALAHHINIFTIDRIP
FT                   IFSEQNENEARRFINLVDILYERRALLVASFAARPEDIFHGEAESVGAEDTVRNRVKRE
FT                   GQRAGHQINVRDEGGSSGRSTTTVGSMEWSATGRAGASLAQLQSKNFTFRASRRCASRL
FT                   VEMGSVTYERTFWASLPRVGVGGFPSTVGAKYARGPT"
FT   CDS_pept        join(750893..751175,751259..752532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631809"
FT                   /orf_name="MICPUN_57833"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO62629.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniParc:UPI000199B6F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X2"
FT                   /transl_table=1
FT                   /translation="MNDLKVSRTVIPPTSFSRFPASFLFFSMTHLNVSCGFRFSNDDDP
FT                   SLTLAAQAWLRSNGFWWNEDAIELGCVVGDSERNKTSRVGVLARRNIDVGEIVARIPTS
FT                   QCLTCGGCAHQKLVGDLEISLGKGEWLALLGFALLLERGIDAGKSSSWNAYLRYLPAAE
FT                   QGVTALWPENRKRYLAGTDVDLALRDERAQAKTEWETHIEPILSRSEYAESGFTFEDYL
FT                   SARSVVSSRAFTICPKVGVGLVPLADLFNHRTGGHHVLLTDIEDESILPESARPQQSTK
FT                   EGASYMYVRLVRSARKDEELFNSYGELGNAALLSSYGFCQRDNPGDQVTFGVPALRAAA
FT                   GLCGVDGLQIASRLRWCEANGLCEEDSTFHLKAQSPPSNTLLLVLWILAASPDEFGEFS
FT                   DSLKGKRMFGTDKVAQYISEVQHCGGFENVKTLQVLMKMLERRRALYASTPSDDSEWAS
FT                   YCLILVDSELGIILDCEKYLEEKLNGRFEAGNASKKRKVISTGNIVCTTTTSDAAFSLF
FT                   D"
FT   CDS_pept        complement(752622..753617)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631810"
FT                   /orf_name="MICPUN_57834"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63009.1"
FT                   /db_xref="InterPro:IPR021825"
FT                   /db_xref="UniParc:UPI000199B6F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X3"
FT                   /transl_table=1
FT                   /translation="MTTGTLFQSVTHQVSYSAVRRGARADRYDVSGQAGGRERNRVGVI
FT                   PLSLAANSSSSAISRDSQAILGHGAGTPRRRNSFRHVRDHVVPRSTGDAAASVSQGAEP
FT                   ELPSPSSGAPAGFVANFVRGLRMRMAADPNFPFKLGAEVCLDEVMTLLVNIGVRGNPLQ
FT                   WALGAQLQVLCQMLTAAVNDIILVYCLAPVKQDGLEAKEKPKEPEIAHIFQEGDFTFAQ
FT                   RIGCYLAKGRFYALVGALSCTFSMALALLLSGQMELFTPVYLFRALMTGALHMGISANT
FT                   RYQIVNGIERVLYSLLPQNAARLASVGTRLSNNLLGARLWIVMTTLTGLA"
FT   CDS_pept        join(753989..754198,754360..755064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631811"
FT                   /orf_name="MICPUN_57835"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="adenyl-nucleotide exchange factor activity "
FT                   /function="chaperone binding"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein import into mitochondrial
FT                   matrix"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO62630.1"
FT                   /db_xref="GO:0000774"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0030150"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG732630"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniParc:UPI000199B6F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X4"
FT                   /transl_table=1
FT                   /translation="MAFSAFAPSVSSAATTASVSQTTKPIRRPSAVVGCKTTIARARRS
FT                   DTGFVKFGCPRRSSMNVLVYAAGGEGDDLDDEENARRAAEPEVEVIEGDEEVEEPAAVE
FT                   ASKCNELLGKLREAVEAGNAADVLADVLPELTSEVSGIESAFGDIQAANVGLKDQADTL
FT                   KDQYLRLNADFDNFKKRTLKEKEQLSQTAKSKFFEALLPALDNFDLAQANLKPENEEAQ
FT                   KIVSQYQGLVDGLMTILTNQGLSTVAGVGAPFDPNFHEAIMREESADAPEDTILEEFRK
FT                   GYKMGENTLIRPAMVKVAAAPSE"
FT   CDS_pept        complement(755080..756573)
FT                   /codon_start=1
FT                   /gene_family="HOG000043048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631812"
FT                   /orf_name="MICPUN_113527"
FT                   /product="HI0933-like protein"
FT                   /protein_id="ACO63010.1"
FT                   /db_xref="HOGENOM:HBG409517"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="UniParc:UPI000199B7AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X5"
FT                   /transl_table=1
FT                   /translation="MVAERAATMFFFGARMRIPSQVRRTFGVDRKVSTASRKPKVSVRA
FT                   QGTSDASVAVLGGGAAGLTAAYFAAVSGAKRVIVYERTSEAGKKILMSGGARCNVLPVS
FT                   ARVEDFVTESTPRKLKNIMASWNVERCREWLENDIGLELGIEHVTNKYFPLSNSSREVR
FT                   DKLLEACLREGVDIRYGASVEGLRRVSDDGADGEAWSLLMRDCPDERVSVVILAMGGMS
FT                   FPAVGTDGTGYVIARRDLEHNLAEPYPALVPLTGKHPGGEQLPGVSVNVSLECEPIQGG
FT                   IKAGKKKKAKANREGFLFTHRGFSGPAVLDLSHNVVRSLVRTKGCNKGEDVEQSDADMM
FT                   EVVVPSLVVSWSGESRDEWQERLAAPPGKALVATRLREGLPQRLADALLAEAGVDNDCK
FT                   VADLRRVDRLKLLDVLTKYRIPVDGHQGYRKAEVTGGGVPLDEINFQTMESLKSPGVYF
FT                   CGEVCDVFGRIGGFNFLWAWTSGRLAGMSAAKLVSEKNQ"
FT   CDS_pept        join(756774..756868,756953..757904)
FT                   /codon_start=1
FT                   /gene_family="HOG000265220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631813"
FT                   /orf_name="MICPUN_113526"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62631.1"
FT                   /db_xref="HOGENOM:HBG610110"
FT                   /db_xref="UniParc:UPI000199B7B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X6"
FT                   /transl_table=1
FT                   /translation="MGGIAGKGKGARRRQKLQENAKAFDKKTGTFREPKIKLVEGQVSN
FT                   VDMLKAPSSFRRFMEATNRTKKQQAKRERQRLISQGLEVSDDEQDLVFSGLESLKTDIE
FT                   SEKARVEAGVTALSSDDDEDEDLNNGPDRGDGEIRDDDDELDSGKKHKRKGNPVVEGDD
FT                   DEEGKKAKRKYMSLRERKREARKAAKLAKQEDEAFMQGGTAGKAEGSRGGEPGFGEIAD
FT                   APPTITLKRKGGGKGSSSVPVAESGHKIAGGKGGNRQAQIFQDLMRTAQGKNPGKRAKN
FT                   GSTPGVGLRRVAEMQALREQVIADYRQMRGKPQNNGRSATLASNPSKLFSSMSSVGGAT
FT                   IRRDAGRL"
FT   CDS_pept        join(complement(758823..759207),complement(757960..758696))
FT                   /codon_start=1
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631814"
FT                   /orf_name="MICPUN_57838"
FT                   /product="SAM dependent methyltransferase protein "
FT                   /function="cyclopropane-fatty-acyl-phospholipid synthase
FT                   activity"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="ACO63011.1"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="GO:0008825"
FT                   /db_xref="HOGENOM:HBG316404"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniParc:UPI000199B7B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X7"
FT                   /transl_table=1
FT                   /translation="MTAVLGDLSVRLENPTVKWVAAGAAATGGLYLAVKYSWFRKNPFY
FT                   VFSGKTGAMAKDLVDSGINSYNKFFDQEDGKGVGDRILSTPEFVNKFYSLITDFYEYGW
FT                   GESFHFAAREVGESFEASIIRQETAIAETIGLKPGMKALDIGCGVGGPMRNIVKATGGH
FT                   VTGITINEYQVGRCKKLNKEAGLADLTEIVQGNFMDLSKVFKANTFDGAYAIEAACHAS
FT                   NTAALYKEVFQVLKPGALFSSYEWLRTSKYDKNNKIHVDVVDGIAEGNALPEVRTIEEC
FT                   IAAAKEAGFEVQYTFDRATTGGVPWQAAMKSARRAAYLTHILTGVLEFIRFAPKGTQAV
FT                   HTMLLKAAVNLEKGGDLGIFSPMYLIVMRKPTA"
FT   CDS_pept        759764..760738
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631815"
FT                   /orf_name="MICPUN_108095"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO62632.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B7B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3X8"
FT                   /transl_table=1
FT                   /translation="MGRMLRRAGRCVAHCTDGGRWSTVRRGERKASRIARGAIGDLTEA
FT                   VKSAGIDDQAEVLIELKNVKKSFGKKVVLDGASFKIRRGEAVGIIGSSGTGKSTVLRIM
FT                   AGLLQPDEGEVIIRGRPRVGLLSDEKDPNLKVGMVFQSAALFDSLTVGENVGFKLYEHS
FT                   DLPEDVIKGLIKESLAQVGLSGVEDRYPAQLSGGMKKRAALARAIIKEDISDNDDALEE
FT                   VVMYDEPTAGLDPVASTVVEDLMRNLHTGNKTAASYEEKKGGVASYIVVTHQHSTIRRA
FT                   VDRLIFLHAGKVVWEGTSEEFDTCEEPIVRQFATGSLQGPIVY"
FT   CDS_pept        complement(760799..761953)
FT                   /codon_start=1
FT                   /gene_family="HOG000193853" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631816"
FT                   /gene_name="FEN1"
FT                   /orf_name="MICPUN_96332"
FT                   /product="Flap endonuclease 1 "
FT                   /EC_number="3.1.-.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="ACO63012.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG316651"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI000199B7B3"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1E3X9"
FT                   /transl_table=1
FT                   /translation="MGIKGLTKLLSDYAPGCMREQKFEGYLDRKVAIDASMHIYQFMMV
FT                   VGRSGEQQLTNEAGEVTSHLQGMFTRTLRMLKAGIKPVYVFDGKPPTMKGGELAKRKDK
FT                   REAAESALEKAKEAGDQEEIEKLSKRTVRVSKVHSEEVMKLARFLGLPVFEAPCEAEAT
FT                   CAALCKAGLVYAAASEDMDTLCFSTPKLARNLMAPSSQEKPILEFDFDKLLAGLELTWD
FT                   QFIDVCILCGCDYCDSIKGIGPVNALKYIKQYGNIEGLLEHLDKEKYPVPDDWPYKEAR
FT                   VLFKNPEVVQTDGLTLKWTAPDEEAVVAFLCGEKSFNEDRIRKQLADLKKARSQGGQNR
FT                   LETFFGAATVKSSTVGKRKEPEKGKGKFGAAGGKKSKGVTKRKF"
FT   CDS_pept        join(762325..762383,762526..762763,762901..763314)
FT                   /codon_start=1
FT                   /gene_family="HOG000255608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631817"
FT                   /orf_name="MICPUN_90531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62633.1"
FT                   /db_xref="HOGENOM:HBG526545"
FT                   /db_xref="UniParc:UPI000199B7B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y0"
FT                   /transl_table=1
FT                   /translation="MDDAEELIGGYDPLVEEFESYEDYLDSQISEVDLYYLDDVELARQ
FT                   LVELGHRGNGEIVKRAEFIARKEASEIAKQQRANKKPKKLASAGKDLETFPLLKALAQR
FT                   EEAVRNGKLTTIIFIRDLNAKKQEVSGYIDYAHRLKTENWEPVFDRTQRLLPKATDLSF
FT                   FNWETQKATCNATPNFQVIGDNEAGLMFKNKRDRKVIDVDPHKRPGDNTTRTDITTDEY
FT                   LQVCIWDHVSRRRT"
FT   CDS_pept        join(763543..763593,763659..763759,763864..764284)
FT                   /codon_start=1
FT                   /gene_family="HOG000176758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631818"
FT                   /orf_name="MICPUN_81273"
FT                   /product="Predicted protein"
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="ACO62634.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG317151"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016696"
FT                   /db_xref="UniParc:UPI000199B7B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y1"
FT                   /transl_table=1
FT                   /translation="MQRKGPQISSVDRPLPKGKSEVSLSAFAFLFSEIVQYHRTRASSI
FT                   AELERRLEDAGTGVGVRMLEILSYREKGNRREIRLQGILQFINTNIWRCLFGKVADSLE
FT                   VYNDDEYVISDRSPLVNRFISVPKDLGDLNCAAFVAGIIKGVLDIAGFPAEVSAYYAPV
FT                   EGQIHPRTNFFMKFSPEVLDREARLGT"
FT   CDS_pept        join(complement(765757..765926),complement(764387..765680))
FT                   /codon_start=1
FT                   /gene_family="HOG000232662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631819"
FT                   /orf_name="MICPUN_57842"
FT                   /product="Intracellular chloride channel family "
FT                   /protein_id="ACO63013.1"
FT                   /db_xref="HOGENOM:HBG409922"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199B7B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y2"
FT                   /transl_table=1
FT                   /translation="MRCMSTIPCVQPLTWTKGHTGNSTLRVTKSCRPTRKMDFPLGATA
FT                   STVNLPETVLSWDELKGIAASTETGKKIAEEEKLRSQGEGSPHVTAKLRLFGASEDDVR
FT                   VTLYRDHAGWCPYCQKVWMMLEEKKVPYRIERINMRSYGEKPAWFLKKVPSGLLPVLEL
FT                   DGKIITESLVIMQIIEQTFPDIPMIPEEHFDRANTLLRLERQLFSDWCGLVFRPSGPGP
FT                   FGGGARKQFEETFDKVNAALGELPGPWFLGGDTPSIVDLQYVSHVERMNASCLYWKGLQ
FT                   LRSTERWANIERWFAAFEERPSYVATKSDYYTHVMDIPPQYGPGYSDSSDEVKEAQLKI
FT                   DGHATWRLPLSLSSSDAEPLPDSMNPGDEAARHEAAYKLISNYDAVVKFCCRGMGERGA
FT                   KQFGAPLADPTAVPNLNYKEKVDKLLRTTVLLLLDGSAGVSTGETSEEGKDVASCLAYL
FT                   RDRIGVPRDMSYPAAMTLRAHLNYVIDAI"
FT   CDS_pept        join(complement(767571..767633),complement(766095..767426))
FT                   /codon_start=1
FT                   /gene_family="HOG000264612" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631820"
FT                   /orf_name="MICPUN_57843"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO63014.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560693"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI000199B7B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y3"
FT                   /transl_table=1
FT                   /translation="MLRSQPCVNINTILRYTSSTSPMTDASFLQSLELNEDRFVSLLRN
FT                   LIGEAEYLQNTGVGTAYVPQEDRAIKHVLEVLAPHRKENGGPLEIDHVTYAEGRGNLII
FT                   KYPGTGSSEDVLSFVGSHLDVVPANPDAWKVDPFSLTVDGDKLYGRGTTDCLGHVALMT
FT                   TLFSQLAELKPELKTTLTCVFIASEEASGPGIGVDGLVAEGRLDHCKPGPVIWVDCADS
FT                   QPCIGTAGAITWHLTANGHRFHSGLPHKGINAIEMGMEAVSRIQQKFYESFPACEKERE
FT                   YKFITPSTMKPTQVKCAPGGLNQIPPEATISGDIRLTPFYDVAALKACIEAEVAAINAD
FT                   IESLPVRGPCSKYVIRPEDGEPIVGHLKLEWGDHLLTGIACDLTSPAFKLMCDSIKDVK
FT                   GMAEPYSLTGSLPLVHDMQSEGFDIQLIGFGLMSTYHADNEYCSLNDMKDAARILATLI
FT                   AKFDLR"
FT   CDS_pept        join(complement(768231..768284),complement(767910..768119))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631821"
FT                   /orf_name="MICPUN_57844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63015.1"
FT                   /db_xref="UniParc:UPI000199B7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y4"
FT                   /transl_table=1
FT                   /translation="MAKSLVATFTFEGEEPKTVSTEVKGKLSDALLDFRAACMEHLTSY
FT                   ISAQNKDGTGEVNDDAFADNSDVEEDNVDAFLKGKKNKRQKT"
FT   CDS_pept        join(768670..768897,768978..770393)
FT                   /codon_start=1
FT                   /gene_family="HOG000223664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631822"
FT                   /gene_name="PGM1"
FT                   /orf_name="MICPUN_96333"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /function="manganese ion binding"
FT                   /function="phosphoglycerate mutase activity"
FT                   /biological_process="glucose catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62635.1"
FT                   /db_xref="GO:0004619"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006007"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG613255"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000199B7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y5"
FT                   /transl_table=1
FT                   /translation="MELAPHPVIPRKKPVLVCILDGWGENPVKDGFNACHVAKTPTMDS
FT                   LAAKGSAYYRSVLAHGPAVGLPTDQDMGNSEVGHNALGAGKIIAQGASLVDIALEKKSI
FT                   FQDAGWQYVKPAFEANTLHIITLLSSGGVHSRYDQLKGLMQGAVADGCKMLRLHVLTDG
FT                   RDVPDGTCHEYMSTLVKDLATLEGCDAKVASGGGRMKVTMDRYEADWGMVERGWKAHVL
FT                   GEAPNKFKDPIEALKKLKEGGDSDQYLEPFVIVDEEGKAVGTVEDDDAVVIANFRADRV
FT                   VEISKAFEYPDFKDFDRVRFPKVKFAGLMQYDGDLKLPANYLVPPPLIERTSGEVLAAN
FT                   GLKTFACSETQKFGHVTFFWNGNRSGYFNENLETYVEIPSDNVPFNQAPLMKAREITAA
FT                   GKEALRSGKYDVVRVNYANPDMVGHTGDLQATIAACEECDACVKELLDLVDELGGMYLV
FT                   TADHGNADDMVQRNKKNEPLTGEDGAPLPLTSHTLAPVPVAIGGPALPATVKFRDDLPK
FT                   AGLANVTATYINLMGYEAPAEMEPSLIAAN"
FT   CDS_pept        join(770846..771025,771117..771241,771450..771741,
FT                   771807..771950,772035..772404,772485..772648,7
FT                   72717..773262)
FT                   /codon_start=1
FT                   /gene_family="HOG000264384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631823"
FT                   /orf_name="MICPUN_57846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62636.1"
FT                   /db_xref="HOGENOM:HBG560695"
FT                   /db_xref="InterPro:IPR013946"
FT                   /db_xref="UniParc:UPI000199B7BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y6"
FT                   /transl_table=1
FT                   /translation="MSGSRTTLPVFFDRTTSVGSTAFWLKEPHALAALNSEGAEQETKE
FT                   AELARAAQAALEVAQAASRELLSDLHSVTKSLGFWETKLHDAPRGLWWFFFLQTGPGTK
FT                   SEQRRRLQASPHLRIDTKVRALSTIQFNLASAVGEVHRHAGLVAAAWGNSNSERFEAGF
FT                   LQRTLHESLEGLLKTMQTVSQSKSSVPSNSQHATQQDGRLPGSQSPLSKAVNTEFSRKQ
FT                   HFSSKLGDGRPANLPFLKNSKSNKQDGIDDIWQLVHLLECEGSRASSSAKSIIAANTKP
FT                   GKWKRRWILYSMLASAAGVLSYYTIRNSRLCGSDNLEKMMQNIFSAISRFWNTHAAVPL
FT                   KEIRAELSLAFEQSKDVVGSQQLEVTLHFRPQATKPGYSAALYRAYRAVGGGSSDEGSS
FT                   EPPDPFALVTARVEEELKSPLQNMLGLLLIQTQVMKVDMESALMQMDQIMRANRLNFSL
FT                   MACMPAVLVGSSFFSIASTSIGNERTINSFSSFTTFSHTLGTRNYRTRTQSREDMRMLL
FT                   GEAERALAELTYSRNKSFASGMLLYALNTLFQSVQKHRNCFSPAEWRAVRLDIMTMSDN
FT                   EVPVESKLNAVARLARVKAFVPEPHRVPQI"
FT   CDS_pept        complement(773374..775893)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631824"
FT                   /orf_name="MICPUN_52794"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63016.1"
FT                   /db_xref="UniParc:UPI000199B7BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y7"
FT                   /transl_table=1
FT                   /translation="MVHQSNEYHQSSFLALVSDMKQADVDGSNCERRMAPWFDYLRRHD
FT                   SESSGKTATLSLGNILEASRGGFRDTKSLLFDALFFAWVNRMSFAVHDDCFLEKVGWKL
FT                   TTTQFARAVEALGVEELLLVKLGDVPQYIARHLKAELEEIRSELQLHKSTRIKELKGKV
FT                   SQDRFPHGSSVNKCLSTEVTLCKRAIRMWLQLNMMTLAVSDSLAIKNITRRALIECKEC
FT                   GRMTGALLLSSDRFQTARISLRNFEQKDSRRQELISILNQITDDDTHVANPRRNNDHTI
FT                   IVDSLWDHFYVDPEGFLIHLLSIARKHSSQASMILSAISHLPGLSAYRLQPEKPVSILT
FT                   ALSRMFRKSISESSNVSRLTSSHKADGLHRIALWLIQKPRASLITASSDIFGYALGTPF
FT                   RAGMDPREALLTNILPALLSNSVSSWCALKMLYSMLYACDVIKDGDAKLSSRGIKLLQA
FT                   TFPGGILLALASCLESSNTDDRLDSSHHLSLTRSSHERSRDLAARLLRDCVEELAHRHS
FT                   QLSTPVLHSLAECDDIAQAKASWHVRLLLEPILQKVRGTSSSSTKREHLGSCELSSEGS
FT                   LEAARQHSGVLKLAKALADLIKLNQLRAFETLNFGEMLTGTEPRAPPKQDRQKMEIIFR
FT                   KIEILRSTKTVDEFRCALLMACAAKIPYLTAEEMDSLFHGILTELVVHISIWKVKAREN
FT                   SDQIVIDLLSRVLRFKANEMNREVRPVDYLEMENLSRHLATKAVETYTKLISNERSKGS
FT                   TAVKKLRILRSLQTALRQVVLIESEKEYTAKPISILLNACLRLMGELMLEGLANELMEM
FT                   FRDFPEHECKQRIMCICSVQMECIAPK"
FT   CDS_pept        777371..778093
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631825"
FT                   /orf_name="MICPUN_96334"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62637.1"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI000199B7BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y8"
FT                   /transl_table=1
FT                   /translation="MPALLDTIFKLANERGLDLDFHVDENGNEVSKGILHISEAAIRNN
FT                   FKGKIVCGHCCSLAAQSPAELVRIFKAAREAGVCVVSLPIVNEWLQNRDVRGLCTPTRR
FT                   GVTTLKELDDAGVPVCLASDNTRDQFYGYGDLDMLEIFREGCRIGHLDRPIHRWPLAVT
FT                   TRPAQIMGLSEDHGCVVIGGKADLVLFRGRYYSELLSRPQLDRVVLRDGIPVTDELPDY
FT                   RELDDKKHRKRARNGAGC"
FT   CDS_pept        join(778831..778913,779104..782257)
FT                   /codon_start=1
FT                   /gene_family="HOG000234582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631826"
FT                   /gene_name="CPS"
FT                   /orf_name="MICPUN_104797"
FT                   /product="Carbamoyl-phosphate synthase "
FT                   /function="ATP binding"
FT                   /function="carbamoyl-phosphate synthase activity "
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO62638.1"
FT                   /db_xref="GO:0004086"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG405439"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI000199B87C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Y9"
FT                   /transl_table=1
FT                   /translation="MIIGAGPIVIGQACEFDYSGTQACKSLRAEGYDVVLLNSNPATIM
FT                   TDPETANRTYVGPMTPELVEQILIKEKPDALLPTMGGQTALNLTKTLAENGILEKHGVE
FT                   LIGAKLDAINKAEDRQLFKEAMEKIGLKTPPSGTANNWDEAVEIADYIGSFPLIIRPAF
FT                   TLGGSGGGIAYNMEEFKTIVTSGLNASTTTQVLIEKSLLGWKEYELEVMRDLADNVVIV
FT                   CSIENLDPMGVHTGDSITIAPAQTLTDKEYQRLRDASVDIIREIGVECGGSNVQMAVNP
FT                   ADGELMIIEMNPRVSRSSALASKATGFPIAKMAAKLAVGCTLDGIPNDITLKTPASFEP
FT                   SIDYVITKIPRFAFEKFPGSVPVLTTQMKSVGEAMAVGRTWQESFNKALRSLETGLSGW
FT                   GLNPKDGEMQGDLETIKEALAVPNPSRVVAMHEAFMAGMSAEEIRKITAFDPWFLRQME
FT                   DLFQTEQWLKSLSSLSDLDKQDWSEVKRRGFSDIQIARAFKVTEGEVRKARVSLGVTPS
FT                   MKRVDTCAAEFEASTPYMYSSYDGNDEVDATDKKKILILGGGPNRIGQGIEFDYCCCHA
FT                   AFALKDAGYETIMLNSNPETVSTDYDTSDRLYFEPLTVEDVLNVVEAERPEGIIVQFGG
FT                   QTPLSLATRLEKALTDNPIPAASGNGNCRILGTPPDSIDAAEDRERWQAILTELDILQP
FT                   PGGVARSESEALVAANNIGYPVMVRPSFVLGGRAMEIVSSDADLKRYIRTAVEVDPEKP
FT                   VLVDKYLNNATELDVDALCDAEGNVVIAGIMEHIEQAGVHSGDSACSIPTQTIPESSLA
FT                   TIRDWTPKVAKRLGVVGLINIQYAVIPDGTVYIIEANPRASRTVPFVAKAIGHPIAKYA
FT                   SLVMAGATLQDLKFTEEVKLNHVAVKEAVLPFDKFPGADTLLGPEMRSTGEVMGIDRDF
FT                   TVAYAKAQIAAGQRLPTSGKVFISVRDSDKPAIVDVAKQFHELGMTVVASGGTAKTIEA
FT                   AGVPVKVAPKIHEGRPHIGDMLLDGDISLMVVTSSGDEADMKDGRQIRRTAVGLKVPLV
FT                   TTIAGAKATCSAVKVLQEGALTMQPLQDFF"
FT   CDS_pept        complement(782368..784332)
FT                   /codon_start=1
FT                   /gene_family="HOG000100049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631827"
FT                   /gene_name="FA2"
FT                   /orf_name="MICPUN_112655"
FT                   /product="Protein kinase FA2, flagellar associated "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO63017.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B87D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z0"
FT                   /transl_table=1
FT                   /translation="MALGDFENLVTIAKGSFGVVYKAVRKDNGRVYALKQVNITNMNRA
FT                   EREEAVDEARVLAEMDSKYVIKYYDCFLEDGKLNIVMQFAPNGTLHSRLHAQRGQPMSE
FT                   DNIWKFFIQALLGLRHIHSKKIIHRDMKSLNLFFDAGDNVLVGDLGIAKVLSPNTLFAR
FT                   TIVGTPYYLSPELCEDKPYNEKSDVWALGVVLYEMCTGGKHPFDAQNEGALIRKIMKGV
FT                   YPPLPAGKFSAQLSDILRLCLTMDYKQRPDTATLLRNPALASRARSLCIELDPDAKNES
FT                   QRPSASFISAANIMDSNAIELYDPAEGRKAILSKGMERQPLAEMVPTTSLSQHSWELPA
FT                   NPHLQQQIRSSESSKIGSQRVHYPGVPPIGHAGVEDDVGYPELEVTRPVQENPMQASAQ
FT                   QPQHLATGEVALTSDGTRTHSELQAAPPPLSDLVAAIEERKQALNAARANGRGNAAAEV
FT                   FKSGFDCTDPFLAHQMAKLGVNADEFQEAVAAAAAERNHAMHAAKANGRGANVMGLMGG
FT                   YGGEASFKGNGYGQHLSGDAQQQTAMIEAGQPIKARSQSNRPYDLDADQMSGSTSSYRT
FT                   ASMEQSAAVRNAKYEAPKFARKRATDLMITGPSMRASGPPSRGTSGGSSGRVANFGYAA
FT                   SLVGTECTTTVAPTSYYNP"
FT   CDS_pept        complement(784909..785451)
FT                   /codon_start=1
FT                   /gene_family="HOG000007944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631828"
FT                   /orf_name="MICPUN_108102"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO63018.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560700"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199B87E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z1"
FT                   /transl_table=1
FT                   /translation="MKYFGVSPDLLPAVVLHETETDKKYILHRAEPKGIAPWLAKYDVG
FT                   SLDPSFKSEEPPNSNDGAVKVIVASTFEALVTGSKANVLIEFYAPWCGHCKKFAPVMEK
FT                   VGHKFASNDAVVIAKMDATANDVLDKRFIVKAYPTLYFYQAKTDKVILYDGDRSEMHLI
FT                   GFVMKHSGKTVSHKEDL"
FT   CDS_pept        complement(<785561..785895)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631829"
FT                   /orf_name="MICPUN_81055"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63019.1"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199B87F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z2"
FT                   /transl_table=1
FT                   /translation="MLAAFEPGAAGLKVYETAARRADIRFGLVTDASLLPELDLPGEED
FT                   IVLMYRSFDERIVRFDMDFTVENLKRFVDAKSLPLVAELDKTPENRNILRRVFEFRAPK
FT                   VIAFINF"
FT   CDS_pept        complement(<785943..786288)
FT                   /codon_start=1
FT                   /gene_family="HOG000193604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631830"
FT                   /orf_name="MICPUN_81362"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO63020.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG156240"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199B880"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z3"
FT                   /transl_table=1
FT                   /translation="MDADNFASTLQEHPFVAVSFTASWCGHCKRLEPEWAKAAEILATH
FT                   KNDPPIVLAQVDCTADKNAGLTKDLDITAFPTIIVFRDAATDGEVYDGPRVADGIVDAL
FT                   RTLAAPIVEPM"
FT   CDS_pept        787626..789611
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631831"
FT                   /orf_name="MICPUN_52800"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62639.1"
FT                   /db_xref="UniParc:UPI000199B881"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z4"
FT                   /transl_table=1
FT                   /translation="MTTRNDDTSPDVAKKTKGKRSKLNQRRPSSQKDAPRAGASTHGQR
FT                   NVNEEGGGPGLAGAPQNAHPSNNIFGSGDIGDMGNESDLDGGLMQQGSPTLLSALKGSS
FT                   LRASAYGQDFTTSFKEDDMSLLGEFKNAASRFTQLNPLGSSIDGLTAEGDMGSEALWSS
FT                   FPVDVDSFLSSRTSAPYGELGGSGRYSDVGGMGGGAGTGAGTTNATVGNVNERVGGGDD
FT                   ADMFRLGSNQYVFQYGEGNGGGVVASGGRSGAPQASMSTGGMSFDSSFENFGNDMQQQQ
FT                   HQGGNRGGMHIRGGTVQGQMPMQPNNSNTQINFSGQQQGAQVRQMRYVMPGAQGQSVGY
FT                   IPMSYQQQSQIQGQQMQQNGMMVQQAYQYSQMVHVPSNGSLQQAHQQHGRGVRKFSGAG
FT                   VDDDAGKGKRPSSSKKTDEKRKASKGNDRTGEQPVSMPAPGSSMLPNQMVSVGLGNYGM
FT                   QSMQPIQGQQLYNRQMNAADLMMQQQNPAVSQMYSGSSSVSTVISGAGIGGGSRVGGSQ
FT                   IQVPQYVVNQMTTEEEVGLVELQAIVGKLDKPTSKNIKESLYRLALSARHRGGRFSDGS
FT                   GHAQAPQPSFEKTNSVVDRCVANLLYHKYTDSPGGTIGTPEAGQQQQNSEGTATVLQQQ
FT                   SSGLGGRGVKPSDMAGLNVRGRHGSA"
FT   CDS_pept        complement(789714..791402)
FT                   /codon_start=1
FT                   /gene_family="HOG000258854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631832"
FT                   /orf_name="MICPUN_80665"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63021.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG314655"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199B882"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z5"
FT                   /transl_table=1
FT                   /translation="MMMNHRSRAAAGPRVPDKSKEGSESKSKTPDLAEFLEKRDWSGAI
FT                   TLLEYKRQGSSHDASNLEWLAYCYFHAGDPGKALETYRDLLRLESDPDPTCHTLCAACL
FT                   FYLGRYQEAEEEALRGPNTKLQTRVLFHCAHKLGDENKLMTYHQQLSDSIEDQLSLASI
FT                   HYLRSHYQEATDIYKRLLLDNRDNLALNVYVALCYNKLDYYDVSLEILGAYMQQYPDSA
FT                   LAVNLKACNQFKLFNGKAAEAELRKLHKNAGSSDAFADNDLIRHNLVVFRGGQNALQVL
FT                   PPLLGVPPEARLNLVVHHLRGGEPLEALKLVKDLEPTTPQEYVLKGVTHATIGQYMDQL
FT                   DAEEHLKLAQQCFQIVGSSASECDTIPGRQCMASCFYLLRQFEDVLVYLKSIAEFLKDD
FT                   DNFNWNYGIATAASGDYKTGEEALMSIQSESFRLEYAFTAWLARCHIMNGKARLAWELY
FT                   LRMDTNDESFALLQLIANDCYKVGAFVYATMAFDVLERLDPNPDYWEGKRGAAIGAFQM
FT                   IVAGQEPKESLGDIVNMLRNTSNPQVEYIIRTLTIWARENGVPLQ"
FT   CDS_pept        791926..792711
FT                   /codon_start=1
FT                   /gene_family="HOG000232704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631833"
FT                   /orf_name="MICPUN_80969"
FT                   /product="Zinc permease family"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62640.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG620552"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000199B883"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z6"
FT                   /transl_table=1
FT                   /translation="MFDGDDQYALFLSLLAGLATSVGGIIAVMKKPDQKLLAFLLGTAI
FT                   GVMATLSLVELYVKNLMQNGFVEVTVAMCIGAVVYMVLEPLLPKTEALEAKVEKQGSGG
FT                   DDVPTRMSKARLMRLGILMAITMTLHNLPEGFAVAFSSFTGIGPVMATAIGVHNIPEGI
FT                   IVAAPVYAATGSRRYALMLATASGLSEPVGAFIALFFIKPYLTPKLLHYLLAGTGGMMT
FT                   AVCIIELFPEGRKCKHDGQLLKGIVFGSLLMLSTLYVGV"
FT   CDS_pept        complement(792814..796611)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631834"
FT                   /orf_name="MICPUN_57855"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63022.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199B884"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z7"
FT                   /transl_table=1
FT                   /translation="MFYWGDVPVEGGAKNEGADSQAKRQGSRTTSQGQEAAAVAQVGDI
FT                   GPRRVLDEARAILTEHNSNDDDMLPPVGRFEWVDVEEDTKRLQAQGTGRLLSAWGVPPL
FT                   QPTEADRRKQRMYERVHRTQFRKRNAANFFGNPDEIDELVLDIDKVPDREENVEIKLNR
FT                   ESKTATQAVAGPSRDTPAHKLGDLGDNISDARHHLRASTGNYLNMVLGQDRVTAASTAA
FT                   EKQSAEAIAAQIKLDTIPAHLRRFINPQLLELPEGSQVVKISGGREHAMVLLKTSDHLE
FT                   RILPRHQENQGRVLMMGSGEHGQLGLGDQKPQTIPVVLATLGEHIGWGGGGLRVRMGGD
FT                   RIGGHSSKVRRAIDIAAGAKHSVAVSEDGEVAAFGTDTNGCTGQGENGLSKIHRLPRWM
FT                   YWISTDTTRILACATGESHTLLLSASWHVFTTGDGAYGKLGHGDTRSFSTPRRVEPLIG
FT                   LKISSISAGHNHSLFITDSGLLYGCGANSHGQLGSGDCDDRMLPVRIYHPDFIGDPVHR
FT                   YEEEPELRTLELQERILGPLPGVKGQFLSNLEAARPFAQPTEQQLEAAVKAREAKLGIQ
FT                   QQQTDEEIRLKLGIAASKPNTSRVMQACGGRAHTVILTQLGRVYVCGQSNRGQLGLGNR
FT                   NSVWQPTPVQTMVNLSCVQIAAGDDHSVMLSSLGHAYVCGRNDTAQLGDGTLDDSLVPK
FT                   PMQPVITKELMRDKSKYEILSLQNHPMFGVLIEQVFAAGSSTFAVVSGGENVYVCGSGA
FT                   YGHPQDRNPTGFAEILRLTLDDKEQKKALVMASTVRMLRPDEQGFNDLVRQMVLYSRYN
FT                   EKCLAHIMKVMMEEVLQKPTFVVLYGSILEECRKTCLGCTALAFRRVILLAIEDAGVKL
FT                   LHAQSETLNKRMLHKMGWAKYQQEQREGAGSTGGSGQLTYYDMITDRDSYMDFKRFRDD
FT                   CKAMQGLVRELFEVHGILLEDDMRDIAAGFPGSQHSVGIIDSEEAKKKSTFFASLSRWK
FT                   SPGERAVEEATRAQHLTETLQGGNVTKRGSESADLVRQEGLSSCLPVPSRAIDEAAWEF
FT                   SESVGWEQYKLSEDIRPDEGAGWGNYIEEQRKHAKYVSPVVIPGEDIEEAELAEAEKDL
FT                   DDQERRQLQRLRALDRRKRLVGLDGKRIVESTLAPSFHRSNTVMTTARSEIETIMTRKL
FT                   GSTSSTRLADDDSGGGERRLATRKLKLQNKLASMASSGESVQTIEEYKHNAETNPAFGY
FT                   FTQDEIDAAPPEVQEERARRTFQFAQKIPEDKTFAIFEET"
FT   CDS_pept        796967..798229
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631835"
FT                   /orf_name="MICPUN_57856"
FT                   /product="Metallophosphoesterase"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62641.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560703"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199B885"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z8"
FT                   /transl_table=1
FT                   /translation="MSSSEQVELELGQKAFVLGGGIRSDGSDPAHRRRGVYEPLTRRQI
FT                   LFRVAVIITAACSCLAVGVGIGISIGKSGGGSSAGEAEVSGVYADAAREPEDYLSFLVV
FT                   GDWGRRGEYNQTVVAEAMGRCAELSKPAFVVSVGDNFYEGGLNSLDDPEFKQSFTDVYN
FT                   HPSLQVPWHAVLGNHDYGDCGYNETRGEKECPNEADVNRSPSFQLHPTLRRRDWRWYAG
FT                   RNFELRPVADVHMCFVDTNPHVTSYRKYDWFNRPGGLEQQVRSAESDKLKLMSTLQGSD
FT                   ARWKLVFGHHPMYSNGFWRDEVEDVRNALEVTIMQGGAAAYFNGHDHDLQHTSKEETVD
FT                   VNCSGVTTPAKRRLHHFTSGAGSKTGRGFGTSETEFEYDGAGFASVRVSHDRMKVQFWG
FT                   PALKGAEGLLYTVVINPILGC"
FT   CDS_pept        join(complement(798935..799222),complement(798396..798851))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631836"
FT                   /orf_name="MICPUN_57857"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63023.1"
FT                   /db_xref="HOGENOM:HBG560704"
FT                   /db_xref="UniParc:UPI000199B886"
FT                   /db_xref="UniProtKB/TrEMBL:C1E3Z9"
FT                   /transl_table=1
FT                   /translation="MVATRKSKVLPEPVSATDSADADSEETQNFNYERKQGLSRLRLGK
FT                   STDIENVRVWPLCFAIAIEKSRRIRPGIMVASSSLLAGVSYHLHESDSELLPTALISSP
FT                   LTVFILVETATLCAAFFILLPGTMAQAYREDKTTAFMVEDSAVLSALPTAVARFAVGSG
FT                   IAWQRAALAVVRDGALFMTLYLLCVAVLVGGEDDVNLEQLGDDSLSDSGESAFRRDGWQ
FT                   EMDGGISVHSYSSHANSDEVEASFE"
FT   CDS_pept        799666..801012
FT                   /codon_start=1
FT                   /gene_family="HOG000198101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631837"
FT                   /orf_name="MICPUN_57858"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62642.1"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniParc:UPI000199B887"
FT                   /db_xref="UniProtKB/TrEMBL:C1E400"
FT                   /transl_table=1
FT                   /translation="MQAEVWKREQEKAHEERRLEEMRKEIAEERKLQELQMQAAEAGHI
FT                   DKVERLEFMYKGGPLMSAAEKSREEEAYLLGEKKYVPPKEKDQLKKAAAAGGALLADGP
FT                   AARNETWNKLNADPLLMMRMQEQDARKHVTENPVKMAQIRREVAELRQQKKEKKRAKKE
FT                   AKKEAKKAKKEAIRDEIRRKILGEGGYATTKQKEGKTSRRSKSDDDNSSSSSSGSPVRN
FT                   SRGRSRSRSRSRSRERRTRKEDSDGRDTRNEGAPFRKRGRSRSHSRGRDRDNDRVRGVR
FT                   DDASAQDGSKGYGLTYANQRAEQAAAVRRERRNEWRESTKDERDAAEESARKAKEEAWA
FT                   KTGGKNSVGHRTGRLTEEEKAARLRAMMDDAQVHDEARWKRLRKNSADEEKSLGELAVG
FT                   APAQHHSKAAAFLEDAQRKVFAGGGGMEDRIQTTKYFTQRGGDGKSFRR"
FT   CDS_pept        join(complement(802167..802258),complement(801870..801957),
FT                   complement(801185..801655))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631838"
FT                   /orf_name="MICPUN_108103"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63024.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG610111"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniParc:UPI000199AD3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E401"
FT                   /transl_table=1
FT                   /translation="MKTFCEVCTTNPAALVCCSDDAVMCGSCDESIHSANPVVRKHERV
FT                   AFKSTSEKPNCDICQVNPVYVVCHEDRAFLCRSCDISIHSANDHVAKHQRFLMTGITVE
FT                   LDAVGATAKEGEVAETPVVTQPPMAKKAKGTKRKIEQQFQAPSANSEDGLVPSMGGAEA
FT                   AADPMASEEEFNSFVQDFLGNTKEGKDVNMSDFLDNFFDDIPAGNDFGVVPVM"
FT   CDS_pept        complement(802816..805641)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631839"
FT                   /orf_name="MICPUN_57860"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ACO63025.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="UniParc:UPI000199AD40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E402"
FT                   /transl_table=1
FT                   /translation="MEEDDPGLPRLGDAATGALVQLLLVSVVLAFFLSMTSGNPLLNLP
FT                   LALLVVWAVRFLAQVRVTVRWDASTRRLNLILTRQRKEGSAGALLSRGKRSFRSDTSPA
FT                   DWSRAPSASEKGSQNDNDGPRMSKTIPSRRPSQRETELMELLRRVEKGDDGNAFPEDSP
FT                   LLGAWGRLRDHVLEEFVTTLWYRPITEDSDFVTSLSRLLDASFAELAHRARGVDLARLL
FT                   LRRVPDILASQLEAFRDAREACGGVDAYVRLTPADADKALASELRKRGQLHTGVDWCGI
FT                   NDSAELIGTPQDPVSRVLSRYCDVVAAALLPPDHASNPILLALMRELLACSVLRPLLGF
FT                   ANPSWVHRGLACLVAPEDDVASPPSDAMDVTSASITEKMHPHRRSVSLDMTKSSASTFN
FT                   SLHPLGSASSEEEGIEDDDDYELARMIADEDDTEDENIIRDHDHATMSASVGGADVSER
FT                   FSKLTASVTEVNIVGKGTAAYAVYTICVKSCVSNGTDSVEELSVPPGEMEHEWVVARRF
FT                   RNFEALHRRLVDAGWSSKSLPELPKKRYLLQSLEGSFVEARRRLLDNYLGALLGDDRFC
FT                   DCRDISDFLDARKGAYDPTKKSAWKVGSMGASWGGDNRSRTLIRRNSVDETSCSSSTPE
FT                   GTEGVTETVSVLARSFTQTMNKSAEDATSTVSRALGRETGDELKPRMAGRRKANPLYPL
FT                   GTSTRPAHHRVASAGAIRGAMPGDRASAASGPRTTDEVTDATHGYDESNNPDGSLSSTQ
FT                   ALMNGPLLSLFEAIFHLQAKGFLRRTIVTVARQTLEFFVGSAVEDFVSSRMRTLRSPST
FT                   VTKAIDFIDRVLWPDGSWYQRSAQVDKDCPLNEEGADLAAAVAAAERERDESVRLRVRD
FT                   AILASGSRGPLPGLLGTRNYTRAALDVLAAARSDLMMRQVGLLVMEAALEALFPELVAV
FT                   EEHAGDADPAA"
FT   CDS_pept        join(806343..806375,806562..807137)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631840"
FT                   /orf_name="MICPUN_57861"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ACO62643.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199AD41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E403"
FT                   /transl_table=1
FT                   /translation="MSTLPVMQAKLVLLGDMGAGKSSLVLRFVKGQFFEYQESTIGAAF
FT                   LTQTVSVSDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDIQSPSSFERAKSWVR
FT                   ELQRQGNANLVMALAGNKADIAEKEPEKRKVDADEAQAYADENGLFFMETSARTAANVN
FT                   DLFYEIARKLPRAEPPTPAAAGVTLSAQRQSQRPKSQCC"
FT   CDS_pept        complement(807246..807623)
FT                   /codon_start=1
FT                   /gene_family="HOG000265221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631841"
FT                   /orf_name="MICPUN_100055"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="ACO63026.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG560707"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI000199AD42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E404"
FT                   /transl_table=1
FT                   /translation="MSTTPVGKALEKVISEVRQAEKLVEDGAPSEDSVLDKIDAVVKIL
FT                   PTLREAAKESEATGETLFPVDVLRHVDEGLDPLRFMVDGILQVGEVNKITKGKANVFSK
FT                   FHAALVEEDSKQQSEGMTEHK"
FT   CDS_pept        808057..809493
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631842"
FT                   /orf_name="MICPUN_57863"
FT                   /product="Predicted protein"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO62644.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniParc:UPI000199AD43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E405"
FT                   /transl_table=1
FT                   /translation="MYYAYSPDTDYENDRTAAKSGVALQGSKGDAELTLDQLHNEAYGN
FT                   GSGGQPGARRTKRQAFENIGNQSRLVSEVQVRKRFGACHDLKRATNSVATPMSGGTVAS
FT                   TDASTVKMEWDELTTDEVAVVQAHRRRAETSRPDLSPRTPCVVESPADTMDAAGNTAGT
FT                   EDTVPPGALTIQRVNLRRHVRDIDAEMEEQHRKQHSHVMLEGTVTRLVLWRDPARTALY
FT                   FGVGVLLLAAARAPGLVAEHVPVNPVVIAAYASMAYLCRAYILAIAFPRRKHNLSIDVE
FT                   EAADFARWFASCCNAVTNAHDDLLSGRSNKDVLGAFIALYGVASLGGLLNSTWLVACVL
FT                   WCGAFAIPPAAEAHRELITRAVGIAKQEIGGRWISFTSNQRWGSGVVVTAVVFVSSPFW
FT                   TRVILGFIALVAMRLYRETHAKQLEGLQRVMKDASRRLSRAGSEFHAMVSTPSLFYRRR
FT                   MGSSSRNLTSHSRIRTSDLK"
FT   CDS_pept        join(complement(810584..>810689),
FT                   complement(<809609..810469))
FT                   /codon_start=1
FT                   /gene_family="HOG000200806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631843"
FT                   /orf_name="MICPUN_70819"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63027.1"
FT                   /db_xref="HOGENOM:HBG610276"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199AD44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E406"
FT                   /transl_table=1
FT                   /translation="EEFAELVTSRGEPVILTGMPMGKASALWTPDYLTSSGIETDTTVV
FT                   VDLAGHRKPGTRRNFTFRKMTFGELIQRVSSNCAGSAEEANNKSLSPVVSFGEKYYLRS
FT                   VAHKAPADLSCMFPSLAADLRPGMVLPGGTGECSHTLWPRDAYHSSVLRIASPGTALWT
FT                   HYDTHDNLLAQVRGRKTVTLWAPDAEPFLYVEGSSSRVDDIVVPDLTRFPLFSEVSDKR
FT                   WVASLGPGEALYIPALWFHHVLSHPKCPEFGDMSIAVNVFWRCLPEQEHDAGDLYGNKD
FT                   PPAARQASELAARAGAAISQLPEPHKSFYARRTIKRLAEQL"
FT   CDS_pept        join(811584..811629,811770..813649)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631844"
FT                   /orf_name="MICPUN_57865"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62645.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199AD45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E407"
FT                   /transl_table=1
FT                   /translation="MEDVPMRGAAKSEKTGATARPALGNLTNDKVSQLTADCNGSLNNL
FT                   KKANPVVVFFALGPLLSWRLCSQRVLISNPPTLPELSRVKVLMNSSTSQLSKQASAGAK
FT                   VDPATEVKLAKKGAPDGAANLMPPPTTALRPSAGRRSMGDALSASSATPVQPEYASRRP
FT                   ITTPLTALVGATTVTPGTNFKPSSLSSAGGVVQTPAAHTRGFDAVERSMNGTPSIVSIL
FT                   DPSKHNIVSQSDAGISDEPFNELLTASPGTALAADILATAIREAPTEASPGTEDLDAHG
FT                   VSAGHVKGDEGNKGELYSRFSAAATPVSAKSKGSAASAKKTSTPTAGTKRKGKQLGSED
FT                   EEKIRSTVGPGVASYGCASGLNLDTKGVGALYSILIPPAKKRKARRWLTDDQKMFVCGI
FT                   GGCARSYGSASSLCAHKRAHHPGWKEDRKRQLEAQVQTDAIIDGDNRNAVGEDEGAEQA
FT                   EGEDKEEEDDEDEEGGDVAGRAARREGAAALDAVARCTLSGAWVESLAADTHGRLGALR
FT                   RSRQRVQRGLRDARAASAKAPPPDTGGDVLGGSAKIAASAAESIASAAAARLLQQMEAA
FT                   LEAESERLQGWLGKLESIAELRMKTGKVIGFSHEERKVLNSGELEAMMVAEQTANAISS
FT                   AACLTD"
FT   CDS_pept        join(complement(816342..816464),complement(814230..816176))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631845"
FT                   /orf_name="MICPUN_57866"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63028.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000199AD46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E408"
FT                   /transl_table=1
FT                   /translation="MNVSFFIIFPIIFVRAGERKPTKSQDRWTPWEEKQFFTALKDVGS
FT                   NFDKIAEIIQTRNRSQVRTFYNTEVKRINTVLAPLGVQVDPSDAEEVHTAMHSWHSMKD
FT                   KLGPGGSFQELCKKPQNRNLFAWDLKKELDKSVWAQGKKEAKLKSLGLLPAVAGDASGK
FT                   VLGVMPVKTTANRGRPKGSGIRTKNTCKADSPAGRTKSTGRKAARRGSVSPNAALRAAA
FT                   ATAAKDDSVAKEQKERLMLQLFPIDTSTRAALVAGGFNPHLELTFRAKKSVTGLMQHLI
FT                   TKWAAALPHLPAGLDKETAVLQLYPFEAASASDAKGAWNHRHEGVTATDIFDAIGRPAA
FT                   FRVRYGWVPSEEAAVRPHLAPPPPVYQQSLARSRSRTPSPPNLSPRKRSAEEMTVAHPS
FT                   FCQAPVQAGSFAGMFGGGNASAVGSVFGSDLALFGGVGGAGAGTGADGGVVGVGAEDFT
FT                   LPGFGADFSNMCREMGLGDVDASRGLGGPSAGLTAARHNGIAAGAQLASAAPDQIKGYS
FT                   ERQVISEFGGGDVTVGTMLENDAMFSLTQMLGDVPEGNISHAGAPVAVPSGPSSFAGMF
FT                   AGGSIADVIGMPRQKLKQPGIAGKPRGGEKKPRQPYNKKPANLGQPYVSSLVMTGPAVH
FT                   GAIVPGYINNGKGFVPVQQQPVESAAAYYPHMAPQGDMAANMAKEAAASASLGA"
FT   CDS_pept        816693..817292
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631846"
FT                   /orf_name="MICPUN_57867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62646.1"
FT                   /db_xref="UniParc:UPI000199AD47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E409"
FT                   /transl_table=1
FT                   /translation="MEQGLSRSGTWTWHPDDVVKAHKMPTGAKQLPKSCTRLTFTTNLP
FT                   PIAPEKRLRLLLEQDDELSRTTSWRTSAEHGKNGRRAAKSTRRAPKFGTWTSKVHTLTV
FT                   RPLFGVWAAKCLHDGGGHRMAGDVDFTQRTSKINPRRTMSDVPSLAGGMSVFAVSVAVD
FT                   ATSLSSCCVERVHLVSEQEVPVGIAVVVIHGALKVP"
FT   CDS_pept        817800..818486
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631847"
FT                   /orf_name="MICPUN_57868"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62647.1"
FT                   /db_xref="UniParc:UPI000199AD48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E410"
FT                   /transl_table=1
FT                   /translation="MSKTAPVMRLCAGTRRRRRDEPAPSVDLGRGPIPLGGTIATASSS
FT                   TTEPNLAFARQMTPSSPRVRVENAPNGGTVQVCWLCALFRRLDGIRSLGLRALGRRFHP
FT                   CPSLGSVRKDLPLLYPRIATRATAILPRFSRRRRLRQPPRCIWDRSRSACRGDRALIAN
FT                   AGLASRSGRCRSNVQNNDAGDDDLDWSSRASEPVRSARREVTDVGIEPIHRLEATMCPF
FT                   PKFRPS"
FT   CDS_pept        818888..819994
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631848"
FT                   /orf_name="MICPUN_57869"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62648.1"
FT                   /db_xref="UniParc:UPI000199AD49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E411"
FT                   /transl_table=1
FT                   /translation="MRAEDFGINIDKLSIATDDAGKEFKAAVARSGGLPLSSRDGELEE
FT                   LRQIVVAKDRSISSLRSTLDGQRSALEGRIAQTEKILGDRDRELGAIRDELEGAMRAKA
FT                   VAEAALKREVEANRRSKEAIKSDLEDLRQKLRQASSEGMKVKANLRAEREKTERLRAEL
FT                   EQIFTREAMVTEQLQMESDAHKETQRKLEKYHNEHVRDKENQAVTAASIHGDLERRLEV
FT                   ERRGREASEQLLRAELKSREEMEYLLVALRDLAMNKKKPSPSGDNQEQIRLVKQELYML
FT                   RSEEERDMKQRREQHDMARKKLEGHQASLAVELAELRTTMEFLPFGTQRSDVQTSRVRS
FT                   EGNKESGEDTAHLMPSSPVSFVVPLRDR"
FT   CDS_pept        complement(820079..820975)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631849"
FT                   /orf_name="MICPUN_57870"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63029.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199AD4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E412"
FT                   /transl_table=1
FT                   /translation="MAWYRYLRSLLRITPTNEQLLGALLQLPPPAAKEELNRRATAAVL
FT                   AEVARAKVDNITRARPPVEVRRSQVRSDSAGSGLFLRSDAHAAKPGDLIAIYAGVYTPP
FT                   APDVTHAADGTSILIPLPALREEGAYVINLQGGGWICGAESALQAKNNAAKGLCAGWAV
FT                   AALANHPPRGSIPNVEAIAVDWDDAISDAVRKHINPITTLPWYIDDGVSVFVPQTVRSR
FT                   GIVFLASRTINPGDEILFNYRLNPQGNLPRWYAAVPDEISWSVVDDAGLAEKKETKSQK
FT                   DRWWDQDHGDWGGGLLN"
FT   CDS_pept        821375..822805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631850"
FT                   /orf_name="MICPUN_100058"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62649.1"
FT                   /db_xref="UniParc:UPI000199AD4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E413"
FT                   /transl_table=1
FT                   /translation="MKFGGMGIPALQQLADSASVAAACTYIPWLHNFVPGLADVVTTDD
FT                   PRDLGLGWGGLDTAWRRIWERATDSGAVDGEGRRVEDERSLLVAPVLVDAAPELQPQPH
FT                   LQRLLSALDAARRYKAEHARTCASFEALLEEDGSWTNPATRWYAQVAAFMLSLGGIGAT
FT                   TWKDAWPTEERMRLTPELLRSGVAFELNLPQESITRAAGRGGRTCTCRHCTSKGLALRL
FT                   DDPDIVHHYLTRMEESSEMGASAYGSHNAIRDVVCDIARHAGHKVRIRGLGGFLRTADR
FT                   ANIPDIQTRDREGNDTFIDVTMSHLCHGSPHTRNGDPMGSMRGKKKAIYEEGFIMETSV
FT                   GKKMAAYDDVAEFRGHRMSYHALEYPGRMSTDLVNFLRKAAGEAAVWSRDEFGAGGLDE
FT                   RARHLVSSNFQKFLRWVSCARIRSIATRIVSAAGDEEDKEEEWRRTTEEPVDPDALVRE
FT                   VFSDPLIMHEDAVFGLNA"
FT   CDS_pept        join(complement(824077..824480),complement(823079..824015))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631851"
FT                   /orf_name="MICPUN_57872"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63030.1"
FT                   /db_xref="UniParc:UPI000199AD4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E414"
FT                   /transl_table=1
FT                   /translation="MPIPGLSGITDEDLFVTLNLCLCGWAILALPPSWRPARWDSSVLA
FT                   LSAAFASLYTATLVHAVYFERGAVPEGSGFGSLDGVVNLFKSRTVVFSGWVHYISLDLL
FT                   AGLYIAKDAERARVPHLVVLVCLPLTLFAGPPRGVELGLHMEVTVARLLTFYGIATTLC
FT                   AMMVVWVTFAPGSCTTSFIAAKTTRKGLHDVYEDKLDSWSRVVPHSLVTKYRENGLVCM
FT                   LHVLPSVLWSGLVPLQLNQWIRKHRPRLHRRVGRILIAVSASMTVGYVLIHVRGLHFHT
FT                   NDFSTLKQGEGLSVLAPWFWPFLGRCMHTWTFGMTGSKDPAAFAFVTFETCAAVYWLVT
FT                   AGVAGYYARKGRGNTTVAQKIYIFRHRSWAIRHVAAGLSVATQRVFIGASHGWCRYHSL
FT                   RCEDAASQKGIFADSLTLGVLTCLTLGEIAIRDSRSKVALDMRSKAD"
FT   CDS_pept        824613..>825485
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631852"
FT                   /orf_name="MICPUN_80638"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62650.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AD4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E415"
FT                   /transl_table=1
FT                   /translation="MPRDDLLISLNEREFIVKALQEEELRVDGRGPFDTRPVSYRFGPK
FT                   DGMCEVQLGDTRVLAVVSAKLEPPSGARGNEGTITINVEFSPMASPNFEPGRPGEQAQE
FT                   LALVLERAIRETGAVDVESLCVLAGRRVWHVRCDVHVLDACGNIAGAASLAADAALLSF
FT                   RRPEATVSPDTQLITVHPADVREPVPLALHHLPVAITFGYFAEQDGLVIADPTVNEEMV
FT                   IGSELVVVLNAHDELCAVRYGGEVAVKPSEISRCVRIASRISKDLTKDLKKAHAAWEVE
FT                   RDKRRVRRHY"
FT   CDS_pept        join(complement(826298..827314),complement(826231..826263))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631853"
FT                   /orf_name="MICPUN_57874"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63031.1"
FT                   /db_xref="InterPro:IPR019149"
FT                   /db_xref="UniParc:UPI000199AE00"
FT                   /db_xref="UniProtKB/TrEMBL:C1E416"
FT                   /transl_table=1
FT                   /translation="MAYLDDWYSTLAKNLKAGSTKRFFWKGYEGAPGEMEKATSLFKDV
FT                   LDTITGRNEKKIKPLALRWISERVVEPSVFSACLTPGSTSMPIIRQAEFDSPAAQYLPK
FT                   ESQTGQLMYVWKTGGVVPPRKICIMLPTTGDAFYWFRKQIALDLLSHEIATVIPMFPYY
FT                   GKRKPKDQFHHIIPSVSDFFVQICSGVLEAAAIGSWAAAEFPEVETVFTGVSMGGSVAN
FT                   VAAILAASNSGSKVGTCCVVATCSATSFLTGVLHNRIAWKELSEAPRGVADELKNLVAV
FT                   ENVSEQVKMMTKENGEELLPTEQNLADTIEVLNLVRIVRLMEETKRDLGGQLPMLDAVG
FT                   GKVKNSEVF"
FT   CDS_pept        complement(827658..828413)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631854"
FT                   /orf_name="MICPUN_57875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63032.1"
FT                   /db_xref="UniParc:UPI000199AE01"
FT                   /db_xref="UniProtKB/TrEMBL:C1E417"
FT                   /transl_table=1
FT                   /translation="MMSFASAKLNRVHSGCSRRRGCVEKNRRAARICCASSNESDVEAT
FT                   LELPAKGKQAVLELRVEVSKPLPAVEGKGDAREFVRSDGALHSFLQGGPSTPQLLGEGH
FT                   WRVVAPGFAGKLFFIGPSVEFYPVNEVEILHSDIDDKEWAQVTLALKRGSIEGCPASVV
FT                   DWINQAYTTDRTTTIVTVDSRMGMVVTSVDVRISIMVPKLFSLVPTHKIEAAMKASALG
FT                   STEAALRTVCDAVGEAWMTYHAGGGLTRV"
FT   CDS_pept        <828803..>830033
FT                   /codon_start=1
FT                   /gene_family="HOG000082709" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631855"
FT                   /orf_name="MICPUN_68623"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO62651.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG748042"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017962"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI000199AE02"
FT                   /db_xref="UniProtKB/TrEMBL:C1E418"
FT                   /transl_table=1
FT                   /translation="FINHKAGMAGVDQERVKAVVKELTRGGQHHREESRKDANTEESIA
FT                   KMKEMYASLSATRIREIEGSVRCRIGEMEAQRDLSRTWIHVDMDAFFAACHTLERPELA
FT                   SVPMAVGGMSMISTANYVARKAGVRSAMPGFVAVKLCPALVFVRQDFELYQKYAAMLRE
FT                   VWRVYDKEFDCGSLDEAYLDVTEFMSRTGMDGGEVAAKLRSDVETKTRLTCSAGVAPTR
FT                   RLAKICSDWNKPNGQFVLERSREAVISFLSDLPVRKVGGVGKVLEGKLSAFQIRTCGQL
FT                   RQSLNVIAAVFTPATIDFLFSVALGTGTEQRPPDAQRKGLGHERTFAPTSDPRFIEAKL
FT                   HGLAEDVAKELQKENLKAQTVTLKIKKSNFEVMQRQLTVPSSNAAKVIAEAAILLLRKE
FT                   RPYGALRLVGV"
FT   CDS_pept        join(complement(831451..831909),complement(830563..831358),
FT                   complement(830494..830531))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631856"
FT                   /orf_name="MICPUN_57877"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="barrier septum formation"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63033.1"
FT                   /db_xref="GO:0000917"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="UniParc:UPI000199AE03"
FT                   /db_xref="UniProtKB/TrEMBL:C1E419"
FT                   /transl_table=1
FT                   /translation="MSLLLALPAMRYACGGVMFARNPLTTQLVSAVGGRRTMVGAQRFS
FT                   PLLGAPPTHGVLQVRAASSKKKDKAGGKKKKNTGAPKKSRYGPRGPDGAPQTSGTTAPA
FT                   KPLREDLDMSELRIDALLNELVDGGEGMSNRAKFRALPVDDKIMRTIKDNQLCMDASTA
FT                   GREARKLRNKELDTKITRRYVLYGDIADRERILLGLRGNKKATKFVAAATTENDLPEAD
FT                   DDIPEVAFAGRSNVGKSSLINAVTCSGAARSSDVPGKTQSLNFYDVSRRIRIIDMPGYG
FT                   FAFAAQEKVEAWNRLMDKYLTGRKNLKRVYVVVDARHGLKAPDREMLAFLSRYGNVAYS
FT                   VVLNKTDLVRPADLARRCFLIREELRMAKRARSTVHMLSTNTGAGVRLFGAELFSLANE
FT                   ASTSTEEDKIEEEYDDKNLMTVKRSQDAETC"
FT   CDS_pept        join(complement(832842..832892),complement(832090..832728))
FT                   /codon_start=1
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631857"
FT                   /orf_name="MICPUN_81202"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO63034.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG318170"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI000199AE04"
FT                   /db_xref="UniProtKB/TrEMBL:C1E420"
FT                   /transl_table=1
FT                   /translation="MPHDGSGPTTRANWSPYDNNGGTVLAVAGEDYVVCAADTRMSTGY
FT                   NILTRDYKKIDQMSDKCVLASAGFMADAVTLKKTLKARCTTYEFQNDKPMGCVSFAQML
FT                   SNTLYYRRFFPYYTFNIVAGLDAEGKGAVFTYDAVGSYERTNYSCQGSGQGLIMPVLDN
FT                   QLKTVSPLVLPAQSSATPLSESEAVDLVKDCFATAGERDIYTGDTVEIWIINKDGVRKE
FT                   YQELKLD"
FT   CDS_pept        join(833130..833229,833310..833419)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631858"
FT                   /orf_name="MICPUN_57879"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62652.1"
FT                   /db_xref="UniParc:UPI000199AE05"
FT                   /db_xref="UniProtKB/TrEMBL:C1E421"
FT                   /transl_table=1
FT                   /translation="MGVTDSIKKLYEREMTGANRDSTIVSLRSPTKGAELDPMISPVQN
FT                   LLRAAGLFAGAIVVMRCFGDAFAI"
FT   CDS_pept        join(834592..834636,834821..836224)
FT                   /codon_start=1
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631859"
FT                   /orf_name="MICPUN_80937"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62653.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI000199AE06"
FT                   /db_xref="UniProtKB/TrEMBL:C1E422"
FT                   /transl_table=1
FT                   /translation="MLDINLFRTDKGGDPEIVRESQRRRFARVEDVDDVIAMDAKWRDA
FT                   RWELDSVNAEFNKANKEVSKLKVAKENADEAIAKVKELAARRVELEQQEKDAEEAVNTL
FT                   LKRIGNIVHDSVVVSQDEENNAIVRTFGLDTKRMEEKLPNHVDLIAMLDIADTEHGTDV
FT                   AGGRGYFLTGAGVLLNQALINYALAFLAGRGHTPLGTPFFMRKDRMAECAQLADFDEQL
FT                   YKVSEGDDKEDKYLIATSEQTCCSFLRKRWIQPKELPIRLAGYSTCFRKEAGSHGRDTL
FT                   GIFRVHQFEKVEQFVAVSPDGDESWQEMERMIGNSEAFYQSLGIPYQVVNIVSGELNDA
FT                   AAKKYDLEAWFPSSKTWRELVSCSNCTDFQSRRLEIRCGAAQKGPEKKKSYCHLLNSTL
FT                   TATERTLCCVLENWQTPEGFVVPPALRPWMQGIEFIPFVKKLDKKGKLVEVSPPPPPLF
FT                   APKENEPVEAKTAAEMIAALNLGQ"
FT   CDS_pept        complement(836319..836651)
FT                   /codon_start=1
FT                   /gene_family="HOG000265200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631860"
FT                   /orf_name="MICPUN_57882"
FT                   /product="Mitochondrial protein translocase family "
FT                   /protein_id="ACO63035.1"
FT                   /db_xref="HOGENOM:HBG560723"
FT                   /db_xref="UniParc:UPI000199AE07"
FT                   /db_xref="UniProtKB/TrEMBL:C1E423"
FT                   /transl_table=1
FT                   /translation="MTTSSPEVGEALAEALKKGEEAGGSKEDAVKAALECPCVQGLKES
FT                   SCGEGFRNALTCFITAPEEERGSACAEQFVELHQCMVKHAAEFEEFTKELVENEAKEGY
FT                   LPASTD"
FT   CDS_pept        join(<837796..839790,840046..>841137)
FT                   /codon_start=1
FT                   /gene_family="HOG000163048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631861"
FT                   /orf_name="MICPUN_65181"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62654.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG610926"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="UniParc:UPI000199AE08"
FT                   /db_xref="UniProtKB/TrEMBL:C1E424"
FT                   /transl_table=1
FT                   /translation="KEDEWAVMERLHDVDDALRREVPEPAHAFPFELDTFQKEAIYRLE
FT                   RNECVFVAAHTSAGKTVVAEYAFALATKHCTRAIYTSPIKTISNQKFRDFGKQFDVGLL
FT                   TGDVSIKADAPCLIMTTEILRSMLYRGADLIRDVEWVIFDEVHYVNDAERGVVWEEVII
FT                   MLPAHVGLVLLSATVPNVWEFADWVGRTKRKKVFVTGTTRRPVPLEHMLYFGGDKEEDF
FT                   YKIGEREQFLPGGYKAATDALNKSKKPSTSSGGGPGVPGAGRGSGRGGGRDGGRGGYGR
FT                   GAGNSGNKHPGRGSGGAPNTGGAMGVRGRDKSVWVELIRCLEKRELLPMVVFAFSKKRC
FT                   DQMVDSLTGMDLTAGAEKHEIHIFCERCLSRLSPADRQLPQVLRVRELLRRGLGVHHAG
FT                   LLPIMKEIVEMLFCRGLLKVLFSTETFAMGVNAPARCVCFQDLRKHDGQDFRGLLPGEY
FT                   TQMAGRAGRRGLDSVGTVIIAAWDNFPQESTVRTLLSGKATKLESQFRLTYGMILNLMR
FT                   VEDLRVEDMLARSFAEFHAQRSVGDRRGALALDVAALKRVNELAAAEEAADPTGWAAAV
FT                   AHESASAAVRAAAAEVRAAVLTSRGGQSAMSIGRLLLIAGGGEDGVGDLPPAEKGADGE
FT                   IPAEVKPSGALGGRGGIDKHGALLRIVSANKGGSGGFSSSATEDRIDGPMPLGLPWRLQ
FT                   SGGMDYVIAAVRADSVLAITEAKISIDASAVLTTPGTSGSPAPAAAAAVARALSEIERV
FT                   LSNGTPAALHPVKDLKLQDLAAVEACHAHARLVAAVPALPSSVAPRLRAWHALLDARRA
FT                   LSKRVEELEHGLSDANLQQMPDFETRVEVLQSMGYLDEDRTVTLKGRVACEIATGDELV
FT                   GTEIIFAGVLTNISPEEAVALLAALVFQEKNSSPPELHGSLLEACENAKQLAFAAGEEQ
FT                   LRRGLPVAPDEFVTATLRFGLTEVVHEWAKGTKFGDICQITDVQEGSIVRTIVRLDEMC
FT                   RDVRNAARIMGDSALYEKMESASTAIKRDIIFSASLYVSG"
FT   CDS_pept        complement(841220..843565)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631862"
FT                   /orf_name="MICPUN_57884"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO63036.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AE09"
FT                   /db_xref="UniProtKB/TrEMBL:C1E425"
FT                   /transl_table=1
FT                   /translation="MPDAQRRARLILPASVAPDGTRKALMRTYHTGGTSGGTTEPRSKS
FT                   CSLRQLPPDLERKLRSSTIVTSVGQLVEELVCNSIDAGAHDVSVVIDTGSTLSVTVSDD
FT                   GCGMSVKDVKLVATNRHHTSKIHSISDLGGSLRTLGFRGEALASIAEFCVLQVTTRAAG
FT                   SFETFSKICSKVGGLTLFVRTSHHVQNLTSRSPQGQTLSCGPARNQLTKAGTIVACKDL
FT                   FYTHPVRRGVIRRNIAKQLEDTRVRLYRLALIHPEVGFLLKDVGARHDVLRALPGRSLL
FT                   SILSDAFGKFIASKLIPLSNIIGEFRLTGYVTAATSETSLPSSELQFFYVNRRFVRRTL
FT                   LHNAVSKAFALACASLDSTTHGCPGYVLCLECPPDAYDITFDPEKTLIEFTDWKTPLDL
FT                   LKSALKQVWPHDDGSNITTPLLRTLPTTPPPNIPTYRTSHELTPDALGMHPQSPPSPPH
FT                   DFGLGECVCCPPSRRRRQTFALQSSAYEDASPPICQMVEPFEDAPALSAPVVEEGGGSI
FT                   TDLLADWKRRRADRDLNVMETVPVAEISRNLLDDAKVLTQWGKKFILAMSASGDLLAID
FT                   QHAADERILLEQLRASLIRSVDHRGKLHTYSPASPMPTTVLGRSQPCLLTASELAILRA
FT                   NSSLVWSWGWRWEDVANCDGDTDEGVKLTGLPTVEGTMLGADALAEYLRQVSVTGPTSA
FT                   PPPALHRLLASKACRSAIMFGDNLGQDECVALLGSLTRTELPLHCAHGRPTSVMLAPNL
FT                   TSGSSGPRKVATTRKQRLVQRAWDTLSS"
FT   CDS_pept        <844220..844459
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631863"
FT                   /orf_name="MICPUN_113350"
FT                   /product="Ribosomal protein L31"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62655.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="UniParc:UPI000199AE0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E426"
FT                   /transl_table=1
FT                   /translation="AKKGLHPLLYRITVVGTKGGTFPIFSAVQQKGSKLFLQADQDTHS
FT                   LWSGKKVVSAATGQVAKFKKRFDFLSGTTIGKKK"
FT   CDS_pept        844485..846200
FT                   /codon_start=1
FT                   /gene_family="HOG000265198" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631864"
FT                   /orf_name="MICPUN_100065"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62656.1"
FT                   /db_xref="HOGENOM:HBG560725"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniParc:UPI000199AE0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E427"
FT                   /transl_table=1
FT                   /translation="MMLSARLLPVVASGRQYGDSRREKGGTGTRSPDRGGGDESDWMQK
FT                   ARKLANKRASQFRRERGAQPVAPAQWRRKRKGEKGDEYGYVEAARGYDDIRKVADDKDE
FT                   LTATAGDGLWRVDFGDLAEEDWGSQWTMTQDEWKSVERLAKETSEPLQALQVFEDAGLR
FT                   RVNPDISAGMLKIIADKAKSARVDREELSGIRRDSRVAHLLGMCVAAARRGSDALSPVS
FT                   VANAAWAVGVISTERANSAEMEVLAARAAQVTEDISKRGIADLAWALASCRHASEELFQ
FT                   QIGIRAAVTGLKGFKAFDISTLVYAFAHLGHGADGFLEGLDQWFAGGAEEDVGKEAADA
FT                   NAAKMAASFTAHPLVNTAWSLAVIGGDALRSRAFAALWGEICARGEAAAAEGATVDPSL
FT                   DGDRIQYGSWKGKNLNQINQAIVAVESAGGAEALALRPAPDSLTAAAESAWMAQRRPPV
FT                   VSWYQRDVASILSYMGEKHEEEAVCGGYRVDLLVPNPVGVPQQSGGIAIEVDGPSHFAR
FT                   NDPELALGQTRLKHRQLRHLGMSVVSVSVAEWEYLESAEEKVEYLREKMATPAA"
FT   CDS_pept        846581..847900
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631865"
FT                   /orf_name="MICPUN_57886"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62657.1"
FT                   /db_xref="InterPro:IPR009769"
FT                   /db_xref="UniParc:UPI000199AE0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E428"
FT                   /transl_table=1
FT                   /translation="MACCFKQPTVEDDDGPTLVAGKFAADNAPAGHVVNRDSELKSRKA
FT                   SNARPARISNGAAHSGRAPRLSMGDTDDEWHDAEDTMPSLDPTWANSPSSKEIGSILEE
FT                   HGIKLEVREAPAEGIGRCLIPRLDIPFEKPGDGDTLSWSANPLGQGFRLRGKQYKKDRK
FT                   KFPSEKPLYDVVHVLAFRSDKQKLDFGELIFGGDVGEIIHGCPTVYIANLMLPDYPPAN
FT                   PLWGKKEKGGPDGPGQHIVVVARMTEETRAELERCGGDVDKMAPEVGLMARHFRAGPHD
FT                   ENGMDMPPHPAPVRHCTKMVCMVADGQQELPMVVRVAIGQGNGKPFMVNKTGYFTKHEG
FT                   KGYFEIAVNAHNFGQFATNGLRNCHSFFKHLVLDIGVTLQGDHPDELPERLLFAFRAVK
FT                   PDLHHIQVHVDELDEEAKSIGKGREARPWLSWDELKMPGT"
FT   CDS_pept        join(complement(851780..852215),complement(847973..851643))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631866"
FT                   /orf_name="MICPUN_100066"
FT                   /product="Set domain protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63037.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199AEC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E429"
FT                   /transl_table=1
FT                   /translation="MSPADAATGGAVSGEVEKLTAKTRELQSALLSDLGGNRFECFRAP
FT                   TTLTDAYTEAQAFQAALADDPDGKKKRRMMEEEAERTKKWAMPPGESLIDENHAPFLAY
FT                   NEEYFRHITAEDVAAFVPEGPTKLEDDPDFRIPALGRYYVLEWEDEDAQEAERRRLYEE
FT                   ELRRNPPPPPPPEPKPKKKSHKKKATRPDDKLQVQVVSPMENPDEKAECCHVCWDGESY
FT                   EDNPILFCETCDVAVHKGCYGIVRIPTGDWNCKACVFKKKNPSKRAPQCCLCPTPGGAL
FT                   KPTGNGKWCHLFCSQWMPETFIDDIKTMEPVMGIGDIDKERNALTCSVCKKRGCGPCIQ
FT                   CVFGHCAVAYHPICAFNAGDHTMQIKTRIGEEGCQYLSYCVKHSKVIGASASGKKREED
FT                   SVEEDGDDGETSERETEITDSDVDISESVSMSKKRGRGRPTKAELEARKRASVGTPAAT
FT                   GRSTRGKPSPPLEFSRTFTKVTERDQALEDADHDEEGAEKENANAAGIASIDAMERAKE
FT                   REREREKQLHEVADAEIKSLLMNDVTLSKRTIAEVAKSAGVVGGTRVLEAWIASDAKES
FT                   ATEHQPVVQAIRAWLRKESLQAMSPKKPIADGGEDGQSNGAVLMDVEEGAGAVGLGRSA
FT                   LMGVTKEGEEGVKAEDDPAMALVGHPDGPEHDPPVDIQHLSEHTIQVLAMPPPGMPEEP
FT                   ESARQDDDTSKTEKKPGPGRPPKCPVCVVHKKGICGTVSAPLKCHRRNKQAAAQVTPDS
FT                   PSATWEEGEEPDSMEEELAKLDRATDLLGLAPDDEVVGELLQAQAALARTLWITRTLAA
FT                   KALTNAKAAAADEAADRQEKIEWVEETEKYEERWRGGRWREEYLRKRGLPSADLQGAFG
FT                   AMSGTISPGGTTQLSPGGTRHQLAELVDPLVETGAMEDALCAVCGGGDSEEPNEIIFCE
FT                   RCEVAVHQDCYGVDEVPEDDWLCWPCHVAEENEKARGMPPSRPPRWLREAGDGSLYDPR
FT                   PACVLCPVKRGALRAVIEPAPPPKHSAPRSTAATVSAAAAPATPSKDGGYGDSTLVDGP
FT                   AAAGGDAEPTRQTAVNIEARTESGAADEENCNKILPNSPAAVRRAALVGYDVHPGKDPH
FT                   TVCPPVGAPVKKESDEGAVRWAHVVCAQCVPGIDFASAPEPGVASAVVRGLDRVPRSAF
FT                   EADCIVCRRSEGAVVQCTAPGCTLNFHPLCARRNGWLLSEAEFQNSKRHAFCGRHSMAE
FT                   RRRLEAGGDPRAVGGGGRGRGRPPLSGRGGRGGRGPKAGGSKRRPPPTRDEMELLKRSR
FT                   YGLEKLRILCERVLRREKLKRSELELQTELWSMQMAGLDDGGGATTEISPPPSPSRLRA
FT                   WMTPRMADSLNATLPLGYAYQPESP"
FT   CDS_pept        852400..853869
FT                   /codon_start=1
FT                   /gene_family="HOG000192257" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631867"
FT                   /orf_name="MICPUN_57888"
FT                   /product="Histone acetyltransferase "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO62658.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG749648"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI000199AEC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E430"
FT                   /transl_table=1
FT                   /translation="MRHKARAQANTLAGGFNWLCPEEKPTLGPPKGTESTADRAAVGAR
FT                   TAKGGGMDLIRNFLGGGNNGEEPDAKRVKREDDDSAGAANGGANGTSTSGAGGAGGAGV
FT                   EGKVDHLGQYAMREIHLRKQEEDGELVYMVIKNDGEEQNMIWLVNLKNIFSKQLPNMPK
FT                   EYIVRLVMDPRHHSMICLKNNTVIGGITYRPFWRQNMGEIAFCAVSANEQVKGYGTRLM
FT                   NHLKEYVCDKENMTHLITFADNNAVGYFQKQGFTKDVMMEREKWVGYIKEYDGGTIMEC
FT                   ALSAQVSYTEFPVMIRQQRAAVDEKVREMSNSHVVYPGLAQFKGPAGPGGVRKPVPPEV
FT                   IKGIKEAGWEPPGPPRYRLVHPGCGDGTPTTDNLHRFMVALVNLVQNHIDSWPFISPVP
FT                   AEEVPDYYDVVKDPICLETIKERVESGEYYQTLEMFAADFRLMFNNCRLYNAPDTVFYK
FT                   NATRLEAYFESKVAAGISWKAGRGERSLDRF"
FT   CDS_pept        complement(853928..854677)
FT                   /codon_start=1
FT                   /gene_family="HOG000005740" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631868"
FT                   /orf_name="MICPUN_113365"
FT                   /product="Ulp1 protease family protein "
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63038.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG715611"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI000199AEC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E431"
FT                   /transl_table=1
FT                   /translation="MEDKVLDYHDTLLRVRDVCLLTGPNWLNDAILGFYFSFLQKDKYA
FT                   SLRRSVSFVDASVSFLVANVAEGDVAEILEPLGLQSRQIVLFSVSNNEDVEVPEGGSHW
FT                   SLLVFRKGERGGMDTFEHYDSAGAVNERAASGLVAAVAPYLCNSRRHKFTSSPAATPRQ
FT                   DNGHDCGLYVLAVADAVCSAHELSQSGNVDEESTLTRKLGKITPGFIADFRLELLDLVE
FT                   ELSSGMDTGTATTLDTASSLEHCEYIA"
FT   CDS_pept        854833..857253
FT                   /codon_start=1
FT                   /gene_family="HOG000241464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631869"
FT                   /orf_name="MICPUN_100068"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="ACO62659.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG595739"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="UniParc:UPI000199AEC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E432"
FT                   /transl_table=1
FT                   /translation="MSSAGGSEDVGRDLCLRLTSRRVPENAAQKDRTGLPFGVTVQPFK
FT                   PLPHFPVDASALLDPADEVARCGDCFGYVNGFCGLERDGWVCILCGNFSYWSSDPVGDG
FT                   GKPRYKRNARRNELPEIALPEYEIEVAREVLTVNPREPLGTAPVYVALIDTTAPEETLE
FT                   LVRSAVLAAIEAVGPDALFGIVTFADRIGLYDVQAAAPSVRRVGLGKDGGLAMPLEEAL
FT                   PLRRLLAPVGAFKEELAAAVETIAPAKSRFGSAGFSHPGVDDGTIDGGDGPVGRRAFGP
FT                   ALEATLAWLGADAVETRGEGRGAGDGVGGGDLRHPSCRVLSFLAGLPNLGDGALDDEIY
FT                   RECAADLDSPDHEEAAKAADALGQPRVDFYADAGARAALAAVVVDVFSLGGGDGAAAFA
FT                   DLASVAPLTEQSGGALYHYDTVGKGGASDAPLPRDVFRLLRAESQAHHCTLRLRTSAEF
FT                   EVAAAYGAAVPDDVYPGLYHVVRCGPGDCFAFDFRHKSAAGFGRRGDCPPTAQLAFEYT
FT                   ALTPLPPDPATQAARYLRQRRRRVCTAQARVASSPKDVFATVDAECVVSLLAHKILATA
FT                   EEKGLAEARLLLSDWLVILTSRFNHETGVARFDPKDAAAVDGAFTSCVPLQQMPRMVFA
FT                   LLRSTMLRPRGVQPDERTRARALARRLDPPSLSRLLYPRLSSYADVDTQAFPRHSLTRT
FT                   AVTTSNGAVFLVDAFDVVVVFYAPAQPGSERASLPYPPPQGSAVRAAVNALREEREVTP
FT                   RVVYIRGGAEDPSAFHDLLIEELDVDGLEGGASGFVGFLHTVESQARRFMREA"
FT   CDS_pept        complement(857642..857992)
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631870"
FT                   /orf_name="MICPUN_81107"
FT                   /product="Histone H2B"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63039.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199AEC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E433"
FT                   /transl_table=1
FT                   /translation="MAKPTSKKPAKKTVAKGGSKAKKSKTETYKIYIYKVLKQVHPDTG
FT                   ISSKAMSIMNSFINDIFEKIATEASKLARYNKKPTVTSREIQTAVRLILPGELAKHAVS
FT                   EGTKAVTKFTSN"
FT   CDS_pept        858341..858706
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631871"
FT                   /orf_name="MICPUN_81242"
FT                   /product="Histone H2A"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62660.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199AEC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E434"
FT                   /transl_table=1
FT                   /translation="MSGRGKGKTGKKAVSRSAKAGLQFPVGRIARYLKAGKYATRVGAG
FT                   APVYLAAVLEYLAAEVLELAGNASRDNKKTRIVPRHIQLAIRNDEELSKLLGTVTIASG
FT                   GVLPNIHSVLLPNKGKK"
FT   CDS_pept        join(complement(863622..863732),complement(863157..863495),
FT                   complement(<862143..863063))
FT                   /codon_start=1
FT                   /gene_family="HOG000064717" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631872"
FT                   /orf_name="MICPUN_81350"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO63040.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199AEC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E435"
FT                   /transl_table=1
FT                   /translation="MADNIAVSVRVRPLNSKEESKGAAWDINSETNAIAPQAGSSAGTT
FT                   DSTSYQLDNVFDPSCRTKDVYDRTTRGIIESVLNGFNGTVFAYGQTSSGKTHTMQGSAE
FT                   EPGIIPLAVHDVFDSIDHSEGREFLVRVSYLEIYNEQMVDLFSADTRRVSRLQIKEDSE
FT                   RGVYVSGLKEEIVTSPTQVLELLRTGVARRHVGETNMNAESSRSHTIFRMVVESRAVGE
FT                   NASGAANGAQDAVLVATLNLVDLAGSERVVKTGAEGIRMKEGANINKSLLNLGIVINKL
FT                   TEGAEGKGSHIPFRDSKLTRILQPALGGNSKTAIVCNVTPAAAHAEETHSTLRFAVRAK
FT                   RVCNNATVNEVVSESALIKRQQREIEELRKKLGGEGGVSQEVEEEINALRREMLEAENE
FT                   RERLANELEIEREERERAEKAASAKISNLTNLVLKSSAMDADGACDKRPKRGNRRETW"
FT   CDS_pept        863817..865205
FT                   /codon_start=1
FT                   /gene_family="HOG000223473" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631873"
FT                   /orf_name="MICPUN_57894"
FT                   /product="Predicted protein"
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="ACO62661.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="HOGENOM:HBG629929"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniParc:UPI000199AEC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E436"
FT                   /transl_table=1
FT                   /translation="MTPASTSAGSTRAFTAWKLPCAVPRRVRRSRRIRAASSPPESPSR
FT                   DDPAPAENRTLPPKDRRFKPLTPPPPASEFPPYEPRDFFRYELIHQSKKSAARVGRICT
FT                   PHGVIETPGYVAVGTNGALKAVPHQELAAAGLDLMFANTYHLMLQPGPDLVASAGGLHE
FT                   FIGRDAPIITDSGGFQVFSLARPNAEDGLEMKSRRATKQKGGDGLLIRTNEHGVLFRSY
FT                   RDGSSVVLTPESSVEAQKSLGADVIIPLDELPPYHIDRAVLERSVYLSHRWEARSLKAH
FT                   LRDVRQQAMYAVIHGGVDRDLRRMSVEYLTSLPFDGFAIGGSLGKDTAELVELLGHLMP
FT                   QLPKDRPNHLLGIGDVGSILGSIPHGVDTFDSTFPTRNARHGQLMTRTRGTFNIQRAEN
FT                   ASLHEPVCHQCACSLCKNHTASYLHHLFRANEPTAVTLATAHNLHYMGWLMQTQREKIL
FT                   NDEL"
FT   CDS_pept        join(complement(866560..866821),complement(865339..866441))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632100"
FT                   /orf_name="MICPUN_57895"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO63041.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199AECA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E437"
FT                   /transl_table=1
FT                   /translation="MAKTDATRGHAGGGREPLVDSALNPCSRLRQRLPPPPDASPPRSA
FT                   FLSEFVAKTAASVLPTEPAANARGATASKPPRRKVKFSRHVHEREFLVSVYDRNEGRTP
FT                   ERNTCEAIARAFTASPVRNPQGRLTRPRRHTTGSMHINKPMTPQRNNGHGANSTTTAPG
FT                   GSEMSPLNSLLRMKAQHDAAVRGGRDIAETQQRRHPRHHLPGVSLDDFAMLDSESPMFP
FT                   SCMLDEGANAVSEVKSASDDEWEIAKAPEDDCSEMVADAATERPSQPASTLLAFPQQLA
FT                   DLFSTEYRTANDPTAAMVHNLPEFRCWSGNLADVGLLPAKANNQEEEPAAGSDHAEPVH
FT                   SDDDSGLIISAEDDDLDVELYANLTRGSRTGRWIPLDNSGGLGQGIGEIAHVKADSKDD
FT                   VDMIASATAELGDGEKHPVQWKQIKTWFENRRMTQKRISEGRDRPPRRPKAKRRD"
FT   CDS_pept        join(complement(868039..868138),complement(867109..867914))
FT                   /codon_start=1
FT                   /gene_family="HOG000198100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632101"
FT                   /orf_name="MICPUN_57896"
FT                   /product="Predicted protein"
FT                   /function="FMN adenylyltransferase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO63042.1"
FT                   /db_xref="GO:0003919"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="UniParc:UPI000199AECB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E438"
FT                   /transl_table=1
FT                   /translation="MGASCSTSGATSAAAPDVITTAAGQKFERIPPAEDGGKIVVALGK
FT                   FDAMHRGHAELARRASKMGAPILMSFGGMAEVLGWEEKLPVVAPGDRARVLEMWKAACE
FT                   GKTVREHVIPFADIRRMSPEEFVSTLKDIGVGGVVAGANYRFGFKAAGTADILKDLGEK
FT                   LGVDVSIVDLLPANEPGDEGVYPAGYENTPQVSSTRVRACLAAGDVEQAARLLGRNHAL
FT                   VLRIAGAGNDGRFPTSAATNQYPAIGRYAAIVVGADGGRTPTTAEVTDGEIVLEGWGET
FT                   NGGNDDANVCVEFVGPAADA"
FT   CDS_pept        join(868658..868784,869007..869107,869284..870015)
FT                   /codon_start=1
FT                   /gene_family="HOG000207015" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632102"
FT                   /orf_name="MICPUN_90540"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO62662.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG297400"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000199AECC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E439"
FT                   /transl_table=1
FT                   /translation="MSAMTMASAVAVKAQRVGGVRRITAKLGGVQLNSKSVQMRRAGGR
FT                   KSMGVFAAGLDFAELEQAASVDEADEWTPPVRATRKDGKSAKEARQSKRFRKAQAAVPG
FT                   RMNPVEPSEAVKLMLANATAKFAETAECHIRLNIDPKYNDQQLRATVALPKGTGKTVRV
FT                   AVLTSGDNIAAAKAAGADFAGADDLVEEIAGGMMDFDLLIASPDMMPKAAKLGRALGPK
FT                   GLMPNPKAGTVTADVATAVGEFKGGKVEFRADKQGIVHVPFGKTNFKDADLITNLEAVV
FT                   DAINTNRPPGAKGIYWKSMYIASSMGPSVQVDYSVMQK"
FT   CDS_pept        join(complement(872241..872288),complement(871918..872156),
FT                   complement(870469..871786))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632103"
FT                   /orf_name="MICPUN_57898"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63043.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199AECD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E440"
FT                   /transl_table=1
FT                   /translation="MAAAAGRPEVCRDFLKTGCRGGVGGFQDPFFTRDPHRTTFLTQIA
FT                   TPRSPHPLQQGACFRDNCRYAHSSQDGSQPAAQANQPICRDFQNGRCFRASCRFYHGTA
FT                   AELAAAQAAAAVGVSAATFAALGGQQLLMPQVDGINALQRAMSLPVNVQRSGSFDGHNS
FT                   YDAQLLASLDPTTAAALLAANGNGFHSWNGTPNGVSSPLGGNTSAAAAAAALLAAAGGS
FT                   PSGAGNIASLLAIQSAQLQQQQNKANGADTTGQWVAIQQQLQQLQQQQQQQGNNGVPAP
FT                   GLLSRSLGDHSKLNGYINGNGHLNGHGNDHTNGGFDAARRASVDIGAMSTLANGAAKME
FT                   VFNSIINGRSSLDLGADLRHGVNGNGHTNGGYPINGNGNGHINGGYPINGNGSSNGLAN
FT                   GGSLSSTGGLWSFDGEGGSPLASRRTSFDPGSRRTSMGDVGVGRSRLSLDGIGGGYGGM
FT                   WSEDRSGVLNRGSPRQSLSLDILPEHVSNNNGIPAKLTSGLSVNGGTIGSSFGSGDESK
FT                   LPATLMEQPAKGNYSLF"
FT   CDS_pept        complement(873121..874056)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632104"
FT                   /orf_name="MICPUN_108109"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63044.1"
FT                   /db_xref="UniParc:UPI000199AECE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E441"
FT                   /transl_table=1
FT                   /translation="MSDTEYYTMEAERRPHAARRSTNLNPAPARTVPATVASVPVAETA
FT                   YFAMERARRPVAAVRSGVVVKQPTPVHIAFEANKLGAAAIDTAYGAMEASRRPSAALRA
FT                   GLRELDAPRHYVPIINYRDTACAAMEAKRRPRAMARLGSHRGSATPELSHPEMRGDATP
FT                   NNLHEQLSEFARWRAGAATDELARLKIEARQPEEVNPFDSLERALAVQLEQSKSRGNSL
FT                   RGATNFGRTSSSSSLTRNGSFGSSGNLQRRNTPMSPKSNLLPRPVKCGFDPSIGEVVCR
FT                   REDNGDVIFHGEADDVDAKLRSMGVANQEA"
FT   CDS_pept        join(complement(878234..878344),complement(876471..878147))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632105"
FT                   /orf_name="MICPUN_57902"
FT                   /product="Predicted protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63045.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG560733"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000199AF86"
FT                   /db_xref="UniProtKB/TrEMBL:C1E442"
FT                   /transl_table=1
FT                   /translation="MGQKREQTIEVEFTEADKECLVRLVKELVAKGAEGDKGDFKAWLK
FT                   ATQKGAMKTKLDPAKHEWSTLSDFVLHLVAGKGEGKWAPVARRHLGWSRWAQRRDEWTR
FT                   WQNDQNEHERPKTGPWSLVGRTASHANYEEQYAKLPSYNEHWARSKKQRPPRWCQEKGT
FT                   PPEMLGVDCEMCETDQDPRALVGVSVVNEKGIVLLKTLVKPPGKIVDYKTTITGLTAKD
FT                   FKGITTTLADVQAKLREFVKPQTILVGHGLVHDLRALKFDHLPVIDTAMLFSYKNLPRS
FT                   TPGLADLCKRLLDESMRAEGTHDSVEDAKMALELAKWEAKNGPTGELEPPEHKVDPKDL
FT                   VKLFVHRIPRGTDVDDIKGMFSKVNGTIGVDHVGSIVAVKGKFLGPKTKKDPASKAMTS
FT                   AYVEFESVEKCNMAFKSLRGANGTDALGLPQKSVKMVVGSEAKKPEKEKKKPTAKPTAS
FT                   NGDSGLPDDLSKMTVVKLKEELKSRGLDLKGLKADLVARLQAAIGTGDGGGFSSPDDDN
FT                   SDSDAPLASLAPKETMTVMVRKMAAHEGRAIGTKDKSAKDVASPGKRKPVDGEKPKRKV
FT                   GRPSRRARLAAKGIIEEPK"
FT   CDS_pept        878582..879790
FT                   /codon_start=1
FT                   /gene_family="HOG000019514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632106"
FT                   /orf_name="MICPUN_108110"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /function="carbohydrate transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62663.1"
FT                   /db_xref="GO:0015144"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560734"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="InterPro:IPR012435"
FT                   /db_xref="UniParc:UPI000199AF87"
FT                   /db_xref="UniProtKB/TrEMBL:C1E443"
FT                   /transl_table=1
FT                   /translation="MPLSADDLTGYTACLVSSFMFGSNFVPVKRVYTGDGMFFTLMMTA
FT                   AVFYEGCFIQLWQGNPKFEPVAMLGGALWATGNITVVPIVKTIGLGIGLLVWGLVSMLV
FT                   GWASGHFGIFGVEPDPPLGAPWLNYLGVALATASLGVYAKIKSQVAEGSGSSSGPPRGG
FT                   DGSGVRAPLLPESTPLVSDDGERGAGQDTSDVSRLSDVSLDSAPDEWGGAGPGRRARTS
FT                   ERQASSPSPPNDSARNRFAFGFTLSVVAGCFYGVNFNPPQHVIDEARRETSNPVHSRES
FT                   LDYVFSHFCGIFLATLVYFGVYCVIKRAKGQRPQMPNCVAPAMVSGLMWGAGEISWFVA
FT                   NSKLSFSVTFPIISSIPGVVGALWAVLVFGEIKGRDNYVLLVVSGVMRLFAVVLIALSK
FT                   NGL"
FT   CDS_pept        complement(879869..880147)
FT                   /codon_start=1
FT                   /gene_family="HOG000159261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632107"
FT                   /orf_name="MICPUN_57904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63046.1"
FT                   /db_xref="HOGENOM:HBG747145"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniParc:UPI000199AF88"
FT                   /db_xref="UniProtKB/TrEMBL:C1E444"
FT                   /transl_table=1
FT                   /translation="MSTLSRAQKVAQAASRIFGTHIGNGLQSGRKELRKNLAGPKIMSW
FT                   YQRPIGKDIDPLFVDPEVERRKLKIERLARRGKVTPKKGEGKRAKKK"
FT   CDS_pept        join(880349..880417,880532..880582,880728..880826,
FT                   880964..881023)
FT                   /codon_start=1
FT                   /gene_family="HOG000207495" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632108"
FT                   /orf_name="MICPUN_93989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62664.1"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI000199AF89"
FT                   /db_xref="UniProtKB/TrEMBL:C1E445"
FT                   /transl_table=1
FT                   /translation="MAEEEDKKGEDKGDHINLKVKDQDNSEVHFKVRQTTKFEKIFTAF
FT                   CSRKSLQPGAVRFLFDGQRINPTQTPQDLDMEDGDSIDAMMEQVGGC"
FT   CDS_pept        complement(881204..883960)
FT                   /codon_start=1
FT                   /gene_family="HOG000198099" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632109"
FT                   /orf_name="MICPUN_57906"
FT                   /product="Pre-mrna 3'-end processing protein "
FT                   /function="nucleic acid binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63047.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="UniParc:UPI000199AF8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E446"
FT                   /transl_table=1
FT                   /translation="MVEPLIEHRLLKRLRVAELKELLEQRGLSTEGIKDELVARLEEAR
FT                   SAEEGGGAEPAVGTPAAEGEDAPAVEAPVDEGAPADAAPAQVEEVLEASPTIDPAPTND
FT                   SEVFEPGDPAGAEGGEPGPAQEIMPDAADVDAVASEPVSLPSAAPLPPVSSAKLDRARA
FT                   RIQANRHDLDAWEVIFTDAQTRGVPEGRSLFEEVLAAHPTASRVWRAYAEAEIAGDTGG
FT                   NRDDEAVKAIFSRCLLSCPSAILWRSYTKYMEKTNDAATEEGVQAIKAAFEYTVDTVGE
FT                   DVESGPLWLDYVTFLKAADPAHVCPDAKAEQAESARMQEVRRAYQRAISVPTNSIDALY
FT                   REYDAFEHGISAALAKPLLAEVKPQVDVARAALKERKKLHDQLVVGGLAGPPGTSKDDK
FT                   SPDAQAKAWRAMIAWERSNPQKLAPNTEAGEMAHPQLVARVALAYDQALMSLWNFPDIW
FT                   LEFAAWQEIIDHEEAKAVLQRARDALPDCLLVHLAAADLVEARGDAAAAAAVYDAVLGE
FT                   YENKCAADAAAANTDGAEDFKYAHPPMDDATLLVSIEYMRCVRRMQGRDEARKAFMRVR
FT                   KAPGKRWETFVAAALLEWRYDKNDKVARNVFELGLKSFISQPAYVAQYADFLVGCNDVA
FT                   NARVLFERATAAAGEASAVAAGLGGTDKEGKSAAEKEFWDMFVAFEHAHGTMETMTGVE
FT                   RRRREAVRGPDAVDGAPELITALLGRHSIFNLKPASEEHMRHFARIGVDLAKPGSNPGA
FT                   ARAGGVPTPPPPPRLPPPPPSGRSKGVKSSGGAPSMTPLPPPDPMVTGVVNPRFAHLPR
FT                   ELGSFASRLPAVNLPSVAPSAVDAVMDTLINSDFTAEGGQAIVDAFNASLGGGGGGKKR
FT                   KAADAGVGAKAPARGAPLTAASQRPPAMDVFRMRQAVRPRTDQAEFS"
FT   CDS_pept        complement(884068..884958)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632110"
FT                   /orf_name="MICPUN_100080"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63048.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199AF8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E447"
FT                   /transl_table=1
FT                   /translation="MPSKYSAPKAQAMQAPKVKDQFDHLICNCCAGGTSTFVASVLCPC
FT                   AVLGSNAAMVQTGGRVEACTLLERQYVCCNEDHAGQKECQMHAGLIGGGCLAAALTYAL
FT                   APWPLNMIGNGVLVLGQVPTAIHGARQRRLIRKDLNITSSNMIIPGNFGDIVCHSFLHP
FT                   LALVQEHRELWDAKYKTKLVKKGYLDGPADKAPMTQEFEVRYDCSCAMCAARFDNMAQL
FT                   IEHLGGEHDVGQINRVLASGKGTVKCDRCRETFPTCAVMKDHECTGARPMRREPKEKKR
FT                   SAKLEDVEEGSGDDE"
FT   CDS_pept        complement(885177..886340)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632111"
FT                   /orf_name="MICPUN_108112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63049.1"
FT                   /db_xref="InterPro:IPR004877"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="UniParc:UPI000199AF8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E448"
FT                   /transl_table=1
FT                   /translation="MYYAAEQPTDDEMVPDRTIPGSWAINAAEYKPGARHTLVVTIPDP
FT                   GEFLITATAGIFRELGSHDDGRTNYGAGTGCGGARYNLRESWRTTLLVWTAPETAETVS
FT                   FKVTTATGKHGGFRNNAASFVANENLPPRGSTPAGAPPGPPASGSASVDGDEGMNGKFV
FT                   AHGWFMAAAWAVMIPFGIFSARYARSPPGAPPSRSDAVETIRRGWFKLHVWLNSIGLVL
FT                   ALIGGLLSYSAVEEELGDGMHLRSAHAYWGAATLLLGINQPLNAFTRPPAPGPGEDKSK
FT                   ERRRWEKVHRFLAWAALMLSIVAMDTGTEAAMNVWGAPKGGKAANSAYIAWVWMVLLAT
FT                   CIAEVFRWRERQRLGIPMWGDAEGRTMNRNFVELSEIEDEPERAGPR"
FT   CDS_pept        886771..888441
FT                   /codon_start=1
FT                   /gene_family="HOG000264806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632112"
FT                   /orf_name="MICPUN_52819"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62665.1"
FT                   /db_xref="HOGENOM:HBG560739"
FT                   /db_xref="UniParc:UPI000199AF8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E449"
FT                   /transl_table=1
FT                   /translation="MACMRHQVGGILATDAIGMHQRRYASRAASRPRVTTPGAAAIAAR
FT                   RVLSTPAKRRVAVVVEAKPDTVEAARARLDAIREEDELPVEDPGERGGFDMFSGGTYLP
FT                   EVLAIWESSNAFFFPRVILVGCTALGLAGSLPQSIGGLFRGDEDGVVVLLQNLLFFAIS
FT                   AGFTAVDVKQRRQALDRLQRELALGGMQVIQRDKFRNERVFPLESLRQAARVAVVYGDA
FT                   DKVARDLAAATPFRRRLEQSRILVVPVVERRAARDGEERSAVADVGPGRWELLKDVVLA
FT                   WPGAGAGRWLAWPTRNDAWAGYFRRLLANAGADATQGGYVTLGVTGQVRGSGVGSPTWD
FT                   VLLSTFPRNRPGNKADAEAEKAWKNATVDSTVGDLGAVTGDDAGRLKDIRGEGAARPIG
FT                   TTLELPTEGPAGEVLRVHNAFYDALGRGDEARMAEVWRPAVRVKGEGEENAIDRFVSRG
FT                   AVLDGWGTVLRPDRRPEGLKLSDVDVTVERDQATVTVLETVANGATLLATQSFEKVDGD
FT                   WVLKSHYTIPYGKDTVAKIALRCDERGCVAVPSKAVASQ"
FT   CDS_pept        complement(888502..889896)
FT                   /codon_start=1
FT                   /gene_family="HOG000223473" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632113"
FT                   /orf_name="MICPUN_57910"
FT                   /product="Predicted protein"
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="ACO63050.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="HOGENOM:HBG629929"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniParc:UPI000199AF8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E450"
FT                   /transl_table=1
FT                   /translation="MRAAARARSAVQRIVDRTSAWLHSHPFFLHSRPFSSSPSDDDERP
FT                   STSSAPNQTERRRRKGSTPIDPLTPPPPASEFPPYEPRDFFRYELIHQSKKSAARVGRI
FT                   HTPHGVIETPGYVAVGTNGALKAVPHQELAAAGLDLMFANTYHLLLQPGPDLVASAGGL
FT                   HEFIGRDAPIITDSGGFQVFSLAHAGEKDGEEMKSRRPSKHKDAAGLLVRLDEDGVLFK
FT                   SYRDGSRVVLTPESSVEAQKSLGADIIIPLDELPPYHIDRAVLERSVYLSHRWEARSLK
FT                   AHLRDVRQQAMYAVIHGGVDRDLRRMSVEYLTSLPFDGFAIGGSLGKDTAELVELLGHL
FT                   MPQLPKDRPNHLLGIGDVGSILGSIPHGVDTFDSTFPTRSARHGTLLTRTRGRLNIRRS
FT                   ENSTLHEPPCWECACRLCRHHTVSYLHHLDKAKEPMMWTLATEHNLHYMGWLMRTQREK
FT                   ILSDEV"
FT   CDS_pept        join(complement(890558..890653),complement(890022..890411))
FT                   /codon_start=1
FT                   /gene_family="HOG000232011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632114"
FT                   /orf_name="MICPUN_96336"
FT                   /product="Lactoylglutathione lyase "
FT                   /function="lyase activity"
FT                   /protein_id="ACO63051.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG704761"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI000199AF8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E451"
FT                   /transl_table=1
FT                   /translation="MAQKSVSSYLPSDTYNSLPKDGDLTFLHTMLRVNDLDATMDFFKA
FT                   LGLQETRRKESESGKFTLVFMASAPGAPEIELTYNWGGEDFAPPSRSMGHLAYATDDIY
FT                   ALCESLQAKGIVINRPPRDGKMAFVKSPDGISVELLQKGEPLESKEPWASMENVGSW"
FT   CDS_pept        join(891136..891234,891360..891504,891587..892377)
FT                   /codon_start=1
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632115"
FT                   /gene_name="RAD51A"
FT                   /orf_name="MICPUN_112646"
FT                   /product="Rad51 DNA recombinase 1 "
FT                   /function="ATP binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO62666.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG413235"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011941"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199AF90"
FT                   /db_xref="UniProtKB/TrEMBL:C1E452"
FT                   /transl_table=1
FT                   /translation="MADLAMEAPVEGDMQEWEEGMAAAGPLPLQTLEEHGVAASDIKKL
FT                   LEAGIHTVEGLAYASKKHLKDIKGLSEMKVEKLKMAATKVVPLGFTTASMVQAVRQDTI
FT                   MVTTGASKLDELLGGGFESGSLTEIYGEFRTGKTQLCHTLAVTCQLPLDQGGAEGKAMY
FT                   IDTEGTFRPQRLIAIAERFGMDPNAVLDNVAYAKAHNTEHQSELLVAAAGMMAEARFGV
FT                   IIVDSVTNLFRTEYEGRGELSARQMHLGKFLRHLTRLADEFGVAVVVTNQVVANPDGNA
FT                   MFAGANALKPIGGNIMAHASTTRIALRKGRGENRIAKIACSPVLPESEAQFSISELGIE
FT                   DAKD"
FT   CDS_pept        complement(892478..893488)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632116"
FT                   /orf_name="MICPUN_57913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63052.1"
FT                   /db_xref="HOGENOM:HBG560740"
FT                   /db_xref="UniParc:UPI000199AF91"
FT                   /db_xref="UniProtKB/TrEMBL:C1E453"
FT                   /transl_table=1
FT                   /translation="MAAVALAGSPVIAAPPALGTRRRSILSGRCVAPPRRATGDSGETS
FT                   PTLSEADAPVLSPEDLVKKQYEEKEAENFGDSILGGRSVVEGTEEETRDLVPFGANNLT
FT                   VLRATKLYADAIENGLDGDDVLCFALGVKSLDALAPAQRAYSEKVRVKLEENAQRLRGA
FT                   TLEAMRLYKTAVKAYAKGMYSDSIQWCDAALEETDPNSLMGGKIQIQKALGLDANGKED
FT                   DALEVYRGLQKHPEGFIKRQAEELKYILEAPKMEIAENEKPDVPLLRDSYGYSDKWSSR
FT                   GAGGGYRGEKRQKSLEEEYGGDFVPDVPTPQNPFITVAAGIVAAGIAWYSTTLVR"
FT   CDS_pept        join(complement(894015..894286),complement(893669..893801))
FT                   /codon_start=1
FT                   /gene_family="HOG000265896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632117"
FT                   /orf_name="MICPUN_57914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63053.1"
FT                   /db_xref="HOGENOM:HBG608657"
FT                   /db_xref="InterPro:IPR018788"
FT                   /db_xref="UniParc:UPI000199AF92"
FT                   /db_xref="UniProtKB/TrEMBL:C1E454"
FT                   /transl_table=1
FT                   /translation="MSVNTAHGAFTVDGVHTEVLVSDYSNRLMVVVTQIGKLGTIYHAA
FT                   DPGPGGVFEGDIPPEVRTLIGRYDDETLEAAARRLVQIVQSRGVNKPVLVSLGTVPNLD
FT                   LGTLRGVVRAAGDFATEALGLAVPRGAAAE"
FT   CDS_pept        894484..895554
FT                   /codon_start=1
FT                   /gene_family="HOG000265482" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632118"
FT                   /orf_name="MICPUN_57915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62667.1"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="UniParc:UPI000199AF93"
FT                   /db_xref="UniProtKB/TrEMBL:C1E455"
FT                   /transl_table=1
FT                   /translation="MPRFSKKVIGTVDAAGDDVNAYEAERAARIEENKRRMMALGILDT
FT                   ANALADAANAERVAARNARADAASANGGYNRRIERPAVKRRSGRLSGEVPKDYSAELDS
FT                   NGTNRDLWEPVYNEERYTLAHKEALGTSTKTWTLFVDGYDAKGNRIYDPVRGATCHQCR
FT                   QKTVCKHTSCGGCGELRGQFCGDCLWMRYGEHVDEANDAGDAWRCPSCRDLCNCSFCRQ
FT                   RKGLPPTGTLYRRAIKAGFASVAHYLVLNNMAGDDDCGENDDRESPARVPETPEKETEA
FT                   EAEAETQPERRSEEIHAAGPKTPESKPKERKRRHDPVATPRKRSRLLALECDVVASSVA
FT                   AAARPVEDEPGYSRRR"
FT   CDS_pept        complement(895645..896685)
FT                   /codon_start=1
FT                   /gene_family="HOG000265195" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632119"
FT                   /orf_name="MICPUN_57916"
FT                   /product="Predicted protein"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="ACO63054.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG560742"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI000199AF94"
FT                   /db_xref="UniProtKB/TrEMBL:C1E456"
FT                   /transl_table=1
FT                   /translation="MADERDPGAASGSATDHPARLRWAVNTERWSPSGDHEGAEFGFLL
FT                   SLLPRHEREECLKFVHMPDKKRALVSRLLQRAACARVTSAPHASIEIRRTKGRKPFLAS
FT                   PLPDPALAPNFNFNVSHEGDFVVLASEPVAVCGVDVAAPGQARRRRRDGRKPSIDEMLK
FT                   VFANVLTPNERAAVENAAGDDEAKEDVFRRHWSLKEALVKAMGVGLALELNRADFECED
FT                   EGAGVRRAGSAAPRGRLPGGVETATLRLDGEPKTRWRFFMQPLGVRESENGGGRHWVTV
FT                   SRGPFEDVTDANGEFSATWRRVDFTDEEWAEAVDAPSPPFSTITVSDLVPEHLRGDFEE
FT                   AGGDVY"
FT   CDS_pept        join(<897605..897676,897751..898713)
FT                   /codon_start=1
FT                   /gene_family="HOG000242272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632120"
FT                   /orf_name="MICPUN_80702"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62668.1"
FT                   /db_xref="HOGENOM:HBG596333"
FT                   /db_xref="InterPro:IPR007877"
FT                   /db_xref="UniParc:UPI000199AF95"
FT                   /db_xref="UniProtKB/TrEMBL:C1E457"
FT                   /transl_table=1
FT                   /translation="NRKAPRRDSGESSTTWRPAPPRPRNSLPARIRARTSDLRARRLWG
FT                   NPADDPNNTQRNLLVLTVGMKQKAGVDSIVRAFDLTQFTVVLFHYDGAVDGWDDLPWSE
FT                   DAIHVSAKKQSKWWFAKRFLHPDVVEPYDFVFLWDEDIDVVTDSFDASEYLRIARDNGL
FT                   HISQPALVSGRGAWPITSAVEGVEMHRRGVDWNGAPCPDAQGNPRDVPPCAAYVEIMVP
FT                   VFSRRSWRCVWTMIQNDLTHGWGLDLTWHRCAADPGGNLSAVDAMGVVDAQGVRHKAEP
FT                   TLKEQGEGGVGLDGADAVGRRRAAEWDAYNSRWKTPMLQELHEQLLEHDEQFAEHHEGE
FT                   SGTD"
FT   CDS_pept        complement(898778..899431)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632121"
FT                   /orf_name="MICPUN_108114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63055.1"
FT                   /db_xref="InterPro:IPR004911"
FT                   /db_xref="UniParc:UPI000199B03D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E458"
FT                   /transl_table=1
FT                   /translation="MPPAFVEELARDNSSAHNAFLQCFATGVLEAESRTGFGFAGGIGS
FT                   LDAAALSESCCESAMDSIPAFMGGRNATACEIQKMCVASDRGHELLKKTSRRLNRLHPK
FT                   HKWLPWVLVEGKPVCTHSCNLQKAIRRAVCELREGTLPDDCPRFPWSTIWYDEPGLSLA
FT                   GIIGVCIGFCVVVSSICILAQQAGFFDEKKKPKRRLEEEEASEKDPLIPPAEKV"
FT   CDS_pept        900762..901271
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632122"
FT                   /orf_name="MICPUN_57919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62669.1"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="UniParc:UPI000199B03E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E459"
FT                   /transl_table=1
FT                   /translation="MTSMTRASLVVFIATVTFMSWPPAVDACNCRVDCVMGTWGEWSAC
FT                   SCLGKRYRERVITTQAACGGTACGALTEWDNTCVAVCPPPPSPPPPPLQPLPPPPAELP
FT                   SPPAELPPPPAEFPPPPVEPSPPPIPPSKKSMPSQSSGDVSHSSWAPVGAALATSLSLL
FT                   AALFPG"
FT   CDS_pept        complement(901414..908295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632123"
FT                   /orf_name="MICPUN_57920"
FT                   /product="Membrane protein"
FT                   /protein_id="ACO63056.1"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199B03F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E460"
FT                   /transl_table=1
FT                   /translation="MSNAAEISNRGGRTLPRQPSTMSVESLPSRRGSFASVASSDGMSD
FT                   ASGLSRGNPGLGGADDPALTPTSPSGTDRRMNRRVTRASNGSHHGLGGPRRMVFLNKPK
FT                   ELSHGRLAFISEIFKIKGTIVLKVVPQIILAAFVGLFANLVKVLYCGEGVASNDECDVT
FT                   FNMDGHLGVSVVLSFLLVFRADLAYERYYQGKSALGAIHTGIRNLNVATATFLRAHPPL
FT                   SRDKGGKKSVINRRKWAAKNATRATALARDRMELFRLTNLLYAFVRQAVRAQRHGYSDV
FT                   GPVTDDELMTRDRGGKPRVPDIVKDKIELDEFKTLEPWNRPNVCVSKITAIIEHHRRVG
FT                   NLGERAALDVFRDCQLVLDALKSAERIVTTPIPYQYLHMLNILLFFFVYSVPFVFTANF
FT                   KWITPFPSCVVALAFYGVNEIGRCMEDPYSWEDPCHDLSGVGWRIYTETLQIHQKADEV
FT                   HREAEDVHEETNASESRVTDSSELEARARLSTSEQIQRALAAAPVADAALHANALEEAC
FT                   ALEDENVAAGEMPTPSTPASPAPKRNRASSAASITGPFTSIAAAARTAIKQNVGGNIDE
FT                   EDDEDDALTADPSIVPKELSTHWSGFLTEIFVFKNTVMPSLLPQIALAFFLGIFAQMFK
FT                   RVMCGADVVAAAECQTTFDITGHQVVSVSLGFLLVFRTDWAYDRYYEGKQSLGQLYNGL
FT                   RNLNVCFVNYLRENKPGERAAFEASGSSNLEGWGDAGPHLTDSPSRAPRESFQSTIAKI
FT                   TEDRAELLRLTNVLYATMRHILRDIRVGAPDGGEVTDEDCVKVDATGKPPLPDLLREGE
FT                   SERLLALMPSNRCNWIAMRIQIITETHRRLGNISERAAFEIYQQLEICLSAYKAMERIV
FT                   STPIPFTYLHMLQFILFFFVFSAPFVFTTTFHWIGYVPSVIVAIGFYGINEMGKLIQDP
FT                   FNWQQPCHDLSGLGLRIYRENLKIHEHAEQFDPKAEKEMSKRRASYQTLMDALQRHDSE
FT                   TGEGMKRNSSITSIGSTGSNSVATSGEVDGKRRKTGTPSVSKTKGASEKYGEELSIGPF
FT                   TFITILFRYRGTVLPKIMPQTLLAAAVSIFAQIIKIYWCGANITSHSECPLAFSETAHS
FT                   VAGGIIGFMLVFRTSISYYRFYEGKKYLGHLYDCIRNANIAFNSFLRVGNDEQGHDAKI
FT                   NADKVELRRLSNVLYAFIRQAVREHRHGYPEGCPAPSDDAGLVRDDVFGRPGLGVLLTD
FT                   EEKEEFLAIDPNNRANMVVWRMQSIVEHHRRLGHVCERGAFDIYHDLEGCLEAFKHMER
FT                   IVSTKMPFQYLHMVNFLLFIFVFSAPFVFTTGFKWLSPIPSCIVAISFYGVAEVARSIE
FT                   DPYSWTKPCHDLTGTGWRLYSESLQLHEASVASVDATLAKDRSKTRDDEVSLDDVRLEG
FT                   GESVVRVSMEPRSSVRASVAHGAADIALLSSKRPDETTRIEDSVKRGAANGGPDDASSV
FT                   STRLWEANPSQPELSDAWHGFITDIFRFKKTVYGEIIPQVLLAFVIGWVAQLVKLWRCG
FT                   GQVQEAFECPVTFAPYAHSVIGSVLAFMIVYRFKFAYDRYYEAKSAIGELHCGLRNFNI
FT                   GVCAFLRDAREGEPGYNRKDVKGVRERCALFMNERTELLRLSGLLFGFIRHVLREQRLG
FT                   YLDDPNPGDKQLLLQDKCGMPCVGSLMRDAQEVAEFSSIPFQNRANTVVTRIQSIVEHH
FT                   RRLGHVCERAAFDLYRECELVLASLKSCERVVTTPIPFQYLQMSNFVTFFFTYSAPFIF
FT                   TVSYQYISFFPACLLAMAFYGINSVGEVIERPFNWREPNHDLTGVGLRVWRECVQIHRR
FT                   CASRDAETLSAHGITDMADGEAFVALEDLARRAAERPNVENVLAASKDLRRNFRSRRAS
FT                   AVVMANELASREYPRHTFSFLTGLFDGSNETLWRVVPQVLMAAAIGAVANLLKVRLCGA
FT                   DVKLSSECSVTFHTEAHAICGAIIGFLLVFCANIAYLRYYEARSAVGDIYHGLRNMNIE
FT                   FASFLRAPTAGEPGHQPGNPADAAATIKDDQLELRRLSNVLFAFIRQALREHRHGYRFD
FT                   SRSRRGLGEDGADEGKPGFLRRIFKSSKAASFGGGTGPVSEASLLEEDLCGEPSLATLL
FT                   TPEERRRYADVPVGNRFNVCVAEIQRIVARNQREGDLYEKAAYDVYKECDRVLAAFKTC
FT                   ERIVTTPIPYQYVHMVNLVLFFFVFSAPLVFTVTFKRLTPLPSGILALGFYGIWEVGRS
FT                   MMDPFDWMEPCVNLTAIGRRISTEAQRITDAGRRRHSVISGSSERVGSAAGMIARRKPT
FT                   GYFGTR"
FT   CDS_pept        complement(908601..908903)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632124"
FT                   /orf_name="MICPUN_57921"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63057.1"
FT                   /db_xref="UniParc:UPI000199B040"
FT                   /db_xref="UniProtKB/TrEMBL:C1E461"
FT                   /transl_table=1
FT                   /translation="MSFSVALRNLWDFLSISFHLARTSGSFAAASVMLLVIALLDACQN
FT                   MMAKQSPIVATTQEAIAQYSTLMRSGLGAGCPRLYGFRSGCFSIILRSLAPELCD"
FT   CDS_pept        complement(909082..910566)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632125"
FT                   /orf_name="MICPUN_57922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63058.1"
FT                   /db_xref="UniParc:UPI000199B041"
FT                   /db_xref="UniProtKB/TrEMBL:C1E462"
FT                   /transl_table=1
FT                   /translation="MAGQEPGAAAPQGRGFRIYARQAGEGLRARPRLRAVTLGPVALVV
FT                   LLLLAWSSANEGGAVQRREARGVTVEDSRVQNAEPVKATPAQVVKAVVQPDDGGFVPFA
FT                   RRKRPGARVKSKSNNEAANEATEQTGPVTGVEGEDEEGVRRSSRNEPIVVKAEDVERAR
FT                   AESEARERAIAEASERRKERGEKSPAKLSEEKTATAYSNPNVVIDSKHDHLFEDDDDQT
FT                   GSGSGEPKTTQPKKKTDEPKKEMDQPKNGGRVGFYLQMANEPKATLELIRSVRVHFPDA
FT                   PLSVTSDAGSYDCSAACETYGCVFTREDTTAGMHGGGGVMEYVRRLKRAAESAETEWIV
FT                   LLEDDVRVERGVTRWPKEGIDGGGVQDWRWTAPLSKELLAEIARRNGGRAPSYKNYGLC
FT                   GGAIVRASALASLPDDLPEEEMRSLQKMDDRFGMWNDVTLSALLMLGGHALEPWDDVKQ
FT                   GNHPAHATAFVHNDKRWYGVRMDAEDKKLCKPQDKV"
FT   CDS_pept        complement(910733..912307)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632126"
FT                   /orf_name="MICPUN_57923"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO63059.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000199B042"
FT                   /db_xref="UniProtKB/TrEMBL:C1E463"
FT                   /transl_table=1
FT                   /translation="MRGVPGAPSFLSPLSWTHAGDALHELSAVSERRSSVSGAGTTDDH
FT                   RSSRMRAIARVKARPPKFLTAVRRLLRGAPSLCPTYSANPLLMDAEAQGVGTADGVCEP
FT                   CDEDTRELARRWARDATALSDWKSLPPQLDVAHPEGGGVPRARGARKREQLRNVFLFVA
FT                   PLLRRKPTAKVVDFGCGGGHQTLPLAYHFPDATFVLVDAKARSLEVAERRAAAAGLRNV
FT                   RCVLGFIEDFDEDFDVGVALHACGGASDAAMDKCVEVNAAYVVAPCCVGKIARETGGGD
FT                   KNKNKNKNANPIDDRAVDDAGEGRAAAAPYPRSALAASVVTTAAYVSIAQAADFGGEGY
FT                   DACGAVSGGPGPYVDSSEEDEDDERDASGFLASIGEDAAVAGDDAGRIPGSIGGGAIAP
FT                   MEALERRAETNPTPGLAAYLRAKAEKRERRKNRAPRSNPSMFAERETQRRACKAVVEAD
FT                   RNASAAERGYNTWQVLMEPPGCTPKNDVLVGIPSTDSDCAAEFGTALRRRGTRPAEAFF
FT                   RSVLDEE"
FT   CDS_pept        912539..914500
FT                   /codon_start=1
FT                   /gene_family="HOG000201405" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632127"
FT                   /orf_name="MICPUN_113599"
FT                   /product="Cleft lip and palate transmembrane protein 1 "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62670.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560750"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniParc:UPI000199B043"
FT                   /db_xref="UniProtKB/TrEMBL:C1E464"
FT                   /transl_table=1
FT                   /translation="MIVERAASVAQYAFLAYLGLLSVVLYGLFVPSQCSASMNPQHCLP
FT                   PVLARGEAFDLWVYASPKRHFHSIESVVTGREEVEPEVANATARLVMSAFDVKLGDAHE
FT                   EEVTVPAAAFGTRANGTLYAHVLMYRSRGKARSQNATRPSGEPLAVTSAPITKHLVHTR
FT                   KNYSMLLGDWTSAAAGDANASTSQLGEDTSSAATCDARGDGEPDGDAPREEGSCAAPTT
FT                   ADASDASTDAVPVASHRLDDGAFVTHIRPRLSVFVVGSPPTFPRSQPPPDISLHPVHAP
FT                   RELAARGYRVAYRPLVAVDEFTITRREYAVMDPNPSRADPTMVVNVRPLNIGLFRMMSQ
FT                   MKHSMEMMQNSFGMTESDLDELKEMFTGTSAKMLALTFGVSILHSWFAFLAFKNDIGFW
FT                   KKKSNLEGLSVRTQWSNFVCQLIIFANLVDGGQSSWIILGEMGVSVCIEGWKVTKFLAR
FT                   DGVFHRFLGIGTEAADKSQMQKDTDEYDKRAMRFLSLLLYPIVLAYGGYSLVYHPQRSW
FT                   RSWVLRTLANGVYMFGFIAMTPQLYINYRLKSVAHLPWKAFMYKAFNTFIDDVFAFAIA
FT                   MPTIHRLACLRDDLVFFVYLYQRWLYPVDKKRVNEFGRAYEDDENGEEKKEHGKDNGKE
FT                   AAKEEATERKGEEDKKND"
FT   CDS_pept        join(complement(916118..916191),complement(914537..915968))
FT                   /codon_start=1
FT                   /gene_family="HOG000265187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632128"
FT                   /orf_name="MICPUN_113598"
FT                   /product="mRNA cap enzyme"
FT                   /protein_id="ACO63060.1"
FT                   /db_xref="HOGENOM:HBG412036"
FT                   /db_xref="UniParc:UPI000199B044"
FT                   /db_xref="UniProtKB/TrEMBL:C1E465"
FT                   /transl_table=1
FT                   /translation="MSGRLPPRRDSVKASRLSTQLQKRRDAARQRQRDARRDLTDHARS
FT                   LAFGAEDSGSEAGATRAVGDQDAMHRSSSNPQELALEHPGTSSTEAWLDVAQMGRESHH
FT                   ERSPRHRRSSSAPGKWSRESVARFSESQFMLPEWMVDVPPDLGHAWFATPRPKGQRVLV
FT                   ISSRGCTVSRLKNGRVLHRFPSALPGGSQRTKHGKAEDSFCILDCVFHQEDGVYYVMDC
FT                   MAWNGMSMYDCTAEMRLSWLYSKLGDPETAECEAATGTGPNNRYRFAVPPTHNCDASGL
FT                   RAAYGSPVPFRRDGIQFLAKDGNYELGVTPLAVMWKDPNTSDFFLDENPDGSDTQRVVL
FT                   SLQSATGDVVTGDPTPIALARLPAQFLESAGRAAESAPAGGDSIGRDGTWRGNGGLRDG
FT                   LLLRFAVGKGGLQIQDGLPVAADLVYEGIANQRRGGADTMTKILFQYYARREPITIEEI
FT                   GMAVETQAREAAMAASSGSSASSVSIARSSQSFSGIPNGLFDF"
FT   CDS_pept        916540..918009
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632129"
FT                   /orf_name="MICPUN_57926"
FT                   /product="Antibiotic biosynthesis monooxygenase "
FT                   /function="monooxygenase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62671.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199B045"
FT                   /db_xref="UniProtKB/TrEMBL:C1E466"
FT                   /transl_table=1
FT                   /translation="MPTMQMSGEVVISVNAIVAPGREQEFLHVMSTAASESRMEPGCVC
FT                   FHVSKLPGERAYMFYEVYQNDAAVEFHKGTPHYQAWNKFRETGGIQSLNAQVCDGVFIA
FT                   PDAYTAYAEQEQELRAHAHMHSPDHDGHETRFDRVEDTSSPQRFSGAPKGFSHPRGLAE
FT                   KPTRPGCISNFGHGGVRHSKKASPKVAAAEATLRFYEGGLAAEHGEVVYGHKDVQGLPP
FT                   NKGRARVSEHDGAQPAYQGGSFNMNPAAPSSSPGASPGGKAMHQDWKMKSRHDLLCPKP
FT                   LPPAKHLLPPNQPWAAQNQKSVFDGGMTANAQDEPRRMRHLPEKEWANQSYKSDFKAGE
FT                   GTDPGPEKTPDPDVPWANAEKQSHMGFVDGTLSAAGGPVSYGHPSTMGATENQGRRVNK
FT                   EMRDMMQKSYYKGAGMAPPPPVMEKREMDPRPWANQHYSKNSFGNGMAPPDEDPKPTPP
FT                   KPAAQPWADDREAEPRAGVPRRMGGLRGYSK"
FT   CDS_pept        join(complement(919550..920794),complement(918762..919316),
FT                   complement(918080..918514))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632130"
FT                   /orf_name="MICPUN_57927"
FT                   /product="MraW methylase/RNA recognition motif protein "
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63061.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B046"
FT                   /db_xref="UniProtKB/TrEMBL:C1E467"
FT                   /transl_table=1
FT                   /translation="MGEKRRADDGSGSDKKPKSSKKEKKEKKEKNDLDPDEAAAKAERK
FT                   AAKKAKRDESGGGGGGGEDDGEDAIETVEVECKGQTGRIIGKGGSKIREIEDLTGCILS
FT                   IDQAKGICTIRGPTVAPAVQEVKNIVQEGRERDELAHAPAPPRARSQSQGWDDAAHDRR
FT                   PSEPAGVSTPDELPFGKPPAGSASRNDTGQNDWQCPCGSTNFARRSSCFRCRAPRVDDA
FT                   TCNPAGGNAPVSVGRSHERTTGPASAARTEAGAAARAPAQGSDANGYEVFVKYLPHTSE
FT                   EHEVADFFSQFGEILGGVRLIRNPTTGQCKGAGFVTFAHEHARQAALAKDGIKFGGRHL
FT                   SITVAKTGTFGVRATEQAFGTHTPAMLRETIAALVKPDPNGTYVDGTFGRGGHTRGILA
FT                   ALGPNGRLHAFDMDPEAIKEAKKLEAEDSRFTIHHAPFGCMDTVLKPLGVTCSGVFLDL
FT                   GISSPQFDDESRGFRPEQDGPLDLRFDVTQGVPASEFLERVDRDELVRILHEYGETADP
FT                   VAARRIADAVCLAVAEERLPSTTKAFAALVAAAKGKEYQAMHPAKLTFQALRIHLNQEF
FT                   DEMRRGMRAAAEVMIDGGRLGVLTWKHSECAILVDFHRHFEVVQPTQPLLKWMRSNHPE
FT                   KENALPTVWGLTMDDAQRPSEREMRDNSRSRSAILHVLRKVDAGRRLADVERAAYPLLG
FT                   WAPPPDAPKPPPVTFKYEAATAGRDEHRKEKKEKKEKKEKKEKKEKKEKK"
FT   CDS_pept        complement(920912..921811)
FT                   /codon_start=1
FT                   /gene_family="HOG000006073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632131"
FT                   /orf_name="MICPUN_57928"
FT                   /product="DnaJ domain protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO63062.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B0FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E468"
FT                   /transl_table=1
FT                   /translation="MASVVTAGSGFLRPAVAMRRSRVKGRSAGDDTGSPLQDLTSPSLT
FT                   PWEVLGIDVATNQEVSIADVRRAYRARMKVYHPDVYAGDATDKEANARRVVAAYAAVAR
FT                   ESGLLDSGDSARAVDWDANSNSEVFPWAREDADPFEEPEGPAQSVFVNEFACRGRGACP
FT                   GYCCCVERNPGSFAWAEDTNAARFRVDAETWGDLNRRAMSTGASDAVKEDADIAAHRLN
FT                   LAVGQCPEAAIHWVTPRQRTVLEGLVADAVDGTSAPNEAGARVYELLAKAKWENGRAAA
FT                   PAASKRRAKASTRWVDWY"
FT   CDS_pept        921934..923097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632132"
FT                   /orf_name="MICPUN_105453"
FT                   /product="Metallopeptidase"
FT                   /protein_id="ACO62672.1"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000199B0FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E469"
FT                   /transl_table=1
FT                   /translation="MADELSVRVTHRGREYVVRVPADASVADLGIELERATGASVATQK
FT                   VLGLKLAKFLKGGTLTPSRAEDAALAVNAVPGLCDSIKPYMLMGSAASEVAALDAAAQV
FT                   DHRVRGFVQEDLRNRRRRRGHVSRTAGGGRSSDVGPPSTATHPYTFLEYRALPVPEFVN
FT                   PPASAALKLLHRLAADPGILGVMAKHKWTVPLLAEMPPEGKVGVSESCVLGYNVNMGQE
FT                   IHLRLRTDDMRGFRVYARIRETLLHELTHNVHGPHDINFKRLCSQLNVECREFDWKRNG
FT                   AGAQKLGGTADESDEETWSEDEAMAATRASSGQALGGGGWVRANLSPAEAAAAAAAARA
FT                   ADAAEREMETMARDALDRADAGMACLCGACGAGPFKLPPPCSTDQDA"
FT   CDS_pept        join(complement(923422..925654),complement(923199..923212))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632133"
FT                   /orf_name="MICPUN_100095"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63063.1"
FT                   /db_xref="UniParc:UPI000199B100"
FT                   /db_xref="UniProtKB/TrEMBL:C1E470"
FT                   /transl_table=1
FT                   /translation="MSTAKRDALEPLNHATGRFTKAGESEIDRRTTAVMAHAQLKGALE
FT                   TLCPAPDALKDEMDVIDPKRLADLGMTPEHAIGLYRALYKYSQKCVESHDRVRAAMAPV
FT                   GPEAKQDVLDGVWSIFTTTWESAAGAAFPSKIADATKALDSVDRLAAALAQLQTECADR
FT                   MKETEQAKAESAERMEEIVVLRPFPGKYEECVKRAEVAETERDDLRSRVEALEQKLAAA
FT                   EAEIPKGWEAEKAAVAAGEARASELTAAAKAAAETAAANVDKLKKDHADEVQELMDQLW
FT                   KARNEAGAAIEAEKDMRAITGTLKADIAFHRESKAGATEKMVKAIERAEAAEGEMQRLQ
FT                   GIADRATAACDEAERRADASDKFAAKESARAANTTARLVITVSQLLRAKKRIAALESTS
FT                   EKQALSQALSRAESAEEERDQMKLRADATDEKSKEQKERINELETQVIQAQTAQKAAET
FT                   KQAELQASNDELAEAKTKLEEELATARQEKADAIQALEDYKKEFLVEQKARLKAEKNMR
FT                   EMRDENRRIISEVGDGDMEKLVTKVDSVGAKAKEGLEKQDKNWEGINAFAGEFVDEQST
FT                   KMDAVKKEFKVWSDEISELTDKCAKKTKEAVDELIATRKKMRKLQQQLKETKEELGNVK
FT                   TELATANRELKEAKKDLAETKSDLETATGRVTALEEQLAFASNELEATKSTLVDIEAQL
FT                   KKERSERLALQFQNQAQKALAEKRQKKLEDAERDLEEAQEELESAKKAASEAGG"
FT   CDS_pept        join(926105..926803,927168..927485)
FT                   /codon_start=1
FT                   /gene_family="HOG000218799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632134"
FT                   /orf_name="MICPUN_57931"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62673.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG714057"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199B101"
FT                   /db_xref="UniProtKB/TrEMBL:C1E471"
FT                   /transl_table=1
FT                   /translation="MATSQCFRALVRHAIGASAAGRPVASRATRPVSSGGTLRYHDRGF
FT                   HRINPQQPRRHHPWSRGARHLATSAAGYEERITSTDNATVKHFAKLVRNRGYREECGSI
FT                   VVAGSGILSEVCGGGGGDAVGSARVLFLADDACVPAGVTASRIVRAPEHVLKKAAGLQS
FT                   VDRVDAVAELSMPPVVGVAALEGAGRITRLLALDGIQDPGNLGTLVRTALALGWDAVAL
FT                   LPGTCDPYNDKALRAARGGVFRMPMARLTWEELEEVTRRDGLQRFCAEPTADATAADTA
FT                   ATGSKGLCLVLGSEGQGLSDVALRTCEPVAIPMPGEMESLNVAVAGGILLYLMRRGS"
FT   CDS_pept        928519..929184
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632135"
FT                   /orf_name="MICPUN_57933"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62674.1"
FT                   /db_xref="UniParc:UPI000199B102"
FT                   /db_xref="UniProtKB/TrEMBL:C1E472"
FT                   /transl_table=1
FT                   /translation="MNEVNPPQFIPPEGRDAATGAVSLPFEARGMTAYSSCLRGCCWSS
FT                   RDLYPFGPERLEETSVRRTAQVPESLRALGIDQHEYGAMLEDAKSGLANAAPPIGLCCA
FT                   GACIFTFVLAPFSMCYLLHLSSPSLSDKLIERGANRVEKAISARASRWRAVYGVETKLV
FT                   RDVRYKRPRMPAGDILLSRAEARSPHMSPHDGCWESSEWVGSALTFTPPSAASMQRGS"
FT   CDS_pept        complement(929267..930349)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632136"
FT                   /orf_name="MICPUN_57934"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63064.1"
FT                   /db_xref="UniParc:UPI000199B103"
FT                   /db_xref="UniProtKB/TrEMBL:C1E473"
FT                   /transl_table=1
FT                   /translation="MALTVELLRARIPFIASAVFLVFALSEHLRFTSVTSVTSVTEKLK
FT                   TERCQAPLLTSVVDYDLDSASQETLRMLDNYFTTLRAHSKIEFVALASSEERCERVKQR
FT                   WGEACRVFHLGEYRWTKQLIGREILAMLRESRRPVVLVDTDMRVGLDPEPLLAKLSCDF
FT                   GVDFAGGGEAKWNINTGFLFFAPTPVAESIATCVVDWIDLVRSDVDGAFKKYVLDTVPE
FT                   DARIEGKSDVRRADATAMSFEQDVVKDCARNAVTNETEMRFSVHIARKRVAGTADFAED
FT                   VHLDVPPPGGGIGWYDGSKCNPVVRAAGEIRCATTHDKQGMLAVVRLPIYHSQMAMRAD
FT                   EHAAFRHCIGKEPACLYEGN"
FT   CDS_pept        complement(930495..932696)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632137"
FT                   /orf_name="MICPUN_57935"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63065.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B104"
FT                   /db_xref="UniProtKB/TrEMBL:C1E474"
FT                   /transl_table=1
FT                   /translation="MAVSSSDMAAPDGNNVDAAPARPVDGALGLTAMRALAKFKTGASA
FT                   ESRESKRSVGAQLRAELPPGHLPDKEPVSMAKRLSRAMAKDGMTAGDRKRRAERLAELQ
FT                   ADIDAQSEAEDRAAREAQEAKTKAVAAELEDLRAQVAALTAAKQREAEAKAAAEARAAQ
FT                   EASRAEAEARAAQEAARAEMEARAAEEAARAEAVARASAAAEAKLRAEAEAVARLRVEV
FT                   EAKIRAEAEAKGRAEAEARAAAEARAAAAAARTEAEALAKAEAAAEKARAEAAAEKARA
FT                   EAAAEALRAEVAARAAAEAKAAEQAKAAEQAKAAELARAAELARAAELAKAAELAKAAE
FT                   EEAARDAANAEAEVEVDETPPTPPQESPPPSPAQNKDANEEDLSDDDDELPLHAALEHG
FT                   ARYELIVRILQADPEGASIFDARGELPLHVALRRNAPAEVIESLLDFHPVAITTNAPDG
FT                   REPMRMALDYADRDDETAVVAVLNRTLREVGGVSHVHAVEEVAVEEVAVDPPLVGDGAN
FT                   RDETEEKVDGSVKVAAASPDPVGFRTPPSSRCLRESFDSAMRSGKAKESADATEDDGKM
FT                   KQKKQKKRFGKRFLAGVGKGLRELAVASSAVVVGAALTKLATREMRKPRVVRKWTGALF
FT                   AAKGGGGKDEADATPADFVEGWKPWFLQTIEPSRFDYDLEYVDDDDELFEEEPSGLLIP
FT                   VYEYEEENDYGYGYEEEYVYEEETPSGLLIPVHVGDDYY"
FT   CDS_pept        join(933113..934461,934555..935222,935934..936829,
FT                   936908..>937105)
FT                   /codon_start=1
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632138"
FT                   /orf_name="MICPUN_80976"
FT                   /product="Predicted protein"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="ACO62675.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG378897"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI000199B105"
FT                   /db_xref="UniProtKB/TrEMBL:C1E475"
FT                   /transl_table=1
FT                   /translation="MPLRYRKVTVGVCAMDKKAKSKAMLEILNRLEDFPEFEIITFGDD
FT                   CILNQPIEQWPKVDALISFFSDRFPLAKVQAYAQLRKPFVVNDLDKQWDLLDRRKVYRT
FT                   LAENDIPVPNHIVINRNEEVKPGVMPDWSRDFEAPGFEEHEDYVELDGKRIDKPFVEKP
FT                   ADAENHNICIYYPHTVGGGYKALFRKVGNQASRYYPPPAPDSSKPYTPVRRDTSFIYED
FT                   FMSTGGTDVKVYTVGPNYAHAEARKSPVVDGRVQRDENGKEERFPVLLTPDEKEIARRV
FT                   CLAFGQTVCGFDLLRTKGRSYVCDVNGWSFVKNSTKYFDDASVCLRAIILQAVAPEHKA
FT                   TMEATEAADQTTTEDDPNAEAMQQQPDESPAEQKKKGKKGQPEPPKEELRAVLAVIRHG
FT                   DRTPKQKMKMRVKHEPLLQLLKKCTGDRPRKQAKLKTPARLQELLNISRVLDSPPLAQP
FT                   RSSCGSKEEWEEEVEQWKQVVSILQEGGHFSGINRKAQLKPLAWEEIPEDQRKPTKDGK
FT                   EGPTERVTQALLILKFGGVLTHLGKNQAEFLGRDFRMRMYPGGDPNSDGLLRLHSTYRH
FT                   DLKIYSSDEGRVQITAAAFIKGLLDLETENNQLTPILASLVNKDAKLLDFVTHEVEEDI
FT                   LHAKQKLYNIMTDGHVKGKNKNKEYSTSDTATYDDFELSRRPPGVPEEPLKLLRLMIDL
FT                   IQGLTRQLREKCFRTNVPTHMGSPTTTTWVDTLAATAPRGSMPKGGLAELKDGSVPAGG
FT                   ESFLLMHARWKKLEQDIYHPRKGRYDISKVPDVYDAAKYDAIHNSHLLLDGLEELYRIS
FT                   KRLAEGVVPNEYGTHAHSKLRIGGTIAHSLLVKLLQDMFTTRQESFNIGKPESYNNSGG
FT                   KTTDGETTDAEKGESSLRRDPSGDPSNGDTLDNEEEEEDEDEKAIKEEEETELSTTRLN
FT                   HRYANTVGVHSPHRHVRTRLYFTSESHIHSLLNVLKYCNLEAFTKTNPPSLVSHRLETL
FT                   GGIGDLDYLTHIVFRMYECFDVPAEDPNRFRIEILLSTGIGLDPFKQN"
FT   CDS_pept        join(complement(938925..939003),complement(938721..938773),
FT                   complement(937755..938396))
FT                   /codon_start=1
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632139"
FT                   /orf_name="MICPUN_93991"
FT                   /product="Predicted protein"
FT                   /function="protein domain specific binding"
FT                   /protein_id="ACO63066.1"
FT                   /db_xref="GO:0019904"
FT                   /db_xref="HOGENOM:HBG611720"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="UniParc:UPI000199B106"
FT                   /db_xref="UniProtKB/TrEMBL:C1E476"
FT                   /transl_table=1
FT                   /translation="MSDGSLSERERLVYSAKLAEQAERYDEMVESMKALCKLDSGELSI
FT                   EERNLLSVGYKNVIGARRASWRILSSIEDKERAKSNEANSGQIKTYRSKVENELTSICE
FT                   EILAILDNHLIVDSASDESKVFYYKMKGDYYRYLAEFLQQEDRSKVAGQANDAYAEATK
FT                   IACNSAPDAGLPPTHPIRLGLALNYSVFHFEIQNKPTEACALAKQAFDDAIAELDTLSE
FT                   ESYKDSTLIMQLLRDNLTLWTSDINDTEEGGEGDQ"
FT   CDS_pept        complement(939233..940432)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632140"
FT                   /orf_name="MICPUN_57938"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63067.1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000199B107"
FT                   /db_xref="UniProtKB/TrEMBL:C1E477"
FT                   /transl_table=1
FT                   /translation="MSANGDVLRERFLATPLVTRHLMASTWIVCLLNPIFGVDDLLVAS
FT                   PYDIIRKGQLWRLVTSIAYVPGLINALIMSFVLYRLGSAWEQERGSIRILCYFLLAIVA
FT                   TNVGVCVLAILVAPLAPSVMSPAFLCGPGILSAFLVLITRSSQGYAGASVSILGLFTMP
FT                   TLYFPLLLLVFFAMFGANPLESAASVGVGYAWARGYLDPVVPSDETLAAMEQWPAAAGL
FT                   VRARGYVSVAAAGPTLPSTSASAGVVNVAGGTQPGRDSVNDLIAQLRDHAFAGGARSRG
FT                   ARDGVGAGGAGRRLGGEPAGSAAAGVGTGPAAAAAASRAPGPPPSRQQLPASVSSPGSS
FT                   GASAAARAHGPSAPGGGGSAAQAQAAAVAREPTREERAEAFARAHEKRLREQRAEQSAG
FT                   "
FT   CDS_pept        join(complement(942103..943437),complement(940806..941300))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632141"
FT                   /orf_name="MICPUN_105456"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63068.1"
FT                   /db_xref="HOGENOM:HBG318530"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199B108"
FT                   /db_xref="UniProtKB/TrEMBL:C1E478"
FT                   /transl_table=1
FT                   /translation="MADDDERSIRLYALDLSSRASTPTSSLTLTTEFAVNAGRAGASTS
FT                   AHDSIPHDNHLKGARWSPDGVCLLTCGAEDNTYRVYDIPANLDDVPPASDEPIGPHGLP
FT                   ADRLWPALRIKERESVYDYAWYPGMTANDPGTCVFASTARSQPVHLWDAVTGSARASYV
FT                   AHDHLDEPIAALSVAFASDGRRLLAGYKNAIRAWDLSRPGRDCDVYRTLEPKRRQRGGG
FT                   AGGGERVGQAGLVSCIATAPAKTNGLFAAGSYGEPGVGVYHEPTGEQALVLSGGHRRGG
FT                   VTHLAWSPCGNYLYTGARRDGEILCWDVRNPDVGCVYRMRRAAEGTNQRVGFDVECSGR
FT                   HLVSGGTDGCLRAYDLRTGEEVGAWRASADTVSDWAFHPGSSFAAGDGGNARGWTAPRG
FT                   ASASGHRHFRSPADGVDASDDDGEGGDAKVESPTNALQIWSFSVAEQHPRTYPRAGLST
FT                   TTLSLFVGAAHRWMSHSGMSARVLSATPSLTRCVVEGWKTMVTVPELETSKEKSAMTLL
FT                   GASLMNTYRNMSRSPLSIRLLSPSVYASIAAMSSPSSPSTWYTGAPASLRSSARNVSAL
FT                   RGILRFSVRHSFSLRFVHFCDASSLLYPASMTK"
FT   CDS_pept        943779..948263
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632142"
FT                   /orf_name="MICPUN_57941"
FT                   /product="Predicted protein"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="ACO62676.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniParc:UPI000199B1B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E479"
FT                   /transl_table=1
FT                   /translation="MAKAVEPPPRPRRDVADRAGTLQGQLRALARQTLTHSRSSTSASG
FT                   GCGEAAEVDATRVTRLQRRALEVLLRMDKDVEVKEPSSAEERAEANSLRLGAALLRMRG
FT                   KGHGDAADLLEGLHDAFTRRRSAYLPRVPFAVGAGGPHPAPNSDRHDRDGSQCPSGFFV
FT                   FDDGDGDDRGAPASNDAASTIVEHASVVSLLLELAGTGGTGEAVDAATSAFAHLAATKL
FT                   AADSSRGILSDDGGLRSALDEPDVRTAAAARAARAGDWLRLAPASELEATPSLSFVSTR
FT                   PSGSTGASKAQRDSASQRDSAFDLAEMSRALEATPGVGALSFGGGAGAGFGDPFSFASR
FT                   PDRSLFDRSLFGGGGGGAALALPPWGEGGMLDPADEPRTTSTSSATTGPRSPIDADVGV
FT                   DADVDSEVAEGLGDENDDPNRAWLAAAEDGERGEEVLGWDLLPEARPACGAFMSRPPDA
FT                   FGRAYDRHLRPTRTMFGEAKPAVAAEEEVVHAARRALAGGRAAAEALDPERSKRAPLRL
FT                   PAAGVGVVAATLGPLADAATMRAELESFLARRSGFGGHGECTGGGLALQAASEAVRGVL
FT                   RSQAAAIHALPAAAAARRAAERAAGAPLSAPYRRDEKEETGDDSSGVTLLEAVAHTRRL
FT                   RSQLAQLHRLCLHPKEPAHGVEIIARLVDALSGSRGVDPSARPLLRYLAAAVARPLLTQ
FT                   LQCWLHRAVVDDPHGEFIVCTASGWGSAAAGLEYSPAEAGVMEWSEAESSGAARARLEE
FT                   EDEETDGPVDPARLPPWEGGPPGRAGAGHGAAEAAWLRDDDSRLSTPHPLLGGLERKVL
FT                   ATGVQLRVLQRLPQTQAFAARMSASVDDHGAQSLAFTAAELAAHSSRRGKTTRSLRAAA
FT                   EECLSAMAATRDAAAARIEAARRARRAAAIARKLERESAVAEAREELLSGFADRMAELV
FT                   ARHERLRWQRKRRALGERRAEELESRTKRDERMVREELAKELAARRGGEEGVASKEPNP
FT                   DPKEPNLDTSIASTDGGFERYDSPAARRAALDAGDAGSTPGTGATNYFDDVADESFVTA
FT                   ASDSSPVRNLAADLTGVNLDDAANVEEEPIAVDEPKKAKDTGGTSLEPSTFGSTRDDGL
FT                   EVPLPVVLRECVEAVVTDRHDVVSRLVVAAMLDHLGVEAHLGAVRRYVLCGAGDFATAL
FT                   VQGLEAASSSSAALAARARASRMGVAGYGGGVGAGELRAVLDVAVRETSVFGDPLAQRF
FT                   ELAPANPPNPDAVFSEHSLGMVDFVRGSYRLEWPVALLLPDVARTRLAAAQRSMLRVRH
FT                   ARLALQEAHDRVHEAGHVDASSLATREGGERGRAGRALALRRLRRLSLLSSEFRHFASA
FT                   VESQVGGAVHGAAPAALHAALRRAGTREPKPSDLYQLRDAIVAFATDAHDACLLSARDA
FT                   QLRRSVDEALQLALDFRAAMRRSPPDRLLSDGGVYAAVQAIHARFKATTGALCGRLREA
FT                   AADPGGALGGVSPGRASALLARLDFNGFYLGDV"
FT   CDS_pept        complement(948394..949110)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632143"
FT                   /orf_name="MICPUN_57942"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63069.1"
FT                   /db_xref="UniParc:UPI000199B1BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E480"
FT                   /transl_table=1
FT                   /translation="MSGTLNPKGAQDAKFWRTTRHYDMSSEKEEAREEVLLTAEISKCL
FT                   RRHCGDGGDMFDFAVESILADVQEDGVPKDVDEASCRWSSTLEDCELKPFDDDDEDEDT
FT                   SELVVNMYGELIEGIQGAMAEARGDVVEYLSSDQCEMCERVAPLTRHHFFPTSEHDFFK
FT                   KRNLCPPDRSLHEVAAVCRPCHTAIHGFADERTLGESYNTIESLLEVEQLRKFAHYMSK
FT                   QKGGMKKHDNALRHAK"
FT   CDS_pept        949241..949645
FT                   /codon_start=1
FT                   /gene_family="HOG000265161" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632144"
FT                   /orf_name="MICPUN_81223"
FT                   /product="Predicted protein"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /biological_process="translation"
FT                   /protein_id="ACO62677.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG390376"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI000199B1BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E481"
FT                   /transl_table=1
FT                   /translation="MATEAAAAPSNPFVQYVVIRKDLGQGMGWPLGSICAQAAHAAVAA
FT                   VWEHKDHPDTQAYCAPDAIDGMHKVVLEVKGETQLVNLGKKLEEAGVAYKLWYEQPEDY
FT                   PTCLATRPYRKDEVSALFKKCNLAKGLIAQ"
FT   CDS_pept        join(949781..952089,952125..952155)
FT                   /codon_start=1
FT                   /gene_family="HOG000198097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632145"
FT                   /orf_name="MICPUN_57944"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62678.1"
FT                   /db_xref="HOGENOM:HBG560763"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B1BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E482"
FT                   /transl_table=1
FT                   /translation="MGAGGSKALEPVVWLFKKPDAHRSEDASTSDNPWDALTDEQMEAL
FT                   SDEELDALLSASDEDEDDDDDADEDETSDADTVITTPASSTSRAASTPTPAPKKPKATK
FT                   KAKAPKGDGPIAIALGAIGGAKDAVASTARRAVTAASTAMRRRVEAIATTPKNELAARI
FT                   ALASLKGVRGAALHAVATSFAGCYLPRLTTAVKAAATASVAAPLLRRAGVGSKLAAIVP
FT                   GTSLESVGYVLELVSPISPDVVTDVAVRAAPAVAGLTQLARRFARSHVRYLVVRSVLRA
FT                   VAREKTRRAEYAVRVAPIVAAYGVKKPLIKRKKLPSQRDAAWLAMHRWGSAEMRRVIAD
FT                   FGGFYRKVGQIMGTARQMMPEPYIEAFAETMDNNPPVPFPVVKRLVERSLGAKLSEHFS
FT                   DFDEKPLATASIAQVHQATLAKNKKKVVVKVRIADVRTMVGDVRSMLHTTLVMKRLGLD
FT                   NGVDFPTIFRAYLDVIAGEFDFTAEAAKINEFRELFETYGLGDRVAVPVVIEDLSTSEV
FT                   LVMERVRGVKLLSVLNRARQRGRRPLVPAAAAKVHVDGGIGWDGVFDTMFKCWSVMLLR
FT                   HGHYHSDPHPGNFIVAKDGRLAILDWGQTQVAPEAYRLHLCRLVVSMVAEDYPKIAEEV
FT                   RLHSQVQLERPTTEALAALCYAYFDTRPTPLAEVNMMDLNNSPFLRNRITQNTQEGFFT
FT                   IRSVFLLRGMMATCGVTSSMVEAWEEDARAVLRASGDRTVPSVIRSRSRRMLTRTWLSL
FT                   QKSLNVGAGARLNTLEAGREGTGRSP"
FT   CDS_pept        join(complement(960062..960209),complement(959379..959830),
FT                   complement(954913..959022),complement(952207..954654))
FT                   /codon_start=1
FT                   /gene_family="HOG000100050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632146"
FT                   /orf_name="MICPUN_57945"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63070.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560764"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012954"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022125"
FT                   /db_xref="UniParc:UPI000199B1BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E483"
FT                   /transl_table=1
FT                   /translation="MTSALASQLQVVAASRPQEERLRGKASLLYDIREAADIDLQTIYA
FT                   VGLQGFNELTRLDGRFEQYSKSLFSRAGSEQNRELMDREANAKLDQQIEGYLRLLSGYY
FT                   LNPAATKTLEYLIRRYKIHVHNVDAAVTCALPYHSTPEFVKLVQLCVLENTSFYWLKGV
FT                   KETGAAPPRDRLVQRSLRDMAFFSFVADTAATAASQKGVPGSASSFYAVLLTETIAEMK
FT                   KVESSVVPRLLPYLEAGLAPAASAEQYAGALMVGVQLSISASLALPLTEALLEGVAKGA
FT                   RAPLHAQALQALLAICGSQRIRDLPSRAFKHLVKMPDLPSRVADMCEKYEAESLVVPLV
FT                   RALAQSATQHANYERVLGGVVNEVKLSDLAVRALVQELVTLGSGSGVDSAAATPAGAEH
FT                   GREVAARSIRMVDVKHPAACSAAVDHVLGEASRRGATKEGEGNEEGKAAADFLREALAG
FT                   SAAGPLPGHAASLGAALDHPQAGLREAALRELRNSGAASKVMSGGARKSSNAPPAPGII
FT                   SGALLRRVTDDVPRIASLAAALPGLRVAVGDDEALFAAAVERLRVASAHFVGKNETAEL
FT                   ERGVAKRLVKLACGTLALPFPRAKDGQGVEVDREESDSEAEESDSEADPVDKPPVEDNR
FT                   GALGNLAGRAAGLALGHAVFSPATRAVARATIAAAKRNLHPSLAELRTDAFDAALAKAQ
FT                   DAAGAASPEPAKGKKGKKASTETTKAEDTAALKEARARSDAAANAVVIGAVAKGIAAGV
FT                   DAWGGEGELTLWALEAWRDGSPGARANLLLAMREAVAMDADGSVRQALWAVLRDSWTEG
FT                   GAADFSEGAAEENLDEPLTAEVARAIARNNPRVTPPIARAALHRLMQTINGKRTGKKTV
FT                   GVPSSGASAGVIDEAFSRMSIADGAAGKGRFAASFDALLGAVERGGGSSVGFLATRAAS
FT                   DPSADSTEVPRTALELLATRGGGSNGAATSSVLAVLTVACTAAEPAVRAAAANAIVALA
FT                   PKGSSTGAKKGATAVWRSLKDAAGDVGSVTKSVDAGAALCDALAAGFAAAGSKDESDVA
FT                   LRDILAPLASLGISDDGDGGGGGDAIEPRLGAYGGRRLVAALKGVGSDASKAEALAPAL
FT                   RWCLARGEGDAAELAVEIIETFTVDYAKSKGATSGESWRVFTSALVAPSPAPARVAAVC
FT                   RATPEFVDSLPAARRGELLRILFTAVGTDADAGARAAARDAIDALKLLADDVISLVRAA
FT                   TAAAATTVASPSTKRSKGSAAAGRDADGSDAVSAAVAALEVVGWKSPGDVHSRADLAGP
FT                   CQELLASLLDAAAAAAARGAEVGRDSDDENVAPSPGGGAASGYSQAVVLSTLDMLARDD
FT                   AMGPDSAPFNKTPGKRQKGSNAGYDVRLIVRAVTEAEAGPAREAALALLAAVAKNDAVG
FT                   VMEHVLEVSAALAHRASNATDDPLAQRALEQALAAVVPAWIEGGFGVKAAAEQVVNALP
FT                   DAPEHRRAPLCLALLRACPEGEGLPVVLLLLLGQLRKLEEAAAASAAKRAKKAAKAAEK
FT                   AGVRVAEAIAEFEQDNTFAESAAWVLDLAALLLSRETASGAVDALVATMKGAVDEGGRI
FT                   VWLSAEVTSKHLSSRAFLQAARRETAAAVASVEKNAEGEDEEDVIAEAEAAAAVIAARL
FT                   QEGYADLAECALLLLQAGTTAGAEESPKAKAKGKSSKHAGGLQPVDTKAAARMERGGRQ
FT                   VLTALDGLLAPGPYLRSLAPLLEHEDGRVRRKALRLIAHRLHAAAAADVAPANKYEKRK
FT                   GEKARDARSRARAKDRKWKRSGKAATATTEDEDAEAEEMEEERADEVEAGVALIEKLAE
FT                   LAGAGSYATRSAALAALDAASSRFAGVKDAHKPIIDAAPAAVESLSCSSRAVVAAGAGC
FT                   IASIVKSQGVRCVGILPNAVPKLLETANSAASSLAKAKDAAARAAAEAEEAGDEAAEEE
FT                   ASAAAGVRDDEGAVLVAALKAVDTLMEQLSAFVSPYLPEMLRLLLSPALVPAVGGEDGE
FT                   DALDRESSAYQAAQSAAALREIVARRIPHRLLLKPLAEAYDSCLASGGGGGAAAARSAL
FT                   GMAAVAASTEPPAPAHRGALVALLLRALDVRREPPAGRCSAAAVDEVEGAAVQAFVTFS
FT                   LQLTESSFVPVFTQVVEWAKARAADAPAARTRLGALFRLASSLADALRAVFVPLATPLL
FT                   DLAAAALDPVSDPAPSKKKKKKSNAGAGVDPAAIVAELDTWRMRTHALSALRRLFVHDG
FT                   GEALLDAGRFNQLHPLVTRMLRAVPPSEGPDGEPTPEAAEGEHMAPGGLASECVACVAA
FT                   MIASAPDDALWKPAHRGVLLATREGVARTRLVALAALGAVVDKLQEEYLALLPEAIPFL
FT                   SELFEDPDEAVEGAARAFTGRLTELSGEDLKSLMLGDEK"
FT   CDS_pept        join(960509..960571,960705..960980)
FT                   /codon_start=1
FT                   /gene_family="HOG000265163" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632147"
FT                   /orf_name="MICPUN_57946"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62679.1"
FT                   /db_xref="UniParc:UPI000199B1BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E484"
FT                   /transl_table=1
FT                   /translation="MEAYRRAFIQTGSLAPLKHVMAGVFVMAFGMEHYFHHKYHSHAEG
FT                   AHDHKEAEVDMTKVDAALPAAAAAAMAEKPLPADMDALTAEIKSLRAEIGTLRAGMREA
FT                   AEEANKKK"
FT   CDS_pept        join(complement(962258..962403),complement(961227..962145))
FT                   /codon_start=1
FT                   /gene_family="HOG000265164" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632148"
FT                   /orf_name="MICPUN_57947"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63071.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG610214"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B1BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E485"
FT                   /transl_table=1
FT                   /translation="MTEPWRDPCFDPSDLSSKREWEQIGDGSFGNVYKASLLGTSVAVK
FT                   EIGNLKPDRVAGLKRDMYYLRRFPHPNIVAVFGAYEEDGKLFMVMEYVSNSLRSRSVVN
FT                   RVDVVRVLSDVARALVRLHAAGHVHRDVKARNVLITRGYETAKLCDFGLARTMPGDGAR
FT                   DDVNPELTPRIGPPKYRAPEVVKRRDYGISSDMYGFGIMCQQLVKELKKKRRRAMGEEE
FT                   VDFILNLASECLRKDPAARPTAGECLKRLLEYRGRSLQLCSRETANKRRSYWIDAPMDV
FT                   GTFKHAGKEPTASSDRSSSDSPGDDARGGRRGEDSEVGRADGARGDGGVAHGDEEDEVT
FT                   GGGAPKRRRVDVES"
FT   CDS_pept        962989..965067
FT                   /codon_start=1
FT                   /gene_family="HOG000271638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632149"
FT                   /orf_name="MICPUN_100107"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO62680.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B1C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E486"
FT                   /transl_table=1
FT                   /translation="MMTLTDVRVTVGDRDLLVGANLRVEPGETVGLVGANGCGKSTLLR
FT                   CVSGLRSHDAGELRVAQRADVGYLEQTAVSGSKLTVAQEARSRMTHVQAAIDAVREAEK
FT                   AMAQGDANAASMLVAANDAFEAVGGNTVERRVADVLTGLGFAKEAWDRPCAALSGGWQM
FT                   RVALARLLLSPAGDSRNSGITGGFLLLDEPTNHLDAQAKEWLAGWLRAYSGTVLLVSHD
FT                   EALLDKGVDRLVEVRGSRLHGYSGNYAKFLEERKQRREVAARAASKEAAKAAKLEQFVA
FT                   KNSARASTAKAAKSKAKQLQGVLENLEELEELTGGGKDLGAGPGDAKRVTFRLPDPPDG
FT                   AKEALILENGVVGYGAGLEPLITGAGLKVSRGDRWLIVGPNGAGKSTLLRTLGGNLRLQ
FT                   GGTLAHGEGTRVGYFSQDLAQELPVEETPLVHVLKVARAADPTVTELTARSVLGALGLS
FT                   GSAAKDRKIGELSGGEKARVALAAFVLRPVNVLLLDEASNHLDTAAIDALTGALRGWDG
FT                   AVVAVTHNKTFADALEPTFVARVEAGAMKTRMVTGGTLSKKDFSPNAVATGGVAGAVAK
FT                   PKEAPKGAKKEQEMTEEEIAAAEAAAKEAKAARDKLLREARNAPKTIDKIERALAVLED
FT                   DIAAIDERLMKCGSDVAAAVEIQKEKDVKVEKQGLYYAEWQRLEEVMAEAEAIAAEA"
FT   CDS_pept        join(complement(969227..969401),complement(965217..969055))
FT                   /codon_start=1
FT                   /gene_family="HOG000265165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632150"
FT                   /gene_name="GWD1"
FT                   /orf_name="MICPUN_57949"
FT                   /product="Carbohydrate-binding module family 45 protein "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="ACO63072.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG561530"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199B26C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E487"
FT                   /transl_table=1
FT                   /translation="MAATAMGGASVVGAPKFFAAGSRRTVRGTSALRAATRPAAARRSI
FT                   ATVTRAQAGQTAEGDRIVDVSQIVVPEELVGIRAYVRWEEAGMPEDTPPEWQAAEYAKA
FT                   RLDLQLEVLNGVTLNDIRRRYNQETVDGDDEPIFSRGDANVMLDDAAGKFTGATSNVVP
FT                   METRPTPLDDFAPTIDIPGGGKKQKVAIEPEEWIEPPPEQVGEYHSDAYVHRDLRSIVS
FT                   HRAGGDEVTAPKYSAKTFMSRWASFDSPNTLVNQRLYTLGDDSEMLVQMYQDVAEDESA
FT                   SSGPRKRVVSRSVVITTDSQEDLVLHWGVAKDEPGQWLLPETTVWPGKTTAVSDMSVET
FT                   PFVSGQGCLPAEAFDKDEVEPGEEDLCYPIQQLTIELPGEGADELMGLQFVIRNKEGTS
FT                   WFRDEKNGNSNFHANYATTQHSKAADELLETIIRSEAGNGWWTLMHRFNLASTMLEQKC
FT                   APGASEKSIAKAVAAAAKIYVWLRYSSNRKLTWQRNYNVKPRELSAAQSKLTKTIAKLF
FT                   CDAPHLRDVTRLMLGTVGKGGEGGQGQQIRDEILNIMHRNDIKEKKGIWMEEWHQKLHN
FT                   NTTPDDIIICEAYLAFLKSNMDISEYWRVLSEGGIDRARLESYERPILAEPTPRPTKKV
FT                   ALIKDFQNYLKILKSVHSGADLIECIKTANKGLGGVSPALNYARVAQNGGGDAIQLLAA
FT                   CVDARHELRGAGLANPSDQEWTRELLYLDLSLDDVARRAVERSGEANYGLEDQMRLAGL
FT                   VMENLALSLPTSNEDIVLALIEWRRVEEARRGGDSQWALRAKAVVDRVRLAVALHADDV
FT                   AAKMQPAATEIGVACGIEHWAVDLFAEEVIRGGPAFALSLVLSRLDPLLRAEADMGAWQ
FT                   IISPVPAVGYVKHVHSLREVMNETFTRPTVLVADKVGGDEEIPAGSVAVLTTCSVDVLS
FT                   HSAVRARNMGCLFATCYDEAVLDSLAALDGEPVSASVMGGDEVVWEEVDASAVALGAGA
FT                   GDVSSVPKGLKLAKIPFCGKFTVPLQEFKKGVVGAKAINTLALNESLGGGKIPAWINLP
FT                   KSMVIPFGTMEYVLDDAVNASVKTELASLVAAIDDSSETALERSLAACRACVKHIAAPA
FT                   GMLDEIEAAMVAAGIPAPEDEDRWAKAWSALTDVWASKWNDRAFVSLRNVGIDHDDLRM
FT                   SVLVQPVVDADYAFVIHTVNPSSKDQTELYAEVVMGLGEALVGNYPGRALSFSVKKTSG
FT                   ETPRVLGFPSKSVMLKIPRQTLIFRSDSNGEDLEGYAGAGLYESVPMDEEETIHADYAT
FT                   DPLVWDEGFRTELLSKIAEAGVAIEAALDGQPQDIEGVVKDGEIYVVQTRPQV"
FT   CDS_pept        join(969532..969610,970046..972060)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632151"
FT                   /orf_name="MICPUN_57950"
FT                   /product="Monovalent Cation:Proton antiporter-1 family "
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /biological_process="regulation of pH"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62681.1"
FT                   /db_xref="GO:0006885"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018408"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniParc:UPI000199B26D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E488"
FT                   /transl_table=1
FT                   /translation="MDGAAALTSSGRDKRRGAGRKYRDALLTGVEGSEWSVFQAKLEER
FT                   VRARGVQGSEMSDDQDSQAEDADSAERAFALQNAAFLLQLFTLATAFVLGLGIKHLKIH
FT                   WIHEAGATILLGVLVGLMISGSSVSDEITDWLDFDESVFFFLLLPPIIFEGGYSLRSRE
FT                   FFANFGAICSLAFAGTTISTFAVGFFVWICGGVGLCYGLPLLHALVFGALISATDPVTV
FT                   LAIFQELGVNTELYSLVFGESVLNDAVAIVLYRTLVNFNNKGVTFISLMESAGFFLVIF
FT                   VGSLAVGVLFAVSATLFFKVLNKHGAHEGHVTLLQRNNHIEMALVMIAPYAAYAAAESM
FT                   SLSGIVAILFCGMVMAHYTVPNLSPETAVNSKVVFKVLATLAETFVFIYMGVAMFLEEE
FT                   KWSMVPFVLVAMVGCAGGRALNVFPVIRWVNEKRRPARRVPDSHTKMLFVSGLRGAIAF
FT                   ALASTTIRDLGEASGKVIRTATLCIVIFTVLVVGGSCNYLVARWDLGAESAWTGLGDED
FT                   GSRRREASTAAEGSPGGVRAGEVHTGPHEELMPEFRVETFEEGYAAAKAELGEATKQEN
FT                   TNYGKVKAAAKALGKVAAVTDAASVMSDIDARFLRPYLTINGSLNASRRASPERSRPPS
FT                   RTDENGADDGEGGNDADGGFRQVPLDTVASEGNIAGGASHETPLGLPGSPAPARTPGVP
FT                   PSN"
FT   CDS_pept        972221..973555
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632152"
FT                   /orf_name="MICPUN_57951"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62682.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG607415"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199B26E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E489"
FT                   /transl_table=1
FT                   /translation="MRHNAAHALARVVQASVSREVASGTLRIAPLAPRRLKRSMSSITE
FT                   DDQQRLLEHYALGLRGILAEHDDLTDPALTAKMRALRDDAPVRLEHRFWGAQFLAMAFG
FT                   HELGFAAAHPPALRAVFNLGVVAAENGLVPFQAMRSAHGQLARLGVLRCDRVDPGADGG
FT                   DGWSLATPRAATPWELFASDRLRVAAREAAAGLVARGSAVVDGALGPRLAEAASAALTR
FT                   HVASERHLFSAGQLDQTGRSDSSTRGDIISWISGDEGADEALRLGAGIWGGHVPGSSEG
FT                   LLGRCPPAVVSPGAVAQMFRSCLSDHVISAMPAGVLMSSDNYVTNAMMSVYAPGAPGFV
FT                   PHTDHCGGHDLRRVTAVYYPASNGDWDVDRDGGALVLRPGEDGAGGRRETIAPEGDRLV
FT                   VFYSDEVEHEVVGVSEGASRERLALSFWYLKPPPGRFDPSLMSRS"
FT   CDS_pept        complement(973655..976891)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632153"
FT                   /orf_name="MICPUN_57952"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63073.1"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199B26F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E490"
FT                   /transl_table=1
FT                   /translation="MTARRGVLRVPNSLIACTLTAAVLFSSADAATNTYTKGVDCGDYS
FT                   TVTVQEKDVWRCCSAERAKGYNFAVRPAANKNAYHSVQMLILDTGIYQQANGLYEPKLW
FT                   HYSGSQCDVEDDGATCTGEPCYRPSSAYKWRCESDKCCQSSRYYFQYCLEIKCNHADWG
FT                   WFSSPCEFDYAYVVFDDAVPTSWTCDKDFFAVNDGCDCGCGAFDPDCDIAGSTVYGCNS
FT                   PEHTGECTPWATCETKQYPPPPPPQSPPPPVPPPPPSCTASTSPSADGSFGPFYCINGG
FT                   TVSGLAPYGCKCQNCNPGFGGVNCADANACSASTDSTKTTGNDGEFWCINGGVIGGSAG
FT                   GCTCTGCGKGYTGDHCQTAKDCTAASDESKTTGADGEFYCVNGGTIGGVTGSCTCTGCS
FT                   KGYTGDHCHTATACTASSDASKTTGADGEFYCVNGGTIGGVTGSCTCTGCNAGWEGVHC
FT                   HTAKECSGTRDSTKTSGVDGKYYCEHGTVSGTTGACQCKDCKTGYEGTHCQTPKICTAS
FT                   SDPDMTSGANGIFHCINGGTIGGVTGSCTCTGCSKGYTGDHCQTAKDCTASSDASKTTG
FT                   ADGEFYCVNGGTIGGVTGSCACTGCNPGYGGTNCATSGACSASADESKTTGNDGVYYCI
FT                   NGGTISGSSGSCQCTCAGGYSGDHCQTANACTATTDESKKDGNDGAYYCINGGTIGGNT
FT                   GNCKCTCDVGFDGDHCEDRKICTNTTDTTKTTGADGKFYCINGGTVGGLAESCTCIGCN
FT                   EGYEGDHCQTGKTCIASSDASKTTGSDGTFYCVNGGTVAGSVGSCTCTGCNTGYEGDHC
FT                   QTAKACAASPDSAKNGTDGTIYCTTGGTVGGSTGSCKCTCKAGFEGEGCKSRSDANGAT
FT                   VTKKEEAEKTRDAILSGIKDEKMKKKAKLLADAAISGKKVRKMSAKLTAPNENTACSDY
FT                   YTKAGLDKKLGACVATAASRRRSLTATTYDVSVFFSEAEVDEAALTAAANSLKAEGVTG
FT                   VQTTNSIDPIEELKTIEGVDASTVETFKTVASAAAATMPPSPPPPPKPSKSPPPPPPPS
FT                   LIKDEDDDDHAPARRGFIFLLTLTTLTLLL"
FT   CDS_pept        977438..979273
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632154"
FT                   /orf_name="MICPUN_100110"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62683.1"
FT                   /db_xref="UniParc:UPI000199B270"
FT                   /db_xref="UniProtKB/TrEMBL:C1E491"
FT                   /transl_table=1
FT                   /translation="MGPRRAPALLALAAFLVVCAAVLPAPVVAVDMLRRAGDAAAATGA
FT                   ADGVAVIRAQCEHRISALEASSSAALREHEEKVASLTEERDDLAATVKRYKRGLLNLES
FT                   KRKDEVAKLEQALRLAESGECPTPTLTDYVAPALDSIRRAWSDARAGVADASDVAARAV
FT                   WSRTRSALAAGVGARRAVISRASAAARGLFPDDTHDDAHARETARTAVDVVIGAIVAVV
FT                   VVAATSRISPPFRGRKSRVGSKGRSTRIEVVDEDDEELRGGAVMEGDEGAVEWKTYRAR
FT                   VPDAGRVEIEGPKRVVQRWGARLPDAISAAAEAFDDKPEDFDDEKELPGPPASPEEEHA
FT                   SDEEAEEEAPDPVAAEEKFVEVLRERAPPARVPARVVQTRSPAPMPELRSRTSSGGGRP
FT                   RAAPAPRTPPQAPTAGRSTRIPRLPHPGSTADVLDLNSASDDLLSQHPWGDDGGDGWAD
FT                   TMGTPDFQKKENKLGSPSKLPVARRAAGARRVSAPLVQTTSPNVVNAPGVNTNPNPKAT
FT                   PPSGKLRLVRPGERRTPTQSPDDGSASSRRYSPGGNRSSSLGLTPDNKQITPRQRAIAY
FT                   AEARRKGVDVDLPSLGGEEGEYVPRGGMRHRGALR"
FT   CDS_pept        complement(979313..979804)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632155"
FT                   /orf_name="MICPUN_108120"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63074.1"
FT                   /db_xref="UniParc:UPI000199B271"
FT                   /db_xref="UniProtKB/TrEMBL:C1E492"
FT                   /transl_table=1
FT                   /translation="MSFSIASSRILVVHAAPTSAVSRARNTAVSCRAGKGALSGGTVDL
FT                   GRRELGAGLVGLLALASPARADEDADEFKMDYKNYNSGSSVPEAESDLVKRLKAKSEEN
FT                   KAKNDAERFNYDRQYSANMAIIKSSWTPDDEKDRERLGITRPAECDLPFFKDSPTCKKF
FT                   "
FT   CDS_pept        979935..983078
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632156"
FT                   /orf_name="MICPUN_57955"
FT                   /product="Predicted protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62684.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG610134"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI000199B272"
FT                   /db_xref="UniProtKB/TrEMBL:C1E493"
FT                   /transl_table=1
FT                   /translation="MPPKARGGGKKGPPPPPYTEADVAEFRAVTGCDSDAAAKRSLAST
FT                   RGNLSEAVLRYLDVHAAVPKPTHGDDKAETVARRQANLHEAKRPRVEAAEGTGADGTAS
FT                   APFAFDLSGLVGTPRPDEHGWVTSMTQELEAEAETVDATVGWARTIEALEAAADGRRRF
FT                   EDASFPPDASSIDGGRADKESESVPCCRCGARAKIKSVHKDGPNHGRWFYACGNQPANA
FT                   WAARAMAAKRVPTPTCGFFKWADDAPSSESSKAMRWRRFEPPRFRLTRGTASGAPKFAP
FT                   SDVRQGAVGDCWLLSALAVVAERQDLVARVVGPAAKCPAATRRGAFLMRLFLAGRWRGV
FT                   AVDPCLPVSGRSTKVLAGANKVGARSNDEYALAYSRAADNQLWVPLVEKAYAKSHGSYH
FT                   AISGGWIAEGLLDLTGCPTETIRLDASGFKSEEAWRKLLSYAAAKFPMGCATQGDPSHR
FT                   EVGLVGNHAYSVMEVRELHGASVGRQTKLTSFVAKERVEDVDAAAGGGGPPLRLLRIRN
FT                   PWGRKEWSGEWGAGSEVWTSKLGAELGHTRVDDGTFWMSWHDFLCRFTVVDVCKAHEGW
FT                   HAISVQAVSAENDPAFEVEVAPDRGASSSSSWAYAMSLQPNKRGLCSERFWYADVGIAV
FT                   YRKGESKTQGPTWTPVTGRLGARERVAQVELMFEVGVTYLVRFFSFTGFKAGPPPILRL
FT                   YSARPLRVRPMRTPNLIPNLAPALHSMLLPSSSPAPNVQEGTRRGGSSDSDIKRRLLPL
FT                   CGGALVVCRCRGGAFVLGVSASPRGSPPLRVWLRIRSGRVGGMSALHQHPPPPAPGTVH
FT                   EGPIPGASLHEIPAGRCRVLALALALSPSDTCSHALEIATEQVCDCRAKLKGIGDRRAG
FT                   AGDEDEVAVVDLDETETETEEEEEEETDAGEEEKEEEGDDEVEIIGEVKPKPKEDASTL
FT                   FEELGLPPPPPGATDEAIARMLADALAVAAARGARDERRGEDDSPDDSSDGDVEVVGEV
FT                   ASTASERRQKKRAEELARPATAPPARLAQVFAHLPVPEAFRREVSAMRGSRCSGGAQT"
FT   CDS_pept        complement(983184..984650)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632157"
FT                   /orf_name="MICPUN_57956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63075.1"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI000199B273"
FT                   /db_xref="UniProtKB/TrEMBL:C1E494"
FT                   /transl_table=1
FT                   /translation="MASAIVAMIAANRLLTPSLISRGDGGGNPSPEVSDVLSWPKERVK
FT                   EWLQEECGISSSVAAKAFEAGVDGATLVELDAAAWDELGLESAVARARVIGKVRTRVMT
FT                   GPDTSTQAGAAEEARWAGVRDGTEGGGLGGGSPSMARSYTPGSFSGRPRSVVLRDGPTL
FT                   EARSVEEWLAKFETWVTRKKNWAAGAEHRLYWTRCVSAANGANGHALKEHFLRFLGMYN
FT                   VAGLLTLTITGPFLLNAEQPTESIDIAICWLMSLSFILSAGGILLSTILYNTASVIHEK
FT                   NFPLFGKTTSGVLGTNQVNDYCIFGFNFLTLAILIHFCKMALPGIAYTTRLDEDPPLSK
FT                   TIWLLLPVLMFFYMFTKIGRSIVVCTQMAVFGGLMHSTPIAPEKVGDPAAWQLRSTREE
FT                   ADAFVHDVMYKSMYPDDFAESVVKRYTQAAAGEAEDAEAEAAERIARISASVGDGGETT
FT                   ALLASLALSNSGGARRHSSFKRIGPLQTAQ"
FT   CDS_pept        join(984793..985035,985166..985699)
FT                   /codon_start=1
FT                   /gene_family="HOG000158234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632158"
FT                   /orf_name="MICPUN_90556"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62685.1"
FT                   /db_xref="HOGENOM:HBG626693"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniParc:UPI000199B274"
FT                   /db_xref="UniProtKB/TrEMBL:C1E495"
FT                   /transl_table=1
FT                   /translation="MSTLRLDSDIRNWVLIPITVAMFFVGIVRHNIGKLMHRDRKVDLK
FT                   ALREAQAVIRAERLRNNSGYLQSAGFRMRKHFFCAPETGVFNQAAKKANPQAQMLSDPT
FT                   MMTSMLTKNLNFIVPNMLTAGWVNFFFTGFVVGKVPFPLTQRFRGMLQRGIELQSLDVT
FT                   YISSLSWYFLNFFGLRGVFNLCLGENTLDDTQAMQQQMAMGMNTEKAFASVKENLDMLD
FT                   HEFVLYVAERRAERLLRRLVSGAAVGEARAFANAEF"
FT   CDS_pept        complement(<985858..>986175)
FT                   /codon_start=1
FT                   /gene_family="HOG000205046" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632159"
FT                   /orf_name="MICPUN_74471"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO63076.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG568696"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniParc:UPI000199B275"
FT                   /db_xref="UniProtKB/TrEMBL:C1E496"
FT                   /transl_table=1
FT                   /translation="RAVLRQAKGSPKKFNDVLRVIRGCSVSDALVQCALSPKKYADVVR
FT                   KVILSAAANATNNHDLDRDKLFVAEAVVGKGTFLPRVSIHGRGRAGKMHRPRSHVTIVV
FT                   EE"
FT   CDS_pept        986779..988500
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632160"
FT                   /orf_name="MICPUN_57959"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62686.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199B32D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E497"
FT                   /transl_table=1
FT                   /translation="MQGEDPPQGGGIRVALVKGGRQRDASAPPPASYPEDGPEEELDFD
FT                   FGGDLDEAEREAGDVLVDDYDDDDDDDDDDAGEDGGDWREGGEDGSAANPAAVSASNVD
FT                   PGGPEPTAVAPPKRVHDPNFKKLYGVMVPIALRDGGDDAAVLEWAMADCKDWEYEPDEE
FT                   EAAMMRELERMENEDFDPLADGEEIPAEVPLVPGENEEDYANLDGDDVEGDDDTAVDDD
FT                   EVDFEPSQEETEIPMSARLDFHSKHFDPLLALRAGVRGELKPPRNVRPLDFVGKFRHLL
FT                   PKRHPAWVDPNRQRKTRTAESIAAQEAAKARAERFRQKAAEFARRDPVVGILADESRER
FT                   GGPLSVLVKAFDEGRRIRVATRHRSGIRGVAVAYLKAFDVYMNMVLQDVHEAYTVRLRH
FT                   SVVDPKRPGRTRVKYKLEHRRRHMNQVFLRGEQVVTIAVEEDEDDEDDEDDDEVDSDDE
FT                   DDEEEKPRKGKVKKGRGIDPVEEVGAADDDEPDQPSRLGLEITRAREAKQAARRGIEPG
FT                   TSRWNPPPPPRPPPGRPPPPPRPPPGAPGARPPPPPRPPPGRPPPPRPPPGRPPGR"
FT   CDS_pept        complement(988583..989164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632161"
FT                   /orf_name="MICPUN_57960"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63077.1"
FT                   /db_xref="UniParc:UPI000199B32E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E498"
FT                   /transl_table=1
FT                   /translation="MRSNAATVIFAVVSLIALIAPSASHAEEVDNAVRSMPTRQQETED
FT                   LTEVDEWLKGEGLNRFGDPKDTMYTGGSPLFDESTGERRDRYEYIRSRHPDEPWKRGSV
FT                   RPKIVDVDDPRPSRFPRHWGPEPPVQTRDYRELPGGYGFGSSTLYKWIETNMAKDAEDL
FT                   DETGETLGAAPGPAPNTMSQSTEDEPEDDL"
FT   CDS_pept        989319..993572
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632162"
FT                   /orf_name="MICPUN_100113"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62687.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199B32F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E499"
FT                   /transl_table=1
FT                   /translation="MVLGPPPPVPPPPRRPPPRPKNEGSAEYVARQVSGALRAAARGRR
FT                   QRHQKPRDVVLKAFARFSEDGRVSPAEFVAGCELLGLTVPIADALAVFITAPSEFVMES
FT                   DRDKENARGGADDAIDEEGTESGAEKHADDVLLLYAPWIDDVLEAPPRTLTRPRQSPPT
FT                   APRASTSGRTSPPASKKTSNETERGKKAEPPPPPPRMAGYAKPVAPSQTFRTRRGPLTE
FT                   HDPPVRDGDAFVYPHCRTPVFPPDGFDRTHVARGGVLPDCTLELDHVHGCGPGLVDRTA
FT                   PVPVFCVAPRAGESPDGKAKAKARDPEHTRKGPGIDPETEECVYYAAGVCVVQTLRDPR
FT                   AVLAERAAENRARDELAARRKRQYMAGVDMDPVPPKSWERSRCQRHFRGHVDDVRCLTV
FT                   HEGSRRCASGEMGVEPRAIVWRVDAEATEAPLAVLKHPRGARAVICVGFNADCTRLVTV
FT