(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_3

ID   MICSR_3; SV 1; linear; genomic DNA; GRV; PLN; 1518631 BP.
XX
AC   CP001326_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 5, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001326.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1518631
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 5"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        complement(711..5111)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633327"
FT                   /orf_name="MICPUN_58268"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="translation"
FT                   /protein_id="ACO63607.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AD5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C7"
FT                   /transl_table=1
FT                   /translation="MGNKKKRGGAPSPGHGTPGGGAVASLPAIVEEELTALQAIYEDEF
FT                   SFDEREHRQFRIRVSPPSLDDDKDDQIPPVVAVIVVQYVAGYPKKPPGVKLDRDESRGV
FT                   KPLVLEQLEAQLRRQAADLAATEGDVMVFNLAEALRENLANPDLVPTSERDESLWDNMN
FT                   RRVNENGGDPSASATEAETAGGTVDSPAVVDRKESMDLGGDDDDNEAYGDYALHEDDDW
FT                   EEVAVAAAAAAVAAGAAGADLAPRGLPTLAQPRKQSSRSATLQLRLKSEKDAAGRQTSG
FT                   PSQENSPEVEKSSTFAEKSWGKNAGASARIIEEDKSDESESETDDSESSSSDSEEEDSQ
FT                   EPRDWLRMGEISSRGGKSSMSRDTHSSLDLVDSLMRGLSFMGSAVHSTGHVLEDEDDDA
FT                   AADSFDRMFPQVDEGDGSSASRRRHEQMLHLLVGHLLGLLCEAGGPLPHALPALTSQLR
FT                   ACGVMPRWLREVLLHRPAHFHRAFKRAFDAEGRAASASVNSDPATQWAIQKFWGGVSDN
FT                   PGDARKHPGAMIGVNEVGSSRGRSRLANSESVLDAAKLDVPSKPVLPPSRYATDFQEIR
FT                   MLGRGAFGRVVLAVNRLDGREYAIKKVRMATKSGGPVSPAAAARVLREVATLSRLEHNA
FT                   VVRYNQAWVEEAVEERRGPKGGRMSMIDGTSDGGTSDEAAAWGGGGGTATEATEASGTT
FT                   ATGTTVTTSFAARRLNEPVTVAWLHIQMEYCRANLRDVLDREAHLGTEIDDERAWAWGR
FT                   QILEGLAHIHAQGIVHRDLKPGNIFVDARGQLKIGDFGLAKFGGADDGSSAAAEAAAIA
FT                   AGAAVAARGEAGDDDLELDTDNPEIDVESTGAVGTYLYTAPEVEAGWVNQSSKVDLYSA
FT                   GIVFFEMLRRFSTGMERAVELNQLRSARPTAGQSGSERLPPDFRSKYPQQTTLIAALLA
FT                   PDPSERPSAAEVLSSGFLPPKGGDEALEEVLRAVETGGAEHDRVVERLTSDGSAGARLS
FT                   ERAAATERGAPAAVDAAAAERMLTTLRATFRRHGASPLSSRAVNWLKEGDTILSQAGGE
FT                   GHRLLSPSGALVVLRRDLRSSLVRQAAAEEATTLRASCVGITFRSSAPGPKDGGTGGAK
FT                   SGGGGGGLPREHVQADFDIIAPKESTEASIADAEAIKCAWDALVERGLSPRVSLNHRRI
FT                   LAAAWIRAGVPSEFRPRTAAILRRDASLTAIRLPPEVVKRTAALHSLRAEDPVAATAQL
FT                   MHELVGSSSTQKTGSTVLLSAIDHLRAVSAHLECMGVPASRISVSPLLPPPEPYHCAGF
FT                   FELTVHTSNSPSTGAAANGVCVAAGGRYDSWLSTVWPSHAAHPPPGGVGVSVAVRKAAT
FT                   LAASAAQRTKSPHVVAAAAATDVIVCARGGGGLIQERLALAAELWANGIRAEVVPSTAP
FT                   SATEQYQYAGQRGARFMVTVDGALLSAGERVRVKGLGRGGQERDVSRQEVVDLLRGMLS
FT                   GGGGR"
FT   CDS_pept        complement(5295..6296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633328"
FT                   /orf_name="MICPUN_58269"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO63608.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199AD60"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C8"
FT                   /transl_table=1
FT                   /translation="MREATSLSATTSAPNGGVNEAPHSVPCVPIADAQQGFAPTRASDG
FT                   RDGSVVLSFDALGSLGPSISGSIHYRRLTPRDMGECESLHRALFPISYEEVFYLTALSE
FT                   SDGIITLCAVERDFGGDERIVGVVTARVVPQTDEEDREVVAAFIRRKRGRLRAMTRWLT
FT                   EALAKTQPKGGGEVLETPYVYILTLGVLTSHRRKGLASELLDRIVERAVFDHQVEVSYL
FT                   HVITHDAGALRFYTRGNGYEVLTQHVNFYRLPPEGCPEPGRIHYDAFTLARGVGKLSED
FT                   SVGRTGHGRGGPSPLGELARGWEQMWRAIVALITWLRMWASQRLQRKEQHYM"
FT   CDS_pept        8589..9494
FT                   /codon_start=1
FT                   /gene_family="HOG000163915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633329"
FT                   /orf_name="MICPUN_108192"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63235.1"
FT                   /db_xref="HOGENOM:HBG412014"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniParc:UPI000199AD61"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5C9"
FT                   /transl_table=1
FT                   /translation="MILPAFAALPLLLSYAGSTTILVPRPIRRLLGDDSDLLELGWIYY
FT                   LYMFLMVIFCSNSINIHAGINGLEAGQSAVIAAAIVLLNVTTIVATGTYEEADPSIRSL
FT                   SMPEAIQRANMLMKTLGSKSSVALKAVKQAERLIAQNDAGMQMHEAHIFSLCLSAPFLA
FT                   VTLALMAHNWYPSKVFVGDTFTYFAGMSLGVAGILGHFSETLVLFFLPQIVNFLYSSPQ
FT                   LFKIVHCPRHRLPKLDTETGLLHPSKATETHYNMNLVNLFLRILGPQTERTLCMALLTL
FT                   QAVCCMAGFGVRIVLSGKWK"
FT   CDS_pept        complement(9577..10815)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633330"
FT                   /orf_name="MICPUN_58271"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63609.1"
FT                   /db_xref="InterPro:IPR012981"
FT                   /db_xref="UniParc:UPI000199AD62"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D0"
FT                   /transl_table=1
FT                   /translation="MTAPPGSVMLVPEAGFCFRGVRNKWTEAGGKVFVNICSHPRIDPV
FT                   CGANLVPASEEHLDLWGLGNMRVPVLVGPVRGMKDGEGRDATAVDVLFHPAVVQRALQG
FT                   GKTVTKEHYRDYLIQIATKNIHEDHGIDLAPARTEVLPTARYKGPKGENSENTHAFPVF
FT                   ASDAGRGEEPSATATREPGNPIIQETGTRGGDRSRDTTSDRIRKGQAVRKGFFSASKSA
FT                   ELYPDGSSEGIPKPGEQYDPLGHIPESIRTKCHVIDTGAIGTADLDRVTSQYAKTGILD
FT                   TSTEGVYAKGTDPGGKRQVGLGHPGALREESSTGKPTARKPAAKPKKETPEHDIQETML
FT                   AGESAVEVRVRLPRLTGGMASVNLDVGEETVSLSSPEYDLNLQLPHLVDVESVSAKFST
FT                   KRAELKVTARRVD"
FT   CDS_pept        <10979..>11456
FT                   /codon_start=1
FT                   /gene_family="HOG000006301" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633331"
FT                   /orf_name="MICPUN_72957"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63236.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199AD63"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D1"
FT                   /transl_table=1
FT                   /translation="VVFQTTKGDIELAFYPDVAPVTSAHILDLCRRGLYISNHFFRVDK
FT                   GFVAQVDGVVGGRRIPMDAYQREVASKKLPGEFSNDVKHTFGTLSMGRYDDPNSATSSF
FT                   SILLGDAPHLDGQYAIFGRITRGEAALQAMQQVPTKREGIFVMPEERIEILATYV"
FT   CDS_pept        join(complement(12190..12228),complement(11741..12095),
FT                   complement(11665..11705))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633332"
FT                   /orf_name="MICPUN_58273"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63610.1"
FT                   /db_xref="InterPro:IPR008474"
FT                   /db_xref="UniParc:UPI000199AD64"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D2"
FT                   /transl_table=1
FT                   /translation="MTGVGAFINGKWEPNAVVTVEKGAHVPFHPTLADVSDQTKRAFSA
FT                   VAAERVAAKLEAKARPMEFQAKLEAAAQFALDAEAHEARRKLAKKKRQRDKKKKKKKKR
FT                   RRDSSSSSDSDSSSSSSEEEARRRSKKPVEEVQAVFVLVE"
FT   CDS_pept        join(12625..12675,12784..15510)
FT                   /codon_start=1
FT                   /gene_family="HOG000265409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633333"
FT                   /orf_name="MICPUN_58274"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63237.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561376"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013621"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199AD65"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D3"
FT                   /transl_table=1
FT                   /translation="MVQIRKNKDKYAARNLAGSQLLGLDDEEEKLRESEHAKNTYHGAR
FT                   DEEGGLPGQVRNPGDEDAVVDIQKEFREKSKAKLDIGMVAAGVQEMQKHKIFMEPSPWV
FT                   ISPRSKYMRRWDMVTLVLLLYTAVVTPVEVSFMDTKIDTLFWINRAVDGLFVKDIVLNF
FT                   FVAIYDPEDGQLVFHHPTVVRSYLKGWFPIDVVSVFPFDLIALLMNTSSVGRMKVLRIL
FT                   RLLRLVKLLRILRAARIFARLETQYNIDYSMLELVRFAVLALVTSHWMACAWGLVADLE
FT                   DSEYNWMKYTAFNTFHETGKLEVGQDPRGVVSTTDIYIAAFYWSSMTMTTIGFGDILPS
FT                   TLIERIFVSFAMLVGAFVYGYIIGAVSNVISTKNAKKNDFYKLMGELNAFLKEGRWDHD
FT                   LCMRLREYFKYRLASSHVDAHTALLQQMSPALRAEITLGMNTWITKVDFFRKCPEALVI
FT                   QLTMNMKQSTYPPQEKILVPGDWCDKMFMVRKGVAICRQKIVTTGQVFCVECLYKEGKV
FT                   SYSAHAVTFVDLFSFDRNMLVGALQYFPDVQKHFQRLSIKIVFREEVIAYSKAFRALEE
FT                   DGVNANVWDKMDERPDFYLKKLRMIYGDDGFGMRYDGASEQEMKERAAIKVQKVYRGYR
FT                   GRVLSKVKSTEHGTSGVMPNSVRSMDPTMYTARALDVFHHRAGQSLHALHLKLDALLNG
FT                   TEPRKDLERDVHDRSRSELFSTPLDGSGKKAAGMSSLASLAGNPAGSSSLPPVTVSKGI
FT                   GGSAAVDAVKSEVDKLRRDLFDKLDRIKVTGGGGEQVMMGGAEDTQQLAVLVQSLAEQV
FT                   GSITRTLSQMSDAQRTFQERSQRTILGHLEQAQTRMAEQVAKTMGGVSRPTAAPSRVSP
FT                   GGVADMTESDLPPSRGYGGQYGGTSGGVAGVGTRALQRRPLGGSTPPARPTQGW"
FT   CDS_pept        complement(15592..16131)
FT                   /codon_start=1
FT                   /gene_family="HOG000265408" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633334"
FT                   /orf_name="MICPUN_58275"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63611.1"
FT                   /db_xref="HOGENOM:HBG561402"
FT                   /db_xref="UniParc:UPI000199AD66"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D4"
FT                   /transl_table=1
FT                   /translation="MGSVKSSGGEDARSVPILFLDIDGVLNRTATAPQINLEQDKVDRL
FT                   KGVLETSGADIVLTTYWRCFEDYIKYVLMRMGAQGDRVVGRTPGEPHLMDSVKHDDNVK
FT                   YARIVEIETYLTHRFGEDRSGWPKFAVVDDKQVVPAGHDWSDRFVKTEPEVGLTDERAG
FT                   ALATALNLEPAEVAAA"
FT   CDS_pept        17387..19420
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633335"
FT                   /orf_name="MICPUN_58276"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO63238.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AE1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D5"
FT                   /transl_table=1
FT                   /translation="MGLDAFPNTLWDEDQAGAVTMPAPAQLTAAIAQANTNKLSGAPSI
FT                   PAPAGSFPGATAATANPAPNLQANPIPDTWKPHPMDPLRFVKHEIRQLLLARGSLSIAQ
FT                   LPEEYLKCYRKPLTQALKMLDSQYTPESARSGKPSGRARKSTLGSFLREHLTDVIEVRQ
FT                   RPHGQHEIVATGAPNTNGTAMLNGNGMLNGNGMLNGNGMLNSNGMQQVTNDQYVAFQAG
FT                   LQQTWSREETPEERIRALILKQQQQQQQQQQQHLRQLRNALSQANVGAAGMATYDSPLP
FT                   LDLNGPLMGSQQVRDVLRSAQLLKGAGYNVDGANLAGLESLGVDVNASLLAMSRHGAGS
FT                   DALTAAAVGALRGAALLSPAASEIPAENRIYVTWRVPSKAIPLRVEDLWSYFSRFGQLA
FT                   FCNPRPLRNSHAPRRTPSLSGAGYAFLGFSDPGGADAVARVLERPSHALRGAEIRVKPW
FT                   RERDEDTGNGDAPAAAVAADVPHAVGDYYFPHPESGLPVLASAAGLAQLAAASNRSANT
FT                   QALAMNDMASLGFGLSSNISHRSASDVALDSLGFDETALFGEGFFNIGPDDSTTRAKLD
FT                   NGPTQAAQYMSAQSQLNAARNNGMWGGSGGGMWGGSSGSERSERSSLESPNASADQASN
FT                   ITFNPTMWQSSAVETSSASDETWTGSRLWNYTGGTAATGSGA"
FT   CDS_pept        19870..20613
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633336"
FT                   /orf_name="MICPUN_108194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63239.1"
FT                   /db_xref="HOGENOM:HBG560976"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI000199AE1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D6"
FT                   /transl_table=1
FT                   /translation="MKLRVLALHSFRTSGSIFRDQLEALGNWPNAIGDLCEFVYVDAPH
FT                   PASGEVPEDVASFFQGPYFEWWNATSFGVEGKEGKVLQYEGLERSLEFVEEVWRTKGPF
FT                   DGIVGFSQGATFTGLLAATGKVEGRGPFVPRDAGDPGAFAILISGMQARTDEAKRLYTE
FT                   ASGEMGMDIATLHIVGETDRAIPPAMSDRASQMFVEERRAVIRHGRGHVVPRLDGDNLK
FT                   SVRSWLQEQLNAKGRYRAGGTTAAL"
FT   CDS_pept        complement(<21105..>21938)
FT                   /codon_start=1
FT                   /gene_family="HOG000265407" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633337"
FT                   /orf_name="MICPUN_70748"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63612.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG594219"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI000199AE1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D7"
FT                   /transl_table=1
FT                   /translation="GESEMFQGTIVERIHYWTTEGWCVALDWGLRKTLGKEKGERVFGV
FT                   INHWVCERANPFMQLVYLSLVIGGYYVFVAYGFDLIGLFVHPAHAFVLPTVMTLSLMQW
FT                   LRVCWSDPGVINASNLEAHYRAHPFDGVLYRPKECPTLGVTVPARSKFCNTTKRRVAKF
FT                   DHYCGWFNNVIGENNLRHFIVFLAVHVALCAYVAYLSTAVVYGEVARRGLLVAEFNTRR
FT                   GPRRLTEDWLLLSKFLVYHYAPLVMLDIFLVVLVIALGSFLVYHLHLINKGMTTNE"
FT   CDS_pept        22110..23414
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633338"
FT                   /orf_name="MICPUN_58279"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63240.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG607780"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199AE1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D8"
FT                   /transl_table=1
FT                   /translation="MDDSAKRCLNCDASYKGLKRCPRCKQVYFCNATCQKEVWKEHVKV
FT                   CVPIDGEPAQPPPKQPSAAAAAKPPADSQAATAAPKPGDPPVQKTPEQIKADQLLRIRH
FT                   EILPEAARLMSAREFADAEEQLEDGVAIASQYDERELLNELSCALSKCFMIQDKYKQAL
FT                   EALNPALMHARREGGPEAMRPHSIAAEINKAKGDVDQMRVELRALMEAASESNDEQEQG
FT                   AALLLAGCLLFDVGDLNAAVPLLSSAATAGEKLGNHNMRAGARNRAGAALLRMRQPKQA
FT                   IEAWMDELKVLEQAGAEEAMAAMKVKEEPKEEEIEKKKPEMPPLGDTRGRRCKAHGNVF
FT                   MAHLLMGTRPAAEVHLQHALSIAKELGKEEEARVWLQCGNSHTLASVDGSNDGDATEAY
FT                   KKCLDLAKEVKSLELIAAAEKGLKKDLDVATMLRG"
FT   CDS_pept        join(complement(24538..24600),complement(24226..24309),
FT                   complement(23702..23887))
FT                   /codon_start=1
FT                   /gene_family="HOG000265383" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633339"
FT                   /orf_name="MICPUN_106883"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO63613.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG607782"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniParc:UPI000199AE1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5D9"
FT                   /transl_table=1
FT                   /translation="MANVIAMLGNMFAFKGTYQAEVTVGENENGESAIRRFRRAVMSSG
FT                   HINETRRRRYFENPQDIKKRKQSTPRKKKGAKPRTAAQALAEKEQAAMNQGQGRRGGSF
FT                   RGNAGP"
FT   CDS_pept        join(24846..24868,24990..25944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633340"
FT                   /orf_name="MICPUN_105524"
FT                   /product="Adenylate kinase"
FT                   /function="ATP binding"
FT                   /function="nucleobase, nucleoside, nucleotide kinase
FT                   activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="ACO63241.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0019205"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="UniParc:UPI000199AE1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E0"
FT                   /transl_table=1
FT                   /translation="MTRYADYGDEPTTIGYDDDLLVDEFASVRVKTLLDTYDSRYKTYL
FT                   DIDTVVRSRSGSPVTGAGLRKRPPRQKLAEKIVLALGAPESGRETTCAKLAKEYGFTQL
FT                   CVDGLLRAEIDAETPTGLHLMEDMEEGIPIETEVLCSVVKAAMAKVGAEGGSRKFLLDW
FT                   FPRDVREAKAFDDLVAGIDFVLFFDVDPMMSVRVEGCYPVLREREPKEGDEEDLLRRQF
FT                   EAFAASRAPVLNYFKGEGMAHHLRWSGTEDGRGILETEAREALAVEKVEPLPILTPEES
FT                   IAAHPDDAVVDDLVDGLAEDAHEFHELGGQSPRFVTRRTAPSVF"
FT   CDS_pept        complement(26480..27418)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633341"
FT                   /orf_name="MICPUN_58283"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63614.1"
FT                   /db_xref="UniParc:UPI000199AE20"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E1"
FT                   /transl_table=1
FT                   /translation="MTTTRVFRGEGDLMVDALIAASQAKPSDNGPQMPGFGRDLVPFFD
FT                   TDGNENTYGLASGTPPQGPEFTYEYQQPVMAQQNANGGGKKSKKKPPQPAQAQKKVPAP
FT                   KAVLQRGQQLPVPLANGQPKADKKARPASGNAKPGEKDVPNRWAGPAFGNSPAPNALPV
FT                   PTFMGGAAPAPLSSSPPKDAGDAIMQMLGQSPPVRAEVPPVHAASAPDLMAMLKIPKQP
FT                   ENGATVLPAPVRPAPLAHKTGSSPQLLTPELLAAMVAKPNGGKTPAQVQSERSSRLMSM
FT                   QSRHAAPAPPPAPPAAAQGDFSSFLMAKLSA"
FT   CDS_pept        join(27909..28718,28809..29846)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633342"
FT                   /orf_name="MICPUN_113352"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63242.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199AE21"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E2"
FT                   /transl_table=1
FT                   /translation="MAPRHGLILFALVFVCLFGFAGAMNPTPEHDNGHGEIQITEHEID
FT                   AYVEGNTVDIDSAHRKGLPHRGVWAVVIDGKKRVVLIRRGKDTVTCPGTWSIVGEHNDP
FT                   GESYFEALRRGVEEELGLTWATDVEAHWELDPSASLLNITYWDKFREEVQRRDLQWTMP
FT                   YVVALKKGAEINVDHKEVDDVLLMPFDAFMPWWGQHGHEICRTATAHVAKFGGVKTRPD
FT                   TPDSFAVGSIGDFTGRQVLRAFNAYKDGMKQRRQEKKEKKEAAKHGHELRISTLARAAL
FT                   SGRSRRIAMLATVLRSSVSPTVAPRACRGNVDRPTPVRALTIRGRCPVGPAASGRDDAG
FT                   ETSRLGRRQSAMAIATVLSGIDASSDFVRADPGAGQGIPAVTHTVFLDVGLCDSIVRAD
FT                   RALGNKGGVCTSPETLGRITIGLYGNLVPNIVRNFVSLCEASPGEGYAGTVFHRVKPGE
FT                   YVLAGQAGSYRLGQVQTPGFDSNPEMLSSASFRERHLSPGTVSLAVGAATGEGDGNGGY
FT                   SPARSAGTEFLITTGPAPAPSLDGENVVFGRVLKGMDVVTRIAAVPTFRPSGNSIAWNQ
FT                   VAEWLRDERAAKARESWSKPTQAIVITDAGVLTRPDPVT"
FT   CDS_pept        complement(29904..31460)
FT                   /codon_start=1
FT                   /gene_family="HOG000005895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633343"
FT                   /orf_name="MICPUN_58285"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63615.1"
FT                   /db_xref="HOGENOM:HBG561017"
FT                   /db_xref="UniParc:UPI000199AE22"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E3"
FT                   /transl_table=1
FT                   /translation="MGRGDKGDEELRAKLEETQRRLESTSRELVAALGKLHGSGPGSPV
FT                   RSRHRKHGSAEMMGMCPCGHIGATCMEHAATSFWRSFVLAYMVRAGVAVFTRGLGLMRG
FT                   KSPRDVLKLEKLIGENHTHYREDAVRLGLFLGAFTGGYHIVRCNMCNRLGFSPKKAAAV
FT                   AGAMGGLSSLFLKRKKRRTFALYLMARLAQGAYASQKNNNRFHFWGSHWSHGDILLFAM
FT                   SSAQVMYAYVMRPDTLDAGFWNFIVRAGPIDKETLGLIKDQCNGKHVDLRPALAARSVT
FT                   GAMDAFGPVVGEEVRCVPCQLMHRSTGCPGCTLHMAMSAKDTFRKCFPFYLSIHLVPFA
FT                   ILNAAKALRDPVGTVFKATTATVRSTSFISAFVALYMGTACVSRRIFQRDHRAMYYFAG
FT                   IVAAQSLLLEKKSRRAELALYLMPRAFDSFASTVIDKKLLPRVPHAELALFCVTAGGLM
FT                   HLYENEPDTLAGFMRSTIRRFVHRPNAPLPHSASEAMIQAVGDEDSDTDNGSPKTKANA
FT                   P"
FT   CDS_pept        join(31688..31797,31896..33375)
FT                   /codon_start=1
FT                   /gene_family="HOG000061500" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633344"
FT                   /orf_name="MICPUN_58286"
FT                   /product="Glutamine synthetase"
FT                   /function="ATP binding"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="glutamine biosynthetic process "
FT                   /protein_id="ACO63243.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006542"
FT                   /db_xref="HOGENOM:HBG299709"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI000199AE23"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E4"
FT                   /transl_table=1
FT                   /translation="MSLNTTESGGSHHHHDVLTALCDLPAMREVYTVEYVWLGGDLDLR
FT                   SKTRTLEGPFRSVEDLPAWNYDGSSTNQAPGQDSEVILVPRKVYRDPFRATAMDKDHIL
FT                   DHDRKNSSVHNRALYVEHRSLDKPALSPVAEPERSSATRPEILDGCRNLLVMCDTYEPS
FT                   GRPIPTNTRAAANAIFTLPEVSCEEPWFGIEQEYTLLDSTTRWPLGWPKGGYPAPQGPY
FT                   YCGIGADRMFGRKIADAHYRACHYAGLSVSGINAEVMPGQWEFQVGPCVGIDAGDQLWM
FT                   ARYILQRVCELTGDVVVTYDPKPVPGDWNGAGAHCNYSTRSMREKRLGGMNEIERAIRL
FT                   LEDRHAVHIAAYGPGNERRLTGKHETGAMDTFTWGIADRGASIRVGNETASTGAGYLED
FT                   RRPSANSDPYAVTSLLAETTLARSWCSEQGSSSYDARNVLGGLSEALKSAKLSNAASSL
FT                   EDDDSSTAEVDQSFKSKSSQAGSGNMYEFGVPITPEKTPPPETLQEYLTRPATVDSKGR
FT                   VHRSPIGDDGSL"
FT   CDS_pept        complement(33584..35926)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633345"
FT                   /orf_name="MICPUN_58287"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63616.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199AE24"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E5"
FT                   /transl_table=1
FT                   /translation="MSSSSRALRRVGSLASRALGPVSSTPAWTGDVGYWRGVAARNVIW
FT                   ARSDAASASRAWTRGFGGFASEVTAHGRATRLDRREHLASRLRGLASGSPARRSPTRLG
FT                   DIRRLSTESRALLAAAGKGGEDSKPPEVSSKAAAAVKKAVADTEKDIDLKILRTLLPYV
FT                   WPKDNPEHRTRVVGALSLLVASKFLNVGTPFMFKYAVDALAIAGAGAATGPEAVAALPA
FT                   AVIGLTPAAMLGGYGVARAGANFCKELQNSVFSKVAQASIRGVALRVFDHLHNLDLQWH
FT                   MSRQTGAVTRTIERGTRGIQFILNSMVFNVAPTAFEIGLVSYILGTRLGPEFAVLTVGT
FT                   IGAYGAFTVGVTQWRTQFRKEMNKMDNEAGNRSMDSLLNYETVKYFNNEAHENNRYDEC
FT                   LRGYEKAAIKTQTSLSALNFGQNAIFSASLSAAMLLCAGGVARGELTVGDLVMVNGLLF
FT                   QLSVPLNFFGTVYRETRQSLIDMTSIFKLLEQSADVVDKPGAPPLVVPPGGLDIEFSDV
FT                   GFGYGGGSKAGRADILHGLSFKVPAGSSLALVGASGSGKSTVLRLLYRLYDVQSGSVKL
FT                   GGQDTREVQARSLRREIGVVPQDTVLFNDTIYYNIAYGKEGGEGEVTEAQVHEAARAAA
FT                   IHDPVMTMKDGYQTKVGERGLKLSGGEKQRVALARAFLKGAGVVLMDEATSALDTKTEA
FT                   GIMDTLDNLMSGRTTILIAHRLSTAMHCDKIAVLEGGKIVEQGSHHELLAKGGKYKEMW
FT                   DAQAHGARGGGDEPDNEIDTSADVVLK"
FT   CDS_pept        36104..39313
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633346"
FT                   /orf_name="MICPUN_58288"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="ACO63244.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG610628"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniParc:UPI000199AE25"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E6"
FT                   /transl_table=1
FT                   /translation="MNELKARALQLLRASADAPSATSPRAGAGDDPSTPSSSSKKGTTP
FT                   SKQGAKKRTPGGGTPVTPGTVGSTPGTPGGTGGSGRKGKGRARFAEFWPRDVVREGLRE
FT                   QHLHEGKIRVNPHRRQEAYVSLEGVPHDVKIDGYAAQNRVIDGDTVVFAIDPIEDWPAL
FT                   MEEKTPRKASRGGRGATGDGAAPEAPAFRAEAGAGAGLGEDDAEGGEGDAYWKTVDAED
FT                   DYGDDDLDLDDDPYDEDVLPGRVRRLAIGGGLVDAAGPVKPPSIATLAVAARRGGVNGT
FT                   PLRPTGRVVAVSQTSPRRETVVGYVGFAEEEFGFGGGRNGKGGTGVPTRNPEGGTGTPA
FT                   SRKGKEERYPDNIPPLRLYPTDPKLPWMIVDMSPSFLPAPIAALAVENGGAGLKGILVS
FT                   ARVSKWSTSYVWPHCQLRESLGMAGELETETAALVAENNILGVEDFTEAALACLPAVPP
FT                   KESGLTWKVPEAERAARRDFTGVRVASIDPPTARDLDDALHAETRPDGTLVVGVHIADV
FT                   SHFIPAGSALDKEAQQRATSTYLVQRVMPMLPRLLCEDLCSLNPGVERLTFSVEWEMTP
FT                   DGVVKSEWFGRGIIKSCAKLDYGVAQRVIEARDEGRTGVDELLEAVNDPSGPVKVGPED
FT                   GGPGSWDPSAVAETISLLNTAARAMRRRRFEGGAVRLDQSKLSFEIDPDTGNPRGASAY
FT                   VIRESNKLVEEWMLMANNAVATFIADAYPDRAMLRCHPEPNERKMGELEQFSREQGIDI
FT                   DASSSRALHLSLQRLKEQSADAYEVAQLMATLPMQLARYFCTGCQDEDSWGHYALAMDR
FT                   YTHFTSPIRRYPDVVVHRLLAAALEAGFRGRGNKKHPRAPKRADINAAAKKFGIPKSDK
FT                   LQAIADHCNERKLAAKNCQDGSMHAYLCAFLRASPQCVSGIVRAVGRKYLCVFVPAYGM
FT                   EVRVQMDGARHVAVTQEEGAGPDASPASVTVEWASEVDAGTIATATDGSKSTSKADRKK
FT                   AMRDTRGARGRFLNSTEEEEGAIREYVNGRGVLPAPALEIPATIRPVQRVCLLLGARFR
FT                   ERAKPEVTALLLLKNPLWTEA"
FT   CDS_pept        join(complement(42936..43097),complement(42594..42804),
FT                   complement(39709..42455))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633347"
FT                   /orf_name="MICPUN_58289"
FT                   /product="Adenosylmethionine/pyridoxal dependant
FT                   decarboxylase fusion protein"
FT                   /function="adenosylmethionine decarboxylase activity "
FT                   /biological_process="spermidine biosynthetic process "
FT                   /biological_process="spermine biosynthetic process "
FT                   /protein_id="ACO63617.1"
FT                   /db_xref="GO:0004014"
FT                   /db_xref="GO:0006597"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="UniParc:UPI000199AEDB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E7"
FT                   /transl_table=1
FT                   /translation="MSESIESDSSDNRYNFHSIDTNVEVETTWTPFEDVADLRPWGYVG
FT                   NKRAPAIADRTDLTHAFFHTNTNFFELAATSPAFDAPVAVASLNVTMNNTNDTNVLPCP
FT                   HFEGVEKRIEIDFHAGGLQRGLRSLPRDILDDAMTAAECLIVSKRTCAAFDAYVLSESS
FT                   LFVYPTKVVLKTCGTTKLLNAIPMFIEEAAKLGMQPRRAKYTRSTFMWPDEQPLEGNFD
FT                   KEVEFLERHFGALGDGGNAFVLGSKTKGVQWHVYLADDNSGAFVDGNGTEGSECSTGFE
FT                   THSAPAARANLPDPTVSLEVCMTDLDREHSKHFFRDDTYESCQKTTDNCGITDLFPQFD
FT                   IDPYVFEPCGYSMNALSGSEYATIHITPEDGFSYCSVERSNIPVSAADPEDYLRRVAST
FT                   FKPGKFSFAVSTDAALPDAANIRRVPTLPGYRRIQASHQEVDASGGAVSFYTFERLPDV
FT                   HVPVPTLPAVNLAAFKPGFEAGHDSDRNTDSEEDAPDRKKFRPLVETPDITREVRPSSI
FT                   VSSHVAESGFELNRCPSVNHMEAPVHEHEPSTLSNHMTEYAGIATLRTPLPTSFPLARA
FT                   FAGYDSEVINTLIGQHCKPLVGSGGKTIDNFCLDIIENGLALPTTDRLARFCVVDLGVV
FT                   MRRWRYWRATIPRAMPHYAVKCNPDTGVLAILAALGSSFDCASATEVDMVMALGVTPDR
FT                   IIYANPCKMPAHLARVRDCGVGLTTFDSVAELHKIYELAPEMKVVLRLRADDPDARCVL
FT                   GNKFGAEPPEIEPLLTAAKHLGIHVEGVAFHVGSGATNPRAFRVALERARLAFDIAERV
FT                   GLPPLKLVDIGGGFSGSVRTVAATNDSDVTLTEVAKTVNAALEEFFPESSGVRIISEPG
FT                   RYFAEATTTLATMVFSRRIRSEEDGSVAKGGDTHQYFVSDGLYGMMNCLLYDHASITAR
FT                   ILPVSTNAAALAGGDLNGIVPRGVYSNEEDTNGLTKYPSTVFGPTCDGIDKVLENTLLP
FT                   EVSIGDWLLFPHMGAYTVSAGSNFNGFDCAGVRKYYVASIVDGDPDEIRR"
FT   CDS_pept        43996..45450
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633348"
FT                   /orf_name="MICPUN_58290"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO63245.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199AEDC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E8"
FT                   /transl_table=1
FT                   /translation="MRRARRDEDADCARRNRALLVLFCCVEFVGALAINAPLPFLSTML
FT                   ERSGCTPTQLGVVFSALPLAILVGSPIVAPLLWRVGALRIFTGSMFALILSLLVPLLIS
FT                   AHEPCGVGEGLVACDKSKTFIITTLWTLSRFGVGLVEAFISVTCLCLITRHMPQRMASA
FT                   YGAIEFAMAVGGFVGPALGGWLYEIHTSPTLPSIAIAMAVAMEIPYVYSVSLQTDFDAP
FT                   VAKGVDVEAQVKSVGYGSVDNVALPRRQGSLKIRGGGEGVASDAKTEMKRRNLLTRPLF
FT                   IACVILTMTLSAVCGVIDVTIPLHWEKSLGMNEGAIGSAFAVQSAIQAVCSLLVGPIIE
FT                   EGLSGSLSEFALGGSTLCALGFFFFGPSRNLPLSSNSQWRGRGWQGWTTRVYIASTLYA
FT                   VGRGIAEVPLLPLMQESVSDLGAEYIEAVAGLFNVWYYLGEMIGTGFGAEWGEMIGYES
FT                   LYSVAGFGMVLAGTVFLTVRILSGEC"
FT   CDS_pept        45575..47245
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633349"
FT                   /orf_name="MICPUN_58291"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63246.1"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="UniParc:UPI000199AEDD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5E9"
FT                   /transl_table=1
FT                   /translation="MTADQSPPAFAEMGEEIAKGWESLQEDMQRLIMDPPGTELGGRGG
FT                   PEVEHHSPRSLVDDGTLLPVSERPAGTTAEVQAEEPLRDIGEKMGGWFRAFAAEIAGVF
FT                   DDRDDQRGRDKPFARGASTAQDGVRVGIVEDGRTQGQTSTMTTPDRMHAGGDASSAGEA
FT                   GRLRRGGFDDDPGRGDDDDPGSASPGRIGPNAGFEPLFSVDGVERNAPPNVETRGGYYT
FT                   DGNDPFGNYPFVLNRSLDAVPVTRRPGDASGSFALEAQRLWGNPGRFVSFDDCAEVLWS
FT                   LPEALQALRACDAAVFRFNFRYVSSNDSTPEERLGAWRRDGSDLCRATLHALVSCGGRF
FT                   GSCVGTPSHRESLVNAVEGYVTGGIQGKVFHGVKETYASDDAEAERALAAIESLPPGAL
FT                   DLHPSHLNAVDSFAVGTIRGLANASCPRHMATAVCDVVRHLAANCARLRSWREEEERSG
FT                   ASLGAGAANGDDVADGDEPAPAPSTDDLLSLLVVLVAKARLRHPVSLAMYMDSFHALIG
FT                   SQHVGEIGYALANFYGAVQYARSEPMRDLLTEWGIHLAN"
FT   CDS_pept        47470..48315
FT                   /codon_start=1
FT                   /gene_family="HOG000233205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633350"
FT                   /orf_name="MICPUN_82345"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63247.1"
FT                   /db_xref="HOGENOM:HBG634462"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199AEDE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F0"
FT                   /transl_table=1
FT                   /translation="MARAEASASAGTGADVVFALDFDGVVCDSEPESSISGWKHGVDLW
FT                   PEVFGPADAEKGRVLDELRLVRPVVETGFENTLLARALLEKIHTVDDIIADWGGLMPGL
FT                   MERWGCDRGEMVAGYGKIRDDWMAADLDGWLAPNLVYPGVAEACIAAEDSANCDVFIVT
FT                   TKQARFAQAIMRRKGNLRIPDNRVFSQTVSGLPKTDVLADLQANARDDDVRLVFVEDKL
FT                   STLEKVCKVGTALERWELYLVDWGYNTEAERARAAANPRITVVNVDEFVGMLNGAAEGK
FT                   "
FT   CDS_pept        48540..51716
FT                   /codon_start=1
FT                   /gene_family="HOG000244610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633351"
FT                   /orf_name="MICPUN_58293"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63248.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG309953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199AEDF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F1"
FT                   /transl_table=1
FT                   /translation="MSSVHASASALAWRGVVGQHRVDRARPPTRRGGRSIASGRRVATV
FT                   SCEAGEARAIDPRLDAVVDSLPIREVLYRCLDALDESTGLVLQAPPGAGKTTALPLAMI
FT                   LSNPAWLPRTGKVIVLEPRRLAARAAATRMASILNEPVGKTVGYSVRFESKVSPATRVE
FT                   VVTEGVLVRRLQRDPSLDGVFAIVFDEFHERSLDADVALALASETRSALRPDLRLVVMS
FT                   ATLGDVGPRASEMLSRGDGGPSCPLLVSEGKSFPVETVYLGPPGRNFGDLEDATVAAVR
FT                   RALSDAPGVDGGDVLCFLPGAAEINRVVAALRDGQSESLSVLPLYGALGQAEQQAALAP
FT                   APGGTRRVVVSTPIAESSLTIPGVRIVVDSGLARRPRFDSNKGMTRLDTALISVASADQ
FT                   RRGRAGRVAPGTCYRLWSERTHAQLASDAEPEIANADLAPLALDLATWGIRDDEGVTSL
FT                   PWLDPPPAGRLSAARDLLTRLGATEEGTGRVTPLGERMARLPLHPRLARMVLWGASRGP
FT                   ESCRMACQIAAVLSDRDLLRGRDAPADVRARLGALWSLGDGGADGPGLARWSLEARAAE
FT                   PTPAVPPSTPKAPIDPAAPVRVPIGTKLPKGKNKGGKFKGAPKGRRPAGGGVQAAAKAA
FT                   RAAASSAGAGSSSASSVGGFGAAYGGYRGFEIDRNATREAGKVVSQLLNAVKVLAADDG
FT                   GEWCAPGVGGGDPRGPCWDFLLGEGENEAGVLLAVAYPDRVGVRRSKGGNFQLSGGVGA
FT                   ASVPGSDPLARAEVLAIAEMTSGDVGGGARNDRVRLAAPVPLTALEPDGDRPGCLADAL
FT                   CRRRDSVSWASASKAVVARRQLCVGDAVLRESPFQPTPDETVEAMLCGVKEMGVRAALG
FT                   WSDKTESWRRRVMWLRTAGGADHLPDLSDAALEATLDDWLAPMLPGVTSKSAMHKQLDG
FT                   DGLVRCLLTYEQTMEVDQSCPTHVVVPSGSRLPLDYDTPGGTPVLRARLQELFGMAETP
FT                   TIGPKRVPIEVHLLSPASRPVQVTTDLASFWKNTYFDVAKELKGRYPKHYWPDDPTTAV
FT                   ATNRAKPRSK"
FT   CDS_pept        complement(51757..54453)
FT                   /codon_start=1
FT                   /gene_family="HOG000244873" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633352"
FT                   /orf_name="MICPUN_94136"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63618.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG309409"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="UniParc:UPI000199AEE0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F2"
FT                   /transl_table=1
FT                   /translation="MEDDSADAMYETILQWSMDVKGVELYEAQEEAILELVEGNNVLLT
FT                   TPTGSGKTMVATAAIAAATARGDAAWYTAPLKALVTEKFFQLVKDFGAKNVGLLTGDAS
FT                   VNPTAPIICCTAEVLANAALRRGRDLDCGLIVADEFHFYTDPDRGWAWQVPMVELPDAQ
FT                   FLLMSATFGDTSKFQRHLERNAAGRDVGVVGGGERPVPLEFEYRETSLIESIKELVDTD
FT                   RAPVYIVNFSQREANERAQDLCSTLSLTADEKKALNAELEGFKFDTPVGNELRRYISFG
FT                   VGVHHAGLLPKYRLLVERLAGKGLLKCICGTDTLGVGVNVPIRAVLFTQLCKFDGNKTR
FT                   LLTIREFQQIAGRAGRRGFDTKGFVWCQAPAHVVENKRAEAKAAAAAAKSGGKAKKVKK
FT                   AQPPDKNFVMWNEDNFRRMETGVPETLDSSFQVTHSMILAVLSRRGDGKRFLRDLLVNN
FT                   HEPKIRQRKHQRRAISMYRSLKDAGIIQEAGTMDTSGRAVNLGFDIGDQFSLTQPLSLF
FT                   AVEYLPTLLNVHGEDHSKRSKLKDERYALDVLSVLEAVLDTPGAVVSAQLSKAKTRAVN
FT                   KMKGEGTEYDARMAVLEEMDYPKPLADELEAYFEPFKRRHPYVGGEELKPKSIARELYE
FT                   SGFDFNKYVTHYGLNRSEGALMRYLTDAYKAMVQNVPESMKSPAVIDLEEWLGETIRRV
FT                   DSSLIDEWEALKDPVAAARAAEDEAAALAAIGIGKQSGKFTAGRAFRVMVRNAAFRWVQ
FT                   LLAIGEEEDMAQLASENLPPRGRDNPWTMDELYAAVDPYWRTHDAMDDGYEARSPDLFD
FT                   VSDEGADGEAHWRVVQKIRDPAGDLDWCVEGEVDVEASEEEGRLVMRLVEIRQEGAVRK
FT                   EEEKVVPSEEDIWAALEEEEEYEDEDE"
FT   CDS_pept        join(55074..55142,55227..55364,55509..56567)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633353"
FT                   /orf_name="MICPUN_108200"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63249.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199AEE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F3"
FT                   /transl_table=1
FT                   /translation="MADLDLKGAPWTDAEDVQLSALQAKHGNRWAAVAAEMPGRTGQQC
FT                   AQRWRHKVNPNIRKDKWTEAEDRQLQALVDTYGLRWADISRRMEGRTDQQCMGRWRRHL
FT                   DPSVSRKQWSTKEDRKLAELRVRHGANWSAIAKTMKNRTAQQCRARWFQAHFTGHRYLD
FT                   DSGALLSPRSADKAEREVEAAKAAAAAAGKTLRPNGVKAANNNNLNNILNNIKPLPEVD
FT                   SASGSPEGRKKRRRDSSGSSQDEKLQRRNSGHLRRDGSGRFIPREDSLPHPFVTPPPTT
FT                   PGVDDSVGLDVSTVPPPIRVKPAGLHRDPSLGLGRQVSLPPDIATLLRGEAQDTGRAAE
FT                   PLAQFNSGDWGALLTGELGSVTAVLDQLGEAEMLGGRESIGKLESFGSLQMLTRQRSGN
FT                   MLTRMGSCNDSFAQLITPELVK"
FT   CDS_pept        join(complement(59029..59403),complement(58238..58873))
FT                   /codon_start=1
FT                   /gene_family="HOG000100058" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633354"
FT                   /orf_name="MICPUN_105532"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63619.1"
FT                   /db_xref="HOGENOM:HBG610978"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AEE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F4"
FT                   /transl_table=1
FT                   /translation="MASTTVVAVVARAVVSAKSSSQRGLGSATRVRGVAVPKTSARLST
FT                   RRSAARGALKVSANGLPPNLAGMMGNMDPEKMKEIQEAYAKAMKDPETAKKVNAQMAQM
FT                   QGMMNNPMVQKQMQAMNNMISNPDMQRRIAALKDDPDFQDFFNDVQKNGPSAMMKYSND
FT                   AAFLKKLNDKLGGEDAIRAAVGGSIPGEPAAAPAAAAAPTPEVETLHDAARYGDVEAVE
FT                   DFIAIGKDVNARDSSQRTPLHYAIAFGKGDAGEEIFNQLIEADSDLTAVDEKKNTPLHY
FT                   ACGYGKTFAVRALLEKGCDITAQNGTGKTPIDLVKLEAKNPINEETDLIEKLTPA"
FT   CDS_pept        join(59888..61756,62037..63296)
FT                   /codon_start=1
FT                   /gene_family="HOG000008829" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633355"
FT                   /orf_name="MICPUN_105533"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63250.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG413876"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniParc:UPI000199AEE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F5"
FT                   /transl_table=1
FT                   /translation="MASGMMMTTTRALAPVAARSASRGVRAAVRAGPSRGFAPSLGARR
FT                   SVYCKAVEAPVNPTELKPPANLHGFELVREDYVAEYDSKVFFFRHAKTGAEVMSLSNDD
FT                   ENKCFGVTLRTPPANSTGIPHILEHSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTYPD
FT                   RTCYPVASCNLQDFRNLVDVYLDAVFHPRCVDNEKTFQQEGWHYELDSPDQEMTFKGVV
FT                   YNEMKGVYSSPDSVLAREAQQALFPDNTYGVDSGGDPTVIPQLTFAEFRDFHGKFYHPS
FT                   NSRMWFYGDDDVEERLKILDSFLSEFDRKEIDSTIATQKYFTEPKRVVASYVAGEGEEA
FT                   DKSFVQVNWLLNDGPFDTETALAVGFLDNLLLGSPAAPLRMALEESGLGEAIVGYGLED
FT                   ELRQPTFAIGLKGVAKEDIPKVESLITETIAKIAEEGFTQAAIDSSVNSIEFAMRENNT
FT                   GRFPRGLSLMLRSLSAWLYEGDPVEILRFEEPLAKLKARMAKEDVFTPLIKKMLIDNTH
FT                   KVTIELNPDKELGKVQDDEEKAKVAAYRAGLSPEEIEKVVADTEELKRLQETPDSPEAL
FT                   ACIPALDITDIPKEAKSIPTDVSTVGATTMLTHDIFTNDILYAEHLMDLHAVPMDLMPL
FT                   VPLWCRAMQRMGTSKRSFVDFDQLMGATTGGFSLSPFTSSIRGSDDVSAYLVLRGKSTS
FT                   AQAGQLHDLMAEMMLQAKLDDKEIFKQLVLESRASMESRVQSGGHSVAAGRLDAMDSVA
FT                   GYVGEQLGGLAQLEYLKTLAKRIDTDWDGVVADLEKIRAAVVSRAGSVTNLTADAKTLD
FT                   ATAGAVQSFLDALPAEGTGAATEAWSKDLVLPPVNELITVPTQVNYVGKGANLYKSGYE
FT                   LHGSAYVINKLLGTTWLWDRVRVSGGAYGGFSDFDSHSGMFSYLSYRDPNLLKTIANYD
FT                   GTVEFLKDISLDKDELTKAIVGTMGDLDSYQLPDAKGYTALMRHLLKVKDEERQQRREE
FT                   VLATTEKDFKKFGEVLEATRAPEARVCAVVSPDAAKAAMKERPDLDFKVTSVM"
FT   CDS_pept        complement(63390..63959)
FT                   /codon_start=1
FT                   /gene_family="HOG000012790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633356"
FT                   /orf_name="MICPUN_108203"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63620.1"
FT                   /db_xref="HOGENOM:HBG561104"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniParc:UPI000199AEE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F6"
FT                   /transl_table=1
FT                   /translation="MVAGALTLTSCGPAAAEAGQKPPPVIDMPGGCTLEALDLFKDTRA
FT                   KFSLEVGTGALPEAVLDLGGCDYSGQDLSGKILSGVIATGANFSNATLVGAEMSRAKGQ
FT                   DAIFTGADMRSVNAYEVNFGGSDLTNVDFDNAILTNARFGKGKGGEWAKLGGANWEGAL
FT                   LSSSDAQRVCENPTVDDYGKAILGCK"
FT   CDS_pept        64278..65144
FT                   /codon_start=1
FT                   /gene_family="HOG000239535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633357"
FT                   /orf_name="MICPUN_100333"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO63251.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG609299"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199AFA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F7"
FT                   /transl_table=1
FT                   /translation="MAKTVKSDAKKAAKKAAAEHQKKLEATVKAAYDVDPATALAPFLA
FT                   RPFSKNGIDAVAAPSTVKQLSADDKKWIWKLLEGNMRPVFGEEVWKAREGKDKKNEMVD
FT                   DDARYIIVRSAPAADPENADPNGPAAPGEPLGFVHYRFVIEEDVAVMYVYELQLDAKAT
FT                   RKGLGRYLMMLCEALAKKASVSGVMLTVQKANEGAIKFYTGCKYVMSVISPTKVEPWAA
FT                   DEYDYEIYNKIWDADALKYLERSARVQWAENKKMFDQAQMFVMSNEELNKELGKELAAA
FT                   KLAEASA"
FT   CDS_pept        join(complement(65626..65848),complement(65199..65467))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633358"
FT                   /orf_name="MICPUN_58300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63621.1"
FT                   /db_xref="InterPro:IPR013240"
FT                   /db_xref="UniParc:UPI000199AFA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F8"
FT                   /transl_table=1
FT                   /translation="MSGPGLFEPGEEYVPAGIKPVVDEATLPTAPAAGGEELWLIQIPA
FT                   DADPADLDGLRFRISDEGNGPEISQFKAGGKKWRLKEDDAITASTMFVLPSKKAGGRQE
FT                   FGGPRRITRRITMNRRNIGIEDAAANEEGAKTPGEKKEKKRKKDKDDKGDKKSSKKSKK
FT                   "
FT   CDS_pept        join(68088..68852,68901..69419)
FT                   /codon_start=1
FT                   /gene_family="HOG000265392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633359"
FT                   /orf_name="MICPUN_81588"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63252.1"
FT                   /db_xref="HOGENOM:HBG561126"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="UniParc:UPI000199AFA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5F9"
FT                   /transl_table=1
FT                   /translation="MGTASDADASGGTKTRAVVVDLYTGEIESDVVLPFKAAHVLPLHT
FT                   GASHEHAEHAHDASAALLVDAAGSAAHVFPATSEARDAAYADRARISYYTVDQERNELR
FT                   GYGLLPASLDKATGEAPASYRTTQTWSQRFPPEVGQIVGYAAKPADEIVHSWTRVLGDR
FT                   STLFKYLSPNVVFVATAPKDAPAGQSSVSAHLIDAATGRVLYRVRHADARGPVHAVVCE
FT                   NWVTYHYFNTKAGRYAMSVLEMFDDAEHRKGAATVSSLAPPPLRIMGQSYYVRPAATMM
FT                   ATTYSAQGVTGHQVLMGTATDQVVALDKRWLDPRRPTKPTKDDKEEGLIPYTEVLPVFP
FT                   QSWVTTRHQVAKLQGIVTSPASLESTVLFVAHGLDFFFTRLHPSRSYDMLDEEFSYLLL
FT                   VVTMVALAAGAFVTQGLAYKKDMEKRWR"
FT   CDS_pept        join(complement(70020..70450),complement(<69691..69911))
FT                   /codon_start=1
FT                   /gene_family="HOG000214172" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633360"
FT                   /orf_name="MICPUN_76020"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63622.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG713373"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="UniParc:UPI000199AFA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G0"
FT                   /transl_table=1
FT                   /translation="MRLGWPTGTEDVLRVRSGFVASFDARTRNPRWVLEVINPRTMSGP
FT                   GNRRRSEFVEDAETPERFRAKLADYRGTGYDRGHLAAAAGHKDSQRAMDETFELINISP
FT                   QVGDGFNRDYWARLERFTRELSGRSGGDVLVATGPLFLPTPTTRWRMDYNLLGEAPELV
FT                   GVPTHFFKVILATSPETKAVAAAAFVLPNAPIPADTPLEKFAVPLERLEAASGL"
FT   CDS_pept        complement(<70893..72004)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633361"
FT                   /orf_name="MICPUN_108204"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63623.1"
FT                   /db_xref="UniParc:UPI000199AFA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G1"
FT                   /transl_table=1
FT                   /translation="MAEENIAERTRFRLMLKRRKAERLKAEAAERAAMERAVTAKQRER
FT                   FERDSIRRAAELAARREEYKREMDRMTAGRTTRPLNLREVVAAWDEIKLHASMKFGCDL
FT                   QTDVGWEGLTVQPAGLQRVVNEVREAFGDGTVTLSRDDTADDDEEDDEEEELERVGDGM
FT                   EEARHDGVGDDVHDDEADDDGSTPKRRWLASHRLHHGAAEFLEACANEGHEVLVLGGPY
FT                   RSAACVRTVLTHLGVRVDQTETGSNDEGSNTRAETNAKTNSTNGPLVGRVRVVGAEEGT
FT                   ARGLVVGAVMREREMPWQRWHLIDSSLSELERVARSELTVGFKARYASWVPALHKDKVR
FT                   AEHAAGVEFIDYDGLFGIVGLETPSSVLDS"
FT   CDS_pept        join(73101..73108,73123..77815)
FT                   /codon_start=1
FT                   /gene_family="HOG000265394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633362"
FT                   /orf_name="MICPUN_105535"
FT                   /product="Transcription elongation-nucleosome displacement
FT                   protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO63253.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG561145"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="UniParc:UPI000199AFA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G2"
FT                   /transl_table=1
FT                   /translation="MARRTRTAVIEEDDDDDDDDSDDEAAKKRKRREEAFELDEEDYDL
FT                   LEDNQVTGFKRKLKKKRLQKASDAEKAKPKTADDLEKDLFGESDDEEPDKAEAAEELKD
FT                   LQDDKEVFKAGAAPQGDFVASDDDSEDEFADFIEREEGQPKRRKIKSHITGVRSEQLQD
FT                   AVDIFGDLGELNELFAMRHRGGAEEEDEYEDDDEDDENDEDDEETDADALAGEGDEALD
FT                   AEPKPKPKAKKAKKAKKKKSRGGVSGGWQSRFEPSIVKEQMLTAEDDEIRATDWPERMQ
FT                   LNPRYGGKPEDPQAEAKWILDRLMGLDSVRDMPTYGGDLLLTGWADDVDLEQHRAREHL
FT                   VRTQNQLPKGEVEAVTAAIAALLKAVHEDGLEVAYVAQNMRDVVEPLMRGRRDDSRPPP
FT                   RDANGAVLERRVHRRDVIHEIMEWDRRFSRLAQRRKEMMKKIDAAAEILERDAAPEQDL
FT                   SLLSSLANECEDAPTEEVLSDVEACLTLRFHEQLTEVEQSGKADGSLGLTRQLRPLNRS
FT                   QYAHHCKKGIRDLLPTYGADPRDLGASLGSYRRTKVSQAVPDMSPEAVAEVYVGDETGY
FT                   ADVSSVIRSLVHVAAAEIAAEPAVRAWLRRAIRRKACVWTQPTPAGTEAMDPFHPLAEI
FT                   KRLQGKPACEFGGAEFGAVLKAHRDGLIKLRIALPDVVIQELTNEMESAYVIEEVSEMA
FT                   DAWNKLRRDALAGAKAALLPALTREAAVALERDAASEIRRLCGESLWRRVALAPWKPDV
FT                   RDHDQFGADDEVEVRVLAAVWGPGDPPTTFAMLDADGELVDFLQCPNIAVGGKFGAATA
FT                   RRQADMDRLIQFMIEHRPHVCVVATAPGQLHACRNLKENIALVIGKILEDHARAIPEEV
FT                   NTIQLHFIDDTVPALAASCAAMRTEFIEHSTEIRHAVALGRYIRNSAAVVAALAAGGEA
FT                   RALNLGPLQDALTPEEKMGIFERGLIDVINQCGVDVNAAVAHPWQQYQLHYVAGLGPRK
FT                   AGSLVAAVRGSSGGALESRDQLVSELGALGPCVYKNAATTLRVIDDDVLDRTRIHPERY
FT                   DHTLEIIANAFDYDFENLKSASASVKRKTLERAMDPDNWDKLAVLDLRAYAEYLNGQGS
FT                   GWLLSALRELRMELRDPFGEIRMSWQPLSTWEEFSLLTGETRESLSPGKIVHCTVKRLV
FT                   PPRREEGTEGHVVVQLESGVMGHIAKSDLSDRPVDRLEHKVAVGQVIAARIINANYEEN
FT                   TVYLKCKGSALSAEESKRIEFQTWGNKLYYSCEPLDGEVAKPTKPKKRKDAASRQAFIS
FT                   RNIDHPLFQNISAQQAQAYLDNKDIGDIVLRPSSKGVTNLSITMKIFDSMVQHFDIKEG
FT                   KKPGVGHTANLALGTPLTLEGTDYDDLDEVYARFVEPLVSSLKKLIKHRKFLRGTRREV
FT                   DQRLKAELARYPDTRPYALSVSHEHSGFFCLSAILSRSGNVRHEYLSVKPGGFRFRQRE
FT                   FGDVDRLLNFFKQRPVPDRDQVRQQQQQQPPPMPQQPPPQQYQHHHQQQWQQQQQWQQP
FT                   QQAYGGYPPQGMPPMPQGGYPQAAYQNYPPQQGGYPPQQQQWQGGY"
FT   CDS_pept        77931..79223
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633363"
FT                   /gene_name="SPO11"
FT                   /orf_name="MICPUN_97333"
FT                   /product="Type II DNA topoisomerase VI subunit A 1 "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="isomerase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO63254.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniParc:UPI000199AFA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G3"
FT                   /transl_table=1
FT                   /translation="MLAATDGPLLGVNAWGDEDPEPTDEPEAFIDGCDELATPEEVLTK
FT                   LEKLAADLVLATLRSDPPATPVPAAAISFTVANVRRDGAVLVSSDGPLAAHRVPLSATT
FT                   TLSLRDPNKRRAERYARIWTMLASSHAHLRRNEKVTQRGLYYLMSSGAHTSSLFPDPAT
FT                   VNSALLDSVSLVAVSRRSLGVVAAPRGEVGGAMSIREGEDAPWRSLWDESRQISGDIAA
FT                   IARWEFRGDFRYVLVVEKHSVFHRLFAEERVHTRLPCVVVTAKGFPDLATRAFLKRLQL
FT                   THPHVPFLGLVDWNPSGVLILGTYRAGGRTSSAVLESSRYALELKWLGVRSADLATNPA
FT                   RIPLTDLDRAKARTMLRADGARLDGDTAGDESTDASTERLQSARARELTAMCATGFKAE
FT                   IESLCPGSCGGEGRSLSDYVVEKILRGDYAD"
FT   CDS_pept        join(complement(80127..80184),complement(79312..80012))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633364"
FT                   /orf_name="MICPUN_58306"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63624.1"
FT                   /db_xref="UniParc:UPI000199AFA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G4"
FT                   /transl_table=1
FT                   /translation="MERQGALFTRVREEASTSAAEKQTRHHEPLWPTGPKYHRYLIQLC
FT                   VRVTLACERAARADADGASPPPRSPFEGVAGAELFKEFNRACAGRPLEVLHERGLLELF
FT                   PHVRGLQRAGEERLPIPPVLRSPGWSHFSTAAAKMQRLLSAARALREALADPDARDGHK
FT                   YAAHQTALVYNCLNHAGGEAWGLRARVEERFDEVKKFCDETFGADETFGARLPPDLAEW
FT                   ALGVAEEVEACVLGLPPKLTEGLGPVLRSC"
FT   CDS_pept        80308..81429
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633365"
FT                   /orf_name="MICPUN_58307"
FT                   /product="Predicted protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="ACO63255.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI000199AFA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G5"
FT                   /transl_table=1
FT                   /translation="MTPYQWFNVVSSLGYVLFTATTSTVTMLVPAIILLRPVSANLYAR
FT                   CTSWIFACWWTSCLFITERLNGVKVRVTGDALPLNAPLLIMSNHKCNLDWMFLWSSAIR
FT                   TGSMFHVGVFKAVAKSEIRVIPIFGWGCKLNGFAYVRRRWSSDASHLTSWIQSQIRRRL
FT                   NANWTLIFPEGTRYTDRNKERSDLSCAKDGLEPMAGEILRPRTKGLALLLRESAKGGGY
FT                   YRKIVDMTIQYTDADGKPLKGAALGTRCFGQLAKGQLPVATCHVHFDVFSHKDVPAGED
FT                   EDEVEAWVWKRWRKKANMLEACASAGQFEGVREWSTSGTAVPLKTQTALRCFFVLQGLV
FT                   CVGVACSSTAFLAYVACAAVGAAVIAQTDPAWW"
FT   CDS_pept        complement(81515..82624)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633366"
FT                   /orf_name="MICPUN_100340"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63625.1"
FT                   /db_xref="HOGENOM:HBG561172"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI000199AFA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G6"
FT                   /transl_table=1
FT                   /translation="MHSTVVRAISVRPAARIAAARAPKPSARPPAGPHFSRGARNTNDV
FT                   FLQKGTHRSRLVASRAEKRSDGAGEADAEKPKKASEDVAKDEDDEMKAEAGAGDAERPD
FT                   DVVGDVEKAPALDDDVAPALEGDWRDFRAMLISQEKGKDELVDDDEIAAASGPNLELLR
FT                   KQNPKLAKDKPWAHRIGAPEKGCLLLAAADEFTLGQQYFHQAVILLLEHHDKGSMGVIL
FT                   NRPTQYNMGYVSGQSDGPFAENALYFGGDVGDGTVSFLHGSDKVQGSAEVLPGVYLGGY
FT                   DSACELVKKEEVDANEFKFFARYCGWAPGQLKRECERGVWYPVACSKQLALKQVIQLPK
FT                   PLWREILELCGGELKSAAARAYGEEDDAK"
FT   CDS_pept        complement(82884..83888)
FT                   /codon_start=1
FT                   /gene_family="HOG000109569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633367"
FT                   /orf_name="MICPUN_97334"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63626.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI000199AFAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G7"
FT                   /transl_table=1
FT                   /translation="MGFEGSANKVAVGVVSHTGDILSNPRKTYITPPGTGFLPRETAEH
FT                   HRQVILDIVQQALDEAGIAPSDLDCLCYTKGPGMGAPLVSVAVVVRMLSQIWKKPIVPV
FT                   NHCVGHIEMGRVVCGAMDPVVLYVSGGNTQVIAYNERRYRIFGETIDIAVGNCLDRFAR
FT                   EIGLSNDPSPGYNIEQLAKKGTKYIDMPYTVKGMDISLSGIETFAKSEARTKIDAGECT
FT                   AADLCYSLQETIFAMLVEITERTMAHCNANDVLIVGGVGCNVRLQEMMRVMVGERGGKL
FT                   YATDDRYCIDNGAMIAYAGILAFMEGQTATMAETICTQRYRTDDVLVTWRKDK"
FT   CDS_pept        84339..84800
FT                   /codon_start=1
FT                   /gene_family="HOG000100059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633368"
FT                   /orf_name="MICPUN_58310"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63256.1"
FT                   /db_xref="HOGENOM:HBG561185"
FT                   /db_xref="UniParc:UPI000199AFAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G8"
FT                   /transl_table=1
FT                   /translation="MRIPKWGWAACGAGLSAAFLVPGTARAHGSIANRAEPRGSDMMTC
FT                   FLYGFSWFYGVKLFLKHLFSPCALFLGSMWLLTRMGVLPERLGPEAYEAYVKPWIPKEW
FT                   TDAKLEVSGDAVKTCERKFWASVHRALPATAHPTCEKVFFAGILLAGLV"
FT   CDS_pept        complement(84905..86806)
FT                   /codon_start=1
FT                   /gene_family="HOG000243129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633369"
FT                   /orf_name="MICPUN_58311"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="manganese ion binding"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63627.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG742580"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniParc:UPI000199AFAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5G9"
FT                   /transl_table=1
FT                   /translation="MDNRIETNLEPVDARSSIARAHTRMLRFASRVTAVALNASVLTTR
FT                   AAHGAPVTARVLVLPSTTATFNRDFTFSSTAMMPPSAPRASVSVPFARAIGPRARPSIR
FT                   HRTPVRSSTRTFAASGGDYVPGQLQPFGDLSVVGAEAIPDGCQMLVLSVCEADAEKLSA
FT                   DDKVLEGYAPGLAAVVKDMCDEQEFKGAAGSSVFTRVAGLPFKHVGLVGLGKADAIAGD
FT                   AWMSLGKEATAAAAKSKCTSVAVGKYWMGDEEAAFRGKAEGIAAGAFLGSFEDSRFKSD
FT                   AKPGPLKTVHVLTQPGVDVASEIAAGKAKASGVALTKQLVAAPPNVVTPSALARIANEI
FT                   AAQFPDTCSVKILEKEECEAMGMGSYLGVAEASDEPPKFIHLTYKGEGAKKTVAVVGKG
FT                   LTFDSGGYNIKAGAGSMIEMMKFDMGGAGATLGAARIIAETAPAGVEAHFIVASCENMI
FT                   GSRGLRPGDILTASNGKTIEVNNTDAEGRLTLADALVYAEKTAGATSIVDVATLTGACI
FT                   VGLGPEVAGVFTPDDDLAAELEASAKEAGELFWRMPMQETYWKSCGMTSEYADMKNTGS
FT                   RGGGAITAALFLKRFIEKDTTKWGHLDIAGPVWDDKKGGATGFAAQTLAAWVASQGK"
FT   CDS_pept        complement(86920..87453)
FT                   /codon_start=1
FT                   /gene_family="HOG000233130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633370"
FT                   /orf_name="MICPUN_97336"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /function="pyridoxamine-phosphate oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="ACO63628.1"
FT                   /db_xref="GO:0004733"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG635025"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199AFAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H0"
FT                   /transl_table=1
FT                   /translation="MPYVKYFQMATVKPDGRPANRTVVYRGFLGDTPDITMVTDLRSGK
FT                   VQEIRANPAGEFAWYMPETRDQFRIAGDLTVVAHDSATMQKERQEAWAKMSPGGRAQFA
FT                   WPVPGFPRLDDENPDAFDIPEELISDPNAVLENFCLVVMRVDEVDHLSLRKNRRWHHTR
FT                   KGGTDEWETVEVNP"
FT   CDS_pept        join(87697..88643,88678..88705)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633371"
FT                   /orf_name="MICPUN_58313"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63257.1"
FT                   /db_xref="UniParc:UPI000199B054"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H1"
FT                   /transl_table=1
FT                   /translation="MARALLALALLALLACPADAWRWNNETWEIEWEFTLGQTTYKFPI
FT                   KRKPRPVGRPEEFCAKYYGVTEDSLFARPPLNQRHGDGLRVARLNQTLTGRGQHRKISA
FT                   EAEVRWAGKSIPETQCHVGFVWHLPTIVFADRYELDRVMTFRPGFVARVFEDWYWIGEK
FT                   HAGQVNASALVLTTEVRVERAEGSSGDLVAVAKIEKVPIHNRYPEPVETTDDWLGRAYV
FT                   NATIHPPRVILSCGSAVREREDAVLGALGGEVEWEWLELDSAPGSRIHNGWRVADGSGV
FT                   IDPALGADVVIWTAPAGVRSHYRFVWWVTILSQYARRGRRRRS"
FT   CDS_pept        90993..92183
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633372"
FT                   /orf_name="MICPUN_58315"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63258.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561213"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199B055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H2"
FT                   /transl_table=1
FT                   /translation="MGGVGTTAGAAPTGTAVLVMALLVTVTSSSLALTMAYLFRSGYPY
FT                   QSTVLAAQQLVCTGFGVVAMQLMPEERAKLRISRSNYLTMLLPFTIVLSAKLFLQNKAV
FT                   QYVSPAFYAMTGQLLPVGVTIAGFLTGSQRFKWSTVCAAAVVSVGGMLIKAGQMELSPF
FT                   GFILTMSSLGLDVVRLLLMQYLLQPLKLTGIGMMLLSAPQQCILFCVNGVFTDVGAIAR
FT                   RMQLTEDEGGFGPEFLPIVATVCALAVGVVLFNLFFVKMTSAIISAICTPFKDLCTIIM
FT                   SDLFVDPRTETPRAMAGFGLACTASFVYNVHDIYARRKEKEREEEEKKPLLEEEGRAGG
FT                   RGGGDADAEGGAGDDAAGERGEGDWTYTDAYKVGFTCCGAGVVVYSAALCWQLHHL"
FT   CDS_pept        join(complement(93730..95462),complement(92300..93671))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633373"
FT                   /orf_name="MICPUN_112657"
FT                   /product="SWI/SNF and RSC chromatin remodeling complex
FT                   protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63629.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000199B056"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H3"
FT                   /transl_table=1
FT                   /translation="MELLQGQEETLGANSPSPRPMVKLSMRHWQDYTPGGSLFMIVRRC
FT                   VRFKLKKGLRRFDWQSEHKRAEFVGMLGDCAEELREKGLLGHVVVYISGDVPAESRELI
FT                   KASARSMGAVLSASANDAAVTHVLHADLDVNGTETKRVFPDKDQAIVRGVVEKEALVHY
FT                   AGYPTSYDAWCAVSTAREHAARDRAHRWDSAPEDDSAIRAASGEHLAIAGRSKPAKHVH
FT                   YTWIVDSVKYNEWCDEGDYAWEDPAETAMRAATRARDAANAAMAATAAASAQAQGGGAP
FT                   KVGEKRKGGPDASVTADDASQGTVATHGTGGTAGTAPAPPPEDERVAPPQFAERIGPSV
FT                   VRQHLTAPHSSVAAVAANDGGARPTDAKAPGRHHIRGDRGGVVQENISRGQMAGAASEV
FT                   AAAKKALDDAVADVTDEVIDADANGSDDAALTGGTGAGTDSREPYKIPGHSHWFRWHAT
FT                   HELERRGVPEFFDGRSETKTPEAYAKIRATMMNQYRVAKKAGERLNFTKARRGLVGDVN
FT                   SLQRVFDFLERWGLINWQPKMDAGKAAGLGANVPRVVAVDVTRPEKPDPGTFSAANVAL
FT                   YRFPPAPLNGAATSVAEAEAAAEAAELAAEQHGARRGRPPTNPRPEQPAPSAALQAPLS
FT                   AYAVLYGNQGNVKRACVGCDADITGKGTAYYHCARPPPRLAKTNVGGVDVCGRCFSAGK
FT                   LPDGTTSGCFLRTVATGASSKKAKKAARVVSVNEDGEEIEVEDDEDDDDSDAEMEQDDW
FT                   TDQETLLLLEALETRGESWSDVASHVGTKSAEECIRRFIRLPIEERFLDELDPNVGGTD
FT                   AADVRGGGDVGSTEEWRMGRPDVDVRGPNDLTVPFAGAPNPVMSNVAFLATCVTPRVAA
FT                   AAAKAALHALDEENKGLTEKGAMDAMDVDGGGGGGGGGGERTAADVPVTDAGAREAAAT
FT                   GLAAAAVRAKLLADAEEREVQRLIISIAEAQMKKIEAKMRSFEDLEIGLTREREAIEEM
FT                   KARLFAERADLRIQKLEHEESVARAKEAQERREAEAATTTTTTAN"
FT   CDS_pept        join(96931..97602,97708..98076)
FT                   /codon_start=1
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633374"
FT                   /orf_name="MICPUN_81638"
FT                   /product="Protein arginine methyltransferase "
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63259.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG715060"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI000199B057"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H4"
FT                   /transl_table=1
FT                   /translation="MLDDVPRTAAYRDALERNPSLMNGAKVLDVGCGTGILSMFAARGG
FT                   ASAVVGVDGAAPMAACARANVAHNGVDDRVSIVQGKVEELLRKGDVQLGGANSYDVLVS
FT                   EWMGYGLLFESMLDTVIAARDAMLKPGGAVLPDVATIHVAGFGRNATSQPFWDDVYGFE
FT                   MPAVQADLAEEAAKLAVVHGVKGAHVCTTDGMVKSLDLATMTVLDTEFSSEEVLITART
FT                   DGPIMCHGIVVWFDTAFSERFCKEAPVVLTTSPHAERTHWAQTLLHFPEPVALVPHGSF
FT                   WWGKDQPKMGLIGTRTNPAKGIKVRIGMAKCKEEERARGLDISLEYEPVLEDGTPGTRK
FT                   ARMYQM"
FT   CDS_pept        complement(98129..98737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633375"
FT                   /orf_name="MICPUN_108206"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO63630.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H5"
FT                   /transl_table=1
FT                   /translation="MLAASELVDENARKEFEEDVRGECAKCGLIEAMATPTPSAEAIEL
FT                   AHPGRCYVKFQEEFSARAAREMLDGRVFDGRTVRASLATDEEFERAAAGAWLPPRPPPG
FT                   DPSLCGILRLRSVPYEATKTDVVNFFYGMGVTEDKVKIVLDANSASTGEAFVEFSGDDA
FT                   NISQALMKDRAVLGSRCVEMFRSSLEEVQRMAMMGRPLM"
FT   CDS_pept        100040..100471
FT                   /codon_start=1
FT                   /gene_family="HOG000255169" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633376"
FT                   /orf_name="MICPUN_58319"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63260.1"
FT                   /db_xref="HOGENOM:HBG739421"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniParc:UPI000199B059"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H6"
FT                   /transl_table=1
FT                   /translation="MASCVAPIAAAIRVPALARHAAKPRARAIVPLRAVNEAGEYISVR
FT                   DTIEAKIAAEIDCEILVVNDDSAKHSLHKGMHDGNAKTHGAESHFSVVVVSEFFAGMNP
FT                   VKRHRQINAILKEEFDAGLHALQLTTRTPAEHAKATGGK"
FT   CDS_pept        complement(100560..102800)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633377"
FT                   /orf_name="MICPUN_58320"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63631.1"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B05A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H7"
FT                   /transl_table=1
FT                   /translation="MLLDDLPQDVFDKVLRSGLDVVDVVRVMAVSRQMRRQAGSERVWR
FT                   EIVWGHFGIRDASETWSDLADRDPMDCDDIEREAEELERAARWRNLYAHLREKFGAGEA
FT                   HWVSARGLYTDGGCDENDGDNFAGNLFNPDRHDKFFCSATSGNINCVGVLTMEDATDAH
FT                   DYAERLRVRRKYMIWRCNLTAKVQDRLHQLAHDPDVPNVDYPRIRRECYDDMENDPFDF
FT                   SNWPDQEVFHFYVHHLALALQQRNEMGKLMFHDEEAIIFDDDAESWTKHPTFARSAFEM
FT                   REMAIAWQGEEGPPEAREEQPDTEMWARLEDAKERGWGLGANSEGGGWVPTDDTPLRLL
FT                   NSGLAMEEFGLGGDGECMLHHTKELDAIVREHGYGKELQDSHELHVVSQTLSLVHHALE
FT                   LGMYDVLDMHIHKERPSSNTRRAKRDIDNCFWYGQREKAASGVGHPRRDVVLSKFEISR
FT                   SGQFTCPVGCGALFVSRGPPDVDQATREKYANHIFYESEGARRWRRYLESQPEGYMLDR
FT                   TGPGGLQVRDEGWPEDDDGPLKPFLGTDMSLFPDAAAVGDWIRCGCERERASTVFDGVD
FT                   SLQKVHDLIREGVLPPIAAIHTSAAGVVVEFETSRSFSRGGGEPEPRFQPVAWFRFKSR
FT                   AETLQSQRNDPNADVLGFELVRKRCARVVNVKLIACEDLMAEWDDHHDAPNIDCRSFSF
FT                   YGVPVELGEFLSPGECARGAPYDTSHLATEVFDIHANAAHRHCRLSYRASVG"
FT   CDS_pept        join(complement(103229..105316),complement(103002..103133))
FT                   /codon_start=1
FT                   /gene_family="HOG000100060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633378"
FT                   /orf_name="MICPUN_58321"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63632.1"
FT                   /db_xref="HOGENOM:HBG558516"
FT                   /db_xref="UniParc:UPI000199B05B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H8"
FT                   /transl_table=1
FT                   /translation="MPPRTYRNGDRASAGSSRTPLPRTVPILLSLFSLLARTTFAADSR
FT                   WLPSVPSPPNDACFGENRFGTTRIALCAYGVPTTTQIAFNAYNKTNGDLPAPKAWITIQ
FT                   DHSIALVNNTAAPGDKPEVWSKPQSYFASTNDGGSEFMGQTTSTWFGTKQGDQNTGASA
FT                   VRSAMSYGYTSYAPIDRCTETFGYTNETAATKTDAEMMSEKSITQEEVDLIRKHCNGTY
FT                   DQKLRENQFMTMTGGGSGYWLNGCPNYSPGNTSKNMNYTCPAVPVAPGGYKFSILGMLY
FT                   GSMINSAHNESYGGYGAEGLPDYEVPHWRDLAQYKSLVMTSTLDITNVGENTTVRSAWV
FT                   EWRNGTTVNFTNISDTTNLAGTKLHFVSPGSGEDEIVLKFAPYYSTGKYERDVAAVKEE
FT                   FGIPCQYPDHCPTCLDYCVRDITGYEGGFQSKALGREIKKLGNGGLSTLPTQHASKSSF
FT                   YPNATSTPKSTKEELMSLGGAPKLEVTEVRPVKIFLRKHGGCTGRPASPAAADMSGKNT
FT                   WPNAPADCPDWFKASTHDGSKWLSEERGTDVKTEWMIDCEAGDLRCYLVDVHLDLAYLN
FT                   GTRSVLGDITNDAGSDKYGWGKGTFFMYDPEIGTGDAVGGFGDEIQGSGDLPCPASGCL
FT                   YPGSDSPAPAPAPDSGSDFPFVFIGVAIGVVALVIGMVVYCVVLRRRKRLKASGTKQVK
FT                   AELRGDVVWCATITADVLGLGRDVLHLHRGLLLRGDAVDLDEAVH"
FT   CDS_pept        join(complement(108497..108622),complement(105793..108294))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633379"
FT                   /orf_name="MICPUN_58322"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63633.1"
FT                   /db_xref="UniParc:UPI000199B05C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5H9"
FT                   /transl_table=1
FT                   /translation="MAVEKAEPMDAVPRHSPQPPARVRHPMVEANIGESPRGSRPKRDS
FT                   SRPPRLSRIAARYRAQLDAKLSHLADLQARWNAQGVFDVVKALRRDFGDTGDDDQKKSD
FT                   EDDAERRKPREPWIQHEKESVRKALLLFGLGRWAKLRMALKPASRPRHDSHDVQLATWD
FT                   LVRAMHRRLEPDSPEAKYLADRLRRESPGGERLPADPIVGSWNLGSRGKLNAANCRVWT
FT                   RRIRMLEMINRSVERLLAEETQDAAIELAGACPLPASDVKRSLPAWWDGACDFSLLYGV
FT                   YRHGFGNFNAVRSDPWTAAVATEAARAKGGAAAVAELRDSIEAIDECQKLYAQAREEHG
FT                   ARISEQGARAARKGPDGGSKGETKEEEEEEEEAKEGSAEEDGDDGDGDDEGEGDDDDAG
FT                   NNVPAVGGDKSELVAAKERVERIHEGENAWPRTEDLTDRVRRVAKELGAPNALKPSDPP
FT                   WVQAMLGHPRRVPKPPMSLAERAARDQKRGESRARAAETESAREEFADAMMRGDWDALG
FT                   KNGAAASVTSLLCADHEKFDADEGKNPEADELVRSTAAALKEKGISNRERKDVVKALMA
FT                   RGLPRLDDNSPDWIELSTASGVGRGAEDVQAMFYSIAVEMKTLEARTDATGVKASKKHS
FT                   ATCKCIVCRIRKEKKNAEDPSKVTWKDAVKTMKEEPGNTAEAQTAASDPTANGQHHDGD
FT                   DEEDHDGDGDDEEDHDGDDGNDGDEDDDAKDGGEGEKTEVGEDRAAKPGKSRRASVCPF
FT                   GLLTHVTANRLRERLDIMQTLRMCLEKSGGKMTRLPMPSIKTGELPVWWTSGVHDVAIL
FT                   RAALKHGCDKWDDLAGDAEFAGVFGKSRPVPKAPLCFRIVRIASRYLRRGYLGLGKHTK
FT                   RKKA"
FT   CDS_pept        complement(109021..109740)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633380"
FT                   /orf_name="MICPUN_58323"
FT                   /product="Glyoxalase"
FT                   /function="lactoylglutathione lyase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO63634.1"
FT                   /db_xref="GO:0004462"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG704761"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="UniParc:UPI000199B05D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I0"
FT                   /transl_table=1
FT                   /translation="MPQALARVAVSGLGAGATLDPDSRRPAARRTPGPSRARSSRAGSS
FT                   VVVHASGDGAAHSGIVEESVVHGSSLASVGISTRKKSVISEPRIGTDPRPLSERIGIQG
FT                   VHHVAVIVRDLAVSMEFYRDFLGLPVNPDRPNDKLPYDGAWLMMGPEMVHLMELPNPDP
FT                   TDAEFRPAHGGKDRHFCIGVKDLAPLTEALESRGVPFTASRSGRPAIFFRDPDCNTLEV
FT                   VEGLEWRDKSSPRFVAR"
FT   CDS_pept        109983..110549
FT                   /codon_start=1
FT                   /gene_family="HOG000100061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633381"
FT                   /orf_name="MICPUN_58324"
FT                   /product="Predicted protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="ACO63261.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="HOGENOM:HBG561274"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000199B05E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I1"
FT                   /transl_table=1
FT                   /translation="MAAPSARLQSMSINVGAEVGADDASSVDAVTRTGTCLCGAVSVVL
FT                   TGKPTAVSICHCVICRKLSGAPFSAQALVKATQVSVVANDIEGGGDAASSGEFSSVTPS
FT                   LTSYASSPAVERHRCASCQSPVYATLAKGKMAAVPLAMLDAVRDDAAMAPTHHMYYADR
FT                   IMDVPDHLPKYVKSAGRQAELWKGD"
FT   CDS_pept        110673..112832
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633382"
FT                   /orf_name="MICPUN_50155"
FT                   /product="Predicted protein"
FT                   /biological_process="poly(A)+ mRNA export from nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO63262.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0016973"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="UniParc:UPI000199B05F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I2"
FT                   /transl_table=1
FT                   /translation="MAIPDWHDDDTDDEDDVLLGVVVSPAVRSPRRPTSGTATRDRSAS
FT                   SLVSTLGKPTGLYGGSVLGFHERNAGTTAFSPFVPIARTAGGASTPGPGRISLGGLGGS
FT                   PRVARLRLEDGNEDGDSTGGRLDGGNDGDVRERGDRGARASPSGLPGPSRGLGIGGARA
FT                   LIPPRSPSHAWPPEARLHLAPGDPNDLVGVDGVTVDDADPAALAYGDAGLRAVSLARNI
FT                   KHQRAASRRAAAAQRARVRQEALELELGWALEQEQSANAELARFADELARSIAREDAEA
FT                   AAAAEREEQRQLDEMDARWRARDAAVKAVLAADAAESERQKLAAEEADRAAKRAEEEKK
FT                   RADEAAAAAKKAADEAKAKKEREDAEAKAKKEREDAAAEAARRAEEERRTGVVTGQRLP
FT                   SGSVPKIQVAAEASKQEGELAKLLAEARAKVAEYSTAPAAKRERRVINNNITVHVQQIA
FT                   ATRQQIEKKAVDIAQFLNGFQPGSIQRTFATVSLAKRVLTQCDSQVSKLNRFAFALAEV
FT                   SVRVAVFDATFGRVLIALLHEACVLAVPKYYPFVQGRYASDDEYFKLMGYVAAEEQPND
FT                   LPEGAPPKLETTDNFCRRIQGFMLFYAAYTQCDNPRHPHGINHAWAWVSRLVNRVPPNR
FT                   FSATALESFVKHAGFALWSAYGAQFGKILDVVDREFLPTLEAKDDADSRPVVSRMRTYL
FT                   NERGFLRAPEGREMPNTDTSSNTRL"
FT   CDS_pept        complement(112879..114126)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633383"
FT                   /orf_name="MICPUN_113407"
FT                   /product="Ring PHD BROMO family protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63635.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B114"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I3"
FT                   /transl_table=1
FT                   /translation="MPFCSFLYDTQLGILTINFENCTLFRAFAPVARLGQWHFHAAVLF
FT                   PVLAADFQRWFKFKTENETSGETWASHGNRRTMAMYRKGSRYFAARHDGSYSLAKEVRA
FT                   LLRELRCGRVQPHVCALDKSDDDDLQAVECAVCLDACVDPCTLRGCPSASSHTFCLSCI
FT                   TRWAEVATWCPLCKLRFDAIIPPNGEPIEVQARSPGDAPRVEADDVVGMDEYGNAVTAR
FT                   EYIECIDAKLCEVCEGGADETQPGMSDAETLLCDGCDSAWHMACLRPPLTTIPEGDWMC
FT                   PGCVKDAEEKEAEEVSIEESDEGEEAEEKENEEPSAKRTRRAELVDVRDGDEQEALTDL
FT                   SDLSEEETEEESLKVLGQTLNQLEGVLQQLPEILQRRQETNEMLFRAALQRQTEATRAA
FT                   DFDRFRYAAQSEQSGC"
FT   CDS_pept        115738..117198
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633384"
FT                   /orf_name="MICPUN_108207"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63263.1"
FT                   /db_xref="UniParc:UPI000199B115"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I4"
FT                   /transl_table=1
FT                   /translation="MAGTDTTILALAGVGAREDKALGFASCERHLGASEGVNVLVERRS
FT                   RDEGTGDVEYSYGISNVEYTVLEQHGIDDTPVDEGSDESAFPANTNVLYIGLGKIREGL
FT                   LSSPRGAFPGMLVNLSKPAMADGTKGGRLETSMQNIADVLTQRSKGTPLHPSRWGDLPT
FT                   FVLYTLRRRITSSAKKKRNPDQSPPNLAQTPDGSFLDLVKNAADLLDRCGVSHPPPQTG
FT                   TVEDYLANGPGFIFCANPAIGPLWQVTEQKIARGSIGERSEVRLEIAEIEWADVHVTGS
FT                   LLVEADSPLGATRQTPSGAPTLVFDENECGRCRLRDVKITNAGVDWHADGTTIWSAQLT
FT                   RTECCEIRVEGDGEFDAKGVTIKGDARYVVPAGWRLQLRPDRDDPGTIVERWTNLAAAG
FT                   GGPTWNWAYEGGAGGDVRLTLDARRVGHHGSSMESAKVAVAERRAAAAAAAREGRSQRA
FT                   PLREKNGVGGSVGKSKKASASREGLPAR"
FT   CDS_pept        complement(117419..119365)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633385"
FT                   /orf_name="MICPUN_50157"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63636.1"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199B116"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I5"
FT                   /transl_table=1
FT                   /translation="MGTRECISSCDNILNSADTAFYSSITGLTVTSFTSSSVVLRTIIA
FT                   PPVCDASGAIDNGAPGSGCTSTLADGASCTPTCNSGYTLSGTRSCTDGTLSDTAVCNAN
FT                   PCDASGAISNGAAGPGCTSTLAHGSSCTPNCNTGYTLSGQRSCSVGTLSDTTVCNPNDC
FT                   AASSDSTKDGSDGALHCSAEYGTIGGTTGSCTCTCKAGYGGSGCETAGACSASEDSSKD
FT                   GSDGTIHCVNNRGTVSGSAGSCKCECKPGYEGSGCETASACTASSNSTKDGSDGTLHCS
FT                   AQYGTIGGTTGSCTCTCKAGYGGSGCETAGACSASSNSTKDGSDGILYCINGGTVSGSA
FT                   GSCKCTCKSGYKGSSCETAINCTTAQYFDGSACQACPIFSSSTGGTSTSCTCAANTFAS
FT                   KSGNTWSCANCTVGATKEAGSVVPGTGGGEKEKDVCTASPTPPTETEKEKAEKTRDTML
FT                   SGIKNEKMKKKAKLLADAATTGKKVRKMSTKLTAPDENTACSDYYAKAGISSSLGACIA
FT                   TVASRRRGRALTAMTYDVSVFFSDAEVDDSTLTAAKNALKAEGISVEVNDVDPIVELGT
FT                   IEGVDSSTLETFKAQATAAAATMPPSPPPPPVSSPPPPPPPPNLIKDDDDAAATPRDFL
FT                   GTILLACVTLLLF"
FT   CDS_pept        join(120859..120887,121076..121292)
FT                   /codon_start=1
FT                   /gene_family="HOG000223546" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633386"
FT                   /orf_name="MICPUN_58329"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63264.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199B117"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I6"
FT                   /transl_table=1
FT                   /translation="MGVAVPELKQYMDKKLRLKLNGNRGVVGVLRGFDQFLNLVLDEAH
FT                   NDVGPDKEPLGMVVVRGNSVQAMEALEHIPKAKGTA"
FT   CDS_pept        join(complement(124764..125042),complement(121425..124622))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633387"
FT                   /orf_name="MICPUN_58330"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63637.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI000199B118"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I7"
FT                   /transl_table=1
FT                   /translation="MSRGESGEPERRSRGYAMGLFRRRGPPQGTALLDEDTGDLVVPLT
FT                   PEGEADDGAPGPLPEKMGLGDEEVAEDATTPGKHARKVSIIAEEVREELGSPRTPGVEQ
FT                   GAKRWLKRTRSRLRSGGGADEVMSYAEQMRLEALMEYQRKLSEPVLLNNEVLISFASRM
FT                   AAEMDFRPYKTMTTMYSKTFKADEFLLWAIRQEEVRDQTDALFLGNELVSRGVFLPVTY
FT                   GAADSLYWTPTIKPGNQTHRLVARTKPQIVAAVLGRDLKVLIEEGGTIAGLGPNSPTAS
FT                   DSATPTNDGQTAVRRTASDPPPATANGHGNTNGHHDPHQTRTTANGHRDPPRVERRGIL
FT                   KRSATYGHGAERGFAAALSVKEFARGWARRRAEAKRARVKRWQRRVRNFRASVRAATAP
FT                   VRLYLGSTLGPHALFAVTFPLLVLHLWHTTMYAVIAALWCLRHLANVDARQRRWVEQKA
FT                   RAEELRRFQGKRGYAKLHPDGSECADWWSEVLRSFWDGWIEFWLNRLLTRILTNVLDRV
FT                   RPSYLEKLEITTFKLGDAAPRINSSRCWRGNEGETILEWDLVWHTENMQITLSAKVGGA
FT                   KFAVPVPLRVYVSKLRIAGKFRMGLFWTRRKGGPYLQKLRISFVGMPEHSVSIKPMTSS
FT                   FVDIRDLPGVDSLIENALNNLFTNVLVEPNCVNWDVEKWWINRPGAREPGALGLNTDNP
FT                   GEITEAELLAEAERIQGKKGSSLTSIMGLGSSKHPTMTVAMTVHLAEIESKEGAKPCSF
FT                   YVRCKRGAKKHTTEAAKAAPVETMVTAHPSGGSEHGGSQGDGSNFGSFGAGEELGLDSL
FT                   ANLQSPGGSFAQTQSRPGHRRGTSSFSQFGSSFSIQSSTGETTHVMEKKWVCRPVWEEF
FT                   VRLDAYDKQVDQSVELKVSCDDGSSVVGSKTTVGRAMIESVLDYADGALHTVQLPILHH
FT                   RTGEEVGLLHLRLKCTPILPDLIAAAKDRNPHASLLRNPKTYSKQFAMSASDYMAAKAA
FT                   GMASAVSGLMPSVPVPKKYVDSAAKTMTKTAISAINAPAKQGRWAVRSVYKGCKKLVYG
FT                   KAKYKEMKKVKLERALREAQEAAKYAEAWQQSAAAAAGKNRWRRSSSRDRRPDTPSKMS
FT                   DIAESPSGSEGTLARQDSDASTASGQRVRPVSFAEAPAEAEAAATPSTPRA"
FT   CDS_pept        complement(125173..138174)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633388"
FT                   /orf_name="MICPUN_58331"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63638.1"
FT                   /db_xref="UniParc:UPI000199D57F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I8"
FT                   /transl_table=1
FT                   /translation="MVEFRQNLESGPTGSGRPRPGHPRPQPILKPSRWTFSCCTPAMSP
FT                   PTPEDEPPVEATTPTPSPPASSTTAAAVDETPPNAATSPTDAATRAAYLAAADFDEDVP
FT                   LPGEILTREELEFYSDVREDAPASPGDMLAGLPSWLDDDDDEEEEWVGTEPAATYRDVG
FT                   EEPARADDADGESPDAEGGADLNDDDDVADVSVAELLDSESDPAFAFRPSGVSIPTFRG
FT                   VLYGNYASYVGDDETLGESSSFEVEREVEREVGEARDAGRNGSSTSDALDDVDDSSERG
FT                   AAAAVAELWSDVRDARAARDARVSDMRAFLRRVRAGDDGVDRRVKFPPSPEPGATSEPE
FT                   PRADAVDGATTREQSPPSPGPARVAAVSPRMRTMRALKDRDWSPMLPSTRVGLQRLVDG
FT                   DAAVVRAFEGEELEKGEEGEEGEEGEEGERGEKDAGNRPPFSSDRSAVVASASELRVAL
FT                   GLPARGKPRREPTPRRSSETVKKTVGQKPPHASRYAFGSSVETGRGGALAAVAEEAALR
FT                   DDADATADFLRRGQRWPRSRLPAPEARSAIRAGADERREARLLERRRAWGARGRREEGR
FT                   VNAEASRTAATEEEATAPVQRGLRERRADEANREKRGQPAPAGKRIVVGDESDEDENKN
FT                   AREFLVVEEDDEPSPPLVLYPRTTSTGAQCDARPTGADTAVQVRMDADEDSVEPRVVLR
FT                   INVVDDRPIDEPLDVTKTAGGEVKAAFETLGYYSAAGVESADAQIQTMGREELRAHGRL
FT                   HVDVADAAGALRSGEFPDENEDAPTNPLVTKLQLQLRAVGVLVGAQRAKHGRRLAALRE
FT                   RYVEVCLGLREQDRLLAFSEAAEKIRREREAAARRRRRGATERWRPPGGGVFLDARQPG
FT                   SRNVHVQSRGAAWTVDPETRGDGQSRDDPWQGSRFKREMLASLARKLLMKCALGAFAAA
FT                   AAERRGVEAYVRRVWSRNRAPAVRVAFETLRNVAARVRQLCDVADDAVELRLRKRCADA
FT                   CAMWSKSAAASKSERKSVELARAHRDRRALNAAVAQWRRLPLMTEFDTHMGSLAGSFRQ
FT                   RKLGVTTFHAWRLFASREAYKKLKLEAAMPGEPKETTAAKARLDAARKPSEVKARANEV
FT                   GEELRLEFIGSRRRVAGAEAAAALKKTDGWLRFRATEADCRWVSLASPHMRRFRRLAVD
FT                   EIKDEEEGYKGTSAAIQRTREALEHLRKVRRNGSGIQVEDEFEETELLEAARKRAAAMR
FT                   VFDAPGARKLGGAADSDAPDVPPSPALDPSDVSRVKLAAATDETAVKARELAREAAADA
FT                   DRLAKDSEAKVSAAKAAQKRAGQAADAVAAARLDRARRVPPSSVDSSEPSRDADSEAAF
FT                   AAAAAKAEHLADAAASAAADATREAIAAEANAAAAKAVATSAAGMSQVADAVALEVHDA
FT                   RARADASSVRAKEALARVAKARAGAARQRELAEDASRNMSADPDTVSEIRGQADSSTAQ
FT                   AIALERDAALARAEADAHEKTATSAIERRDALASAAEGLESAARAFRATRKRRDDAYKR
FT                   AQTADALSAEAVATARAAQALENFWAKRLERAERDVESSKLSEEAAARNHRDERLSFTR
FT                   REAKRLRAEAEAAEEAKLAAMAAADAAEKTAGDTARAAADEAAAARESALAAEALAAAS
FT                   AAELEAARQKVDTLRRRADAAERSARVHVELAAEAAAYGRELNSDPAFRARKAEAFAAA
FT                   VVEAENFLRDAELKKLRAIAEAKEVKAAADAAERTAAGVATAEIERSLEFRAIADDAQR
FT                   KHLEVSASAADAESEVARLDLADDPVALHRDLGQLAREERTRAESQLAAATVAAERRAE
FT                   ECGEFEAKSVNAREELRSVAAAAETAPAEMTAVAAAVHELLSAVGADAKRSHGLADAER
FT                   ADAYLLASVARWREEAARLATERSRVEVAAGAARDREAFAASAARIAIAENNTANPDVE
FT                   KATAEVATHADAVRRLEARRESLVRDASDALRVAAAAEARLAATDHDRKLAVDAASAAA
FT                   NERSAASRALVARVASALRAGAAVERASAAATEREAERCAMAAADDSRRKSVAFTKAAE
FT                   ARTAKEAIAREARERAEKARREREAAVAEARRRVERARAAAADEARAVAEYEEEAAKER
FT                   AELEATRARELAARARAEREAFAARAQKDAASAALAELRRAEEAAAREADAAAADAKRR
FT                   GERERRAAERREMVATREHEIAEDEKDRAAAIRIDAAEREAEDRLLAAKRTAQEAERMR
FT                   VAALEAETRAAKEAEEAAAALAAAEARNVRFVAVVEADAREKLTRVELREKRELAAIRV
FT                   AEAEARANAAVARAREKRESAEMAAERAARAESQREELALAAAEAAKAAEALSAAEDTP
FT                   RRGDVVEAAAAAEMAEAEVEAIASQVSIAESPTTAAAAAEALDRAKARAAVARSDAKRL
FT                   AEAFESAVSTPPAPELESARQRALDAAGAAERAAAAAVKLADERRRAAEEAASAEEAAS
FT                   RADAARADAEAASASAIAEEFATVKKQCDRVLEHLKAQHAADVEEAEAEASRWHRAELE
FT                   ETAAATAAEADAAAAAELESSLASARKDADDREKTSREHAVFAKFASAAKREEERAATD
FT                   AEKAAKEAAAEALAEAKATHADHVNRAVAEASEALREAKAELVALGEAARTRSRDAMDE
FT                   QGAEELRMARDRARVRLEVAKVAAEAKLQRARQTADAEFEEAQRRAREEMDAAIAAARA
FT                   DAAEKAEKRREAEEERRAASVAAAVARKRSARIAASAETESEEIRRKRAETEARAAKAA
FT                   QVLFEKRVVADSAAMRAKKAEDAVANAQSSAIKSTAAVASARATRDAEDEAALERDRAL
FT                   RAANEMREWRAKATAATETAKRERERAERAIAREAKARERADRAAAKEKKKVAALEARA
FT                   VAAEKAAAATEAQIKRRVKERVARDAEATAQAAAKAAAEEAERRAREEADEKERAAAAE
FT                   KEKEEKDAAAREADKTAALAAAAAAAEATYEARERAAVAAAEAKAKREAAESAEKYVAL
FT                   ALAEASAAAELARGRAVRLAETAAAAERARLEVEREDALVRERAATARANAAAARELEA
FT                   EATAAAERATLEAAVEAAKEEAAAILARERAAEAEKRALWEEAEAARAQSVYEAEMDAA
FT                   RAAEERAQAAMDELNAAVARAAEDADNERRLAETAASEKAEAERIAQQEELRRLHVMTE
FT                   AAERLRELEARAAEADAAAEEEAGRLAAAEARAERAEEALRVANEKVEEAARAAANGAI
FT                   VARAMASSSGGSAGWIAGWTALPAPPDGVGDVLEAPSIPGAMPMGSFHPGRRFPPRQPT
FT                   ASARRVAEARVAFSGRRRAAVTAVTVKDDASPGQKRKARAVEDIDDDDLEPATSIAPSP
FT                   PRLTPEEEAELKERRVRDARARAARRVRAVRRAAAASGAAGDAGGTVTAVTGTVTGTVT
FT                   GWRPRWETPTTKHSIKFRDTSAESVVAVRSATADMNRAAARFKNQNGGAAKVTTASSPR
FT                   LVTAERGERRSRGTGAFGVTRGRHVKPRAVMAHVRVRNWASPSAPNTTTDRRRGEGEGD
FT                   QSSGKRRRVNAARASTLNVASRVFERVFDRVYREMGGGAETDAHDGVRSGDLPHGEKGK
FT                   DRLDDDDDDDESMFSVNLDATPIAGVEYSSPTLTLNPKPSSLDAAAARLHRAHRLAAAL
FT                   GALRSNVARSKRADEVELTVVPALRIRRFMRAFEKGVASAKATRMAEEEARLSAAERHA
FT                   LERARSFARRHRGGRTLKAWAMVAKASKKAGERLKRLALNALANRALRKRFEKQLVTSM
FT                   RQRLRRDRTPSALFRRWCARARRRALLRRVLKFAIKRRRAFQSRRGWHATPLTVYAKKI
FT                   LRRWRQRAGTLRRERIERRATWRATTARKLSLLLRAFGAWTRAREDAVEIRREVSIFFT
FT                   AFLGWRSEAKRRIATRRSLRERRIARLAELAVRAWRGWRARVVQIRAAGAMRLRATIRF
FT                   IGPTFTAWRIVALAGARRRVVEAMRIDAARRHAMWRAWRAWCLGPALAAFTAGAPTPAP
FT                   PVHDDVNTGAGDSPNTGAGDSPPGDASVAVERRRDAPADDYFAVTRPASSPLAPPRSPS
FT                   RHARAPGPGGTTSSPRATKPSVRDLIASSAAARAVKTRAAFATWRRARMERFERRRSVL
FT                   AVVAAEEPGDAANDERRDEEATRVTGYPRRSSIPFFDRRRAANSLVVAEEEPEDGDGEE
FT                   GVEDGDEDGEERVSVSPRIEPAPSDSALDDPPRSHAAALDDLPRGPPTWRDAERELREA
FT                   SDALVGSHARPYPRDDPGGTSRDWFLAEDRSRAVLLAERARAATMEANRIPAYAAADPE
FT                   VVTGAVRELRASGRWRDPRTLTHGSSPGGRGRGRGGRSWR"
FT   CDS_pept        join(138319..139203,139360..139649,139684..139690)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633389"
FT                   /orf_name="MICPUN_58332"
FT                   /product="Predicted protein"
FT                   /function="ribonuclease P activity"
FT                   /function="tRNA binding"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO63265.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199B119"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5I9"
FT                   /transl_table=1
FT                   /translation="MTVDGHSCRMKVWSNREVWRAARRSCSRRENLDGATRTVQRAPAE
FT                   VAPTRQTTSLRRSLTSAVAAAARSRVLKPPVVARHRGDALGTSMASLSLGCAQLSAAFN
FT                   PATCLHRSRAFAHAPVHPTSAAVPAHRRARVVAWTTSWRARNLTATRAVAEPRGSSANK
FT                   EDDWDEDEDEVEDDEGFDDDHDGPALGGDKFVKMTHTELLVMTPEQRKEYHKRSVLEGQ
FT                   IRAKKKRERQKVSQQRTVRPAPFDARGGCDAFAFALHTTVFAFRVINQYWHQPETTLGS
FT                   MGNTPVIEENSFVSHESISGEVFRPRERIKSQRDFQRVMNQQGNNFNGKLMRIKYCSNE
FT                   GLKDVDCTRIGIKVPKKFVKRAVDRNLVKRRIREIFRRNKDAWPARTDLIVMT"
FT   CDS_pept        complement(139870..142725)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633390"
FT                   /orf_name="MICPUN_100355"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63639.1"
FT                   /db_xref="UniParc:UPI000199B11A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J0"
FT                   /transl_table=1
FT                   /translation="MAAVKQQDTQLEECARDRDRYAQSLSVAVDRAAAMERTTELNESE
FT                   IVPGLRTEIDELKLELEGVKERERASVKAREADAVAEKIRVARDRARVMEAEENAASFR
FT                   ERLEAATRDNESLVAEKTSLETTVMSQASRIDRMLTQAEARKGALRSAEESLVDAADEI
FT                   DELRRKLDEALADVGKATELARAKERERRALAIRVEEADEATDRETSSLREERETLRAR
FT                   AEAAEPNAADLRARLDASEAGRDDAMGTHRAAAEELAASLAAHEATSAELRLARSELAG
FT                   TREEKDELDRRVAELRETHAVEISKVRTLLEASEASSGRADDSGRAVSPQDTDGWTAER
FT                   ASTEKELASLREELASLREELAKADDAQDAAIEWARSAAKEEAEAAWAAQVEASSARVR
FT                   AAEEKARAAGLTHAAELEAARAAAAAESAASSSSEKVTELESSLAEARVSLDLARADAE
FT                   AMSAAAADLDAELTKTKAFHAENVRELRASAEASVERLRAELDPLKKRAEDAEVSLMTA
FT                   SHNERRLRAQLREAEDRGARALADLAKELQQAESTAVERMMASEQNAAKADETNARLAR
FT                   ELWESRQKFDRETKALADELDKARRRAAEAIRERPMRRPGALTGDESVNEAVIAELQRE
FT                   LEAEMKTSEAAAAESARREGVARRKLAHLEARVAEANAALVQATKAIDEKDAALAKADG
FT                   RIVSLESALRKLEVKAAKCEDIAAVERAEKADLLDVRDAKEALAARVRALEGDVEAARS
FT                   RAGSAEKDLADAKETMIFLENEARDAARDATEARAGWQRAEALAGDANLLNAEIHRLKL
FT                   ELKGASESLHEREAEIEEYFRSMDAFAGQDNEAQRVKHHQRVKEHRDQLKKEVAAGKSR
FT                   LRRAEAALRLMCTATETQRAQLIRDARAKCEDLDVAGRTNRRLSSWAEDEHETGDDANG
FT                   AADETWEATVAFLAHLKLPVE"
FT   CDS_pept        join(143224..143288,143448..144288,144460..144978,
FT                   145036..145938)
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633391"
FT                   /gene_name="KLP1"
FT                   /orf_name="MICPUN_97339"
FT                   /product="Kinesin-like protein KLP1 "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO63266.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG561347"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199B11B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J1"
FT                   /transl_table=1
FT                   /translation="MASAVKVYLRTRPTDNVQGSFTLQPDGKSVAIQVKKTDKPRGTGH
FT                   INNTADTIKFRFDDILLDASQETIFGTCAADVCDNVLTGYNGTIFAYGQTGAGKTYTMS
FT                   GDVSAAYNQRGIVPRAIHHLFHESELRGDKEIEVRVSHLEIYNDVMYDLLADDVTQADN
FT                   LQIVDRIDDPRFPETFAAGTGARETVIKGLTKKYCANEAEALAYFFAGEANRATASHIL
FT                   NKTSSRSHCIFTVYLESRGVGDSSEKTTVAKLNLVDLAGSERVKKTSVSGQQLKEANFI
FT                   NRSLTFLEQTVNALARFGQDNVDPHVSARQSKLTHILRDSLGGNCRTTLIACLWPDVEH
FT                   ADETVSTCRFASRVMTLQTKAVVNESKDPRVIIRKHERQIRELKQELAMHDTFAGKAPV
FT                   NYGEMGEVERQELRQQVGMFLDGDMPVDDLPCESLKQVREIFRILKHSYRGAKTELEDA
FT                   LAKGPADTAVAAGADAAEEGDAEGEVGDMDAEGSTFNVGVAPPDFVPPPETPAATAPLP
FT                   SAGATGAAETMRVGFKGTDAKAKAAAYEGYKAKVAPEKAGELAGMLADLRAKKRELREA
FT                   IATCNAAKAEIDAVAKQLEETRLAAARGAEEGAEEGAEVPTKPPPPGDVDVIDQETYDA
FT                   MARAKQRKGDYRRAFEEVKSLKTAVTEMSDEVQQFRAVFVNEFQAWYDKGGGAEFRLED
FT                   EEEDELDYGEKFDHLEMQLHLRDDPESGAYFQSKKLMRSGKTRPGVDKSAMSTMRMRVS
FT                   GGTLKGGSKKEWDPRDTAPRPR"
FT   CDS_pept        complement(146015..147655)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633392"
FT                   /orf_name="MICPUN_58335"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63640.1"
FT                   /db_xref="UniParc:UPI000199B11C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J2"
FT                   /transl_table=1
FT                   /translation="MGEGEESAPYVTCSQCARLRPRKVFQPKQLRSDDPLCKACFQKSE
FT                   TAGSSTESGDDEPEMTIGEHLCACVFGIPLFAAFFAAFLGVQLWFYLLFVIPGLLYKYS
FT                   GPIKWTIDPIRSFLRRLIFGAPNPDFDFPRIFTSDDADADDHGGCLGCCLATTFGIYKF
FT                   ITLYAFVYSCADYDESRKNGKYAVHVVFIGHIIGILCVLMYVGGSIALLVLYIMYITDP
FT                   GPGQIRDYNNAVQKWQGGLAKEYESNWTSRQLPTLYLEQDVNDANQIQPLTYEPTFQLE
FT                   ISKTFEPSLPQLQPGRGDMQRYEDKVMVAAKIENFHTPSIHPSEGGRALTVRIGEQNFT
FT                   FATVHQWKEEYYHGRCHFATYLNGLMFVFNEEVQKHACTPLYYNPYLTCHHKWPSLYPP
FT                   VDLALRVEIRSPHDPVIVASDIIACPSPDSNYFGGSWWWGETMRDKWNTFTILAYLVGC
FT                   CGLALFLFSKPGWLWEYLEWDEKSKPKGAHEEPKKAKADIESGASRAPPHSRQHIGETK
FT                   TIDPRQSGGWLSGGWFKITSISRQPKVIR"
FT   CDS_pept        147855..148754
FT                   /codon_start=1
FT                   /gene_family="HOG000199475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633827"
FT                   /orf_name="MICPUN_100357"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO63267.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B11D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J3"
FT                   /transl_table=1
FT                   /translation="MDRLDRIFQEAQNRAASEDGGPKRGLEAALARDGEDDASKRAAMS
FT                   VADRVLADYERGDYFSCLGLPPPDCDDAGRPVWDVTDAAISKAYRRASLAVHPDKNPTP
FT                   EAKAAFDKLNDAVRALRDDVRRGEALRTFADVAFKEKCRANPELMAKARKDQERRDAAD
FT                   YGAAIRAQQAQQLERAMARREKVHAALRRRRGGDDDASSSDASTDGDSDDAAREVDAEK
FT                   KKKKKGEGSGGGRVEAERGASSAAAVANGGGGDVKRRRFGVGGRRGGIRAAKEDSDEDD
FT                   GGLARPVLGAKKKPRFIM"
FT   CDS_pept        join(complement(149448..>149583),
FT                   complement(149271..149340),complement(148905..149166))
FT                   /codon_start=1
FT                   /gene_family="HOG000055227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633828"
FT                   /orf_name="MICPUN_76839"
FT                   /product="Predicted protein"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO63641.1"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI000199B11E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J4"
FT                   /transl_table=1
FT                   /translation="KKDKTPSKNKENDDDEGGELRPVCAIAKPLADIGFHKKILKVVKK
FT                   ASKHKQVKRGVKEVVKALRKDTKGLCVIAGDISPIDVITHIPILCEESNVPYIYVHSKE
FT                   ELGAAGQTKRPTSCMLVLPDAQKGGDKMSDDDAKEFKDMYGKVVSKIKSLD"
FT   CDS_pept        complement(149981..150589)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633829"
FT                   /orf_name="MICPUN_108209"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63642.1"
FT                   /db_xref="UniParc:UPI000199B11F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J5"
FT                   /transl_table=1
FT                   /translation="MLTMTLVIAFLAGAGSNGNGNGNGSRGSREREGERGVTTEDEAMD
FT                   AGRRAAKGGGERREGVTVAGGVTIEEMPPSPLGRVDPNVRGAVSSSSSRGGGTKQRTPP
FT                   PPAVASCGRDDSAKESRGGSLSASSDDESFGGDLAKSSSALDVDVAATRRAERDSPKRT
FT                   PPFVGGGEKDWSGGGSVSAARRRMIADRARRILEGDESD"
FT   CDS_pept        complement(151713..151922)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633830"
FT                   /orf_name="MICPUN_108210"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63643.1"
FT                   /db_xref="UniParc:UPI000199B120"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J6"
FT                   /transl_table=1
FT                   /translation="MAARERERLRQAELESDRLREELETVANHLAHERAERERDAARWR
FT                   ARESAANDRERLARTRIAALEVRA"
FT   CDS_pept        152134..153843
FT                   /codon_start=1
FT                   /gene_family="HOG000234041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633831"
FT                   /orf_name="MICPUN_58339"
FT                   /product="Oxidase"
FT                   /protein_id="ACO63268.1"
FT                   /db_xref="HOGENOM:HBG285857"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000199B1D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J7"
FT                   /transl_table=1
FT                   /translation="MQAAHARLRAHVPRRTPSRSSNAHRRRALRVRAASAKDKDDVIVI
FT                   GAGWGGLAAAKCLCEAGCSVTLIDAIDDPTGATPMLTKTGKPFEPGTRGFWKDYPNIVS
FT                   LTRELGIAEDEAFTEFTPSAFWSPDGLEATAPVFGDSLALPSPLGQVFATFDNFKRLPL
FT                   ADRASMVGLLYAMLDLNRDEATFEAYDRLTAHELFIRMGLSKRLVDDFIRPTLLVGLFK
FT                   PPEELSAAVVMELLYYYALAHQDSFDVRWIKTKSIAEVLIAPLCAKLQREYGLKVMGGT
FT                   FVNEVDVDEGERRATAVRWVNKSGEEGELAGADAVVFALGAKGMKSVVSNSPTLARVAP
FT                   EFSAAASLGAIDVVAVRLWLDRFVAVEHPANVFSRFEELRGAGGTFFMLDQLQKDTEVE
FT                   LWGGNEPRGSVVASDFYNGTAIACMSDEDIVGLLTERLLPAAVPGFAGAKALDYEVRRY
FT                   PGAVSWFSPGSYPKRPPLETSIANIVCAGDWVRMGEAEHGAKGLCQERAYVSGLEAGNS
FT                   LLRRGVVRGGAGRGHPVIPIRPDEAQVVFGRALNKQFMDAVTPFGLASPWIR"
FT   CDS_pept        complement(162269..163129)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633832"
FT                   /orf_name="MICPUN_108212"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63644.1"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000199B1D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J8"
FT                   /transl_table=1
FT                   /translation="MSDKENKPKRGTVPTAAPSYGPNPAPVATVVQYPATAHQNPYEIH
FT                   QGGYPRGALGVSPGLHAPPPFLPPPTYPPLWPMGDTRGIHTRMMHPDSRAYTSNLFDCF
FT                   DDLPTCLGGTFCTPCQVGRAASDAKAGDCCATGWIILGLSQLNQLLPGLGNVASGGYLA
FT                   HIANRAASNYGIQEHTDVLTACFCAPCVSCRLAREVKNRAEMGQEPVDWRLLAAAPPGA
FT                   YSAPAAPVMDAATQRHHHQAPAPTRRAAPVEASGSSAARESVVTYVAVVDSPAGEYGVA
FT                   RPNGD"
FT   CDS_pept        complement(163327..163791)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633833"
FT                   /orf_name="MICPUN_108213"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63645.1"
FT                   /db_xref="UniParc:UPI000199B1D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5J9"
FT                   /transl_table=1
FT                   /translation="MRHALRVAVLVAMLLLALLAGGAASASGKEEERRGEDDEPIPALE
FT                   PVCSSGSNDDVGPVRQIKFGDKVALDDLGPIIVNDDCTMRRIENWPRMTDRERRGTQKR
FT                   VSERNAARLAKCRDDYAKAGIWHDAYSDTEYKWKGPSRGRDPENERKDEP"
FT   CDS_pept        163960..164286
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633834"
FT                   /orf_name="MICPUN_58343"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63269.1"
FT                   /db_xref="UniParc:UPI000199B1D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K0"
FT                   /transl_table=1
FT                   /translation="MGDDDEEVVDNTAKANRADMNKLGGGGGDDDGGVDSDAAKKRALE
FT                   MANDDLKKEKEAEAARLKELMAVKISQEDVATIVGEIEVEKKAAEMRLREHGGDVVAAL
FT                   KSYV"
FT   CDS_pept        join(complement(165211..165460),complement(164364..165085))
FT                   /codon_start=1
FT                   /gene_family="HOG000265414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633835"
FT                   /orf_name="MICPUN_58344"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63646.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG561398"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199B1D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K1"
FT                   /transl_table=1
FT                   /translation="MAAHFQEEQHVPKECGNCGCTEDLALCARCHSIHFCSRKCQRAYW
FT                   PFHKEWCRQNDFADAAEKTEPKFARWMRKHGKMAVLKDDEVDRIERKVTSMEDLYGRAQ
FT                   PKPRPPEFDADDMRRMKAREETDLLAARAAEAATLEDKSALAYRQLEIEHNLGEDCGTY
FT                   KWRQTQTYVEVFVPLPATCVVATDVSVNLTSTFVSVRVRGEPVVEGELHSPIKAEASTW
FT                   VVVDGVLEMSLLKRNRRGNYDDGCTNADTFWYSVCLSTKFGGQIQPATGDHRGARRLAL
FT                   TEPPHEYYDTDWIADPEDAGPAGRDKNGRGASSRGRAIKGRR"
FT   CDS_pept        <165927..>166436
FT                   /codon_start=1
FT                   /gene_family="HOG000265415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633836"
FT                   /orf_name="MICPUN_73114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63270.1"
FT                   /db_xref="HOGENOM:HBG607796"
FT                   /db_xref="InterPro:IPR022203"
FT                   /db_xref="UniParc:UPI000199B1D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K2"
FT                   /transl_table=1
FT                   /translation="LVTVVEPETNRTLLCMLRRRFKLGDGQERCLCLPLDHPIDVLRGE
FT                   GLDETEDLSDIGDDELAAILPDMSMELAKKGMLLQRSAFCMTVRGAVRFNETDTLVMDT
FT                   GGDEESEGVEVATFQSGGSKYLVYAPMNPVLLVTKEDPGTGEHTVMFDEEMDDDVLEEN
FT                   MAAVEEE"
FT   CDS_pept        complement(166725..168701)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633837"
FT                   /orf_name="MICPUN_50166"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63647.1"
FT                   /db_xref="UniParc:UPI000199B1D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K3"
FT                   /transl_table=1
FT                   /translation="MRPIPKNTKKPLDASMPTSQRDDRDPPSPPAAAMSADGVITGRRP
FT                   YRFLDETSAWNGAVRLSAFVVLPLLCLVGGILMISYETGWANHEDRDSRDMAWDYRVTA
FT                   PGSNNFHGAYFRRAHWNTFRAIEAPATVYTEVVLAAVDRPTMLALHPTGACERTVQVAC
FT                   LATKPAHRAASAGPLNLGTDDGSWAVGDGRVLTRSSGVTSLAAVNTPEPAAYATHAELA
FT                   SFYLTRYAELHEMRQRVCVNCNAAPLVCAADATGKSCSWDSTQWAQWAQNSFTQLGTTK
FT                   TCETSVNVCEQVEAAIELAAKDEDVAGRIAARVVTGSWTADNVHTKHLASASAPTVQFV
FT                   TADPSTNKLVAGDTPVAWTPLTDTSTCGACGYVDPATALTFAKATAAANGGAAVKGYLV
FT                   PPDADGKYRGLRGGVAIGGVYADLQATHEIGDEWHTRRGFVPAFYEAGFWPWEPQCDGT
FT                   SSNVTVAIDPATYVPNFPAFDARGAQTPFVNVTALGTFSVVEAYESACDFDGAGVGAAA
FT                   AAVTCRVAALSGVDVAVAYTPVAGEDLGAWRLVSVAASYGGNGGENDVFVGTEAAAVAK
FT                   FTGGVTRSVRVTLRDAGAPETSSFPPLGTPGKIYAAMAFFLAALFTAPIHPYLMSSYVK
FT                   YNVAVNEGKPPPGWQAMRRFRGW"
FT   CDS_pept        join(168704..168931,169062..169190,169349..170122)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633838"
FT                   /orf_name="MICPUN_58347"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63271.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199B1D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K4"
FT                   /transl_table=1
FT                   /translation="MHSSSVRKNTKKKWGVVNGRSCPILPDVSLERNNEPILPATRNLS
FT                   HVRVLHCVRRGATARSRRPPASLIMGVPKTKWSPEEEEALRKGVKKYGAGKWRFIQKDP
FT                   VLGKILNQRSNVDLKDKWRNMYPGHSTADPNPDSVRSRPANTRVDAKISSPLGSHPSCP
FT                   FGDESFWFFFTLASRTDSSARPASPSQDDDDRKSGSRSRGKSGGGGGRAASDSGGSHHR
FT                   RGGSAKDHPAKRAGGSGKDNKDHKDHKDHKRRRHEKTAGDANGTHGTHGTHGAKGSEQG
FT                   SEPYLFLVNGQYRTAEEVTRDAARAVREAERAAAAAEEAAEEAELCEREAWEAERLANE
FT                   LLEEAERQKRASDAAAAATKMGPAAAAAGASTIFAV"
FT   CDS_pept        join(complement(170932..170960),complement(170394..170763))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633839"
FT                   /orf_name="MICPUN_58348"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63648.1"
FT                   /db_xref="UniParc:UPI000199B1D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K5"
FT                   /transl_table=1
FT                   /translation="MSGLLSLIRRCPARHATFTSNATRAWTRTMAGPNTKHYDVSDGPM
FT                   AQLLRIVRDGEGMTVSQLYERATSDGVGVHSRRHMKGLLQWMKKIGRVRTEPARNAQGK
FT                   IVRGKNHSFHLTEVGETHIAKIDEAAGR"
FT   CDS_pept        171322..184125
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633840"
FT                   /orf_name="MICPUN_58349"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63272.1"
FT                   /db_xref="UniParc:UPI000199D580"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K6"
FT                   /transl_table=1
FT                   /translation="MDPRGGAPGPTPGDDSPDGVASSASAPDPFAFGRAPASPPGAGAG
FT                   DSPPSRRHRTTGPAGQTHARRTPSSASAKSYTTLQGTPHPPGPPTGGPPTGGPPAAGGS
FT                   HVTLRGTPLPPTHTPGANRGAPSWAWLPKDGEVFAAADPGTCRPMMCDPIVDESMRSPG
FT                   VIEPLHVMEDGELGFGDEPHAPYRLPGDEAGPGLGGAGGSSGAGSSSSLAVPVLKDSTR
FT                   HAFEARLRADWVGSRRVSFGEATHEFSFATPDVAGLERIGEVGGGGFGSPFGQIGQTPN
FT                   TASTGGSSSSAISISSEGSSPTVGGDAAVAARALGCVGLVSVFTGKYLQARRKRPHRLQ
FT                   FYSDKRGVYEMWEVIGGARSKLGRWRAWGAALGVDALEDGNAETTTGSTSVGSASASVG
FT                   SNPRSRFMGDDEMRASLADLFDLPHVALESLESRDVCIVRSKQSPRRCLLLVRLTLPSG
FT                   EPVVSHSPSRAEPDSRLGSLSRRSLFSRGTTPTPRLSEGSISFTVQRPGGDDSPSEVRS
FT                   RRTSRTLESPVRSGSVSGRESQGEVTASLDALDVMSLSNKLLAGFARGRVETRRSQRQA
FT                   YFAWRAHVREVNRLRARAEMVGLLYEKKWRQRLVTAWERRTSELRAKRRNQERMCLRVR
FT                   QWRARWHWRRCTLGFVRWRRMARKSAAGGELLERWARRWLNSAAARCVARWRAHVADVA
FT                   RMRTAARRVVRRMRAVKLSTAFDRWFERATNAKLARAKIRSALAAAGKTTTRGAFRRWA
FT                   HVAADARRGARDARRAEVLFERRRRAFKADAFFAWTTYRFEKVRARYRFEKVSARWRRL
FT                   ERARPFRAWRESARRVREIRTHLRGTYLADLERLKHAAKRRGFAWWRLWTTATRRTRLD
FT                   AEAVQRTERRILAVAVNRLKRVAVAAAFDTWRDAIRASRLEARARRFANKLISRAAAFS
FT                   FEAWRDWVDERALAREKIAVAVARMTSSTLTRAFNSWAHATEAAWARRVKGERAERLLS
FT                   KVLDSKMSRAFAKWKECVEDSRKKVHFLSGHERARALKAQCRALRVMSAWKGYTIRKAI
FT                   GRSTREMADKMLRKKRMEAFLKKWRLEANWKDTVERRRLVSICRRRSSRREMGARFARW
FT                   RTYRRAEQRQRLAIARLVHASTYAAFATWRDFAANQRAFLRRMEKVMRRWLRLSLSYPF
FT                   ERWAQSVDERRRVRVVLQKCARRLANRSVATAFLTWSDAVAKRRERGAAERRALNLIRR
FT                   MTRLAVASAFDGWSDAVRRASAKRETAHRLLTRWLNAHAAYFFDTWAAHVRESRSRRVA
FT                   LRKTLARIRNVKLNAAWIAWTDAAQGCRRARRVARRLRNLRGSRTLAGWRSLCERRNAA
FT                   RAVLRRCERFMHRVLTVHLRVAFVAWLDSFRHRRQAKRLAYVASRRSRFAELGRRFARW
FT                   AAPVRNKRGLNLQVLANAIRMQNARAVKTRCFREWTRAVDDGAVRGDKAASMRTRHAAR
FT                   RAMRRWRFVAAAGKMNRRKMMIATRRWAGRVVVKCFATWVETSRVRRRLRRFLARLSAS
FT                   RLAAGFDAWAESTKHAKRHRYSLQKIVNRWRRLQLAAPFGDWVDWVDEVRNNRGTMTRA
FT                   LKKFRRSALWAAMSTWRESIGHARRERALLDRAERVLRRLVLRDASRALVSWRDFVRSR
FT                   RRLRALLRRWRARDMDVAFRTWRTRANEIVAQKSALRVAARRMLRHRQAAAFARWLDVA
FT                   AEGRHRAGNLRKMDTFVRRLKSRVASAAFFAWLERAIHLAAARASLERVAIRWTRLALS
FT                   VPFNDWVDWVEKVQRDRLKVSRFLHRMKTVYFARAFYAWVDARLEMKRRRHVMSRAERY
FT                   FRRANAQVLSKAFNTWAENVFDNRRRRYALEKIILRWQRLQLSAPFNDWADLVDEVRRN
FT                   RLKVSRFLHRMRTVKTAAAFARWDENRAEMKRQRHVMSRAEGYFQRASSQSVTKAFNAW
FT                   AENAAGAKRHRYLLEKIISRWQRLQLATPFQRWADRVDEMRGSRNVLRKAVHRMRTVKA
FT                   AAAFVTWRDNWAELRRQRHVMSRAERFFGALTRRSVLRAFNSWIDETLERKRRRAALGK
FT                   IVIRWRRLQLAAPFNDWVDWVEKVQRDRLKVSRFLHRMKTVYSARAFYAWVDARLEMKR
FT                   QRHTIQRASRFFQRVAKSDYARAFFAWRANASDLRRAKKSLARLVSRWRRLHLHYPFRA
FT                   WRDWLDETLGNRDVLRLVVHRMSRFALFGAFSRWRERIVETREVSIAKRRRNVVVEKFV
FT                   LRASRRELSRAFNRWVESTRAAKRARRSLRKVCARWQRLRLSVPFDDWVEWAEEVKSNR
FT                   LKISRCVRRLRKATVLAAWARWIEFTGESRRQRVLLARATRCLARLANRVAARAFARWR
FT                   DSVGRDLRHRAALRKIVIRWQRLQLSAPFNDWADWVDEVQRNRLKVSRFLHRMRTVKTA
FT                   AAFARWDENRAEMKRQRHVMSRAEGYFQRASSQSVTKAFNAWAENAAGAKRHRYLLEKI
FT                   ISRWQRLQLATPFSDWVDWVDEVQSNRVKISRFLQRMRTALIASAFATWRDNWAELRRQ
FT                   RHVMSRAERYFRRANAQVLSKAFNTWAENAAGAKRHRYLLEKIISRWQRLQLATPFSDW
FT                   VDWVDEVQSNRVKISRFLQRMRTALIASAFATWRDNWAELRRQRHVMSRAERYFRRANA
FT                   QVLSNAFNTWVESSADAKRHRYSLQKIVNRWRRLQLAAPFGDWVDWIDEVQSNRLKLIK
FT                   AVHRMRVVKTAAAFATWRDDWAERRRQKRVVSRSERFLRRIAMRSTAAAFNSWVANAEY
FT                   ARSLRHGLDKVIRRWRRLQLSSPFGDWVEWVARVNENRTMLRRVVHRMRRVKIASAYAA
FT                   WIDAVDASRAENVRLSKMDRVARRIANRTVASAFTALLENAREVKRLRRSAAAVARRWR
FT                   RLALSIPFDDWREAIAGAYRERLVLVRFVHRMRTVVASAAFRRWREFLLDGATTRAIER
FT                   RAEIMARRWAQKSAAAAFAGWVDAAAARVDVRRALARHVRKWRRADVSYPFVTWRDNVA
FT                   ENRRMKGSMERAKRFFGGRMLKNARARAFQTWKLHYTFVCRVREAEDREETETRRKNQA
FT                   RVRAQRMVRRWTLRTIAAALDAWAAFTRERRRLKASIKKATTRWRLLHVSVSFHDWASY
FT                   VEDMRRERLALRESARRMVRFQLLAPFQRWRDAAYVRRCERGAVLRAERFFTRLLRADV
FT                   LRAFNAWRGHWHHARRVRLELGRAVARWRRAALAAAFERWRVYRDVCETNRAILRRAGA
FT                   RLRSHRLGPAFDTWHAGWLEGRRAAAARGRAARFALRLARATLARAFRAFVAHAAERRR
FT                   LFAALGAVAKRWRSRTASAAFQTWSDRTSEAASHRATVAKIARRMSRVRLAAAVAKWRD
FT                   EVSFGHDVWAKEKLAMRALRRMARRQLAAAFDRLRANREDARRLRELLARCRARWGNRA
FT                   ASAAFDAWRLETDKKTLERKTLRKAVHRMRTVRVARSFATWRDTWRDTRALARAWERCE
FT                   RAFKRRAVAKVRAALNAWYLFGAKARRLTLQRQADELMFLQGSLGSERHQKEKASQELH
FT                   RARRETEGLVVLVERLQRETGVLLDQVAERDAQISRLLEERDRSSVATFSRPHDRVSAV
FT                   LASPPRRRKTPPRPPAAEPAPTSIEIREEPVAESPESPESPATPESPERSDSDEEDVTR
FT                   ELFPADDATPPPSRPSRTPPPPSPPRASDRRSSGGGGGEGTGTERTSKRTAQTSHSLLT
FT                   SHPSHDPGHYASYAANWASGRRSTTVDDLSVRLFARVRPFVDGDVDVTRSLRPSRPGAS
FT                   DLDVVTRRGEVPFRETFQFDGGVFWEDDDDVLPATTAAAWLADATRRGRDATMLVVGSD
FT                   KGGKTHVSDAVVAAAAAFLDLHAFRVNERAAAEAEKGSPRGEKGRAKRGSESATGSASG
FT                   SGSGSGSVGVESIVETGLSISVYQTRGLHADDLLAGFGGAAGLRVKPGPEYAEGVGQTV
FT                   GQTGTDEPGWNTQTGGGLLYEVEELTRVDCADLRDVRETLALARARRDGKNGLKRSAGP
FT                   SETAAATVSELWITTTETRVLNRGHGLNRDDGFGDEMRRTVHRRCARVVDVGGGDGVTS
FT                   STPLFNLGQLVRGVTGVTGVTGNAPDWRRSALTKIMKGPLTGTGTLSVLVATAASEAHA
FT                   ADALGALRLAAAAKRLPGRGPGVTGVTGVTGPAGGMAVRKVVERPALSRRERLERTLEL
FT                   ARSTARATVLSEGLGEMTTPPGRRSAAERRAREMSMDVQLTPEHVRFGLSPTQGDARTP
FT                   GRSFRPGPRSASKRGPRPNDDSDGEEGKNRKRE"
FT   CDS_pept        complement(<185227..>186201)
FT                   /codon_start=1
FT                   /gene_family="HOG000241940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633841"
FT                   /orf_name="MICPUN_69576"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63649.1"
FT                   /db_xref="HOGENOM:HBG316537"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018790"
FT                   /db_xref="UniParc:UPI000199B1D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K7"
FT                   /transl_table=1
FT                   /translation="EDLTHLFDEQGIDRDLYESDVSFEDPLTKYDNIDGYLFNIGMLKN
FT                   VFTPTYTMHAIEQTGDWELSTRWTMEMNLPEFPFVWRPKLTFTGTSVMGINPATMKVRT
FT                   HFDTWDAIDTQGFFLKSRSPEGVREVFQQIFDFTKQPDLETPRYQVLRRYAAYEVREYL
FT                   PFLVAETRTAAEGASRAAAGGMTGTGDGSNFNPFGTLAGYIFGQGNRTGEKMSMTTPVF
FT                   TSPGKMQFVLPSKYTDPSQLPPPKDGVPVRVTRVEGGVYAALRFSGIATDAVASDAEAR
FT                   LLDLIERDGLTRASGVASSLAQYNDPATPPPQRRNDVLVRLEGF"
FT   CDS_pept        join(<186850..187031,187077..>187809)
FT                   /codon_start=1
FT                   /gene_family="HOG000198187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633842"
FT                   /orf_name="MICPUN_75952"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="racemase and epimerase activity, acting on
FT                   carbohydrates and derivatives"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO63273.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016857"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B1DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K8"
FT                   /transl_table=1
FT                   /translation="LVTGGAGFIGSHLADELLRLGYRVRVLDNLSTGKAEYVDSRVEFI
FT                   EGDVRDADAVERAMRPSATDSATDAAVAVVFHLAAMSKVGPSLHDPDMVKFCVENNVVG
FT                   TENVLRSALRAGTVRKVVYAASSTFYGNQPTPFAESLPMKISSPYAVTKHQGELLMRVY
FT                   DEVHGLPTVNLRFFMVYGERQPESGAYAVMTGIFLAQRERGEALTVEGDGTHFRDFVHV
FT                   DDVVRSMILAWERAELRGVTVNVGSGRAVTVNEVAEMIGGEVKRVPPRAGDLEGTLADT
FT                   CAAKRTLGFEARKNFEREIREMVR"
FT   CDS_pept        complement(187935..189011)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633843"
FT                   /orf_name="MICPUN_58352"
FT                   /product="Predicted protein"
FT                   /function="specific transcriptional repressor activity "
FT                   /protein_id="ACO63650.1"
FT                   /db_xref="GO:0016566"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniParc:UPI000199B1DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5K9"
FT                   /transl_table=1
FT                   /translation="MTTRGSRATEDEVAAFPHRYEVGDEVEVGLDGRSSLYPYDQGWGE
FT                   GTIVKVHPLVSEFPKGAFHGMDASRLGAAVPYMVQLHKGKTIVPCPIDDPDFIRAKGAK
FT                   YQTGAPTRFKVGDSVECKIGPGPDDWIPGTVRALWQPYPGWGRGWRELGMFGYERDSRQ
FT                   TPDCCPYHVTPDGKRFDGKVVGATNIMVPADNDGYIRTSAKFREKAAADAIEAANAAGH
FT                   TRPGREQLDAVVGAYKESVAADPAHVAALDEFIALLEKTVQLAVVGLGNLPEKRVRRAI
FT                   RALNPRKLPRKGDARRARTVLLKLLIQECKNDAKYERRFRDMLEDMRRRDGEQYDISDI
FT                   YPLDSETAHVTIGRRDDY"
FT   CDS_pept        complement(189177..192986)
FT                   /codon_start=1
FT                   /gene_family="HOG000100062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633844"
FT                   /orf_name="MICPUN_58353"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63651.1"
FT                   /db_xref="HOGENOM:HBG561000"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniParc:UPI000199B1DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L0"
FT                   /transl_table=1
FT                   /translation="MVGRRLPTLALFLALIAGLLHGVAATAGDTYTYDFIINVAQVGQL
FT                   GPHCFYVKLDGVLPSQYQFTWHRPPDRRVCDASKSGGSCATGEIGMASDDPLKYSAWND
FT                   KMVGEKIFSVASATRIASIEISCYYPKYTPGWLIKENGMEVYRETANRGDGDIPYPATY
FT                   TYDLVCDASSPPANGGVGNCTSALFSGESCTPTCDTGYLLVGERSCVDGTTVDTAACVI
FT                   PPSPSPPPSPPPPAPPPPLLRLHLVADDMNATSHTQNLVWRDRSSFGNDLTTHLAAPEV
FT                   IEDAFNGHKALRFGFSDLFQDDVEGFSCMRLDPVSSDNLLTYGSMSHWSFPGVTVFAVI
FT                   EPRDVPWGGDGDPLDFVFDFGEFPTQGFGLAWHENERTLYTPTDHGGEVRRSAEPRENK
FT                   KYVVAIQYTFGQDGHVRALTQFATRHGRADLIDPTDSSGAAQAFSVHGFTPETVAHEQS
FT                   PFSVGCMSKENTASGAKGKRVFRGDIAELRLYAGLLSLDEVFAIRDALVDTYVPECERG
FT                   CSTLTRRGLNQVDRYDEPAVKAPVSEEYKCIADGECISARFIRLYKTQSASNPTIHLLE
FT                   LAVWTSAFPDINLAAGKDVTCSPACHSLSGSRLVDGATNTGTAHTCFEGDDASRGGLAE
FT                   GACANDVSRWMEIDLGQEYLIDGMLIVNRPDQYRIRIQDVKVDFKDADGNVVLTTAAIT
FT                   SDESSEDGYVMDLTKTSLQSNVEFDAWKYIPQGEIIQAADFDWTPYKRWCAVNEYWDGA
FT                   ACRDCPVATTSRGGDVTMCCAADEFWNGQACGACPTGSTGMQYVMCTCATDEFWNGTAC
FT                   QTCPTGSFSPGGAATSTSCTSCKANEFWNGQACQTCPTDSTGIQYVMCTCATNQFWNEQ
FT                   TQACETCPTGSFSPGGAATSTSCTSCEANEFWNEQTQACETCPTGSFSPGGAATSTSCT
FT                   SCARDEFWNEQTQECQTCPTNYFSKGGAATTTTCMTCPAGQYRNNDAGCGACPTGSTSP
FT                   GGSGSVTSCDTCLSHYYKSGSTCVACPTNSVGAGGSATSCTCNDNYRAYWSGSAWSCLA
FT                   CAAPYVKSGSVVPQSIESSDTCDDPPPCQRELKVERVGGDPSWGAPFYFTCGDVEVYAG
FT                   ISDSRTKLVIPPNNIAWGSCPTASFKRSAPGTSSFRYANTAWNYDDVFKVTEMNNCGCR
FT                   RKVRITRTDASTGWGHWMSLRCAGTGGANPVEVIVGNSDSNTKDVVLFSPYNYECPPTF
FT                   TLGTDNFQLDLLSTTCYSGKQVYDGAPYEQWIHEPALNQFWTNV"
FT   CDS_pept        193837..196611
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633845"
FT                   /gene_name="FTSZ"
FT                   /orf_name="MICPUN_58354"
FT                   /product="Prokaryotic-like GTPase "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="protein complex"
FT                   /protein_id="ACO63274.1"
FT                   /db_xref="GO:0043234"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199B1DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L1"
FT                   /transl_table=1
FT                   /translation="MLPAASPAAIASLPATFAPPKALRARRRRGRRSKTPAFAPVSVAS
FT                   SSNPQTLPRGGKSARGEGAGVTVVGIGTRGTVVVDRLVKQKVLPLAEYWVLNSDTNSLQ
FT                   NSAAPNRWRLPPGNVPATDSAVLDNAASAANAILSGGVSRRPPGTILVLASAAEAAGAG
FT                   LETVKAIARLKDGEAPQRKWSLSGFVGRSRANAIAHRGPLLISAVVCPFDFEGPRKSAL
FT                   AAEFLDAAQMASDVVCAVPQASLTESSEGTALTVAEATEYADTTLQWSAWTVLEMLRSP
FT                   AWVGTNAAGGAGKVLGWDQELTAGLLRSAVTGRDQVGAGIDGCGVASVGHGAANVQIAG
FT                   FPLGQAQAAAVRQAVIAAARDSPFLRGSLFRAAELVACSITVGGELTAGARAAASDALA
FT                   QLTNGECVQVITAPPADVRAAGDVVEVTLMVVTEPSVAYAPRKLGEKRRETTSGAHVGR
FT                   GSKDSYDTSVSFPEIPGISNVKPGRLASAFNEAKRAQQALGIGYDATGPRTATASGMSP
FT                   PGDETAADDDEGKAKKAQKLTGEMMRKLGLNDPKRMVDEHEEGQKRAANGRVNGDPSPA
FT                   PAVSFRGEEEEEKVSKAQILDAAARGEAPPPLPVPKKRETVRVKVESALPMPDPEEVAA
FT                   RVEAPEEVAKPAVEPLARNGAKVFADVHLEDEAEEPEQPEPPEPAPEPVADVAAAAMNR
FT                   PKPPKTVEPSVDDDASAVAADAAEKAGSVPDVVVALPREMGKVQVAIRILEMEEDGSGN
FT                   VIGYKDLSGAPANASDGGADSDSDEEYRSDEPAPKRGIFGWTGREKQEAPRGSKDAVKN
FT                   RLASVLDKDRSGWSRDVVRMEFAGSSVYEGEWAAGKQEGEGKQVYSSGDWYEGRWREGL
FT                   PDGRGKLWYMAGGHFEGMWMGGAPNGPGVLDLEEVGGPRVDGRWVDGKLTEQW"
FT   CDS_pept        complement(196690..198033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633846"
FT                   /orf_name="MICPUN_58355"
FT                   /product="DNA glycosylase"
FT                   /EC_number="4.2.99.18"
FT                   /function="DNA-(apurinic or apyrimidinic site) lyase
FT                   activity"
FT                   /function="damaged DNA binding"
FT                   /function="hydrolase activity, hydrolyzing N-glycosyl
FT                   compounds"
FT                   /function="zinc ion binding"
FT                   /biological_process="base-excision repair"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="ACO63652.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003906"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016799"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="UniParc:UPI000199B283"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L2"
FT                   /transl_table=1
FT                   /translation="MVEGHGVHRVAASARRHLVGKRFTATSPNGRFAHGAEVIDGKELK
FT                   RVDAIGKNLFYFFNEADGPDAHVMHVHFGMSGRFSTHHTLPGPEPGATTRLRLESREHG
FT                   ICALLSAMTVELGDISLFQTKRAKLGEDPLREDADADRLWEKFTRSRKSVGLALMDQAM
FT                   FAGVGNIYRAEILYKAGVHPEQPCADLPRPAFDEVWRHSVELLQRGFVTGSILTVDPDE
FT                   AKTLGEPWTRRYVYNQRSCGRCGSAVKTWDMAARTVYCCEVCQPLVKSETSNGASAAVR
FT                   IKVARDHVPFVSHCAAESPGTLAAEPEKLTVAKLKEILDSAAAWPEGLKRTAKKAELVA
FT                   AVRDMATGGYTPATLARHGLAATPSPRKIPAPGIAALEGAEASASAAAAEKRRAGEKGN
FT                   VEHVALADDESLGRGASKGNKRGGTRGAPVTPETRAPDRSKVRRRESP"
FT   CDS_pept        198262..199482
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633847"
FT                   /orf_name="MICPUN_58356"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63275.1"
FT                   /db_xref="UniParc:UPI000199B284"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L3"
FT                   /transl_table=1
FT                   /translation="MSRRFATLADLMTGRGGVHEVSARRLVPVAVADLEGVDRLSSEAV
FT                   LEAGPSGAGGDARDAAASPSRYFESHVEYVLPVASAGAPPRSLHVLRLLPAIEANLRAE
FT                   LLPRAHANARRGFDAMERLVLGPDAGVTVSNVGGYQSAHDVLEPDTWSDSDEEDGEEQD
FT                   GEEQDGEEQDGEEQDGEEQDGEEQDGDERLPRDAAVDDVEPAASRATIKGWGMLSEVAC
FT                   AAHDRVRDRAMGERAVTRDDLYGWLNCNAPGDFNKLHDHGGAESWSGVYYLQCPAPVRG
FT                   VGSDSDGDSEWDEAEDEGAYGAGALGLRCHVSRHVSDNVSGSVSDDDGGDTSDASVPYL
FT                   RFQPRVGDLIVFRGDVLHAVESNGCARRGFWRGDLSDKDMESMRMSVAFNEDSAAADRK
FT                   AALALAA"
FT   CDS_pept        join(<200107..200447,200510..201195,201685..>202061)
FT                   /codon_start=1
FT                   /gene_family="HOG000017164" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633848"
FT                   /orf_name="MICPUN_66924"
FT                   /product="Predicted protein"
FT                   /function="6-phosphofructokinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="ACO63276.1"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG454858"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR013981"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI000199B285"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L4"
FT                   /transl_table=1
FT                   /translation="RLGLVFSGGPAPGGNNVAWGMLDCLERWAAESGRGDDAEPANFVG
FT                   FLGGPDGLLRRRWKRVDAGEMKRRKNQGGFDLLGSGRTRLNTTAHFEAVRDACVEADLD
FT                   GLVVCGGDDSNTNAAFLAEHLAADPNCRTAVVGVPKTIDDDLKGGGIGVSFGFDSASGV
FT                   YAETIGNLCSDARSAGKYWHFVRVMGRNASHLTLECALRCAPNVALIGEEVAANGVTLE
FT                   AVVDDIATLVEARAREGLTHGVVLVPEGLLAFVPDVAKLMDELARVHPGGASDTSNTMA
FT                   SLSMDAAKTAASLPNDIFAELTRTRDPHGNPRLSAVDTEKLLGRMVKSRIDAAGATRRE
FT                   EAQTAVDAKFSPVYHFCGYEGRSGLPTDFDATYAYALGYAAATLAAGGANGVIATVTNP
FT                   EASSPRDWRVAGVPMCRLMRRESREGRERLVIKKTPVDLNGGAFAAFVSRRDGWRMVDR
FT                   YACPGPVQFS"
FT   CDS_pept        complement(<202483..>203763)
FT                   /codon_start=1
FT                   /gene_family="HOG000200809" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633849"
FT                   /orf_name="MICPUN_75576"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO63653.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG529991"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199B286"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L5"
FT                   /transl_table=1
FT                   /translation="HDWRAFAMLCAGVFVIMMDQNLMAPNLSAIAHDFGFDDTERDVRL
FT                   GGHISVAFFLLGLPAALVIGVLTDVIQRKRILVWTMILGQGPCVLALFVSSYWELFAIR
FT                   TLTGVAVGGALPIVYSMVGDLFPANSRSYASMIVGMAMNFGGMFGQGVAGYLGPSFGWR
FT                   VPFAVVGTFGLIVAAVVQNFAVEPRRGVADGGDGGLGASAAAAAAAASAKTASLASHRW
FT                   APLLREWLKKSAAVFRRPTNVLGFLQGIPGCVPWSIIGVFMNDYLAVDKGLGVEHATTI
FT                   MMFFGFGGMFGTITGGVLGQKLYNAKPWYMTAYMGAAAIAGIFPWLYIVEADDYGTSAE
FT                   AMGEKIAVMFFAGWLATMTGVNVRTVIVNVNAPYERGTAFAWFNLTDDLGKGFGPVMSS
FT                   ALVAHVGRTLAFKLGFGFWAPCGALCLL"
FT   CDS_pept        complement(203949..204644)
FT                   /codon_start=1
FT                   /gene_family="HOG000199436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633850"
FT                   /orf_name="MICPUN_108215"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /protein_id="ACO63654.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199B287"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L6"
FT                   /transl_table=1
FT                   /translation="MLSSPTVTNTHVVTPATARIHRASRPVRVYPSPTRRSTASKTRRH
FT                   PVRSRSPTTVLAQAAAAEPDPNPPPWSSLSVPVYSLATVPDAGPTKGDSADRPSMNITT
FT                   YCTPVTIKPTRRLAVALYTHTATARNMLATGRGVLQGLRSHHAELVPLLGKSSAHDVDK
FT                   LEALRETHGLNIVERWGVPTIEDAKSAVLLEIVSLETAGDHHLALCEVVDWENIEGEGE
FT                   PLYTGDLPK"
FT   CDS_pept        complement(204881..>205354)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633851"
FT                   /orf_name="MICPUN_97341"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO63655.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199B288"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L7"
FT                   /transl_table=1
FT                   /translation="DPRALGRLAEELKVWRKDPLHGFVARPETVDGAVNLLRWECSIPG
FT                   KKDTLWFSGHYPLTMEFSEDYPFKPPKCKFPQGFFHPSGVYPSGTVCLSILHEDEGWRP
FT                   SITVKQILLGIQDMLDSPNPASPSQSEAYLLFKNNRADYDKKVKEQATRYPAL"
FT   CDS_pept        207000..208469
FT                   /codon_start=1
FT                   /gene_family="HOG000265455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633852"
FT                   /orf_name="MICPUN_100375"
FT                   /product="Calcium-dependent cytoplasmic cysteine
FT                   proteinase, papain-like protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63277.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG561410"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI000199B289"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L8"
FT                   /transl_table=1
FT                   /translation="MGSDSRYATKIQADSADKEYVDPCSTTGCMKGRGAWGCVFFPVVL
FT                   LWQSVNIYFIPCVGIYLNRLATVGEKGLCCLCVLFGCWRFKDTEFVGDAALGDPVKYRD
FT                   VEWVRAREICKGLEPGKNPKLFAGKIEPADLRQGHLGDCWLLAALATLAEHPVAIRKCF
FT                   LNREYSSRGKYRVRLYDGLKRQWVIIVIDDYIPVKKGTKDPIFVKPNGEELWAMLLEKA
FT                   FAKFYGSYAKLSGGQEIGALFQITGDNCFSFRSVPETKKDDGYWKHHWVRHDPKFMFEE
FT                   RDWVSFERSDEEIKDDRFFRIMLQYNHKHSVMTAAFMYNYAKSDPELQAACEDRADRWG
FT                   LVPSHAYSVLEVRRAGTSLGMGGVRLVKLRNPWGSYEWKGKWSDGSKEWTENPEIAKEV
FT                   GYVDDSSDGAFWMSFDDFQDFFREVQVCDRTTVEDLRLDVVEDSAICGPTIGCVGGCIG
FT                   FWCCCMGARTIYCGNVTKAETEKAAGCCTTV"
FT   CDS_pept        complement(208566..210422)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633853"
FT                   /orf_name="MICPUN_50172"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63656.1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199B28A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5L9"
FT                   /transl_table=1
FT                   /translation="MSTTMALAALLPVTSKEGSTRATKTAILTKIRAVADSLPDGSRIY
FT                   LGIDDDDTVLLPIDQEELEQATHPHGVTRRIFASTNPSNIIGIVNELCMLAFADGMDFF
FT                   VLLGDDVSLQLGWFDTVSQNFKEIERSTGQPGFGCVALDDVSFPGFPTFPIVGRSHVEI
FT                   FGGWAPSAFINQGADPWIFEVYRRFNSARFCDARVRNGIGGDELNESRYVKHTIQWKDD
FT                   ILTNAVASVRTAKPFLKETVTLDVLVPSFRADLDILQRICELDVPSGCSTQVVIIIDDP
FT                   ARIDARRLLEEKYGHRVRVRVNDGNLGASASRNRALDESAAEWVLFLDDDVHPDNLILH
FT                   TYVDAIRAQGDYVSGFIGPTQMPPPANVYCAGIELVWLLYFWSKHVRSRKNDEVPWGVT
FT                   AQLCTKRIEVRFDLRFPKTGGGEDIDYCLRVKRVTKKPLLGIESKCVHPWWDRGYPRNN
FT                   RFYGWAEGDSMLIPMYPEHAYLSFPNAIESMAITCLASAAWMCGNSTACTETPVRCAVI
FT                   CFGILLCDAVFDVFNIFFEDNVSHFRGTRRLLAGIIGSVWYKNLGVELGHFYAPIRRFQ
FT                   FQVLHRFDWWCGKDKSKVDETRLRELMRFVAFAGLALLVAIS"
FT   CDS_pept        complement(210824..211621)
FT                   /codon_start=1
FT                   /gene_family="HOG000198132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633854"
FT                   /orf_name="MICPUN_82178"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63657.1"
FT                   /db_xref="HOGENOM:HBG714520"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR015916"
FT                   /db_xref="UniParc:UPI000199B28B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M0"
FT                   /transl_table=1
FT                   /translation="MRTERGYLAVAHAGRSSGAGLLALGGSDGKGALASCEAFDYRAGE
FT                   WREIASMSRPRIWLGAATVGDHVFAAGGYDGQEYLDLVEVYRPGPPEAKPGSVSALGRW
FT                   ERCRSLSSGRSTLGLVGCLGTLYAVGGFTAPHYLSTCEAYDPNADQWWGVAPLGAPRRD
FT                   LGLAAIEHRHMLVAAGGYDGRKYLGAVEAMDPRINRWRPLANLRKPRQLLAMCAKGDQV
FT                   WAMGGFDGKEGVRTVEVYDARADKWTDAAPMSTPRLGLGACCA"
FT   CDS_pept        join(213068..213129,213201..214515)
FT                   /codon_start=1
FT                   /gene_family="HOG000265401" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633855"
FT                   /orf_name="MICPUN_100377"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63278.1"
FT                   /db_xref="HOGENOM:HBG316928"
FT                   /db_xref="InterPro:IPR012419"
FT                   /db_xref="UniParc:UPI000199B28C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M1"
FT                   /transl_table=1
FT                   /translation="MGMRSPAPRRRGRRGAATPPRRALIASRDTLRAWTELGCVLALFW
FT                   IADRSGAVPDAEKHYDRDLFWAIFGALGAYGWFTTAKECRSNAPLNREQTEEWKGWMQV
FT                   LFLLYHYFKASEIYNAIRVFIAAYVWMTGFGNFSYYYVRKDFSFHRFAQMMWRLNFFVF
FT                   FVCLAMRNDYVLYYICPMHTLFTWAVYFALYVGREHNTSTNVVLGKFAVCFAACYVLWE
FT                   IPGVFTAVFGPFQGLFEYVDPKKPDVDPMHEWFFRSGLDRYVWIHGMACAFFHPRFESA
FT                   MKKVDEMDQRRRVTAQCAIGAATLGAMYWWYSSVYVLPKLEYNALHPYTSWIPITGFII
FT                   LRNLTRGLRSWHVSLFCWCGKITLETYISQFHIWLSTSNVPNAQPSALMALVPGHPMLN
FT                   FALCTALYVGVSKRVFAVTNDLKIACVPDDARQIGLNAAFAAAWGVGAWALGAVLSSAF
FT                   "
FT   CDS_pept        complement(214644..215351)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633856"
FT                   /orf_name="MICPUN_58365"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63658.1"
FT                   /db_xref="UniParc:UPI000199B28D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M2"
FT                   /transl_table=1
FT                   /translation="MTPDPDTLAKQREQLAKRRALRASIPEEAALEAAAAATAAGSPAV
FT                   SSRGSSEGAAIAEAAAAMAAGDPTHPATLFASFSARDAGERAASSRAAAAAAAYHQADE
FT                   DAHRLAVAVVDPVSAPVSDVAAQTDPPPPAPPRVVPIHDPPTVDVFAAVVLGLLVVGVV
FT                   ACACVFPAQGARDARGDARRWETTLAAWSIANDLPRVASLEGFYAGAAKGARGIEAYLP
FT                   PTETRDEDGRTNG"
FT   CDS_pept        215577..217244
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633857"
FT                   /orf_name="MICPUN_58366"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63279.1"
FT                   /db_xref="UniParc:UPI000199B28E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M3"
FT                   /transl_table=1
FT                   /translation="MTAIPVSRLRPPNVSILFGVAAPPAEDDARAIDRRARASPPCLLV
FT                   ELALRPSSSAAGETAVEGGGGRVTLAQRACAPRWEFLFRLDAREAATSRGVVTVLDPSV
FT                   RSHRGGCVLARVELPTLPAVRGGGGSGGGGLPATRVDPPVAPSTVACPVASPSPSRLHL
FT                   LPSPAAPLWVDRAEALVRDPPRALALSRVVQLLLLLDVCVVALFVLFAGRSRRRRRSRV
FT                   EMEDDLADDVDAAPETRARSRAASPTAMATSHPSPSSLSLSSFSSSSERGTTALRRAEE
FT                   EVFPDDDPPSPSFLPTATPPRWTIVADVDAPCDPHERRDWSISAVVRTDLTHGGVQETD
FT                   LVTAFLAAPPRPCGRDRNLDPSLEAAALDRDVSFEDDEDAGVSSADDDEDGLLCREARV
FT                   VVPVPVPAEKSRRKSPAFRVKMWGRSMPGATARLLLRDLRACAQFAGATMRTFAPGTFE
FT                   SPGNPSLPLSVAPAVAVPGTAASAPAGVPTMGSAAAAAARGGGRRGWAAAMREFAAPPA
FT                   TAADADATDLFRREGWEGSRRDSKGRLAKKSGAKPAGR"
FT   CDS_pept        complement(217423..219750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633858"
FT                   /orf_name="MICPUN_58367"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63659.1"
FT                   /db_xref="UniParc:UPI000199B28F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M4"
FT                   /transl_table=1
FT                   /translation="MTTTDATRMEDDDHATHAALRSSKTGVRDSLGSTIVPPPPSDSAS
FT                   DRSSYDDDLDEDLSAVDGDEERTMEDEDPDPAFETIERGPLADFDDDELRGILARADLD
FT                   AEDDDEDFLDDDDVNDEVNDEEDLGEGSARREPMSTSAALAALKSTRPRTARAPSAAAD
FT                   VSLDAASGKKKKPPNNPGKIVGPNLAAKAWFADLATLRNRQRLVEHRELAPALDKLDPD
FT                   LESTARRDAEASRRECAALSGDLAGRLKRVREAVNELGVHVVNIRGGDEYVRTLGRLMD
FT                   GAEKDIVALKEAQRCAFDALQEEEKELARYVDDFASRLDDPSWGAGASRALVAGIDARN
FT                   AKAQRKIYGTKRPVSAGTVLRGAPRDEPWTVEKTSHAFSADKTPAKSASNPSFQSPHST
FT                   SSKPRPATARDPVGPWARGVATTSARRTPGRGGDSPGGDSPDTAGADGSPSKRAPPPAV
FT                   TEYERYMSDYGPTGGWADVDHSRWRRCLARCNMNYGNAVVLAAEELAPFGIERAEVVRH
FT                   ARWDAEREELHEARKAAVAQWRAEQREAERTKREALDDTLRAREVSARREREERFNARR
FT                   LEEKARLAEWREKKRSEEEAALAARREAERVAVAARAEAARVKKKEREEREARNAARAQ
FT                   ARWEAAEAARAAAEAAAEALIPKAVDVSASEAKAERDRLAQRALETAKKRREAATARDK
FT                   ALSERLERQKAAAEKLAARRRLAEGRSEEVAADPDRVTRATAAHAMRVASDRPDRGLFD
FT                   SRPAVQYVQHRATPSWTSGVIR"
FT   CDS_pept        join(219925..220040,220152..222453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633859"
FT                   /orf_name="MICPUN_58368"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63280.1"
FT                   /db_xref="UniParc:UPI000199B345"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M5"
FT                   /transl_table=1
FT                   /translation="MSGKRGPPSGTMVSPRKSFFQSLDKDERDALLKIAPSLRSKFDAT
FT                   DRQERRLSHASEPESPAYRLHPPSVNGGRSPRHSTGAASARSAAHHQTTATTPAGSRRP
FT                   SVAYANLPADDDVDDAPPVTITRVGGGYSGVRSPKTTPSPAARTPAIDDDDHHHHRRGD
FT                   RRRPSATTTRRPSTAATARDRTRDHRAAFDPSLTKQLAHKEATLRFELERVRAQNATLL
FT                   AENDGLRVRLEDARRRFTATEGDFVLQSHELDRARERAVGEGARRVAELEDRCDRQRRT
FT                   LQELAVASEALAKDNVALSNELVALRDSNEENEGKVRELTTRLSSAQRLYLAGQKSLER
FT                   AEELREATAGGSELERKLDALLTPEMLARSRPPPSYPAPLALGPVDASSSSGVGGVGGG
FT                   HDGVQGGGGGGGGGQRIPGSLISDRQKVAEENSKLRARLEKSERRVVELGAESREANGA
FT                   LAELRKATAASSRRHNAQLTGALRRLQWLVERQGRLEAECEEKDAYAKSLERRLLSQHK
FT                   TLRGVASSAAGKGAPFARASTVKGVASGRSTAMDARGKGGGGGGGRGLRASAAALLRTP
FT                   ETPPERSSSRYRAGGGGWVTGAGRRTPEARAAIALSRRAMAMNASPTSAPTPGGEDDSD
FT                   DDLSDDPKARGSDPDADADGAGPRRLDWGPGSSAFNRVAGDGAAPSPGDERSLNPKTRI
FT                   AGVGAIGIALESEAVASDDEDTPRRPEWVHAPAKATPSPGTAGSGSGKKSGTKARSGAE
FT                   PSPRPRAVGDDMSMEAIQDYIVQLQNLHERSAQLASSGGGEPASESPLLMGD"
FT   CDS_pept        complement(222534..223646)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633860"
FT                   /orf_name="MICPUN_58369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63660.1"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199B346"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M6"
FT                   /transl_table=1
FT                   /translation="MSSTVFASTRVAPACRARDRATKHRRARPDPRVPREFRSLRAPAL
FT                   EGDHRAPVDGAGARGAPRRSNAPRAIVTRTRRDHVASTLLAVAVSGLVNAVPVPTSWAE
FT                   DAAARATGDRETETVLANDDRREREGGSVLGAMESPMSSTTAAIDAAEVAVPLEIIGGN
FT                   RPAVARDDSLPDEISVAGKVLTRYVDETSGYSVAVPAGWARDQPAANTPEFHPVSEYGG
FT                   RRFRVTVTPVGKVSSRLLASLADSDSEEIQDGGFESAAAYAAKEASKFAPLEGTPAAKA
FT                   AGINATTQILDARVSEDGAYYYYSFRSEGVYPFRFWGASAVGPGQTGGARKLGRRDVVS
FT                   VVAQMPEDKAKEEDYELLRGVVESFRVFDY"
FT   CDS_pept        224120..225088
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633861"
FT                   /orf_name="MICPUN_108217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63281.1"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B347"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M7"
FT                   /transl_table=1
FT                   /translation="MGVCASTPQADAEPEAKGSRRKNVPPPSEVADAAALEARRARSAV
FT                   LTNEERAEETELEAKVLSLFVQMDVDKNNGVDGKELAAVLDENPALRRRLLRNLDLDVR
FT                   DGSPQSTECADSSVVAAAIVKAAAAANPDMNDWSGDSHSIGWYDLERAVKGTPPVDYRK
FT                   APDSPKLCRENMLRGARARAEIKRTEGGGYAGLTDAKEAVIIGERARNLQVNRRALYVE
FT                   SEPDVWHDGALYSTDAAARRARAAKQREIEETLRAEGLIRDEFPGLDAAAAAAVRSEIK
FT                   TGGVVVDIEDDDDMAKKKTRKLPPKLETLRNTPIKSRAIAA"
FT   CDS_pept        complement(<225254..>225880)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633862"
FT                   /orf_name="MICPUN_72485"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO63661.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B348"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M8"
FT                   /transl_table=1
FT                   /translation="PRSKDALQGVSLRVPRGSMFMLLGPNGCGKSTLLRTFAGLVTPWS
FT                   GRLRVQAPRAFVFQNPDHQVIMPTVGNDVAFSLNCRYPNMSAKEMNARVRAALAAVNLD
FT                   PDEFMTRQVSTLSGGQKQRVAIAGALVENPRVLLLDELTTFLDEADQAGVVRAVRNVVD
FT                   SDSKVTAVWVTHRLEELRHCDAACYMEDGRVAEMGSGDYIRGYIRQ"
FT   CDS_pept        join(226371..226531,226758..227196,227221..227397)
FT                   /codon_start=1
FT                   /gene_family="HOG000243552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633863"
FT                   /orf_name="MICPUN_106889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63282.1"
FT                   /db_xref="HOGENOM:HBG412609"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000199B349"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5M9"
FT                   /transl_table=1
FT                   /translation="MQYGGGGYGQRQPGAPKARIVMTEARKSYVNKWQTDLMGAPCANP
FT                   GFCLYAACCNVCVAYSHRKEIMFNDLTNYTCCNGDTCISGRCGEKSCPEFCLCVEAFCC
FT                   FPSAVATNRFMIQDEMRVENTPCDNFLIGFMLCLNQLACIFRVAAMISQNDDIERAADI
FT                   LDCMADVTYCSVCACMQTQHQEQLKMRNPNARPPTQGVIYQMPPGAQPAGATHFQQQHY
FT                   QQQQPPAPTYGYSQPPPPQYGYSQPPPPQGGAQYRY"
FT   CDS_pept        complement(227703..231602)
FT                   /codon_start=1
FT                   /gene_family="HOG000265382" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633864"
FT                   /orf_name="MICPUN_58373"
FT                   /product="Bromodomain-containing protein "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63662.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199B34A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N0"
FT                   /transl_table=1
FT                   /translation="MSPRPRRAAAQAAAVSLAANVDGDAADDEGGGAWGGKGRRTARGA
FT                   GADPGDDKENVENADDDSEDDVAAPTRRSGRARRPANRLRDSDEDEDDDRGADENDNFV
FT                   RRSSRAAKPVARLSPEWKQHVSDDDDEPEAEETDPEGEYVEEDDDEESTEEEEEEESDE
FT                   EIEGIPTRYSRRQRATVERYSPKPNERGLAGGGGDRRAGRRTPSPTGRSRGRKPKGKRR
FT                   SRPDYRESPGDSAGRRGTNGKRWMDDTDDSDADAGHAGNPGNFPALFGGMFGGGRAPDM
FT                   YPLAPPGGGGGGGAVEAGGPGGKKEAADAEITPLTVDPTLTFEQVGGLSHYVHSLKEMV
FT                   FLPLLYPEVFARFKMNPPRGVLLYGAPGTGKTLLARALAASCSRAGAEVSFYMRKGADV
FT                   LSKWVGESERQLRLLFAEAQKRQPAIIFFDEIDGLAPVRSSKTDQIHNSIVATLLALMD
FT                   GLDSRGRVVVLGATNRVDAIDGALRRPGRFDRELAFPLPNAAARFEILKIHTRAWEKPP
FT                   PSLLLEQLAARCVGYCGADLKALCTEAAVHALRRRYPQIYESDDKLLIDPGQILPSRVD
FT                   FRAAMEAITPASHRSAQAHARPLGPLRQPLMGPALGKAVEATFLAFPPAAMAANADKNA
FT                   AGSSGSSGSSKPPTASMVFDLDDLDDDDDDDGLELLEELDGGGAGGFEGGAGKTPAVSN
FT                   KRGVSDRDGLSGASAAAALATAALEFLNCPLARQPRLLLHGPCGSGQAPLAAALLHELE
FT                   AFPVHAVGLPSLLADGGRSPEEALVGAVTEARRAAPAVLFLPHLRLWWDSATPTLRATL
FT                   RTLMEDVPADTPLLLLATCDCERSELDPEAAGLFGKGQRMRIDAPDGRALAGYFEPIVA
FT                   AAVRAARGMDARDRDVAAGVDPDTRGRRHRRTLETLPKAPMPGPEGDDAGGGGGGGGGG
FT                   GAGDAATAAMIAEEDHALRQQRMFLRDLVTRLLYRKQWRDFASPVDDDQLPGYSKKVKE
FT                   PMDLSTLLWKVDSGAYATMDAFLKDVHLIVAAAKTYWGGLEQERREANDEELDENGFDV
FT                   VEGRKVVSRAHALEDTIQELAGQLDPSLVQRCAAIARHRAARASGGGGGGGTGEGLPLM
FT                   PGEGDRGERRSRRGADGELAEQEGGGDKRKRIHDEPGYVPDPEALARDLRAKRAKEEAA
FT                   KKEAAEKAAAEQEAAAAAAAAVTEAAEAAAKAAAGANQSNPRERAMSADGSAPMQFLDA
FT                   IDPLTDAEVATNSASFVDFLVTRCSGKPAADAEALATDLGRAVKTALSRDALRTTDWTR
FT                   HLQGALQSFMSARTA"
FT   CDS_pept        232269..233525
FT                   /codon_start=1
FT                   /gene_family="HOG000265384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633865"
FT                   /orf_name="MICPUN_100383"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63283.1"
FT                   /db_xref="HOGENOM:HBG560980"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B34B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N1"
FT                   /transl_table=1
FT                   /translation="METRWTQGGLRPRVVHESTSDWIRRVAFDWPNAVMGTAAGSVLVC
FT                   NCEELGGLEYRERARRLLARRKDAHSRDWRAVEDRGLGERSLLGLYDAGAVTAVAIAGD
FT                   LVASGGRDGKLRAWRIPPGADVDSPGHPRDGERLMCVGAAEHPEVVTGAEFDVAGGCVW
FT                   TSCLDGKIRRWGLGGNDEDANDETDDEDDAKTLELLGEWSVGQAALCLSLDPNARVLYA
FT                   GTADGGAVAMDAGSLNANDDGDGDDAGSSSSSSSSSSSIGATLGAWTAHEDGVTRSVSH
FT                   ARGGCLTGSSTGAVYAWRVDRREGASCVSPSLAAKMIGHAAAVVSISTGNPRHVVSGAH
FT                   DGTVRVWNAPDLTPDDEDGEERGGGGDVKKSECLYAVTGHTVWLGSVQADETRIVCDGA
FT                   NNIAMCYDFSDDPDDNGDI"
FT   CDS_pept        join(<234383..234495,234705..234833,235221..>235266)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633866"
FT                   /orf_name="MICPUN_73264"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63284.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199B34C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N2"
FT                   /transl_table=1
FT                   /translation="PQEDALLREQIQKLGGPGNWTAIAEALPGRSSKSCRLRWCNQLNP
FT                   MVKRGPFTEDEDRAILAAHAIHGNKWAVISRSIPGRTDNQVKNRFNSTLRR"
FT   CDS_pept        complement(236388..237194)
FT                   /codon_start=1
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633867"
FT                   /orf_name="MICPUN_100385"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="ACO63663.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG726602"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B34D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N3"
FT                   /transl_table=1
FT                   /translation="MGLRVGFVGAGQMAEALCRGFDAAGVAKCVDMTIIDRNQPRRDLF
FT                   ASWGCKIGASNEEVVKNVDVVFISVKPYAVADLLREMAPFLGPNVLVVSIAAGVTLATM
FT                   EDAAGAGVPIMRVMPNTPCLVGCLAGAMSKGTSCTPEHVDTTARLLGAVGKCHEVPESK
FT                   MDAVTGVSGSGPAYIYQVIEAMADGGVLAGLPRAVAQDLAARTVMGAAKMVLETGKHPG
FT                   ELKDAVTSPGGTTIAAVHHLEKCGVRAAFQGAVKAAADRAHELSKS"
FT   CDS_pept        join(237556..237612,237709..242031)
FT                   /codon_start=1
FT                   /gene_family="HOG000216693" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633868"
FT                   /orf_name="MICPUN_58377"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO63285.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG521093"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI000199B34E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N4"
FT                   /transl_table=1
FT                   /translation="MADVAEIVAINENVAAAPKAKKAPAAKKPKAPLGEKDVNAAKPAS
FT                   SSSSDGKAIEDIYQKKTQLEHILLRPDTYVGSCEKTEEKAWVYCKDTNKLVQRQMSFVP
FT                   GLYKIFDEILVNATDNKVRDPSMVTLRVDIDQEAGCIRVYNDGNGIPVEMHKEEGVYVP
FT                   ELIFGHLLTSSNYNDNEKKVTGGRNGYGAKLANIFSTEFVVETCDGSRERRYRQVFKNN
FT                   MGEKCEPVVTKCKPTDNWTCITFKPDLAKFNMTELEDDTVALMCKRVYDAAGNIGKNTK
FT                   VFLNGERLKVKGFSDYVDLYLEGRENAPKVYEKVNDRWEVCVTISDSGNFQQVSFVNGI
FT                   CTMKGGTHVNQVADEVAGKLLEKIKKKEKSCKNLKAAHVKNHLWVFVNALIENPAFDSQ
FT                   TKETLNTRASNFGSKYEASDKVIKQMMNSGIVEQILSWASFKQSKEMKKSDGKKATRLT
FT                   GIPKLDDANDAGGRNSEHCTLILTEGDSAKALAVSGLSVVGRDRYGVFPLRGKLLNVRD
FT                   ASHDQIMNNAEINHIKQILGLRHGTTYESAKSLRYGHIMIMTDQDHDGSHIKGLLINFL
FT                   HAHFPSLLKIPGFLVEFITPIIKATKGKQSKVFYTLPEYDNWKEHAEETGTGRGWNIKY
FT                   YKGLGTSTAKEAKEYFAALDHHKKTFAWTTDGDGNLIDMAFSKKRVEDRKAWLNAYEPG
FT                   TYLDMTGDDVRYDDFINKELILFSRADLMRSIPSVVDGFKPSQRKVLFSCFKRKLKSDI
FT                   KVAQLSGYVSEHSAYHHGEASLASTIVGLAQDFVGSNNVNLLVPSGQFGTRLQGGKDHA
FT                   SPRYIFTRLAPICRVIFPECDDALLDYLDEDGQVIEPEHYLPILPLVLVNGADGIGTGW
FT                   STSIPNFNPRDIVANIRRILDDECTERMHPWYRNFKGTIEEEIVKGEIRYNITGKYEIV
FT                   DETTLVITELPLRSWTTDYKDFLENMLSPKEKNAQPFITDYKEHHTDTTVHFIVTMTPE
FT                   NMAKAQKDGIEKKFKLCAKVSTSNMHAFDEKGGITKYSSPEAIMEAFVPLRLDAYARRR
FT                   AMLIRQAEFELKRMSNKVRFILAVVDGEMTIGRKKKSVLIEELEAAGYDKMPKTAKAAA
FT                   AADAEPAESGLSDISEEGAPAPADGASYDYLLSMPLWNLTQEKVDELVEEQRVKTAEVE
FT                   ELHGTTDKQLWIRDLDAFDAAMDVFDAEDAKAAEELAKQQRAAARNQTKGGKKALAKKK
FT                   KAARAMDSDEDSEEDEDFSDDEFVPTKAKAKKAAAAPAAKKAPSARAKKPTAAPASSAT
FT                   SEVSEAVSAQVSEAVSAPPPAPEPESDDEFEVAPKLSLAERLLQRAGAPSAAAAKVKPA
FT                   AKPAAAKKPAAAKAKPAAAKDEFDFSGSEDDSEPAPVVKKPAPAKKPAPAKKAAANSDD
FT                   EFGSDAESDVEAIADVAPRAASSRRGGAARKVYKEESSDEESDEDDFEDDGDDSDFE"
FT   CDS_pept        join(complement(243204..>244005),
FT                   complement(<242454..243121))
FT                   /codon_start=1
FT                   /gene_family="HOG000234041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633869"
FT                   /orf_name="MICPUN_67767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63664.1"
FT                   /db_xref="HOGENOM:HBG285857"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000199B34F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N5"
FT                   /transl_table=1
FT                   /translation="KACVIGGGWAGFGAAWQLLKHGFDVTLLDSSPDPGGLSAGWRTAN
FT                   GRAVEAGCKGFWRHYGNIDALAEELGISPFTPYTSSAFYSPKGKEVEAPVLGDLPRLPT
FT                   PFGTLLYTSPYFTQLSVEDRISALPLAIDLLKYNATVESYLEYDDKSARDVFRGDPTNG
FT                   RLGASEALYEQFLAPILCALMFAPPEELSASAALDVLYGYVLAHQDDFDVRWCKGTIAE
FT                   EIFTPWVNKMRELGGPDVLLGGRRVQTVELGEPGARARVVASAPNGTSEIYDADVVVMA
FT                   TGVGAARGIVSSSPELCECPDLAGIKDVPSTDVIAVRLFLDKQVRLPNMSNVFAGFPLG
FT                   GDDAAVNVAGTFFDLCALHDEYATIAADPRDDVRAVVEVDMYNAGAVLGLADAELVDVA
FT                   LRDVLEGCVPGCVPSDVRVVDSSVLRFKGGVTKFAPGTASLLPKTRVGGLDNFFVAGDY
FT                   VWQGPDSHGARGLSQEKALVSGLCAADAAAEW"
FT   CDS_pept        join(244314..244571,244632..>245339)
FT                   /codon_start=1
FT                   /gene_family="HOG000233029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633870"
FT                   /orf_name="MICPUN_81677"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63286.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG749424"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B3F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N6"
FT                   /transl_table=1
FT                   /translation="MGGSKQHDATAPGATARRRKSKPARSRPASAARVPLTSAKQLIFG
FT                   RKIGEGTQGEVRLARHATTGKRYVVKILDLDDPDDPDDPSTEARAVETEADCLRMLSHP
FT                   NVVRCHGTFRLDPTADDPTSRRRSRLCIVMSHCEGGDLATLLARTKGQPLPEDAVMRWL
FT                   VQLLLALDHVHSKNVLHRDLKPANVFLSKNLRCVKIGDFGIAKALEHTDDLAVTRVGTP
FT                   LYMSPELVTGQPYTYASDVWALGCVAYELASGGKRAFDADSIPQLMCKVMTCDYPPVPS
FT                   HFSRQFERCVGAMLDPDPHERPTAAALLRHPFVRTHAEAWL"
FT   CDS_pept        247093..248580
FT                   /codon_start=1
FT                   /gene_family="HOG000091641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633871"
FT                   /orf_name="MICPUN_81470"
FT                   /product="Wd-40 repeat family protein/notchless protein "
FT                   /protein_id="ACO63287.1"
FT                   /db_xref="HOGENOM:HBG330076"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B3F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N7"
FT                   /transl_table=1
FT                   /translation="MATLYVPDSKRRKKDREELALNAPSGPENRVNIIAQLEDAEGNPA
FT                   GPQLDLPHDADPKQLEEVLNALLQNEDKVPFAFYAADAEITGTLGEHLRKRDASVETVL
FT                   KIVYQPQALFRVRPVTRCSSAIPGHAEAVLSVAFSPDGKHLASGSGDTTVRLWNHETET
FT                   PRHTCSGHANWVLCIAWSPDGKYVASGGMDKDVRLWDPESGSAVGGPMRGHKKHVTALA
FT                   WEPAHVRYPPVRLASASGDGTVRVWNVVHKNCELALTAHTNSVTAVKWGGEGLIYSASR
FT                   DTTVMVWNAETGAVVRQLRGHGHWVNTLALSSEYVVRTGPYDHKATKPKDDVEAKAKAL
FT                   ERYKAATGGKGERIISGSDDFTMFMWTPGTSKQPLQRMTGHVQLINHVLFSPDGRWVAS
FT                   ASFDKAVKLWDGHNGTFVATMRGHVGPVYQIAWSADSRMVVSGSKDSTLKVWSVRTKKL
FT                   ELDLPGHADEVFAVDWSPMGTKAASGGKDKMLRLWRH"
FT   CDS_pept        complement(250363..251505)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633872"
FT                   /orf_name="MICPUN_58381"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63665.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000199B3FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N8"
FT                   /transl_table=1
FT                   /translation="MAALAPSAAALAPLPPPTRARHRRVTTRASPVSVRSTAATSSLVA
FT                   PVPDSDFGRVVDGPALLSLPHAERRAVLREALERGSGLVLVPNLAGISPRTLVELSYAV
FT                   GDVVEKNPGVAPEYLIPNVPEVQVIGNVRDERGALRAMFSRAPPLPTDRITGAPTLRYD
FT                   PELRSPVWHTDQAFRDPPPFASLLYCVKSPPAGAGGDTAFADMTAACNALDTNRREELR
FT                   KLRAVCSYAHHNAKVNRRTPTYPLLTPTQRAAHPPVAQRIIRADPDTNTESLYGFSSAV
FT                   CAVIDEKDEVTPEDLDRYDLLGEEDASVRALMYDELLPFATGAEFTYRHSWTEGDLVVW
FT                   DNLRTIHTATPFDERYDREMWRTTVAHETGGEAYLGASIG"
FT   CDS_pept        complement(251774..252568)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633873"
FT                   /orf_name="MICPUN_58382"
FT                   /product="Predicted protein"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63666.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI000199B3FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5N9"
FT                   /transl_table=1
FT                   /translation="MACTIVSALATARAPAGMRPRTRRTPRARPIRPPNPVSFVGGRSG
FT                   APRAPNTKIVNNHRELPPLAAAGGDGDETLDETLDVDAVMKEITDTSQLGQRDEAFFVG
FT                   QMVLVLLVAFPPFQMDLGDDVKFGDPLFGLATMALAAVLLVQGSKNLGNSLTPFPKPRA
FT                   DNVLKTGGAYAAVRHPMYSGLIFGCFGVALLTGDPTRTLFTMALAALLNAKAAKEEDYL
FT                   CEMHGADVYGKYAAEVPRLVPRIDGMKQVVQDFADGFESNKE"
FT   CDS_pept        <252785..>253801
FT                   /codon_start=1
FT                   /gene_family="HOG000250286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633874"
FT                   /orf_name="MICPUN_70470"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63288.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199B3FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P0"
FT                   /transl_table=1
FT                   /translation="VGSVLGTMTFGWRFSSEECDDAKSLELMETFLDAGHVELDTALAY
FT                   SGGETEKIMGRIFDADPSLMERCTVATKANPWPGGNMTSSAGEGGLAPSELRAQVEASR
FT                   ASLSPYGPIDLLYLHAPDAATEIEQTLAELKAMHDEGAFVNLGLSNFPAWEVAYIHGKC
FT                   EDIGLPPPTTYQGMYNCLTRAVEPELLPALRKLNMRFLAYNPLAGGLLTGKHRGKMDDA
FT                   QLCAEGASRGRFTENKMYRDRFWNERYFAAVDTICAACETNGVAPAEAALRWLYSHSRL
FT                   DGAYGDGVILGASSAGHLEANLAAAEKAANGEALPESVLEAIEAAFEVCAPVAPPYSR"
FT   CDS_pept        join(complement(255642..255730),complement(253997..255599))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633875"
FT                   /orf_name="MICPUN_58384"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63667.1"
FT                   /db_xref="UniParc:UPI000199B3FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P1"
FT                   /transl_table=1
FT                   /translation="MVRDPAPPSSTPPPRALDSKKLRQPKRRHTYRGCNPDLPAAGECQ
FT                   TCGISNLASDWASPDLYPVVLPPFAAGGWALFMTLYLSSAGRFKGRFLALDLTTRTLSL
FT                   LARLVGVTVALASVWASHGAWVDGMELCQRGVHAPIRLRTQHGGWYVGILANGLAFVSG
FT                   AFAVLFGRGNVLGPTNNQLAMASIDERQFASITPANLGPYQVGLTPRGERVMRTPRPAT
FT                   FSEAHRAIGLGAFTRVDVDDEEIAMTAREYGVGTTGGVWARGDEEAGGGDGDEAMGRRG
FT                   RASLGGVGDGRRRGEARGGARASAPAGGGARVAPPADGKRGWEEFKARFWRSQTSHSPA
FT                   APEGGSGRRSDPGDARYVAERNQRVGRLGNILGRFASRRGESPGGESPGGDASVRSDRS
FT                   DDSAEAARGAVPKKPPAFKKPSVPPPRPTPVFQFSNPLASSSNGGAADAEHAPSAPPFE
FT                   ADGDRPGLADEPPADFEWNPLRDPYSITPSKKGAGPSRAGVGGRGRPGGPSAGPAMSPP
FT                   RPDARRARMERARAANEAARGDAGDGPESLRERMERLRRERERDGG"
FT   CDS_pept        join(complement(256141..257591),complement(255906..256071))
FT                   /codon_start=1
FT                   /gene_family="HOG000186529" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633876"
FT                   /orf_name="MICPUN_82193"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63668.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG314242"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013180"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B3FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P2"
FT                   /transl_table=1
FT                   /translation="MPPPKPRAQGPAVQLDPDELLARAEREAFGGDERLAEQNATLDEK
FT                   GLRRMVLAFERRYAANQTARLKHADEPDKFVDSEVDLDEEIKRLGTLAGYPELYPEFCR
FT                   LNAVPSILALLSHDNPDIACDALVLLNELTDADAVESSEEGGAALVASVKENSGYELIY
FT                   QCLERFGGEASPEDQAAIGNVLGIVENCADIDVDAAADFCAAAPKLLKWLLKRIGSKKP
FT                   TDNNKLAAAEVLAILVQTSDENKKRVGDIGGIDALLRAVAPFKGKDPADEGEREVLENI
FT                   FDALVASTMETNNKKAFVENEGLELMLMMMKSKRSCRTSAIKCVDYALTRCPAACERFV
FT                   DILGLKTVFSVFMGKGFEKLRKSAGLEAVQEEEERAVSVVSSLFLHLAKGSERYNRLCA
FT                   KFVEDEHAKCDRLAELYAKYSNRVKAVDARLETRTNEEFELTPDDLYVERLGGGLYTLE
FT                   LLSLIFASVFATGHAGIRTRLLLQMELRGVRRILETHAENIGGADGEEERVRRRAHVVK
FT                   LLVAIGGGRPEGEEEEAKAAE"
FT   CDS_pept        258126..260612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633877"
FT                   /orf_name="MICPUN_58386"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63289.1"
FT                   /db_xref="UniParc:UPI000199B3FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P3"
FT                   /transl_table=1
FT                   /translation="MATAVPPRISDGSDTSIPGAATGTLAGGGALDVEGDAVRDAIDKL
FT                   QRALTPSVVLDRELDARRNDAAKVASGAAYKSPYHDAHHATIVAASALLGRALGEGGVG
FT                   TGFVYGAETMVRDALLMIEGAARDALRRDEGELPRLFDIAEGMRKRRDDARAAARQLVL
FT                   AFSRQNAGMGFRERQRLRDAVAQAKAQSTRETEQEKARLAKEHESMREELELMQRQLIA
FT                   ARDASNAQIVQLSKQVQHERNARGGDALEHQQTGEHVRAKLEMAEVKIADLANQLRNAQ
FT                   RERAIEKAQLEDQLSEALEVGQGARAHAVNARTVLRRQKGRALRERCFVVWKIKAAAYA
FT                   LLKKQTMEAAETVKAVKKGYEVQIAKTEKACLEKVESMRNKLRGRDPRDANKPALGDST
FT                   NQKKGGNKAPRADPWSFLDESTKLEREIAKREREEERRARETVAMAMAEDHISKIDEYY
FT                   AKAAEAARQRNAGRDDPNPEIVMVAHNVSLASHPPPSPLSMPLTAAREPRLSKGFVHTY
FT                   GGGDRGATPRSGASSARSMIEPTPPRTAGRVPAPTRVPVRRAESSSSSSSEETEDPWKP
FT                   ESPEPPPPPPPKLGEPAEELAFTESLYGLVPPPQVPLGRKTRDAGVAAPRTEEEVEPAP
FT                   PPPQRKLEPLTAAAAGMSGIGRGAGRGGGLAPLMARSGDEPAVAASVEPARDRAEPLRA
FT                   ETTEIRSDPIRSELPTATTFIPPPPPRAVPTFPRSPPRSPSRPIPPFPRSTRTSEGGGS
FT                   RPGTSGGRSEGSGFPSRPPTSGGSRPGTAGASRPGTAGTAGAAGVRSSVASLAASEAHT
FT                   EYSEDFDDLPEDLDLP"
FT   CDS_pept        join(complement(263001..263132),complement(262601..262876),
FT                   complement(262398..262502),complement(261069..262214))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633878"
FT                   /orf_name="MICPUN_58387"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63669.1"
FT                   /db_xref="UniParc:UPI000199B400"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P4"
FT                   /transl_table=1
FT                   /translation="MSTTACPIVIKVPVHTGYRRATLPSVAARLQAREKPERKAVTEED
FT                   RVAAFIAFRTARIPPLSDATHVPSHGNLTQTFDFDPQKDARRELLVAAAQARKAATAAL
FT                   HNKRVNEQRSSAIRMKTTIEHYTRSTINRRLKEAEALRESRLRAKAIKAKAFIDRVDHV
FT                   AERNDARKAELQAQYERKLEAAAQKRERRLANRQFAAADATARAKSIALERSRESETIA
FT                   RRLSDRIFGAAHRRDAQLDIVASKAAFFNERAVRVAEHKRAARVLDARVIAAGIQSKQA
FT                   AADYLRSLDLRLRQQRAALTNERAAIVVERQRLSQHIQPMVAGAKLRAEQFMASERRSE
FT                   VIFDIQNRAHKFIRRAVVTCANNEVQNRRLSEYKRANLEERLAAAERRKGELLLCGVSM
FT                   AGGGPSPTRHPGAAGFKRVSSPALSESMSLALRIDGFALTPPQGAPARRPASAIGVMNT
FT                   AHAVHAIAPRPDRPVTARGLNRLTTRAAHDSVTSEESAKSSDDDSYDDGVIVFQTPEQQ
FT                   TSRPSTRGSSRHTASGGENDWTHVSAPVSPTASSA"
FT   CDS_pept        complement(263296..264012)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633879"
FT                   /orf_name="MICPUN_108219"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63670.1"
FT                   /db_xref="HOGENOM:HBG560986"
FT                   /db_xref="UniParc:UPI000199B401"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P5"
FT                   /transl_table=1
FT                   /translation="MSTALFLRRASSSAASSASTSARAPLASYVGYATAPTERLAAERP
FT                   RHHRHLLLGNRGARLVATDAPAMPPMYTSTHEILRPDTSASPPDGSVVMSVGLTPRAFD
FT                   LIGDVRHVEQTFRHFVDIRGEIPEGVPLCMLHWEGFKRTASDELYHAQWANATGDRPLT
FT                   LPFAAAVVAVNQAAISEAYKTIKADESGWIYKVRARPETMETARKLGLVMSEEQYLAMC
FT                   DRQEEQEDAEASRSYP"
FT   CDS_pept        join(264539..267397,267959..269539)
FT                   /codon_start=1
FT                   /gene_family="HOG000222974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633880"
FT                   /orf_name="MICPUN_82079"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63290.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG499785"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015700"
FT                   /db_xref="UniParc:UPI000199B402"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P6"
FT                   /transl_table=1
FT                   /translation="MPPTASPAGSQQGRNNAEPLEFSKAPFNELNAPRKIRSVRFSLMS
FT                   PQEIGKCGVFHVFERNLYQMPQRVPLKNGILDPRMGTTDKKGTECATCKGKLIDCAGHF
FT                   GYVKLELPVFHIGYFKNIIAILQQVCKECSRVMLPEEERQQYLKRFRNPRLEIVPKRAL
FT                   SKKLADKCKRCRICPSCGAANGAVKRTGASLKIVHEKYSKNPELMEAYVKEFEEAVKHN
FT                   DQLKANLARVQDDLNPIRVESILSKISPMDCELLDVADRPEHLILTHLPVPPVCIRPSV
FT                   EMEGQAGSNEDDITMKLIQIIEVNNVLRQGLEKGLAINNLMENWDFLQIQCAMYINSEL
FT                   PGLSAQYQGPGKPLRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVGVP
FT                   MHIAKMMTYPEVVSRHNIEMIRERVRNGMNKHPGANFVRFKSGGTQYLKYGDRRRVASE
FT                   LKYGDVVERHLHDGDVLLFNRQPSLHKMSIMAHRARVMPWRTLRFNECVCTPYNADFDG
FT                   DEMNIHCPQTEEARAEAINLMSVHNNLCTPKNGEILVAATQDFLTASYILTARDHFLDR
FT                   AQVGALIAYMGDALMAVDLPTPAIIKPVELWTGKQLFSVLIRPRAVDRVFVNLEVAEKN
FT                   YSKKDTRHMCPRDGYVCIQNSEIMCGQLGKATLGSGNKNGLFYVLNSEYGSEQTASCMN
FT                   RVAKLSARWLGTRGFSVGIDDVTPGHRLQDEKGKVVDRGYGACDERIEAFKRGTLALQP
FT                   GCNAEQTLEAEVLGILSTVRETAGNVCLDELPRHNAPLIMALCGSKGSTINISQMVACV
FT                   GQQAVGGTRPPDGFAERSLPHFKRGEKTPAAKGFVANSFFSGMRPTEFFFHTMAGREGL
FT                   VDTAVKTAETGYMSRRLMKALEDLSLRYDGTVRNSTGGIVQLSYGDDGMEPTEMEGADA
FT                   QPVEFPRLLQHVKGLVPRAGSGLSHSRKIAVAKAEMHTRAAAMNNEDGAHKIKDGMSVK
FT                   FKHDLVRFARANLVRVGKPEGHGVGVTKAQLDEFLERCVRKYSAKRIEPGSAVGAVGAQ
FT                   SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINAAKNISTPIITATLECDDNVKAA
FT                   RVVKGRVEKTTLGEVCKFIDVVYNPSACYVEVCLDPAVISALQLDVTVESVRHSLITAP
FT                   KLKLKANTVLHAGENLIHVLPPDEESKSKAAAAQGAAAYRRALFHLQTLRTAVPNVIVQ
FT                   GIPSVSRAVINDVGQGKYNLVVEGTNLQAVMGVEGVKGTHTTTNHVMEAERTLGIEAAR
FT                   SCIIKEINDTMKAHGMSIDARHSMLLADVMTYKGEVLGITRFGMAKMKDSVLMLASFEK
FT                   TTDHLFDAALHGRTDTIDGVSECIIMGIPMPVGTGMFKLQHRAMRLETMDEEEREEEDA
FT                   VVASDGKGAASSVEITELEEAAAGANSNAAELGGGGAGRVGASLTIESKEDLVLPKRPP
FT                   LLLARLMEEERKIMCGQC"
FT   CDS_pept        complement(<269850..>270599)
FT                   /codon_start=1
FT                   /gene_family="HOG000030515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633881"
FT                   /orf_name="MICPUN_75968"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="ferrous iron transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63671.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0015093"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG601550"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="UniParc:UPI000199B403"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P7"
FT                   /transl_table=1
FT                   /translation="REKSLGVKRLEAMTSAYCTPLKTYVKGFPNPDRFHPFERALLELT
FT                   LSDKKYRATVEAVDVMRKGLYGIGKGYAAQVNNQRQSAEMKATTEKGMNEMEAYYAKHG
FT                   RCVDDLKSIAKMLRRLPVAELETPTVALVGAPNVGKSSLVQALSSGKSEINNYPFTTKG
FT                   IKMGHFFVETERHIVTDTPGLINRADRDRNKIELLTIATLEHLPTCVVFVTDLSGLSGT
FT                   SIADQLELRESLYEQFAHRRPWIDVLSK"
FT   CDS_pept        271268..273808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633882"
FT                   /orf_name="MICPUN_58391"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63291.1"
FT                   /db_xref="UniParc:UPI000199B4B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P8"
FT                   /transl_table=1
FT                   /translation="MFEPDLGPMPDDDDDELNDELNDIGLLTREAPAAKTTKAKSAPRE
FT                   KPAPKSSAWELTGNAELDALFQSSTLTARSLNVAASRPSTTGPSQGKPLRSTPVEVPIS
FT                   RAEKILAKLAEQKEEDDKESKKLDRQRKRVEDDARAEAAAASARAAAEAHDARVEAQLA
FT                   GAIQLGRDVKEKAARVEAALADAGDGSDETPSPRDVARALRDDAFEPDTHSRPGSDPRD
FT                   SCVANMPRSVRDAPSDASAFASAAEADAKRRGADAGDAVAHALREAIVGGWLEQRFLIA
FT                   RRDGEAAGAAGGAGEGEAKRKDSSPVMSVVGGVMRSAAAAILGTGSRARESVSPAALVR
FT                   APPLCAEDTARWLFQTATAPSSARDASWVTICARNALYASLGFEPNPALAPAPRWLCGT
FT                   PTLRAPPAVPWRIKASDIIGALGACGVVVDVDALGESLGKESRGGAGAGVGEPSSRTAS
FT                   KRKRPAAATTGGEGDGLCALSGRGEGDREATVQLYQDKERRRLRPQIFAAIQIAGAAAA
FT                   AARWTPRRRFASATVTPVKGSAPPASAANAVREEGPHCWVRDDPEGAADLLAVLAGLRI
FT                   DPRAGALRAAVDHCAENLLAAAALGCDGDEWRAFRSAAASKLAKVGPTHAARLAAIRWI
FT                   PWSNRKEQEVQDLAALVAIEHIVPLILQRLEADDLGPAPSGTNALAKKKKPRPNPKAKK
FT                   PAEKSDDVDAWQRRAVQALDPIRVDVESDVDAAWAIHTAMHLADIVLHAGTLGGGAGLR
FT                   GGSLGANGAPRTPGKEAAESASLDAAAESFMQFLKRTKANIPRSGKTAMNALKNLAVVI
FT                   FTRQQRAEQLRRTKTEHERANSSDDDDDGEDEDE"
FT   CDS_pept        join(complement(277224..277346),complement(276826..277083),
FT                   complement(273917..276688))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633883"
FT                   /orf_name="MICPUN_58392"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ACO63672.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B4B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5P9"
FT                   /transl_table=1
FT                   /translation="MPRPEELLGLLRTLPPVGGDELRRTVSGSQGLGDSQGPARKLTLA
FT                   ELLAETTARHESLDREEEREKRRSVEGDAQEEERDDDANGAPSGRRSAPRGDDAESSDD
FT                   SEGPPDEPLWGSQELDEVMDRCAVPVGEVDAFAPVAGGPGQFRSVQSAEEAGDLVLGPP
FT                   SREWDETLGAGKPESRGERGDAAPSAPSAPSAPLGTTEEEDALYVPAALNCHLREYQRD
FT                   GVRFLYALWASKRGGVLADDMGLGKTIQTVAFLAAVLRSPRANPSPPPALVVCPMSVLD
FT                   NWETELKRWGRMLPGGEFCTERVHGQSRDDAWTRSIADGSRCEIVLTTYDTLVRNSDAF
FT                   AARTWSACVFDEAHSLKNDKTKRYEAAYSLQKERRFGLSGTVMQNSYDELWCLFDWAYP
FT                   GSLGDVKHFKEYYSKVMQQAQRHGVDDTTLGRGRDKAEQLRRLLRKYMLKRTKKDTLAD
FT                   QLPQKADNVVFCDMSALQIRASRRLLEMEEFQLLIRHEEPCDCGSGEKRARCCYQECTG
FT                   PAPIWRSYDHEKHVTARNGYLCPYCMTFPLMQTLIKVSNHLELLKPDPEDEYGNDEARE
FT                   KFEKARVVARAALGEDAHLVGGADHPDMDFARLGDATNCGKLLALEKLLSLWHRQRDKV
FT                   LLFSTSARLLTVLEKFLTQRGYVYARLDGSTAGKDRQKLVDDFNASESLFVFLLSTGAG
FT                   GVGLNITSANRVVIFDPNWNPAKDAQAQDRAYRIGQRRDVDVYRLLAAGTIEEMVYQRQ
FT                   VYKQQQSNVAVDASKERRYFEGVQGDKQHQGELFGLSNMFTLANEEITRMQSLVDRERR
FT                   SAAEYAFEIKSAAEIEAAARAKAEADKKDADGVAREGQGQGLAAAVESQRGSAEGGGWR
FT                   RASGGSSGGGGSRGGDPSRDPQPPPQRRRLRIVAEEEERREEEDGGDLGRRMFTRGEDR
FT                   VVHEHRHDNIVGDDGPGGRETARSHRAVAVARRQGFDAEAEQRARDEAAVAASKAAAER
FT                   AAERAAEEARRAAAADEVLAAMAEWKGTSTADLARRLTSLDAAGRAAAVSEFIAAMEGR
FT                   RR"
FT   CDS_pept        join(complement(279193..279280),complement(278971..279011),
FT                   complement(278735..278804),complement(277670..278640))
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633884"
FT                   /orf_name="MICPUN_81419"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63673.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B4B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q0"
FT                   /transl_table=1
FT                   /translation="MSSGLELRVGNKYRLGRKIGSGSFGDIYLGTHIQTGEEVGIKLES
FT                   VKTKHPQLLYESKLYKILQGGTGIPNVRWFGVEGDYNIMVLDLLGPSLEDLFNFCNRKL
FT                   SLKTVLMLADQLVSRIEYVHSKSFIHRDIKPDNFLMGLGKRANQVNIIDFGLAKKYRDP
FT                   KSHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKA
FT                   ATKKQKYEKISEKKMSTPIEVLCKGFPPEFVTYFQLCRSLRFEDKPDYSYVRKLFRDLF
FT                   IREGYQYDYVFDWTILKYQQTQALTRPSAGPALGAGGGASRERSREKEPRSRGADDGRR
FT                   NTPADGTGRGLEARGLDAARGGGGGGRDIARGASGSGTRGGYGPGADRM"
FT   CDS_pept        <279883..280125
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633885"
FT                   /orf_name="MICPUN_81889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63292.1"
FT                   /db_xref="InterPro:IPR013865"
FT                   /db_xref="UniParc:UPI000199B4B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q1"
FT                   /transl_table=1
FT                   /translation="RDAERPLELAAGDEDGEKKPSEPKDNRTEAERRYDEQAERTQARL
FT                   IEKMASKSHKDKVREFNEYLSKLSEHHDIPKVGPG"
FT   CDS_pept        join(complement(281197..281235),complement(280993..281041),
FT                   complement(280234..280799))
FT                   /codon_start=1
FT                   /gene_family="HOG000198008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633886"
FT                   /orf_name="MICPUN_58395"
FT                   /product="Predicted protein"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="ACO63674.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="HOGENOM:HBG560989"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI000199B4B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q2"
FT                   /transl_table=1
FT                   /translation="MGFEIQEPLQPFMGRKERRRSSAGKLFLGDHCDLRNDAEVQKLMA
FT                   KHGEPPLVLFSCEVLKINRRGEAVPRTLLVCANSIFLLDADARRGARRKIPLRSLASLR
FT                   MSEMSDNFLAMVCPAEYDLLLVCGRKTELVVVLREAHRCAMVELGMGGGEGRGSRSVDA
FT                   GGGGRGADVGLRVELSNRFTYKAGANVAKAVTFTRAGDGEVDTEVADIVASSPG"
FT   CDS_pept        join(complement(281908..282087),complement(281389..281742))
FT                   /codon_start=1
FT                   /gene_family="HOG000240708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633887"
FT                   /orf_name="MICPUN_82300"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ACO63675.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG714413"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199B4BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q3"
FT                   /transl_table=1
FT                   /translation="MADEAGEEVSPVELVDVRVGKVLKAYKHPEADKLYIEEIDVGEAE
FT                   PRQICSGLVPYMSAEEIEGQNVIVLANLKARNLAGVPSHGMILCASDEAHENVELLVCP
FT                   EGAAPGERVKFGSWDGEQSEPHTENQMKKKKTWEKVAPDLKTTADCVAAYKGLEMVTSA
FT                   GPVKCKSLANALIG"
FT   CDS_pept        282553..283053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633888"
FT                   /orf_name="MICPUN_58397"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63293.1"
FT                   /db_xref="UniParc:UPI000199B4BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q4"
FT                   /transl_table=1
FT                   /translation="MAAAVTNAITLTRPRVAARRAARRVVAAKASASSPDAASAPVSNL
FT                   GPSRSSAREVAQVAAKKAVVAVPAKGSEPATADRPFNFAGSAILAVLIGGGLTVFRILK
FT                   TKMDEREQALYEARVEAAAEAAAEEGGEAARDRNDKLFGDYAKTKEEMDAAAKAAADKA
FT                   EGK"
FT   CDS_pept        complement(283132..283446)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633889"
FT                   /orf_name="MICPUN_108220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63676.1"
FT                   /db_xref="UniParc:UPI000199B4BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q5"
FT                   /transl_table=1
FT                   /translation="MMGRGCGNVLSKAVSRQQFTLTVVKDKVRMKALRDGPGYMKDGVG
FT                   RFEPLKMGKAVVLTVGDKVVFRMREGKQGGHLGVHTILDEGGEEKEVGWLESIRIQLGC
FT                   "
FT   CDS_pept        join(285757..288434,288462..289449,289530..290261)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633890"
FT                   /orf_name="MICPUN_105549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63294.1"
FT                   /db_xref="UniParc:UPI000199B4BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q6"
FT                   /transl_table=1
FT                   /translation="MAGVSASCACLALSASSLTLSLASFAAASAAARSAFCCSAAAAIA
FT                   SRSSCSARLADSSRALAASILAWVMAAAWASAAALRSFSAILSSSALRRRAAMRSSDVA
FT                   GTFTGGASVLADLAALAAAALASAAAFSVLAFSAAAFLAASAFALSAAFFAAAACFSAA
FT                   CAAFTASARALAAASWAAFFSAVSLLMTAFLALNSARSFSCRTAASARALACSASRSAL
FT                   AAALAASRSAFAAAAAASASSLARFLASAAAALAASAAAFSSAVGALASRSALAAAAAA
FT                   SRSAFAAAALASRSALAAAALASRSAFAAAALASRSAFAAAAAALSSESTAAATGAGAG
FT                   AAGSSTGAAGSSTASGSGSGSGGALGSSSAYSLNAFPTPLKSTPMSPAEMGLPSSADLT
FT                   TAATLASEAALASSARCAFSALALSCAALSSAAFSAALACSAAALALAFSAALAARALS
FT                   LAAAASAFAFSWSRSALARSCAAAFCSLARAAAASAAAAFFASSRFLVSAFCLAFSALA
FT                   LAASAFALRSSEAFLSAASFSTAAARAFASRSALAASAALALAALAASASALATAALAS
FT                   RSTLAAAAALSASAFLAAASAALAALALSASAFLAAFSLALAAAAFSLSALAASTSFAF
FT                   SALALSNSAFFAASALAFSALAASAALAFSAAAAAFSAESSGLGAGAGLGAGAGFSAAA
FT                   FSASAFAAAAASAFAAAAFSLSALAASSALAFSALAASRSAFLAASALALSAAAFSASA
FT                   ALAAAAFSASAALAAAAFSASAFLAAAAFSASAFFAAAALAFSALAASAALALAAAAFS
FT                   FSAFCASAALAFSALALSAAAFLAASALACSAAALARSALAASTSFAFSAFAFSNSAFF
FT                   AASALAFSALAASASLFLVAESENPAAGAAAALAFGAGAGLAAGLAAGLAAGAGLAGAF
FT                   CALNSSTEGTLASRASSRLIWRAWRSAAAASALAILSAAAFSAFSASAARSAAITLAAA
FT                   MRSASNCARAASRSLDCAAAALAASARARASAAAFSAALVFSALAASALAFSAASAAAF
FT                   LAFSASAALVFSARAASRSAFLAASALAFASAASARALAAAASSAALALSASALALSAS
FT                   AAALSASALAAASALALASAAFAFSAFCASSAFAFSALALSNSAFFAASALAFSALAAS
FT                   AALAFSAAAAAFSAESSGLGAGAGLGAGAGLGAGAGFSVLGLLGSGLGSSGFGAAPGGL
FT                   GRRHRLGLRRGGLGRRCRLGLWSGLLRLLGLRFLKLLNLGRRGARELVVGGHVAGLERE
FT                   SLLRGTGSLLGGGGRRLLGGGRRRLLRRGGLVLRLALRVEVLGGEVRDLGEHGAGQRDG
FT                   AVRDEARAVGLAVELLDRARGEGDGRDGDVGDDGRGRDPGHDLLRDGIFELGGVVGLGL
FT                   GRHVLLGRLTGADQGGDPASVRRGVSAERVGAGDAPEELRLGRRERRHRTAGLLHPMDR
FT                   PPAD"
FT   CDS_pept        join(complement(292227..292469),complement(291831..292151),
FT                   complement(290613..291704))
FT                   /codon_start=1
FT                   /gene_family="HOG000232413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633891"
FT                   /orf_name="MICPUN_90715"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="hydrolase activity"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO63677.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG284362"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199B4BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q7"
FT                   /transl_table=1
FT                   /translation="MQRGSTDNSYIVKGADKTALLDLPDKSFASVFAGAIDCGAVDYIV
FT                   LGHLSPKRVDALATVLDARPADAPAVEVWCSNPAAQGLRARLRTIKTGEELPLGGARRL
FT                   KFTTAPTPRWPDTVATFDPQSGILFTSKLFSAHVATKTTGADEDATDVGLGFDEFGGDW
FT                   RYFFDCMLAPMARPAARALTTLAPYPAKMSAIAPLHGPVVRSARNELVREYREWVAAQV
FT                   KSADDFSVAVIYASAYGNTSAMAQAIARGITKAGVAVEMLNCELSTNEEIEALIKKTDG
FT                   FCIGAPTLGGHMPTPVSNALGVIVKESTREFPAGVFGSFGWSGEAVDLMEARLKDGGFD
FT                   FAFSPIRCKFKPTQETLQICEESGTDLAQSVKKIRRKKQSDKTKQVSAGSSFGQSDTAA
FT                   AVGRIVGSLCAVTAKKDDAQSAMLASWVSQASFNPPALTVAVAKERAVESFLLKGSNFN
FT                   LNVLQAGNEKDTMKALLKPFQPGENRFGDMEVEISERNGCAIVTEALSYLECEVTERME
FT                   CGDHWVVLATVREGKLLKEEGLTAIHHRKTGTSY"
FT   CDS_pept        join(293228..293334,293473..294160)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633892"
FT                   /orf_name="MICPUN_58401"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63295.1"
FT                   /db_xref="UniParc:UPI000199B4BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q8"
FT                   /transl_table=1
FT                   /translation="MKRVSPSRLWDRVAERLGTDRESAQLEVLLAAGYSWDDSTGELTS
FT                   WPINDRPEPRSPPPEAPDGARVSSPIDLCGSPEGSNRAVSETPSPTPLRARLGAAPRTM
FT                   TSPEVNDEDEEIENEPASASRRAIDATKTSRRRGHGVQPDVRLAAGQTGDASRPKKRRL
FT                   KADNDGGDGRDDVGGAVALEDRLGEWIKRDDELYERILLMKTVDVDDVAAALRADGGPD
FT                   KENASENAWTKKVPRTKLLAYLESEGVAVVSTKSRRGNKTHF"
FT   CDS_pept        complement(294230..295879)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633893"
FT                   /orf_name="MICPUN_58402"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63678.1"
FT                   /db_xref="UniParc:UPI000199B4C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Q9"
FT                   /transl_table=1
FT                   /translation="MEGIKGFAADGSTMLSHGAICLLDPGGDGRPVTVRVHERLRGCTL
FT                   RVALRGRTIPSITEADERHGGDTTLVIPIPRPEDISPKELVGCAWVFAVLDPEAESQPQ
FT                   PSVDPPRSGARNRRSGRSRRGGADASSPDPDANLVQIGASVPLLLVPDKATASEIADAV
FT                   RTIRSDLGDAQAVRFVTRLGNCVSPATINDDDLGAAMEVTKVLDMRLTERMMLESMFTA
FT                   RREEGARANRDGGSEAGDKDDDGGSQSHSNDAIIDDSRDVAGGEAAESPRSWGGVRPVG
FT                   WGRGVGAGWLSNDDVAKMLRRDPGLRRSWMGTIDPWEARVWYIAMACIAIHGFTTKRHC
FT                   NLGASPYVRSIIGSVLASIASLGKPLPSDEWLRRRGFNFKLAYLYLGGMFMWWGYGEGG
FT                   SFIRRDDMHGQCDKTMMHIKGFVCMSIMMLVYAIHPLAHGNLRGLATTCVVSFALPCLS
FT                   NHALGVAEYNGFWTVRVANVPAIAEALGKLPWDGALVGKAADAMASAALFVGYWAFPLT
FT                   LARVIQREYVRRLGQTTKPSSPTRARRRLSPL"
FT   CDS_pept        296415..298316
FT                   /codon_start=1
FT                   /gene_family="HOG000232413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633894"
FT                   /orf_name="MICPUN_58403"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /function="hydrolase activity"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO63296.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG284362"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199B581"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R0"
FT                   /transl_table=1
FT                   /translation="MSASASLASRAVTANAPALVSRARMTRRVAAARAATVRAAIAEPP
FT                   GSSASEVKNSEIQMFEGTKRLQTQVAEIGADTTCIRSLDWDRDRFDIEFGLDLGTTYNS
FT                   YVIKGASKTALVDASHAKFEQLYIDTLKGVVDPASIDYIVCSHTEPDHSGLIGPILELA
FT                   PDATVVGSKVCIQFLENLVQKPFKSRAVKGGDVVDLGGGHELRFIMAPNLHWPDTMFSF
FT                   DPATKLMYTCDAFGSHYCTEDMFDTNLEAVLPHYRFYYECLMKPNARSVLTALRKCESD
FT                   GANPLDNDFAGICNGHGPLLKFNVEELVGGYKKWSEDALEKAKAATTVFYTSDYGFSDR
FT                   LSQSIARGLTKADVEVTMMDMNTEDTQELIEAVSKAAGIVLVVPPATGPAHDNLAAIIG
FT                   NIKSKQKILIAESYGGNDEPVGPLASQFAGMGVEEVVPALKVKENPTEATYQLFEESGT
FT                   DLGQVLTKKETLKAMKNAMSPDVAKALGRVSGGLYVVTAAQGTAKSAMIASWIAQASFE
FT                   PLGFTVAIAKDRAIESLMQVGDKFVLNCLPEQGFEPLMKHFLIRFPPGADRFEGVEWAP
FT                   ASCGAPILKEAAAYMECTVTSRMEAADHWIVYSEVREGKVFKDEKTATHHRKVASYY"
FT   CDS_pept        join(complement(299298..299568),complement(298570..299072))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633895"
FT                   /orf_name="MICPUN_58404"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63679.1"
FT                   /db_xref="UniParc:UPI000199B582"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R1"
FT                   /transl_table=1
FT                   /translation="MVSPLATVTGATVATAVALRGTHRRTKSGGRGRGASPRSDKAPAA
FT                   IPRDAEAVTRRGLTRTKASEREEGDVADGDRRAFFAAATGLFSPHALKVDANRDARSNI
FT                   PLGPACLLDDANDASRADAPAPARGGGAGRIWGNGVLALMLGAAGFGRVHHAPMNDYAH
FT                   AAVTTGTVAKGGVSSKAGGVGARDGGGRGGMEPSAAHIEEHGGSRVYSKSLLPGVKSAK
FT                   GKLRQHPDHIGPVPNPHFEDVVCSKWFVGSLNAIG"
FT   CDS_pept        join(complement(302345..302428),complement(300475..302214))
FT                   /codon_start=1
FT                   /gene_family="HOG000240486" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633896"
FT                   /orf_name="MICPUN_82124"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63680.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG316501"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B583"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R2"
FT                   /transl_table=1
FT                   /translation="MVEEVSEERSGDQPAGDDDATTAPVPERAQVGGSPVYIVERKLGK
FT                   GGFGQVYVGRRVTSSGTRGSDTGSANANQVALKFEHRSSKGCNYGPPYEWSVYNAFSSL
FT                   GGILGVPKVHYKGRQGEYYVMVMDLLGPSLWDTWNTNGQIMSQEMVACIAVEALAILEN
FT                   FHSKGFVHGDIKPENFLLGPPGTPTEKKLYLVDLGLATRWRDAICSTHVDYDQRPDIFR
FT                   GTVRYASVHAHLGRTGSRRDDLESLAYTLLFLLKGRLPWQGYQGDNKGFLVCKKKMATS
FT                   AEALCRYTPPAFRQYMEAVVNLKFDEEPKYASLASLFEPLCGPSNRRPISTEGAEKSRV
FT                   GQKRKAEPLDEEGEDGRPKKKVRLGMPAQQWITIYNAHRPMKQRYHYNVANSRIEQHVD
FT                   KGNDDGLFISSVSCAQELWALIMDAGTGFSAQVWELSTQFLPKDWILEQWDDGYYITAL
FT                   AGSTTGSALVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEGFYVTSMATSGTRWAVVMS
FT                   RNAGFVDQCVELDFMYPSEGIHRRWDSGFRITCCAATPDQAAFVLSIPRRRPADETQET
FT                   LRTSAFPSTHVKEKWAKNLYISAVAFGRTVS"
FT   CDS_pept        303039..304064
FT                   /codon_start=1
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633897"
FT                   /orf_name="MICPUN_82074"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO63297.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000199B584"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R3"
FT                   /transl_table=1
FT                   /translation="MDRAVVRSRGGPLHVRTPLIISKPMSEVLGRDVYLKLDALQPSGS
FT                   FKLRGIGYTCQKAIAEGANALVSSSGGNAGLATAYAGQRLGAPTTVVVPETTPEFIRDR
FT                   LRSLGATVVVHGSQWSEAHAHAVALNDDVRGKLVHPYDDVDTWTGHATVVHEIKADLEA
FT                   AGCATPPAAIVTCVGGGGLLAGILQGLDEVGWASGCPVIAAETIGADSLATSIDAGSLQ
FT                   TLPAITSVAKSLGAASPSPRVLEMALARGAAHGSNGLVRPWRTSDEFAVRACVRLADDH
FT                   RVLVEPACGAALSAVYGGPNGTCEALDGLSGDGPVVVEVCGGAIVDLGTLAAYAEQFGI
FT                   E"
FT   CDS_pept        304161..308606
FT                   /codon_start=1
FT                   /gene_family="HOG000170952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633898"
FT                   /orf_name="MICPUN_58407"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63298.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B585"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R4"
FT                   /transl_table=1
FT                   /translation="MAGDDELLRGLGVTARGERELARDVIRDAAAAAAAREDARRGGDP
FT                   GRVDGHVDAVSIGGDGGGAGAAERGPGDGPAARTLARLRDESERLERELAAVRDALDEV
FT                   RRRTLDGDAPVDAALQIAVGERRVQGLADKRDALDANLREAEENAVAEASERARASPGA
FT                   PKSPTPGIDTNTSGKSDQPTETAGRRRARRAPAAVVVREDDDFDALMDTLEGRTAGNGN
FT                   SARGDIGETERERLIRTGVITPFDALAGFERRANDDAAADAHVASMSAWKAGRGATKLL
FT                   EGDAVPKQRPEAREFGRRPRRHAAPGLDAKVAAKRREWRRAAAEREGGGAGGSRGTNKS
FT                   GGKTRRRRRQRDAAYSSDEEDSDEGDSETAEEEEGAEEEEEEDGDGDFIVPKVDPESAP
FT                   RSLPRWPCPACTFANPGERDACELCETPRPPADDRYDRYDDDDDVQFVREIAVTSNRRR
FT                   RRRPAPVSAADPQPPAPKRGRGPRVKTEPSSLGVDARRPSAAPPPPRRAARVAARNAGR
FT                   AAAAEADGEAFGDGSESEYADDDDDADADDDDDDEVEEEEETEGDEDAGGEGEGEEPPA
FT                   RAPRSRRAPRRHPRQPAEEDDDDDDEEEEEEDIIFDGGLRIPSGTYARLLEHQRTSIKW
FT                   LWELHCQRAGGIIGDEMGLGKTVQVSAFLCALERSGLYRPTLVVCPATMLRQWRRELRA
FT                   WAPALRPVILHESAVSQSALADARGNKKSARLKLLRDCVADAKGVLLTTYEHLRLMRDH
FT                   VLSVRWGYAVLDEGHKIRNPDADVTICAKQLQTVHRLIMTGAPIQNRLSELWSLFDFCF
FT                   PGKLGTLPVFQAQFAVPIQLGGYSNASQQQVVTAYRCATMLKDLISPYLLRRMKADVNI
FT                   NLPKKTEQVLFCPMTGEQREAYRSYIHSRDVEEILEGRREALGGIDVLRKIVNHPDLLE
FT                   RTTQAHSEKYGEAERSGKLLVTEKVLGLWREQGHRCLLFSQTQQMLDILEAAIARAGYT
FT                   YRRMDGTTPVSHRMRLIDEFNGDDDVFVFLLTTKVGGLGVNLTGADRVLLYDPDWNPST
FT                   DAQARERAWRIGQTKEVTVYRLITAGTIEEKVYHRQIYKEFLTSKVLKDPKQRRFFKAK
FT                   DLADLFTWEEDNANTKPGKEDAIETAELFTEVEAEIRAADVAGSESDADDFRSDAAGED
FT                   GKVGTEKSAPEAGGWGAGDPDLVPNGVAPGGSVPGGPSRFRMERDRLVGSNNRDGGGGS
FT                   GAAARDGGDAAIMRSLFGGGGDGGSGAAGTIRGAMNHDAIMGAAGGGRDHVTSGHHARV
FT                   AAERTARAAAEAVRASSRGRANVAVPTWTGRSGAAGAPPGSGGGRFGRAPLGGGGGGGG
FT                   GVGGAGIGAGIVGASRGGMGSQTLLQRIRERDAAAGTVTAMARGVSPGTDGDGGSVTDD
FT                   ESDGDAGGGATRADAEKILDDICRFLRDRPGGAAPTGLIVDAFGHAVRDKGLFRRLLKQ
FT                   AARLEKGAGTAQWVLRDHFA"
FT   CDS_pept        308765..309385
FT                   /codon_start=1
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633899"
FT                   /gene_name="ICMT"
FT                   /orf_name="MICPUN_58408"
FT                   /product="Protein-s-isoprenylcysteine o-methyltransferase "
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63299.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI000199B586"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R5"
FT                   /transl_table=1
FT                   /translation="MDPLAAASALVAAFPWQFRAFVSALCFYHLSEYGIAWAFNRETLS
FT                   RDSWLLSRQYVVAMSAGCVEYFVELALFPGFKRGDLGALRWIARIGLAMVVWGDALRKA
FT                   AQITARHNFTHQIQFSRRPTHRVVSHGVYAWCRHPGYLGWLTWSVGTQVMLMNPICAVG
FT                   FAVASWRFFATRIPFEEGLLRRMFPGEYEAYAARTRTWIPGIP"
FT   CDS_pept        complement(309497..309892)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633900"
FT                   /orf_name="MICPUN_100403"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63681.1"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000199B587"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R6"
FT                   /transl_table=1
FT                   /translation="MRGCDVRSDTGSGVAAEGAQLDVEDCVVSNCKTHGVAVYGDLFGS
FT                   GGFGRVVECEIRDNGEDGVLVRGGAVAEVAGNEVFDNGRFGVELVDVGAGCVVVDNAVG
FT                   VGRKGRRGVVVDDAVADVEVSGNRERL"
FT   CDS_pept        join(310691..311047,311141..311577,311650..311827)
FT                   /codon_start=1
FT                   /gene_family="HOG000165140" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633901"
FT                   /orf_name="MICPUN_94166"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63300.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B588"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R7"
FT                   /transl_table=1
FT                   /translation="MAAHGSWATGPDPTRAWRHVGLPIAVSGASVACATACTNPLDVLK
FT                   VRLQVMDGATTPGIGGLGNGAQPRARPTGMADAFASLVRHEGPLALWKGLTPSLIRAVC
FT                   YGGLRLGLYRPITVLRERGGGGSMSTKVVAGCASGAFAAALLNPTELVKTRLMADERAR
FT                   GRGEGPPGGGARVGPYQVMRAVINEKGVAGLWRGSAMSMTRSAVLTASQCATYDEVKRV
FT                   VTRWTGLSDGVTVHFVASMLAGAVTTTATNPVDMIKTQLYMDAFRPGLAGAADAFVAVW
FT                   RRDGPRGLMRGWGANYLRLGPQTVITFVALEKFRSMAGLDTL"
FT   CDS_pept        join(312110..312236,312467..313704)
FT                   /codon_start=1
FT                   /gene_family="HOG000060335" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633902"
FT                   /orf_name="MICPUN_58411"
FT                   /product="Predicted protein"
FT                   /function="chorismate synthase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="ACO63301.1"
FT                   /db_xref="GO:0004107"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG292336"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniParc:UPI000199B589"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R8"
FT                   /transl_table=1
FT                   /translation="MASVTAVAGAPVAGPASLRRRHRGAAALRLAPRPVASQRRGMSVR
FT                   AMGSSFGRMFRVTTFGESHGGGVGCVVDGVPPKLELTREELQFELDRRRPGQSRITTPR
FT                   NEEDSCEILSGVGLDGITLGTPIAVLVRNKDHRSQDYGEIAVAYRPSHADATYDMKYGV
FT                   RAIAGGGRSSARETIGRVAAGAIAKKILKQIAGTEILAYVSQVKDVVATGVDHETFTMD
FT                   DVEANIARCPDAASAERMIEAIDKVRVKGDSCGGVVTCVVRGCPRGLGAPVFDKLEADL
FT                   AKAMLSLPATKGFEIGSGFEGVNTTGSEHNDEFYMDPKTGIRTRTNRSGGIQGGISNGE
FT                   IVELKIAFKPTSTITQPQNTVNRDGVDVELKAKGRHDPCVVPRAVPMVESMVALVLVDH
FT                   LMMQYAQCNLLEREDYSNLVMGNMKTLYDPAFIGGDGKSGGEMSTKDMSAAFSED"
FT   CDS_pept        complement(313782..315788)
FT                   /codon_start=1
FT                   /gene_family="HOG000264602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633903"
FT                   /orf_name="MICPUN_58412"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO63682.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG560999"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B58A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5R9"
FT                   /transl_table=1
FT                   /translation="MADASNGGDEFNRHDGGGVSILGVDGRRYTVDESTASYFYEIEAL
FT                   LQTDPETPEQVEERTILAGNALEEAVGYEMALSMDARCSRIVEKLLTAAGDDDLVRFLA
FT                   GITKEATDFYVLCKSLFGSRVAEHALGCVAAKVGKTPSEELLGKLEPPLRAVADGIVAE
FT                   AVNCAYDPRVSPVARKFLSVLSGRECAPVAKAGGLAGKLKGGTSKAGAFADSGIGQPDR
FT                   HRFDDELKAFADAMLAALEPELWNLTEDACGSAFLQAMLNAHQGDAAALNWIVPGFLGC
FT                   APAAGTPEGELLADADEKDVRQLMDSRAGSHLFEAILRAAPPKLLNEIFRRFFRGKLRA
FT                   LSSHPSANFVLQAFLGATGDADHVATALMELGQDFGSLMRERRAGVVAAILAACARTRS
FT                   GERDAAKSLARGLTAKMPARKEGRSQLAPALLWMNQHSGAGGGRCDVLGAAMLQTILKF
FT                   PPDAIPQFIESVASMTSGEAVSAACDPGGSRALEAFLGSHAHRPRDKKDVVQSLSGDWA
FT                   KLATSACGSHVLEAAYGAADQRTRENIVSAMSRAESQIQGTRHGPHLLRRLGVSQFRAD
FT                   PEQWNKRAKQAEDVKADFAREFGMEEEEEEDNRGAKKRKTEDFAREEHADEGEAKEDEE
FT                   DEEAPKEKKAKKEKKEKKEKKAKKEKKEKKEKR"
FT   CDS_pept        complement(316279..319773)
FT                   /codon_start=1
FT                   /gene_family="HOG000100062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633904"
FT                   /orf_name="MICPUN_58413"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63683.1"
FT                   /db_xref="HOGENOM:HBG561000"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR016060"
FT                   /db_xref="UniParc:UPI000199B58B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S0"
FT                   /transl_table=1
FT                   /translation="MTEASAFDAAMTSSPTADNAHSGRSPASSSRRRSRWTGASLGIPA
FT                   LVASLAISPPTVFASATSQSWYEVNTGFVCSGRNELGSFSLSLADCAARCDAEPTCISF
FT                   EFNSANPDSDWTSSTAHSCQLSETCTMSLAATVSGWSLLVKLSCDASAPITNGDVGNCT
FT                   SVLLFGESCTPTCDTGYFLVGERSCVDGTTVDTAACVIPPPPSPPPPPSPPSPPPPPAP
FT                   PPPLLRLHLVADDMNATSHTQNLVWRDRSSFGNDLTTHLAAPEVIEDAFNGHKALRFGF
FT                   SDLFQDGVEGFSCMRLDPVSSDNLLTYGSVSHWSFPGVTVFAVIEPRDVPWGGDGDPLD
FT                   FVFDFGEFPTRGFGLAWHESERTLYTPTDHGGEVRRSAELRENKKYVVAIQYTFGQDGH
FT                   VRALTQFATRHGRADLIDPTDSSGAAQAFSVHGFTPETVAHEQSPFSVGCMSKENTASG
FT                   AKGKRVFRGDIAELRLYAGLLSLDEVFAIRDELVDTYVPECERGCSTLTRRGLNQVDRY
FT                   DEPAVKAPVSEEYKCIADGECISARFIRLYKTQSASDPTIHLLELAVWTSAFPDINLAA
FT                   GKDVTCSPACHSLSGSRLVDGETNTGTAHTCSEGNDASRGGLAEGACANDVSRWMEIDL
FT                   GQEYLIDGILIVNRPDQYRIRIQDVKVDFKDADGNVVLTTAAITSDESSEDGYVMDLTK
FT                   TSLQSNVEFDAWKYIPQGGIIQAADFDWTLYRRWCAVDEYWDGAACRDCPVATTSRGGD
FT                   VTMCCAADEFLNGQACGACPTGSTGMQYVMCTCATDEFWNGTACQTCPTGSFSPGGAAT
FT                   STSCTSCEANEFWNGQACGACPTGSTGIQYVMCTCATDEFWNEQTQACQTCPTNEFSEG
FT                   GAATTTTCMTCPAGQYRNSDAGCGACPTNSVGAGGSATSCTCNDNYRAYWSGSAWSCLA
FT                   CAAPYEKSGSVVPQSTLSSDFCEDPPPCQRELKVERVGGDPDWGAPFYFKCGAVEVYAG
FT                   RSHSRTKLVIPPNTIAWGSCPTASFKWSAPGNSGFRYANTADTYDDVFKVTETNNCGCR
FT                   RTVRITRTDASTGWGHHMSVRCANTGGANPVEVIVGNSDSNTKDVVLFSPYNGECPSTF
FT                   TLGSDSFRLDLLSTTCHSGNRVYDGASFEQWIHDPATDQVANVQISAPSPNFGGGFG"
FT   CDS_pept        320884..322614
FT                   /codon_start=1
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633905"
FT                   /orf_name="MICPUN_58414"
FT                   /product="Fad-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63302.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199B645"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S1"
FT                   /transl_table=1
FT                   /translation="MTSRVALGGAAVRTGANAKANAKARARPVRAAVSEPPAAPASEQV
FT                   PAARGAARKKVVVLGSGWGAISFVKSLPASAPYDVVLVSPRNYFLYTPLLPGAATGAVE
FT                   ERSIVEPIRRPIAEKGWKYYEAACIDVDAGAKKITCRAADPECFDDKGRDCEWHTFDVD
FT                   YDYLVTAVGAVPNTFGVPGVEENCMFFKEIVHASRFRREVNERFERATLPDVPESRMRE
FT                   LLTFVVIGAGPTGVELAAELYDMVYQDVAKMYPSRLIPFVSIKIIDLQEKILSAYDRRI
FT                   AEYATDFFQRANIECLLNKQVGEVKPDAVVITDKITGEKSEVPFGLAVWCSGIRLNPLC
FT                   EKIMDSLPEGTQENRRSLACDKNLRVNGSNGSIFAVGDCATIVRPRSMSKAMELYKSAA
FT                   KCDDAGECEIDLDKDQIKAALNKGVEEFPHLEEVVNNIDDKFAVFAQANGRCTFDGFSK
FT                   MLTEVDNGLRALPATAQVAKQEGEYLAAFFAQCDGDATKLMGDETKFEYNHKGSLAYIG
FT                   KDAAVADIPGFTIVKGIAAGIIWKSFETISQVSVRNIFLVASDMIRTKLFGRDISRFID
FT                   "
FT   CDS_pept        complement(323732..>324736)
FT                   /codon_start=1
FT                   /gene_family="HOG000274470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633906"
FT                   /orf_name="MICPUN_81933"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="glucokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO63684.1"
FT                   /db_xref="GO:0004340"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG644410"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniParc:UPI000199B646"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S2"
FT                   /transl_table=1
FT                   /translation="AVAQTVFVGDIGGTNARLQVWTADPSDPASATMTFEKVYGTSGHP
FT                   TFESVITDLFADANVAAGSVSAACFAVAGPVADDRCQMTNISWIIDGAALQKSFDIASV
FT                   KVINDFAAVGYGVLDLAPDETVTLNEGTAKSPTGPIAVLGPGTGLGEAMLFHNATTGAY
FT                   DVVPSEGSHADFAPRGDTQRALLAYCEEHLGECEIEQVCCGSGIARIYDFLKAHRSKPD
FT                   LPALDPAGVTDAAIAGTCEVCVEAVEMFLEILGAEAGNLALKCLATGGVYVAGGIPPRL
FT                   MKIIGDDGGALKRAFLREECRYKDVRAGYPLHVILNDKIGLAGAKVYAMRQLR"
FT   CDS_pept        join(complement(326587..326679),complement(325456..326340))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633907"
FT                   /orf_name="MICPUN_58416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63685.1"
FT                   /db_xref="InterPro:IPR021503"
FT                   /db_xref="UniParc:UPI000199B647"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S3"
FT                   /transl_table=1
FT                   /translation="MASSTVTNGFAAVIGLKSPSKRNRVQSRRTQRGVRTTALGPDGRD
FT                   QPWHDGHKNEHADGKADPLYFPPPRSPDDLSRRASQAASSFTDNIPNGEAVPSFPPNPA
FT                   STHPENAQPAPVNRGVCWSNLQDLDDVPSDDAVYILVFGAGTGSEGLYSLQERTKDDVP
FT                   VDIILAFPTHEDAARYGTLLEAEMGRVPVVEAARPEDLKYTCREGGYRCKVARRGVLLM
FT                   PPEKTVEVTDWERTNALRQGQWSVQGFEEQLSSDMDAQIAGFDAGDKSPNVGVLSAADF
FT                   KAQYEAVCGDVEDDEACVLPPDYDEEAARQQLMKMFNRGDWNPY"
FT   CDS_pept        327429..328310
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633908"
FT                   /orf_name="MICPUN_100411"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63303.1"
FT                   /db_xref="UniParc:UPI000199B648"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S4"
FT                   /transl_table=1
FT                   /translation="MAWSARAASTPPWTSPSTRAQSNPRRSRRLRRSPNATEDASPSSS
FT                   SPAPSSSPPFAPATWRELDIDWGRRHLQCVFVDDGHGVLARGAEGVCQRVAKWAGAGHM
FT                   VFPESAGVNVADRRTSSSLGLDDLDADASLSMLTRLDPICDHPRYATRAPYEFTDADAA
FT                   VADLVITCGGAGVERKVREMAPSAAAVVDLWEFAQFARRAELDGTGVAAIVQRSLARGV
FT                   VAPCIEEAMKLRVGEHWGLPADVAGGGAGKDANLKDALDVARARTVIGVAGLVTFLLAT
FT                   SPLEEVERVTKR"
FT   CDS_pept        join(complement(328874..>332719),c
FT                   omplement(328493..328789))
FT                   /codon_start=1
FT                   /gene_family="HOG000264603" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633909"
FT                   /orf_name="MICPUN_81844"
FT                   /product="Condensin complex component, non-smc subunit "
FT                   /function="binding"
FT                   /protein_id="ACO63686.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG318107"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B649"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S5"
FT                   /transl_table=1
FT                   /translation="VAMEFDIPLALTDLETAPARDGALFPRDVQDVRSMRDAEANELVE
FT                   RLTHDLCDNDPTCVMEQDIFDRAYVCVRDFHALSAVARIRLCDALCSNLSVLSSAAHTM
FT                   LAAGAGADGADAVASHREALKCYSTLIYHLAKGAEADAANAGAAPPAEDPKTKGKKGSK
FT                   SKAAPLAEWKWDEQRERVLHVMSGVLDVDLWNLFRPRQPPEAFLTMFTSLACAAMESQT
FT                   ALRSKVTKAAAFDMLGACALKWGQLENVTTSLVHLLNKHEHLPGPIAECAAAAADRHEN
FT                   ARLAASLLREVGAVDPAEYKRQQLSDAVGVRCVGVFISELAERMPKTTMTNISLLLPHL
FT                   DGEAYSLRSSLVTVLGHLACSGASSGALDRDQDRTTSDANAPLLRAKQGFLDLLVDRVH
FT                   DVSAFTRARVLQTWALMAEKKAIPLSHWLVVADLGIGRLGDKAALVRKAAMNLLATMLG
FT                   FNPFAPTLPSAAFADSLAEYEAKLEAMAPPKTTTEDDGDAFEKQMPETIDEGDEAEDAE
FT                   DTDDADAEEGAEGAEGAEGAEEPEERPVAGDADAAPELDGGVEAVRTMVAALKTALGFA
FT                   VQMGGAVSVLCRLLASSTPSDAIEAAGLLVRLKQFGVDGADEGARRMLGLVFSRDQSVR
FT                   DAAVEAVDVLFLAGAESPVAAAEGLARVAAASALGELAALEEVLKLLVSDGRVPADGAV
FT                   IKALWAQAGDRASHEASRAAALTVLSMCAARTPEIIGGARLVTVAAALDGACQTRKTSN
FT                   PALARAAAAVLARARPGGNAGTPESLGVCAPALPPDHPAFAALARVLTPTSPLPGRGWY
FT                   PCAEQAIAALYALHPDPEGVAADIVRSFAAAAFPANGGENEGKGDTAPASGIVAAHLAR
FT                   FLFVLGEVGLRHLVHVEGLARAVRRARVNRDRKAAENAEAAAAKGKDNSEEAALAAALG
FT                   QGSVSEDLHLDNSRELAEAELLAFKAAKGVGKGIVAAYAPVVVALCGHPAIAEGHALLR
FT                   GAAIAALSRLMAIDGAFCEDHLALIFTRLRGESDRGTRAALMVALGDLAFRFPNALEPW
FT                   TEHLYGLREWGNSLHDPDAGVRQHAVTVLAHLVLNDMMKVKGHIAEMARCLEDPDPRVA
FT                   SVARLLFHELSRKHGNPIYNLLPDLLSRLSGDAALAPDAFQRIMTRLLGFIDKDRQTES
FT                   LADKFTNRFAEAALASTPKPARDVAFCLSQLALSDKAFRKFMEQWKLYEPALYDKEVYS
FT                   ALCGVVAKAKKSYGGKSKSAEGGDAARVQVEEFEAKMHAAHVERYESWRTQRRAEGHAE
FT                   DGEDEHPLGPLKAREEEADEADEADEDADEDADEEDAEEDDADEEEEENDENDPAPSPA
FT                   PVKKTSRRAAPKAKKADAVKAEEAPARSSRRALRANR"
FT   CDS_pept        333021..334256
FT                   /codon_start=1
FT                   /gene_family="HOG000079643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633910"
FT                   /orf_name="MICPUN_58419"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO63304.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG561004"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199B64A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S6"
FT                   /transl_table=1
FT                   /translation="MTEADFDRPELADRLLRKAETAIRARTSRILCVIERCTDEHNYSA
FT                   VIRSCEALGVQHIWLVDPVDVSYDGIDDGLVDDDDDDGDDDGVDADRARERAGGLLKSH
FT                   GHGSAWREAHKLFARRANEFTTIREFPTTRACVEALREAGYVIWATDLSQKAICMTHDA
FT                   LRDAGFGDPDDPTATVVPEKLAIVFGTESVGCTREALESADARVYLPLRGFADSLNLSV
FT                   AAALCIQTLFHLCPEAVGAMSDAERAELREKWFTQLAANRVTTRGQDRDLRDARTKLTR
FT                   VRKKLLRAETATASGGGDPNPNGVGGRVADLEREETQLCDAIRAMEETRRSAAKRAIAP
FT                   YLADPPAPLRDMRRPDEHREAYVGKGVRAKNAEHWAGMPAVGNHASVRNHTKKMFEGVT
FT                   HRTVALAIRNTK"
FT   CDS_pept        join(334422..334509,334822..335360)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633911"
FT                   /orf_name="MICPUN_108224"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63305.1"
FT                   /db_xref="UniParc:UPI000199B64B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S7"
FT                   /transl_table=1
FT                   /translation="MGPMIADDDSSDDEVPLAQRMKQEAATPKAAAVKKPASKGKIKMS
FT                   GAKKKPKKAKKPAKKAPSGPVKEKKVYDLPGQKKDTPEEGESLRKFYVSLRKQIPESVM
FT                   AEQWLMEHGLLPADEAAKAYKKFLIRKGRDPKKAGGSSGSKPSKPKPKPKPKPAVKKEH
FT                   KSPVAKKASGIKRKALDDDDSDSDIPLAALKSNGGGGGFKIPKKE"
FT   CDS_pept        join(complement(336555..>336961),
FT                   complement(336234..336386),complement(335468..336191))
FT                   /codon_start=1
FT                   /gene_family="HOG000165728" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633912"
FT                   /orf_name="MICPUN_81715"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO63687.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B64C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S8"
FT                   /transl_table=1
FT                   /translation="EVEEGLRRRGIAVSDDQLRSMLGELDANKDRRISASEFDAFCDKR
FT                   RANIKQVFRDVDADGDGQIDSKELRRGVERAGLKISDEQLRAAFKRMDLDRDGRLSFDE
FT                   FESTLMLLPHGANPEAVFDAFAHRAFVDDPDGGETIGTAKKLASGGVAGAVSRSATAPI
FT                   DRIKTIMQAGRLPSSGGIAPVAGAAARAVWHEGGWRAFWRGNGANVAKVVPETATKYVA
FT                   FDILKRQLATDPGNATVLERFAAGGMAGAAAQTVVYPLEIVKTRVSLSAGGCSMATVIA
FT                   GVLRTEGTRGLFKGLTPSLVGIFPYAGIDLMANSVLKDALAAKYAEVGRDPGVAELLGC
FT                   GMASSTSAMLVTYPLNLVRTRLQASGMPGQPTYSGPVECAGKILAKEGFAGLYRGLVPN
FT                   LAKVLPATSVSYAVYDVLSSWQRRKGED"
FT   CDS_pept        complement(338545..339030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633913"
FT                   /orf_name="MICPUN_104815"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63688.1"
FT                   /db_xref="UniParc:UPI000199B64D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5S9"
FT                   /transl_table=1
FT                   /translation="MDDPDAMYPGFTETGLTSAEIQSLLDEYECPGRTVKGIHDTIEAG
FT                   QAVGDYFYFGPKGPDGLMPEVFERYVYVDNMFRKNPRWWIENCATCGAPDNVYMGQEVH
FT                   LYGLTRKQIECFVRCGTPRPPDFILRMDDDEFDMVGLRDTIQTSRLGAWEIQNASSG"
FT   CDS_pept        339557..339823
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633914"
FT                   /orf_name="MICPUN_108225"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63306.1"
FT                   /db_xref="UniParc:UPI000199B64E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T0"
FT                   /transl_table=1
FT                   /translation="MSVSDLAKPVLSSHRRGAPMQIAEISGGHKHAHGAAVEVQPGKGT
FT                   VGLPSRAELANARFVSAIGFLVGGGALCFASIWAWEAKFNRNF"
FT   CDS_pept        340551..341732
FT                   /codon_start=1
FT                   /gene_family="HOG000238032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633915"
FT                   /gene_name="LHCQ"
FT                   /orf_name="MICPUN_82194"
FT                   /product="Chlorophyll a/b-binding protein "
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63307.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B64F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T1"
FT                   /transl_table=1
FT                   /translation="MAAAAAAAEAHWSTRPKPPGSGLSKTHPPEPTPEPETETETETKT
FT                   ETKTERETVNNAAAIVSPTADVQPAGAIATSTSSTDVNSALGDLISSPLFYVTFGVAAA
FT                   VALVQVLERSGVENAEFGLSALPIVLLTAISKTEFGAGLAKSIEDRRPELEAERARVER
FT                   ERAAARATMPAHYGPTRRKFLPDGFGYPFPEHLDGTLCGDAGFDPLGLASGSPGDLDRY
FT                   RELELLHGRWAMLGVVGAAVPEALARFGGLELGEPVWWKVGAAKLNSPDLALDYLGLGG
FT                   FHIAGSSGLAVIAACQLVLMGGPEYARKVGIDSLVPVGVYLPGDRDYPGGAPFDPFGVS
FT                   ADAAVFERQKVAEMKHGRLAMVAMLGCFAQAWATGVGPVENLTETWEKLRAFL"
FT   CDS_pept        341976..342590
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633916"
FT                   /orf_name="MICPUN_108226"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63308.1"
FT                   /db_xref="UniParc:UPI000199B650"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T2"
FT                   /transl_table=1
FT                   /translation="MLDVPFQERLHVDGLGMGTYRADDTLEPDGRTTRVAFAEPRLNLP
FT                   AVLARLMAKAQAYHEHTRYDPVTLERHVRVVPAMGAEHMDFTFTETVRPDRDGVGGCVA
FT                   TSVVRVHCDGGWLGRVLERFICSTSKVKLGERDAYLNAYLEREMGTTYANASVVEVNLG
FT                   VALTNKADFAKALLSHPLPPSTFERSAWGRVKSALGGRFGR"
FT   CDS_pept        join(complement(343205..344131),complement(342707..343096))
FT                   /codon_start=1
FT                   /gene_family="HOG000190594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633917"
FT                   /orf_name="MICPUN_81968"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO63689.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG736019"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI000199B651"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T3"
FT                   /transl_table=1
FT                   /translation="MDGFGTEGLDFPTETSLEQWKLEHVARDIYRRSVASARIREEEDP
FT                   TEECVACEGGWEASVAVLHRETHVAYLTKSLRHLSAGHVVLDASRCWLCYWIVHALALL
FT                   GEPLGDDAARDVVEFLSLCQHPDGGFGGGPGQMPHLAPTYAAVACLAEIATVEAAKCVD
FT                   RAKCAAFLARCKDKSSGGYRMHEGGETDTRGCYTALAVARLLGVQDAEGLCEGVGAFVK
FT                   MCQTHEGGVAGEPGAEAHGGYTYCGLAAAVLCDSAHSLDLPELTHWLAHRQGAVEGGFN
FT                   GRTNKLVDGCYSFWQGGAFPVLELASGAAIASDASSNAACALFPAAQLATQPTSSSNTA
FT                   PSAPSAPSAPSFSSRALQGWLLLCCQLPNGGMQDKPGKGRDHYHTCYCLSGLSVAQHWG
FT                   ADGLVGPATNLLERTDPLVNVTEARLAEWTRLVAQLPKI"
FT   CDS_pept        344306..345658
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633918"
FT                   /orf_name="MICPUN_58428"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63309.1"
FT                   /db_xref="UniParc:UPI000199B652"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T4"
FT                   /transl_table=1
FT                   /translation="MTDSPRARRPRAPKPLKWIVADLLARHVDELVDAGGESLRHLPCD
FT                   VRDALLAVARRRRCLDDAALRALVDESTTIIDASGCGGGRVTDAGIAALAARRALRNVT
FT                   AVDLSRCDGVTAAGLRILARAAPRLRTLRCGGDATCNAACEAAIPGIVPRLEDGGGVDD
FT                   WETRAEVDSTTRATALEWLVWPDVRPDTRATIVRQCPRIRIVAPPREVHLRAASAVTDP
FT                   SFAAVAGEGWIGFGRARTTPVTHRPVTHRGYESSPPGSSPRPVSQYAERCVGRGEDNDG
FT                   LVVVAASKRPGEGLTTHRRGIPWWLAGENDVNTSPAVPPIEADPTRALDEAHLTRVDPR
FT                   SWVHPSSSSSSSSPTAASIDRRGANKLLGENAATTASSMALRWRLKFAEDDVPIAERFR
FT                   RACAEVEAARTARRERNHQKRKNRHFNRLAASSSERLIFRAMDDVSLVDLR"
FT   CDS_pept        complement(345803..346747)
FT                   /codon_start=1
FT                   /gene_family="HOG000165139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633919"
FT                   /orf_name="MICPUN_58429"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO63690.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B653"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T5"
FT                   /transl_table=1
FT                   /translation="MSAPPASKKQAPWKGFLSGSLGAMASGAVTHPIDLVKVRMQLYGS
FT                   TLDGAQHAGSAGVAPKAPPGMMRTGYLVVKHEGAFGLYKGLSASLMRQASFIGTKFGAY
FT                   DLLKSAVPKDADGGLSFWKMTLCGLGAGAIGAAVGNPADLAMVRMQADGRLPKELRRNY
FT                   RHGGEALARVVREEGVLALWRGCAPTVNRAMIVTASQMAVYDKSKAVILKESGAKDGLA
FT                   VQTGASFIAGVVAALTSNPIDLAKSRLMTMKPDAEGRMPYSGTMDCIVKTARSEGVGAL
FT                   YKGLVPTAARQVPLNMVRFISMEFMKKLLANVD"
FT   CDS_pept        <348160..>349092
FT                   /codon_start=1
FT                   /gene_family="HOG000179779" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633920"
FT                   /orf_name="MICPUN_67699"
FT                   /product="Predicted protein"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63310.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG317600"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI000199B710"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T6"
FT                   /transl_table=1
FT                   /translation="SIRTRQRGVPHSQFSWKNRPRNVLVIKKPKDKNTTAMLPRVHAIL
FT                   QSKGIRTWVEPVVHWETGLGETWEQDDDPNLDRLIDFIICLGGDGTILWVSNLFPRAVP
FT                   PVVSFAMGSLGFLTAFAEESIPKAIDDVVAGNFFFTMRSRLVAHVVRADGTEERERHVV
FT                   LNEIVVDRGARSQLIDLDVNVDGNPMTKVLADGVMISTPTGSTAYALAAGGSMVHPGVP
FT                   GILFVPICPHTLSFRPLVLPDSVILTIQVPETARVEPVASFDGKQQRQLRRGESLVVAG
FT                   WRYPVPAICHAGETGDWFRAVKDSLLWNVR"
FT   CDS_pept        complement(349183..351912)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633921"
FT                   /orf_name="MICPUN_100418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63691.1"
FT                   /db_xref="UniParc:UPI000199B711"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T7"
FT                   /transl_table=1
FT                   /translation="MGKKGKKKPPAPPAVSLPSEPPGLPPPVATHAGIATDTPRTEASS
FT                   WPSTPGSSWLPPSASRATAFERALAEAGMDEEAGTADADVVAPVAEKEPASGSTTPASA
FT                   PEPMVDAGDATDVANLRARLEAAESRLEALRADFHYNLALLKDRDAELEAQDEKIASLE
FT                   RAIAQRDVAAADLDARLVATTAEKSALPAAVDRAKEEAESTASHDDAVRSIRATHAAEL
FT                   ETERRLRDESIAEANTRVEAANTRAHAAERDARLAADARCVAVRAEAEARVRRATERVE
FT                   EVERERDRLAETKQRLLDEYEEKCEKLVASMRDVEAHFESVQDDRERAERERAASEETW
FT                   RSRVRALEGELEKAREKEADARAIAERERDERVRVATRELAEKASELEREATRLASENE
FT                   RLGESLARAEGRADAAETRLAEERERLETQLAEERERLETELKAQRSAVDELSATHAKE
FT                   HAMLRARAESAEAALEELRRAYAARSLAAAAVPAVDSKASSPEAEDLPEDLPEADGVAT
FT                   EDPDPPERNPTEETRGSETKGWTEVDPGTETNRRGDEPARTEKGEEYWLERFDAAARAV
FT                   SAAIASLPEPAPDRCRETKGPAGGVEEAGGMRLRERMRALRASLSATRVDAGTPAPIDT
FT                   AGKAKKKKKTTKKKKASSPQPRQRRSSPSPSPSPSGSSGPKKLKNLEKALRALKARPRV
FT                   AKKRAQRKRATTTTFVRDVEARSAPISSFASHRTAFGRTTTDPLPGTYRPSPPRARQAL
FT                   DPREEEAVARLTRPKSSREVPEPPPPPFRPRGYSRPLGAVPRRPPHTPFEPPSSFRAPS
FT                   PPSPTPLDERELSRFEAHWDKENARHRYASAGDKAGDGYFALSPRSKRWTTSAREGASR
FT                   EGIGPARDLIAAGEDRLAALERRRREHRALRMAMRFNG"
FT   CDS_pept        352170..353399
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633922"
FT                   /orf_name="MICPUN_58432"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63311.1"
FT                   /db_xref="UniParc:UPI000199B712"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T8"
FT                   /transl_table=1
FT                   /translation="MAGKGGAKAARQVAAADSVPPSNNVSADAVKTIVKPPGVTAFRPR
FT                   VPAPTLDGGGSPEPGSSAGGSPGSTGGAATPSPGRIANAASRLQAQLSQFTEGLARTDA
FT                   MLLAGTEELTRSTERQSKSAYDFTGSMLGMVRDSHANVSAAKTRVQAQRKAFNDLNAER
FT                   DSLRVEKESLAHAVEDAAARLADKDAELEVVNESRRILEKEVDAKAKRLAQTEAKVESL
FT                   NDQNAQLGAQIAAKEREVNDAEARRRELSARHEELERTLAAAQLARDRASAKATALEEA
FT                   NAALEEEIAAGEEAVLALQRQTEESFSALQADREALLARNDALQRQMRESQARLDAVRE
FT                   EAAAIIAEEQGRTEELEAAYEETLLELEEKGGEGTLRPMLVEAQNREREALDRVEELER
FT                   KLRELRTTRG"
FT   CDS_pept        complement(353567..356083)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633923"
FT                   /orf_name="MICPUN_58433"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63692.1"
FT                   /db_xref="UniParc:UPI000199B713"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5T9"
FT                   /transl_table=1
FT                   /translation="MATGDASPRGFYSAEAADEDRVWRRHARAPELESTTARFRAADLA
FT                   GDLPKIPRPESRCVAGTTWSGSRGACVADAIDARYGISAASTGGGGGFDFRAHFPAVLS
FT                   LLLAFSVCVVVVATSLLLAFALARAGSLVLARGARRIKKIARRVQEDMTRKMKEADDPA
FT                   RSRRAGYAAAAAATIGALAEICARLLGWIHDRLDETYARTHATSRVPASPTPASQGDDN
FT                   VDPPRGVELGAIVGAALAAHVPTGTGGLDRERLRSCATQMARALARRLVRGGARGAAAT
FT                   ATAADEEEFAGAFVGACELAWREGAGTSRVQTPTGTKKKKKIGEPRASAEPGDGAGESR
FT                   SSSTTSSPVVVEASTVTGNGSRNGSPSGATGSASTTTSDDKPMRPATHRPVTGRNGRAT
FT                   RTTNEEGVTHEGSPGGSWFQGLAKTWETMTTGPAEHATAADDDAAEAGGRGKKKNDNGD
FT                   NPGRRDDRKRSSEWDSDDEDEDEDDEVSGSVTTSPTKTSSWGLALPGVGGSPRRAMRSI
FT                   MRVASAADDKQLRVLDMAVRMREVLSSERANALAEKRLTLSARALEAQRLNLDVAHEAN
FT                   ELHSEANTIARSSLERKDVAARKAEAEKALGETRAALADAFYAGLVVVLCTTLAGGWRR
FT                   AMAALDSVIGVCPRPAGGTGFSGAAWAIVGGGPGPLDYAWCVTRAFVRAAWGGLLLLFV
FT                   GWKLLQYNVVTNYQSAPAFVLLVVLGGGCGQLGRSAVDSLGGDGDLWLRMWGGYMCAAA
FT                   ACTWRADFVTSACRKIGPFGRLVFYAAFGAVAPFCVGAAPFEDTFGAFAESLIDRAMFW
FT                   GETVVRAVEDAGDIIGFGFLWGPAGR"
FT   CDS_pept        join(356329..356404,356706..357040)
FT                   /codon_start=1
FT                   /gene_family="HOG000264613" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633924"
FT                   /gene_name="HLIP"
FT                   /orf_name="MICPUN_106894"
FT                   /product="High light induced protein like protein "
FT                   /protein_id="ACO63312.1"
FT                   /db_xref="HOGENOM:HBG609020"
FT                   /db_xref="UniParc:UPI000199B714"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U0"
FT                   /transl_table=1
FT                   /translation="MACVAQIRGVPATAPRLSLLGNRRAVRGKRMSAVMNATETDVVAE
FT                   TKQMLKEGGVTVEYQRRKAKEMVKFFKQQAYDQAVEDSQVFGWTPKNEINNGRWTMFGL
FT                   LVGMMTEYATGVDFIDQIKLTISVLGIADIYD"
FT   CDS_pept        complement(357222..357545)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633925"
FT                   /orf_name="MICPUN_58435"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63693.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199B715"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U1"
FT                   /transl_table=1
FT                   /translation="MSGVFCLYIRVKLKTDAIAEFLERWGKLASHVRANEPETLSYELC
FT                   RSDQNEDEFMIVERYPSRAQLEDPHQTSEEFKAFKEWWTSSGVVLEKSGMSCVETGVGY
FT                   MSK"
FT   CDS_pept        357749..359257
FT                   /codon_start=1
FT                   /gene_family="HOG000038766" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633926"
FT                   /gene_name="CTPA"
FT                   /orf_name="MICPUN_58436"
FT                   /product="Photosystem II D1 protease "
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63313.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG750030"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniParc:UPI000199B716"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U2"
FT                   /transl_table=1
FT                   /translation="MHRAASAPVVLPAGMRARALPCRARVAARASRPARKSLGTAHRGR
FT                   VLETTDGDAEAFEDLIGASEARDADARRDALSSRLFARARRGAAAAAAAAAVAACAGGF
FT                   AAPPADAITANNLLFLEAWRAVDKAYVDKTFNGVSWFKYREETVKRTPMDSIDQTYDAI
FT                   RAMLAKLDDPFTRFLEPEKYASLSESTMSANITGVGVEMAYGESDAEIVVVAPTPGGPA
FT                   DEAGVRPADRITAVDGRPVAGLSLYEVADALQGPASSEVDVSLRRGGEDVAVRITRRSY
FT                   ALVPVRAQLCSPAAGTGTKMEYVRLTTFNQLSGAKVAEAVRSGLENGADAFVLDLRSNS
FT                   GGLFPGALEIANTFMRRGAGIVLIADSDGVRDVFETDGVKTLAPDAPLTLLVDKGTASA
FT                   SEVLAGALRDNKRAAILGDTATFGKGLIQTVVPLTDGSAVSVTVARYQTPSGADINKVG
FT                   IRPDAPLPVVSGADGQESALPTEPGAFCAVVAADEGVAKALFPR"
FT   CDS_pept        359368..361071
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633927"
FT                   /orf_name="MICPUN_58437"
FT                   /product="Predicted protein"
FT                   /function="polysaccharide binding"
FT                   /function="scavenger receptor activity"
FT                   /biological_process="immune response"
FT                   /protein_id="ACO63314.1"
FT                   /db_xref="GO:0005044"
FT                   /db_xref="GO:0006955"
FT                   /db_xref="GO:0030247"
FT                   /db_xref="InterPro:IPR001212"
FT                   /db_xref="UniParc:UPI000199B717"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U3"
FT                   /transl_table=1
FT                   /translation="MAPRGRGRRKVNGANRSVVDLFRKMRDAARLAGLVAFLRLLLLLA
FT                   LVNPTAATDRTLCFQLPGELRPRPGARRAATYPNSTADRCVTRALWDIQAASMHRVRGA
FT                   DDAGADATALRCVPAQEAFLCDRRLGDPNELFVCELTDAGPGSTLTTAMDACVWPVCEQ
FT                   ICASAPPGGTKTADDWEMTRACGRCERACDAEGFKPQTSSAGQNQNSSPGRRFCAGIAA
FT                   AAGSGGDAETRARAAYAYALGGWTGGWSGISAAATGAGAAASTAAATAAASTAASTAAA
FT                   ASTAATTTAAAAASTAAATTAAVATTAALTGNFFVVSARVALLFVAFKSVLQHFIVVAP
FT                   PGFGWNPVPNRPGGHPNPGGPHPGWPPIPPAPTWKAPPPYSWAPSPPPATFTKPPPPPA
FT                   TSSSPPPPPAPTPGGQCPGVADPAFTCVGECGLCIYFPGEEDPNCCCDADCSSFGDCCG
FT                   DFDACCPAGTFAAKHAFDASALGKKSVFSGARRGSSFGGVRTVSGSPFDGVRTVSGSPS
FT                   GATGRDARPRTAGDEAARLSTRGATVGARRAKEGGHARVAARSARILDLD"
FT   CDS_pept        join(361438..361610,361659..361954,362087..362386,
FT                   362429..362851,362894..363135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633928"
FT                   /orf_name="MICPUN_82170"
FT                   /product="Ca2+:Cation antiporter family "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63315.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG595493"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI000199B718"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U4"
FT                   /transl_table=1
FT                   /translation="MCLVVALVFWILGDTAERYFCPVVRTLADRWNLAPATAGVTLLAL
FT                   GNGAPDVFASLAAAAAAAGATAAAGAIVSAGMFVSGAVVGAVALVAAPFPVDPRPFRRD
FT                   VSCYLAAVIVTAVVVADGKVHAWEAAALPAYYVAFVGYVVWCDARTDPGAKEPSSTASR
FT                   LVDRARRWFATRWREREGGSFGFGFGFGGDSALRRALDATTLVCLVAPLEVARRATIPC
FT                   GDPKRWNRFYACANAALSPLLLTHLVVSFSGLELGFGGSLGSGGLEFAVGVGMASFAAA
FT                   AVLWRVTADDAPPRWWDANGLVDAVAFLCSVAWIAAAARELTECLAAIGDVLGVTPASL
FT                   SVTVLAIGNSLGDLAADVATARSGQPTMAVAACFSGPLFNMAVGLGGSFAIATWGRGGD
FT                   PLPLAMHPTVAVGFVFLIVGLVATASLVPMRGYVVTRGHGYGLIALYVTYMACAVAVEV
FT                   LTDGGGGGTMSESAPARWR"
FT   CDS_pept        363251..364105
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633929"
FT                   /orf_name="MICPUN_100422"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63316.1"
FT                   /db_xref="UniParc:UPI000199B719"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U5"
FT                   /transl_table=1
FT                   /translation="MSSYEELKRRVAALKQVDREETAARKAVAAQENAEVARAKAAMLA
FT                   KEKENDERLHAAKKALHAATERSQAMRKQYESEVKKLQQKLDVTTGKLAASEEKASRDA
FT                   VAAETRRRDALAEVNARWEADVAEREARRREETTELARLLEEARAKSSDRTSELLVRAT
FT                   QAEEAATAARAYSAALREELENLKASAANENAARDREREELIAAHDAKVLAVDAHHEKR
FT                   VEKLREEHRATLAAVDERVRGTIGRMRDDNARLRSQLAASQEREGALSRVLSDQAARLL
FT                   SEA"
FT   CDS_pept        complement(364202..364936)
FT                   /codon_start=1
FT                   /gene_family="HOG000019419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633930"
FT                   /orf_name="MICPUN_97364"
FT                   /product="Predicted protein"
FT                   /function="ATPase activity"
FT                   /biological_process="barrier septum site selection "
FT                   /protein_id="ACO63694.1"
FT                   /db_xref="GO:0000918"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG691818"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="UniParc:UPI000199B71A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U6"
FT                   /transl_table=1
FT                   /translation="MSIARLGYKVCLVDADIGLRNLDLLLGLENRVMYTAMEVLEGECR
FT                   MEQALIRDKRWRSLALLPISKNRQKYNVTKDSMSLLIDILKDMNFQYIFIDCPAGIDVG
FT                   FINAIAGANEAVIVTTPEITAIRDADRVAGLLEANDIYDVKLIVNRVRADMIKKNDMMS
FT                   VKDVQEMLGVPLLGAIPEDTEVIVSTNRGEPLVLKKKLTLAGIAYENAARRVVGKQDFL
FT                   IDLEQPKKGLLQRTKEFFTGSD"
FT   CDS_pept        365349..366356
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633931"
FT                   /orf_name="MICPUN_58441"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO63317.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199B71B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U7"
FT                   /transl_table=1
FT                   /translation="MGRHFPSDPQVCGHLMTDGTLGRTGKMALTSWLLAPIRAPRALPL
FT                   LPGAIDDAMTREGTATCAPSAATTGAKRKSPSSSSGVNPFSIASRAASAPSTSSRRGAD
FT                   PNPETLPRGDYHLPNHPSSLLRYEPAAMSCTRDEYEQLWRFADSVAPTPNPMNRNVNLL
FT                   RKQATFGATYRFGAQVSQRVDLPSRDTWPALVRRCVDDAVQRVDPSDGARDSYRANVAA
FT                   HVNWYPNGRSGMGRHRDAEPDLVPGAPIFSYSFSSASADGLPRIFDVYRLGAKRPIAAV
FT                   PLSHGDVLVMAGTTQETHEHGVRATAKRAYAGESRINVTVRAFKPGSLAVRVEK"
FT   CDS_pept        join(complement(369644..369742),complement(366444..369506))
FT                   /codon_start=1
FT                   /gene_family="HOG000201156" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633932"
FT                   /gene_name="IRE1"
FT                   /orf_name="MICPUN_100424"
FT                   /product="Endoribonuclease/protein kinase "
FT                   /function="ATP binding"
FT                   /function="endoribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="nucleic acid binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63695.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016891"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006567"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniParc:UPI000199B71C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U8"
FT                   /transl_table=1
FT                   /translation="MGRLLSPAPTLWLVCIASMLATASVEGKPTAIKRAGGRRLAEATD
FT                   AGEPLLVSLLDGTVRAVDRSSGETLWTFSSGGPLVQAHRSVSDGPDGGGGVAIRGRTNP
FT                   TVFPGIDGSLYAYGGGHGSGSGGTGEVSRLPVTARQLVEASPSVTRDGGVVMGTRRSVV
FT                   FAVDKRTGELLRSFDTDGTVVHGGNDDTGFFLSNESPTGDPTPNDVNDEAFYIGRTEYV
FT                   VRSVDSSTGRERWNVTYGEVTPLTSTAQGGGGRGGPLFLRRGDTAGDGDGDAGDGSSAP
FT                   RLEWGPGNSIACAGGAGHAHAWTAHMPSTPVAVHDGRTGRAIKGGSPGVGGGGDGGAGG
FT                   GDILVGAHGGGLFALPSTDGGKTRGLSLGVPGDSLGTVGALVPVAVSPTVRPDDDWACI
FT                   PEKLWDDALTPGGLDSFLALHGVSGIGLSTDGGLALLTPLQRAVGSPVGAAVVVTVAVG
FT                   FGTLVSYAALIARSRLNGLNGGSNSGSNGSNGSKRGSRGKNRGRRNKGKGGVGGVGGVG
FT                   RVGDDEAADEVPVATADRGNPPEPLRSDSGAVRVGRLSVGPGILGYGSCGTIVFEGELD
FT                   GRPVAVKRLLAQFHELARAELATLISSDEHPNVLRCFAMEEDADFVYVALERCSSALAS
FT                   VVDGGSMGVGLDLATKDGDAFDLVDPSTGRPTSEGMTLMRDVCEGLHALHSRGIVHRDL
FT                   KPQNVLVTPQRRGKLADMGLAKRLGVGVGSDVSFETHLAGVGGTDHHHAGSGTAGWQAP
FT                   ERLLRGKQARSVDTFALGCLMHYCLTGGEHPFGERYERDANVIKGNANLAAVGHMPEAA
FT                   DLIGKLIARDADARPSSAEVLLHPFWWSDAKKLTFLSDVSDRVEMEDREVGGKRLLGSL
FT                   ERDAMKNALGGGEWVPKLDPSLLENLGRYRKYNAAAVRDLLRVIRNKMSHFRELPAKVQ
FT                   ATVGSPPDAFYRYFATRFPGLLLHAYAFAARECAHESMFRRYFFPHEEDTRCSGEALAS
FT                   LERASAAVAAKAAERAARREATNDRTSVEYPVRPGEPDCVFWIKTGRCKFGAGCKFNHP
FT                   SGLHG"
FT   CDS_pept        join(370130..370185,370367..370424,370639..370707,
FT                   370962..371027,371169..371264)
FT                   /codon_start=1
FT                   /gene_family="HOG000242291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633933"
FT                   /gene_name="PSAE"
FT                   /orf_name="MICPUN_90731"
FT                   /product="Photosystem I reaction center subunit IV,
FT                   chloroplast"
FT                   /function="catalytic activity"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I reaction center "
FT                   /cellular_component="plastid"
FT                   /protein_id="ACO63318.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009536"
FT                   /db_xref="GO:0009538"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="HOGENOM:HBG599647"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniParc:UPI000199B7D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5U9"
FT                   /transl_table=1
FT                   /translation="MASITCATPALAARAAVTRKLSAKSQKQSRVAFRVRAADAEAAKP
FT                   AAEKKPEPIGPPRGSKVKILRPESYWFNDYGKVISVDQSGVRYPVVVRFEKVNYAGVST
FT                   NNYALDEIEY"
FT   CDS_pept        join(complement(371943..372245),complement(371508..371846))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633934"
FT                   /orf_name="MICPUN_58444"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63696.1"
FT                   /db_xref="UniParc:UPI000199B7D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V0"
FT                   /transl_table=1
FT                   /translation="MSTRGPATVVTTATRVPPHRRAAKGSRSAVVASATRRGDGDDGRV
FT                   DRAADVVVVVGRRTALGMGASALMSASPLAARAEDADPWEGSYVKPALTVPQYLDKIAT
FT                   SRGPAFEELRELTDQLKFSQLNNALVIAPFDDVRQSAYFLPWALVKLDEDAGVAAQRRW
FT                   LDFRERLIQLDETSIDAGRREADETDVGRCVDRLEAALDELIAAVPTSSR"
FT   CDS_pept        join(372374..374265,374389..374464)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633935"
FT                   /orf_name="MICPUN_58445"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63319.1"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B7D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V1"
FT                   /transl_table=1
FT                   /translation="MPRKGQHRGRQDWLDYSDDDEDDAPGPSSAGRRGGGGASEGSSKH
FT                   GRRRVHGVDRAHHARLHADVGVDRGALQGSPRARAFAIADGTGRGGVVVGARGTVDDAN
FT                   DPRIVPLDHLQMPASLVDMFGTSLPVEALQDAYVQCGRSLSRTVDALLALTLDDRDKPG
FT                   PAPPESHTGVDLWDTLPSEVRLLILDRLGPKDAARAASTCRDFAETVRAWRLNARGLHL
FT                   PPDLSVAGLASLAGAYPLITYLSLRKTRGVVRDPADVRRILVGAAAGPAVCTITSVDLE
FT                   GLDAAVADKDLPGVLDCGLDAVTELNVGRCARVTDKGVFALAQHRRGGDLRGLSLAGCS
FT                   PGVTADGLEALLRGKSGGFPEMRRVDVSGCMGIRGSVTVPPRTVATSLRMLNVASLTEL
FT                   HAKLTADAPLENLSVSQCGTLRVLCVSAPRLERVNASMCKSLRRLELRCERLDSAVLQH
FT                   CAELTDVREFRCPSLASELNVTGCKSLTTTTLTSMLRETPRLRALRAEGCVALEGELAA
FT                   SNRCLEVVQMDGCSRIGGVRLAAPVRTLVAKNCKALAAVWIEDPPPPEDEEDEGRGGEG
FT                   GEERWKNRSIRVDLRNCSSLERLVGVRAAATEGRLTVDLRGCTSLPPSARPPMHRLDST
FT                   PGAIPKEVVVPKAEKGGAEN"
FT   CDS_pept        complement(374746..376083)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633936"
FT                   /orf_name="MICPUN_108229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63697.1"
FT                   /db_xref="UniParc:UPI000199B7D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V2"
FT                   /transl_table=1
FT                   /translation="MARASTAFIFLALIAAAGHVDALCGVATRGCNAPAQFSGMKKSTT
FT                   LPTIVASTGITQDFKDKLDEGHQVLINFAGGAGPTTAYILEGGGADAAYADFKTKNCEQ
FT                   TTFEGYCGADKLITQAKNSQGQGTQAFKGSGGKTCSCGHALESSAALYYILDSSTTAEV
FT                   VGERAVHEMCHVTQMSRGEYFPTWLVEGGAVHTECLLQKKLTWSTQTYEDCFRTGGGRG
FT                   GVIPNFRSYYDSTYGYTNGLKKGELRECGGFVGNSDTEATQKAGGADPSHLYYDTGTVA
FT                   IAYIINKAGITSQQFWQSNELGKGFWNTIVPFDGHDLRTGYPGQCPEDKGWKKSLLAIT
FT                   KHATVAEFYAEFDAWAKTASVADVVAILETQSAIDTQTAGVFDLSTATEGTDHDPCGSA
FT                   TQWPPSPPPAPPSPPPPPLSAGSSLSGVVSAVVAAATVVLAGTGRA"
FT   CDS_pept        complement(376323..376517)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633937"
FT                   /orf_name="MICPUN_58447"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63698.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199B7D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V3"
FT                   /transl_table=1
FT                   /translation="MTTPRLRHYLAVGGADACVLNVKAEWEVVKRWEASKAPVNALEFA
FT                   PDAKALYAGCSDHNLRVIA"
FT   CDS_pept        complement(376780..377691)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633938"
FT                   /orf_name="MICPUN_100428"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63699.1"
FT                   /db_xref="UniParc:UPI000199B7DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V4"
FT                   /transl_table=1
FT                   /translation="MVYSKRGGCCCAFAFVLEAIALAAALIAITGTFWLDPVVTDAGSV
FT                   LPGVQNAGLWKVCYPEAPVELATPDDIGTSDDGAVAATLFATDPGDPDADAVVSGFADD
FT                   APVAPRRAGPPAASAADTKDASEESLSDRLTNTSMVLSNIRRDLDENLPWTEGSPNSQC
FT                   VTITGYREMTLYSDVWGHDFGSKVDATRALTIVFVMLGFVRLLHSMIVSVCTGDYAAGA
FT                   TCTGGALTTTQVLAGWAGWLIYLWILLDMSRAVDAHARAAAAGAEIDVENAGEVSNYWG
FT                   YSFWLFLASTLVTSVGAFFGCW"
FT   CDS_pept        complement(<378194..>378718)
FT                   /codon_start=1
FT                   /gene_family="HOG000200810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633939"
FT                   /orf_name="MICPUN_71544"
FT                   /product="Predicted protein"
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="ACO63700.1"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG317408"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="UniParc:UPI000199B7DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V5"
FT                   /transl_table=1
FT                   /translation="YNKAMAEYSKTPFEYRHELGLYYHFILPNLIVGTQPQTREDIDRL
FT                   KDVEGVTCMFDTQQDKDKDYWKVDAGAIRDQMNKRGVLHVRQPFVDFNADSLRVGLPKA
FT                   VAQMDKVLREGHVVYCHCTAGMGRSPGVAIGYLYWCLNFDSLDQAYDFLTSKRPCGPKK
FT                   ESIRLATVDMLR"
FT   CDS_pept        379575..380945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633940"
FT                   /orf_name="MICPUN_108230"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63320.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniParc:UPI000199B7DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V6"
FT                   /transl_table=1
FT                   /translation="MCVDPKHKSWTPRELAKAPPERVLIAIDGRVHDCAGWLRRHPGGA
FT                   ALLRTYAGRDASDVFAAFHGPEVYKTLKAFDVGCVVEEPVVENPGLDGALTGAYARARR
FT                   KETAAFRKLREELWREGAFERSVGAIAVTVARLLIILALAMWFTLRRTEWVTTSRAAGA
FT                   VFLGLFWQQSLLLAHDCCHRCLTRNTAVDKRLGYVFGTLIGGVGAGWWNMEHCEHHAVT
FT                   QVIDGDPSAGSHPVLCPHTSMIDKLGPILRAVVNFQALYYVPICVFVGRVNLHIISILK
FT                   APTKDKLTDLCLMAGYAAYNALILQSVEPSARATYFVISNTVCGVLHLVLNMNHYPMPM
FT                   LSFDTAMDLGFFRFQCVTTLNIASNGWTSWYYGGLENQIEHHLFPLMPRHYLPKITQRV
FT                   KKLCEDHAVPFTVAAGFFDANNKVMKTLNNATRNIDVVLSRKDSHGNVSTPSELHEE"
FT   CDS_pept        join(complement(382983..383042),complement(381123..382796))
FT                   /codon_start=1
FT                   /gene_family="HOG000159304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633941"
FT                   /orf_name="MICPUN_106896"
FT                   /product="Predicted protein"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63701.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG318532"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniParc:UPI000199B7DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V7"
FT                   /transl_table=1
FT                   /translation="MGTAAKRREKRKAAKAAAAQGKGKKAAKGKKAAAAAAAAATDSED
FT                   DVVIEYVAAPPEVDDADGGAFKEFGEIFAKFASREDGVAATFVKREEGVDAAETEGGVK
FT                   KEEGDAKEENDGDDEGGEDSDDEDELSRKKKKLLTRMKIAELKQHCSKPEVVEVWDTSA
FT                   ADPRLLVYLKAYRNTIPVPAHWSQKRKFLQGKRGIEKPPWQLPGFIEATGIQKLRDAYA
FT                   EKEDQKRLKQKGKDRTTAKLGKIDIDYQVLHDAFFKFQTKPKMSKVGELYFEGKEFEMD
FT                   LGGKKPGVLSEEVKEALGMSDDGPPPWLINMQRYGPPPSYPNLKIPGLSAPIPPGAAFG
FT                   YHPGGWGKPPVDEYGNPIYGDVFGVYGTKEHDDRTPYDAVVDKTKRWGQMEELSESESE
FT                   YEEDEEDEEDGDGTELGDDDVRAGIASMSSLQTGVETPAAPLDLRKRSGPASEAEPARE
FT                   LYQVLQTKDAGVAGTDIMGSAHTYVVPSERVGLVPGSKEEQRAAAAAAREGTDIALNPE
FT                   DLERGLDEAGVAARYDAEVAARKASAAPEDFSDMVADQARRAKRKADQKSKEKDAKKFK
FT                   F"
FT   CDS_pept        join(383256..383288,383438..384883)
FT                   /codon_start=1
FT                   /gene_family="HOG000265425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633942"
FT                   /orf_name="MICPUN_100432"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63321.1"
FT                   /db_xref="HOGENOM:HBG607809"
FT                   /db_xref="UniParc:UPI000199B7DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V8"
FT                   /transl_table=1
FT                   /translation="MARHTAIFALAAFLALAAFDGADATTCISSSNPLDNNKEYFSVTD
FT                   RVAVDGTAAGSAEVTVAGDFSITYHKHFKVLKNLLVTPAKTYVLRMCGSDVPTKYPNGT
FT                   AIESDAKHFSVPVKGVGVGGSIPMAFLEQLDLLDKIKVADPQYVHSPCIRNAEKAGTIL
FT                   GQGSGHLHAAGWANKTKDNDAVELVVTDSWNTGACSCDKDVVFDPSTDDTPLGRAEWIK
FT                   YISTFFNEEGRANVAFAREKAAYDATKKIAKDAADVHASLQKPKKKCAWVNEAYDSNWN
FT                   SYWKLDIAPYKLAYCADAGMEAVTDKDSQGYAKNYVKSGNRLTNALADVDVVIDETYDS
FT                   DPATNLDTKEKVLAKLGITLKEGAVLLRLDRELSDNSATSTKFYEINSGNSGINWAWSE
FT                   SGVLRPAHVLQGLVHAVWPNSVKEIDPACVDYFRDVTAGEKPVVKDHTHCTKWDKANAD
FT                   AQCVTNIIFRDSPAAKPSFIVAILVALVVALIGA"
FT   CDS_pept        complement(385445..386491)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633943"
FT                   /orf_name="MICPUN_58453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63702.1"
FT                   /db_xref="UniParc:UPI000199B7DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5V9"
FT                   /transl_table=1
FT                   /translation="MSDPARVEALVQAECAATGAVVRKSRRGGGGGGSTNSNATKVPKP
FT                   SGTYEVSRAVQRAAPPASTSAPSSLANDDDAEGLRRAAVHHWRARMMVKLSSLYADAAW
FT                   DAQEKPRKFFIKHRGFGPTHGRKDLPTHRRMFLRCALASAERAFELASSSFECATLRAC
FT                   ILSLINAEDGPDAADAALSRACAACRHAIRLHERWARDASRETFEVSVLHSPGGGSDAG
FT                   HGVGSGAPSSAHRAPPPAGASGSAARRIESLRSMATYAAHVLADRRGGWDFETSWVRET
FT                   GDEWIDEEAEKAAKRVAAVILDDDDEDGEDDEDEDEDDDDEDAGGGWDMWQSPSILDYS
FT                   LAALRGPP"
FT   CDS_pept        join(386638..387030,387145..387867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633944"
FT                   /orf_name="MICPUN_58454"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63322.1"
FT                   /db_xref="UniParc:UPI000199B7E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W0"
FT                   /transl_table=1
FT                   /translation="MARGERRHVPHDPAAPSPPPYRDDNLDRSPAKARFTSTRDKYGSP
FT                   RVSKLTAGTVKLGGPLTPFPSEVMKPEPQGLVLVPKVKVDLARARYTKGRDMPSRPTSA
FT                   TTAHSATSMVHYQTTKERLLKEKEWERVHPRQFIKVSRTARPGDREGMAPDPTVETART
FT                   AMEKRRALEHEAAVAHLEKLRVEAIEERDAAVAERRSLTTAHIRREFGAQRERRRDWCE
FT                   RAVATAAWKPMDANRFEQTLAAERDLALTYDPKGLAETMRSSTTYAAYFEEHARCTRAT
FT                   AAAEGGCKDAGSGRSSRCENEERERDARAIAELDDFDERVGYFHETSLRDRCKDRGWIL
FT                   SPAGRRTGGVPATPTTLRVSNPPVSFQSPDF"
FT   CDS_pept        complement(388078..389394)
FT                   /codon_start=1
FT                   /gene_family="HOG000255424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633945"
FT                   /orf_name="MICPUN_82337"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63703.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG526281"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199B7E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W1"
FT                   /transl_table=1
FT                   /translation="MTRGNKAKLDNSKLAKLEPHKLAQTFEQRWVRIDDVEYDVTNFKH
FT                   PGGSVIFYMLSNTGADATEAFKEFHMRSPKAWKMLKALPQRPAETPRSADPDAPMLQDF
FT                   ARWRAELEKEGFFEPSRLHLAYRCLELCATFALGTFLMYIGRPLLASIVYGAFFGARCG
FT                   WVQHEGGHNSLTGSIWWDKRIQAATCGFGLSTSGDMWNQMHNKHHATPQKVRHDMDLDT
FT                   TPAVAFFDTAVEDNRPRGFSKTWARAQAWTFVPITSGVLVQMFWIYVLHPRQVLRKKNY
FT                   EEASWMFLSHVVRTAVIKLALGCGTAEAYGWFWVGNWIAYMYLFAHFSTSHTHLDVVPS
FT                   DKHISWVNYAVDHTVDINPRNSIVNWLMGYLNCQVIHHLFPDMPQFRQPEVSRRFVAFA
FT                   EKWNLNYKVLTYYGAWKATFSNLDRVGQHYYVNGKAKAH"
FT   CDS_pept        complement(389920..391425)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633946"
FT                   /orf_name="MICPUN_58456"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63704.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199B7E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W2"
FT                   /transl_table=1
FT                   /translation="MGAGEEVPRPPLDLTPASLSAARSGRRALELYLARYDDRGGESNG
FT                   GGASSPPSSSSSEKTVARRMALPSDRGRAPLDRVDGDAPPGPPPLPAVDPEILRRLDER
FT                   LCAGLRVASSSALTRRRGSTPRHLPGGRIVKPLLPWVRSRPSSELLHRHEWPDAEWPAA
FT                   RRHAPPRGACRRGGNPASSRFERRGVGPGDRSRSAACSVVDRRAVSAHASGSPSIGSSE
FT                   LSSELSSELSSDDSSELSSDDSSDDEEASGRRRHSWRRRSRSSLDARSARGGSSRRDDS
FT                   YSSPDAAAVARVDALLERLTRAAVGRRDGWRRDDAEFAPSPSSGRTRSPSGDDDASPGD
FT                   GVLSGAPSGVPSGVPSGVPSGVPSGLSAPPIASSSRPTPRIPEAERASVGTDRETERRE
FT                   RDGDGDDVHVDGRRSRSPAPPSPPPPTTTLLPPRAESMSRSPGPRGGEDATPGARRTAI
FT                   SKMRKHELIEELTERGMDAGGVVKELRDRLRAAREVGGWRGDE"
FT   CDS_pept        391574..392743
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633947"
FT                   /orf_name="MICPUN_100436"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63323.1"
FT                   /db_xref="UniParc:UPI000199B7E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W3"
FT                   /transl_table=1
FT                   /translation="MGKSPRASQGRSIARRMESSGGRRKQKGDGLVPGSKHAGLFSDDA
FT                   IASFDELLNSDDVAFRTAPGPPVRRAPPPEPDPAAAAAAGGGGTPSWIPSALRTASSGR
FT                   WLSWINVAMLLVLLLGAGLAYVYVGGSEWTEPAEADMRLADTAGMVESAPAASEPPSAK
FT                   DIIEEYRRKRLAKEAKEREERETRLAARMAEVANEATTSPTPEPEPPAPSLEPEAAPPP
FT                   PRRAMKPKKAATADERAAKPKSKSTESSQPNSKSTESSQPTSKSKTESSQPKSETDEER
FT                   SARYAREDAAREARIVREDEERKARIEEEERAARARVEELEARARVEELEASSVGAAGG
FT                   AAKPAAVVDTVDYEEEEDRPAPVRQRKKEREKEREEAPAVAGNLGVDYE"
FT   CDS_pept        complement(392935..393417)
FT                   /codon_start=1
FT                   /gene_family="HOG000157065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633948"
FT                   /orf_name="MICPUN_94181"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63705.1"
FT                   /db_xref="HOGENOM:HBG447209"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="UniParc:UPI000199B7E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W4"
FT                   /transl_table=1
FT                   /translation="MDSEFDNPSPLVRRARSRSCTARTSRVDDSNDRTVEPFASTEIFD
FT                   HIKNINDPEHPYSLEQLDVVKEAGLLVEGSRVKVVFTPTVPSCSMVTLIGLSIRLKLSR
FT                   VLPKRFKVDTIVYPGSHTSEMSVNKQLNDKERVAAALENPNLVQKVDLCLSGKTAF"
FT   CDS_pept        393940..395217
FT                   /codon_start=1
FT                   /gene_family="HOG000232521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633949"
FT                   /orf_name="MICPUN_58459"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63324.1"
FT                   /db_xref="HOGENOM:HBG285032"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="UniParc:UPI000199B8A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W5"
FT                   /transl_table=1
FT                   /translation="MASIVNAASAASRVAAPSKATAASNMARASAFHGLRAHKASSVKA
FT                   SARSGAQVVKASADSDAATFGRRDIAKGALAGLSAAAIAAMPAGPAKAEEVSKFWEIVD
FT                   LPLEPGVILLDIAFVPDDPKHGFLLGTRQTILETFDGGKTWDFKSIPAAFDDDVNYRFN
FT                   SVSFNGKEGWIVGKPAILLHTTDGGDTWERVGLSPRLPGAPVLITATGRAGQAEMVTDE
FT                   GAIYLTTDAARNWKAAVEETISATLNRTVSSGVQGASYYTGTLSTIARNNDGDYIGLSS
FT                   RGNFYMTWSPGQAYWQPHNRSSGRRVQSMGWRPDGGIWELTRGGGIFFSNTDGLPENDD
FT                   DFSEGKIGSRGFGLLDLTAKPNGKQFWIVGGSGSVFYSNDAGKSWKRDRGTDNVAGNLY
FT                   NVKFSSDDSGFILGNDGILLRYVGPK"
FT   CDS_pept        join(complement(396806..397097),complement(395488..396659))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633950"
FT                   /orf_name="MICPUN_58460"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="ACO63706.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG561030"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000199B8A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W6"
FT                   /transl_table=1
FT                   /translation="MAERATGLGLVNRRGVAAKEKFGTIVEDAPNINISGSGAGSTPTS
FT                   SGDGSVANGEPGTFGYKIQEFDSASSLGSLADRVAEFVTPERTPEKTPHRAVGLLFWAC
FT                   TAELWRRLLGWYFLPFGLYFASLVHPAFSPSAHRTQRGQHASQVGLVVMIYAFLLSALL
FT                   VYPNYFLFCAHPWIRAVFIGYISWYVFVDYATPESGKRFLPWTRRLPFWNKLADYFPVR
FT                   LHKSCDLDPAGNYLFGYHPHGIIGVGALITFATNATGFEQAFPGLDLRLLTLAINFMFP
FT                   FTREVLMALGINSVTRASVQRNLTRAPGASVAIVVGGAAEALDARPGWAVLTLARRKGF
FT                   VKMALKTGASLVPVFAFGENDIFEQMDNPEGSPLRRFQLWMKQLIGVTPPAFYGRSLSG
FT                   GVLRRMFRSGKGPMPKRESIEVVVGHPIPCPKIAEPTLRQIDEYHALYLSSLKELYDTH
FT                   RRLFHKLKRAGSHDDLHARMSKMKEIKFS"
FT   CDS_pept        join(<397927..398104,398174..>398502)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633951"
FT                   /orf_name="MICPUN_72501"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63325.1"
FT                   /db_xref="HOGENOM:HBG610041"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199B8A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W7"
FT                   /transl_table=1
FT                   /translation="LDLTGIGLTKVPDEVWTLTDLTDLQLSNNKITRIPNDVGNLAELE
FT                   RLGLAGNRLTEIPEAIGRCERLRHLMLAGNRIRELPASLGDCKYLEELSVPGNRLESLP
FT                   ETIGGAYMLRVIDVHGNRIARLPDSIARLKSLEELSAQGNLLTSIPDDVGEMRRLVRLN
FT                   VAENKL"
FT   CDS_pept        398536..399768
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633952"
FT                   /orf_name="MICPUN_108233"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63326.1"
FT                   /db_xref="UniParc:UPI000199B8A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W8"
FT                   /transl_table=1
FT                   /translation="MMTTLWCYGNPDLRSLPMSLAKNVSLRSVWCEGCDALEGDEVRAL
FT                   VEALPTRKGGVGATIGLDLAQCTRAGLKIRPATALDANAPGGLACDHPHVAVSEIPGAD
FT                   TSPDSPDTPPGRYSRGYFKHVRWTEDAHAPVLIVAFGSAPGVPNWGGLLRKLRKDLLAR
FT                   GAACAGGAGADAAAAVEAAAVGFDVLYVADVTRSWYHGEGVGGGNEGNDEAERTWREGI
FT                   GRVAGRYERVLNLGDSMGASAALLFADVADHAMAFCPQVDLVSASIRPGRSARWMRHFR
FT                   ERLVSAVDRAVSGSRRSRVEIHSGTWEHDLAQADFVPDAVGRDRIDAEGLALNVVLHPV
FT                   DNHRLALALEEGDELLPMVRKAYHEQLAAARAGGGGGGDATRAPLSGANEAKGADAISL
FT                   KSFKPGVRLPN"
FT   CDS_pept        399873..400958
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633953"
FT                   /orf_name="MICPUN_50205"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63327.1"
FT                   /db_xref="UniParc:UPI000199B8A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5W9"
FT                   /transl_table=1
FT                   /translation="MLPLLTGTGTPRGTSPRIVTMADDETRRSDFDDLDDAADETASDG
FT                   LLPVGYPVKVTRAGEWLDDWAEILRVNTRPTSDNPTPTYDVLVKPMINVTTVSDEGGES
FT                   VRDGDGNIFRLHSVWYVIRDKPYASEVVELRPDVDPDDAKKVAEYRKRYAQESWYRGAV
FT                   ADEKRRRSSVTVRVLRAGDVDKLASARANDDGDEAKPGGESLGVVDVSTPVDVNLYWMK
FT                   DVLKHMKKFTPTVPKLPAGFGRSGATWFFHTAKSRKAMANNFNDVLLPSIREGLCDDKD
FT                   APLRGGALYLDGKKLAEDPEECGFPGYCHEYQRVCTWAIDEGIPFVFVAAGERYDEEAW
FT                   RGVHHGRRKPARGVGCGCVVS"
FT   CDS_pept        complement(401043..401609)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633954"
FT                   /orf_name="MICPUN_58463"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63707.1"
FT                   /db_xref="UniParc:UPI000199B8AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X0"
FT                   /transl_table=1
FT                   /translation="MASRDVRFVEETLRSWRDGVGSKPAPGEGIRDGGAEDDVASEEAR
FT                   FVPTDEQRAKAAHLANRLDLARCVAGGMKQRVANLARELETQAREHSDAREDLRVARRR
FT                   LHFARNDGRSALAALPIGADAGAAPSVHDSEGRALGAMLTKAARDPDATKALAERLALR
FT                   KTLVTDELLALSALDADARRRQTQV"
FT   CDS_pept        join(<402079..402417,402565..>403035)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633955"
FT                   /orf_name="MICPUN_68304"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63328.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B8AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X1"
FT                   /transl_table=1
FT                   /translation="DPEDVWRQFENLLADGHRPTVKTYTSLLSALGDVGAPEDAEEVLA
FT                   RMRDAGEVPDARAYNAAVHAWCANGKPANAERLVEKMLGDGVAPDAATYPDIVAAYATL
FT                   GDLRRCESILDMERVAERKGRVSRPVTASYGMIIDHYVSVGAMGDARRLLGQMQWDKVA
FT                   PSIEIFNMLLKGYLKSGNVGAAQDVFRELEGSGTWDMDSLGIKPDVTSYTSLMDHWANQ
FT                   GDVDLAEKILAKMELKGVAPDERTFGSLVKAYARGRNPEGAEKVLERM"
FT   CDS_pept        complement(404092..405315)
FT                   /codon_start=1
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633956"
FT                   /gene_name="IDHP"
FT                   /orf_name="MICPUN_97369"
FT                   /product="Isocitrate dehydrogenase (NADP+), bacteria-like
FT                   protein"
FT                   /function="NAD or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63708.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="UniParc:UPI000199B8AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X2"
FT                   /transl_table=1
FT                   /translation="MAAASAGGKIQAAPMVYVAGEEMTRYTMDLILERWIKPHVDTSAW
FT                   EFFDLRAKNRDDTEDQVLRDVISAGARLKAIFKEPTITPTADQVKRLGLKKAWGSPNGA
FT                   MRRGWNGITISRDTIHIDGVELGYKKPVFFERHAVGGEYSAGYKIVGKGKLTTTFVPEA
FT                   GGEPIVVDDRKITDDLNAVVAYHNPLDNVAHLARIFFGRCLDAGIVPYVVTKKTVFKWQ
FT                   EPFWESMKTVFDAEFKQKFYEKGVMKPGSELVHLLSDAATMKLVVWTDGGFGMAAHNYD
FT                   GDVLTDELAQVHKSPGFITSNLVGVDDNGTLIKEFEASHGTVTDMDEARLRGEETSLNP
FT                   LGMVEGLIGAMNHAADVHGGSSGVHPWTGKLRAVIHKLFREGRGTRDLCGAGGLTTEQF
FT                   IDAVAEEL"
FT   CDS_pept        407198..407737
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633957"
FT                   /orf_name="MICPUN_100441"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63329.1"
FT                   /db_xref="UniParc:UPI000199B8AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X3"
FT                   /transl_table=1
FT                   /translation="MTSPPKRPVVTPDGCGPVVSVRGEPVQGKAVPDTSEVLAWVDVKD
FT                   DGDIALSGYDPVSYHAGADHGPLMGKAVHETIIETLLQGRVRYRFASEENLAKFRADYR
FT                   NLKPKYGGFCAAGVGLHDKLASADPLVWDIDPRDGRLLLFCSWEMKAEWEKDADAARQK
FT                   ADERFGGLCAKASQAA"
FT   CDS_pept        complement(407843..408229)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633958"
FT                   /orf_name="MICPUN_58467"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63709.1"
FT                   /db_xref="UniParc:UPI000199B8AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X4"
FT                   /transl_table=1
FT                   /translation="MRYTCRIGRTGASRFGTTVLAAPSARRRRVSREFLCACVGSRAST
FT                   DAVLPRVHRSVGPGSGSLNVWPFKEPDLGWLTSTLRCKCTLQVALKHGVGVVSRSWLDG
FT                   AQPSAAAQTPKRGAYDLLRHGMDT"
FT   CDS_pept        408559..409497
FT                   /codon_start=1
FT                   /gene_family="HOG000265490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633959"
FT                   /orf_name="MICPUN_108234"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63330.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561036"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199B8AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X5"
FT                   /transl_table=1
FT                   /translation="MPKASKKLVAAVASEAGPLGSFVDGLVKHGLTRALGPGDRVPLEI
FT                   FFNYALFSLCICLGIFTASRIISPRLFKGAMSHLKPFEVKIWHTNMVTFLPTFAVTFFA
FT                   LPAILKYSAERYTFIAPASAETLKATGMSLGYMTWDLMVLIFDAKDQMAAYGGVTPYVL
FT                   FLFHHSFSIAAWPYAVSAGRCVYFVNYFLVSEVTNFNMSLRWYLMKTNREGGSLYFWNG
FT                   ILWIPLFFCVRVAVIPNLVDRYLNSDWSALGVNETWAARLLLPVPVMLNLYWFGLIITT
FT                   AVRFLVTGSEGGHVEAAEGARGRAKSRKKAD"
FT   CDS_pept        complement(409599..410666)
FT                   /codon_start=1
FT                   /gene_family="HOG000248787" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633960"
FT                   /orf_name="MICPUN_108235"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63710.1"
FT                   /db_xref="HOGENOM:HBG396855"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000199B8B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X6"
FT                   /transl_table=1
FT                   /translation="MVWGAANPVGKPTEAETPLRSVQIDGQVVMKIVKHCSEQAPTLVT
FT                   GQLLGLDIGATLEVTDCFPFPNQDAAAAEGEEDDGANYQLEMMRCLREINVDNNTVGWY
FT                   QSTYLGSYYTEELIETFLAYQENIKRCVCVVYDPTKSASVGTFGLKALRLTDRFLEIHR
FT                   AGEFTFEKIADKSLSWADIVCEVPIRIANSALLSAMFGELTRSVASEEKHGVTQSDADR
FT                   LAVSSAPFLEKSLEFLSECMDDLAAEQQKVAHYQRFLSKQQSQQAQWLTKRKAENAQRR
FT                   AQGLEPLPEEEDPSNPAHKPSAEPSRLEGFLIANQVNEYCTQIQATATASLRKLTLVAG
FT                   SQGCGDVVPAVDSKA"
FT   CDS_pept        join(411069..411158,411362..414562)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633961"
FT                   /orf_name="MICPUN_100443"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63331.1"
FT                   /db_xref="InterPro:IPR019170"
FT                   /db_xref="UniParc:UPI000199B8B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X7"
FT                   /transl_table=1
FT                   /translation="MESRIAIALIAVALLCGAAPAVAQTKTQITVVGDWAKNTPSSVAA
FT                   NSLCSAGYFFDPAGLECNQCPAGSSVDGFGCACPANTRWVAGTGVAPYGACTACETNTT
FT                   LSWDNSTCMACDASNGASLNAAKTECECLTNAGADDLTKVLVEFDESGARYGAGKRCVA
FT                   CPSPDGSAAGARDVTQNGKCISCERIRKKDGTGWIQMTYDAATKTCSCPSGSDYDCFDL
FT                   AAKKSSLTTAYSTVTFDSTANTLVYSDMGASIQSATVISDWFANNLIEQAHLCNSYGNT
FT                   TACNAVANACVLAMYSSSHAACKLYAGMRDKRTASQYHQSDASTKVNPKLDWSETLPWL
FT                   YYSTGDYASRADVGLTMSFSVPAENEYAVVSNLVFVLSVSTLSGEWLGFRPVGKLLQLC
FT                   GGREDDLQAWARFGTNYFNDCSLPVADALDAARGMGISTAGETLFFDLYLQDLGGVAPT
FT                   ANAWPERLYPVPIKVNNIAENSNAALDDDKFVRRFFVIDETAGVASGTKKAVTYMKNIK
FT                   FTITARSDEKSKIYPPAVSITYASRDPSFAYTVEDGVGFQCEYTVDDSFWTTWDNVFIT
FT                   SMVFSGAYWAYGMMRVSRRRITRDADSSLMMYAVGTGAACVAGGLAVVLIFGGLYWFLF
FT                   FKAQQEVYTVVPMDTDSRVKMFKEVLDAAVGLAAVGMAYTIAWQCNYDIFFLDWEKPRA
FT                   TTTPQGHAVNAPVSAWRKMFIANEWNELQTERLTSRAFTLTLMLLFLLGLDWQNMCVIE
FT                   PTLATDDPKPYQVQSMLLRFALAAILMCVIVLCQVVYKIVWHHNYVEHPIQQFVDLLTM
FT                   ANMSIILLDDECSGYYLHGRSLMTFSDTSMQELMAQMRREEEMQVSARGLVPSAARAEL
FT                   AENQVFELYITKELRMAYESKLLRRIQESAAMQGGGMMGAAGALTSRGGRPRGGGMAGS
FT                   MGRNEYGRGGGWGGMGGGGMGGGMMGGGGSTLASDQTLAAAEEIGDIFKQLINFTEANA
FT                   SSFVLERPFFDRILNMPPESVSMMQGASPVFYHDFQMNFQKVMFYGIEFQLMIFDLLVF
FT                   TALDKEFNSFAIAAFLTWLVGIFVDHFRQSFGETNISRKSLIDGRFLI"
FT   CDS_pept        414733..417531
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633962"
FT                   /orf_name="MICPUN_58471"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63332.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199B8B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X8"
FT                   /transl_table=1
FT                   /translation="MARASFFLHRTDQESIRRRQLKNGVTLLLILLVDCACACVLYFTR
FT                   EKRLGEIWSELANLTSADTFKDGTGDLLALFAARLVLLTCAGTAAVYLGRQRNKGPPPP
FT                   PRSARASNLSSRDASQADLTLRAPLLAPEDHDEDEEDDRVCPAVHDASPAGVTVDDAPN
FT                   DPGAFDPNDFAPTEEDQFHNQRAIRRRDVIVESTFLLCIAMQAYVAVKSVSFYYAEGKT
FT                   ARTVLLLAASIVAINAESVYLRSYVAACTVRTGVLRRDFHAHELQFHDRVVGHVCDMCG
FT                   LRLIAGSKGLRFGGFRCKTCDFDCCMRCFCRKDRATAEGGIRGDKGTKAENERTPAEYL
FT                   WRVMALAKLEWQLIAMAICTTLVTSAAALFVPHFQGAAIDAAIAVDKEQFNRTALMLLI
FT                   SSAGVSLFSAFKGVCFSLVGRRLAYKVRTGLLKNILSQDIAYFDGVNTGDLLSRLSYDC
FT                   ANLTAPCNTVLSLAAQNLVVICGGLTMCFWVSWRLAMVSFAVVMPITFLIKRYARWSQS
FT                   LNREISAMLGLASNAANEALGNIRTVRAVSTEDVEFKRYEEHARAALNAGIKDAFGGAL
FT                   TVALTNLLELGTAVLILWLGGGMTMERPNPRLTIGSLITFQLYFNSVTSSYTALSNCLT
FT                   TLVRAAGSASRVFQLQDNLPDISPNAGETFRPEASRATAGPEIRFEKVKFWYQMRPNTM
FT                   VIDDMDMVVAAGSTAALVGKSGGGKTTVVSLLLRYYDVKSGAILLDGKDVRSLNLASTH
FT                   RHIGLVAQDMQMFNHSIGGNIGYGLDPETEATREKVEAAAKAANAHDFIMTFPDGYETR
FT                   LGERGVRLSGGQRQRLAIARVFLRNPTLLLLDEATSALDLESEAAVQEALDRLIATGGH
FT                   TAVVVAHRLSTVRHATNINVISAGKVCESGTHEELVGKEGGVYAGLLALQQRKKEETIA
FT                   EN"
FT   CDS_pept        complement(417665..418252)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633963"
FT                   /orf_name="MICPUN_58472"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63711.1"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniParc:UPI000199B8B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5X9"
FT                   /transl_table=1
FT                   /translation="MSRDDDNASKIAEKLLQGWTMLAEYCPADGCMTPLMRGRDGRRFC
FT                   VAHDMFVMSSEEAEEMKRKGGGVGGGDAPGAKASPSSSAPAPSGSKPSSLDRIDFYSQL
FT                   RAGRSPAPDPEPLARGYGDDGAAPMTLDRDGGGGGDDLEIGAIARSTRATVAAKMEEAR
FT                   AALARSESFSESAELLRFIRECLETARACDGI"
FT   CDS_pept        complement(418706..422413)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633964"
FT                   /orf_name="MICPUN_58473"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63712.1"
FT                   /db_xref="UniParc:UPI000199AD67"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y0"
FT                   /transl_table=1
FT                   /translation="MPSTRAWLALTAALVLAAPLGALADPQRQPPAAPRSSFTNFDILK
FT                   QLVKDHHAQTGKTVQARRGAGVVSRLGSFLDANAVGRRRRLLGGAPPDAAAQAASSPQP
FT                   PPSPPPPSPPPRGTPLLDQLAQLLDRNASAPIFPQAGPGLGLDTLLNPPNLTALLAPLS
FT                   AQGGLLQPFSGPPQLPDGPIREQLAALLGNLTDPSVFPQAGPGLDALLTPPNWTDILGP
FT                   LAATTPIRPFSGLPQLPEGPIGEQLAALLGNLTNPSVFPQSGPNPPLGGGGLLNPPNWT
FT                   ELANLIVQPFAGPNPTGLIGSPPNWTQILEPFRGAGSTIPDGGGGGAMDGAIRNQLLAL
FT                   LGNALAGGGGDAGVFPMIGGGDAGVFPMSAGNWLQLVTAAATGNSQQLFSTLAGNAVRN
FT                   QLLGLLGGALGGDGAGAGGGVFAQSGPGSSIFPSTDAGSLLDVWGSLSDGLGGGDASGI
FT                   ANVLPLLVAAVAGATGGDGAVLAQSGDGAAPPPAWLNSDWTLNLPQWPAPADADSGDGL
FT                   RERLASLFTPDEDAGAPAFGSPLFDGSLFAQSGEGDRAPPAWLDPDWSLLGSPAASPGT
FT                   ALAADAFLTQLLDYYSGAANGGGVAAQSGEEGALAPPPFDATRPAGGDGWFVSDWTLLG
FT                   RLAALANENEASGGSAEEAAGEASGGALRSYLAGLWEDTWFSQILTSVMRRRADAQQPP
FT                   SPPPSLSGGAPSPPGPSPRGPVAAVPTYPPSYPEGPPRPPFPDSATTASFGGPPSGSVG
FT                   SHIDSIVANLRNPDGSIDPATVSDVAAVLATLAGVNLTDADFDNAVAIAVAAGLAGMRE
FT                   GSDHQTGSNDANDHHHHEHREGHFNATGGVQRYRDMFGTALRAAGDFVEESFASANSGA
FT                   DADGSVGGKDSAEVESLVAAAIKVAEENAAHFIDLGVGAEGAEGAEGAEGADSGEAVDV
FT                   DTAIELLDRVQGVLAAARGDFHAALDQSQQGAGVKAPGAPDGYLTAAQLLTLMGGMGPR
FT                   GGGGLASGLPVDENVGDPTVPGTKFPFNATDNTEELGNIADKVAEDPLGYLNGLIDDLI
FT                   NPNRDGADGGGDAMVGAQSGPDDDAVRTDPPAVDVSDTVSDTVSDDGSPAAKFFEKTET
FT                   QVAIPVAAVVLAGGIFAAYTSGLSGRLFGRGASGAEGSGNAGNGRMFDAAGEADGATGA
FT                   STAVSAGGGRIVRRTSTSTKIEMSGSTASSNGGGGGGLASVRRGFRDLTSRAGRSAAEA
FT                   RPIRGEKGAA"
FT   CDS_pept        join(423055..423953,424263..424512)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633965"
FT                   /orf_name="MICPUN_82249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63333.1"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniParc:UPI000199AD68"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y1"
FT                   /transl_table=1
FT                   /translation="MFRNGLLHTGRSDHKGPSVTVAGVPRVGWTYKTGGRIFSSPTLAS
FT                   DGTVYVGCTDGFVYGVQRSGVIKWKYPAGGPVVSTAAIGNPIGSDTTLFMGGADGTLHA
FT                   VSANYGTSKWEYIRPRLHLNGKWQLKATRPIVSSAALAPEGIVYIGADTALYAINAATG
FT                   SGGFSGTVKWSYETRGLILGSPALDGAGRIYVGTMEGALYCLRQDDGGFIWRFDAEGGL
FT                   YSSPALDGGGRVYVGSVDSYLYALDALTGALHWKFRTSAAIYSSPAASVRDGTGRGYVF
FT                   VGSTDWKLYAVRANDGLLASAVGVVSSPVIGPDGVVYVGSSDRYFYALNNLTGAVEWKL
FT                   YADGPIQSSAAIDSDGQLYFATDAGTIYQVVEAVPPPPPGQK"
FT   CDS_pept        join(425116..425394,425508..433259)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633966"
FT                   /orf_name="MICPUN_58476"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63334.1"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199AD69"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y2"
FT                   /transl_table=1
FT                   /translation="MGTSPVSRCVLLGRAGRAVRVAALTFAILASRFVAGEGARLDGSM
FT                   AFTVVEVEMPETLDKHWEFSIKGGAAGDQYVANTKVFKADEGVRRGDKIKLSINVPSGE
FT                   YHLVLRNTKPSDDDSHRECDKADGFGPIRYRILDTRSENFWATNFTSVASVGKSFVPAS
FT                   PAGAVACQCTCANDVRFHTFFATRVGAALNSQAYVDPTLRDGETADAGYKNLNRNAYML
FT                   FQSFTFDVDADAGDGTYLQVILRDDDDVDELEPFAGDDPSRLAQRRTLVHAQAYDEWAG
FT                   NGGTIGTALRSAATDGDGVVEDARTAGALTHGLPLGVRPDSNAWGGDQGYDHNYVPGFH
FT                   FESTETVTPGRYVVSVFRTCSNGPGHCDETARDDAGKSFQFKITAQVIRRSSFQWEVVD
FT                   SRDSNNFASGYERDNHRRGSGTTVVTVADRYICMFGGPTDDAATGADFAVYDTVEDKTT
FT                   KPAGFSYLHVAFAVAVEDKSFVPSGNLVGAFIMTHAYHHGSNDSLQPYAVRRVTISHAT
FT                   GSDPGVAVTEIYPAVAVAGMPARFGSAGVWYDDKILVHGGFHVDGAHALVATSCVENPT
FT                   DAVWAFDMNTFQWSKFAGPTRPNGDGTFCASDPGTGRGRHAAAVLNADRAPSTVDGTAP
FT                   PDPTLRISGGYAKISDGVPAHTSDPSHISSDQWSLNLVTKAWTKLSDPEHSGPSARDSA
FT                   IARADHSLIVLGESTVVMTGGQCRTTERCKENFVLAQPLGPDPTSQILTNVTLGVYPVT
FT                   YMHNAKPKMTNKAVMAGAYVYLLSFGDYESYGQNTDGAAVGYIWRYKLVSHVKNAAPAV
FT                   DNAEAGRGSQAAPYRTLKYAINRGQAPVVVLMTGSHEGVGNANVVVAGPSMGKAPVNDG
FT                   YGSPCHLAVATTLPFALTPSSNSALETDGRQKRQTCVGPLIIAGQNNAHLDGTRVSNDA
FT                   ADVNVVAAALGPVEKCQRKCAELEHCCNSSPYEGTNEYPSCLQACVLVYDGGWAEDQCT
FT                   SYCQEDRDYDKVFYRRRLFSHDSTYCSRGSGTYQFSFCDYYCSDLPQSQYGYDAQSGSK
FT                   RYMEAPYTCSTQLGTDERTCADGCVAGASLRTAPAPPSPASGGEVLVHSPGLVVTGGVN
FT                   LVLHGFTVKDVVAKHGAAVYVDKLDFSWSNVYVERMSFANAYATYDGGALYLARDSSIV
FT                   ATKLSGCGAGNRGGCVFARNHATWLNVNGVTVDAKGALESAPTETLRSLVAAAGIRVLD
FT                   ETTARGGIVYSTSRLRVTRSTLANAGAVKGACVYVVGYGSQPSYLTDVTFEKCAGTKGK
FT                   SFGGAVYAQENDLISSAAEWTNRGLHLVRCVVRDCSAHSGAGVYAARGSLWIRDGTSFE
FT                   RNAAAFEGGGVTVLTGTLYIADSSFVRSAAARDGGGVSATSASLRVIDSRFEGSASLRG
FT                   GAIRARDCRDATGNNAVTLTNVTVAGSQSKVSGAIHVSDVDLAMSSCVVTDNSAGSRGG
FT                   GVHVDGISSSTFQNCEFTNNTAVDGGALVVAGGEASLFHTTFERNVAERNGGAVYAEAT
FT                   RSVDFVSATIKNNAARMGKGGGVFVAGGGRESEMNGARPRIDFRKSILRENVAVNGGGL
FT                   AEGCDVDTTFADGVARCPRISLGSGSTVRNNSASDAGGGVYFAALDSPPVFDADSANVG
FT                   NALTGAAGYGSQRGSIPAKIVIFPDAKDLSSGTVTTDTISISLVDADGQVVSSGALAES
FT                   LVVATYPRGISMNSGSQVRLKLGKAETKLGVIGEEQTVRIAYRAVATGDVPVPPAEFRV
FT                   TIGACRIGDYFDGVACRSCGAGHYIPSDVKNVTAGQPGYDASCFPCLAGHYSLVANATE
FT                   CEACPAGTASGVVAANAVSTCVACAEDTISGAGAGACVACGFGQMSNHGNTACVLSSSM
FT                   LISIVTVLVAMFVGTAALAQATFKFGNSKVSRLMELAIGGGKTDAEDDAADEDAAIKSM
FT                   NAILMESRVTSSASGAVESAAKNAVAAASALTGLNREALALAVAPVVARRRRSVEAAIN
FT                   ATVEAGSAGGADIVAEEADAIATATKEAIAAVCDAVLAECDARAASNIDAAAEAAVGAA
FT                   AGTLRARVDAANAVDHRAVDALCAAAELEAREAVQEAAALGRKAGVGTEEDRAAHLDEV
FT                   QKVLDAVDTVARRRADATRSREKRRGGRPLPELHTKESNAETEELFAEAFAYVAELEDA
FT                   ADGHLGGEVAFKPTGVPALAAAKARLSATIADAASRCRTGVEDRRGSRQAQAAAGEPVT
FT                   DPVGVVSSAGVLDAVSTQSAHAAESNVLLAVVAGPPGDPPPHLAALVEAEAVADAAMAT
FT                   AALHAAKFAASAYDPQGLDPFESARYAGELAKVTDPMRVAIKNLSERRHDDVVARLRRA
FT                   MADAAGDASGNAEDAGSNPDKADDAAAVDAAARSLNDELGALAGMIHGGEVDGIPPEDM
FT                   SAEAFESLRDSMDRLADDLQNAADKGASTLAARLARRRAKGDKESRMHGTVADEVAAAV
FT                   AGGETDPDVHAAAADVLEAGLDEDGAAPAPRVDAESVDAAVAPPAPDFKEQRGSLDEAR
FT                   AALQRQLDRSTNRHGAALQERLARKKARREAGGGGGLGFFGGIRENLRQRAMAAAMVAQ
FT                   TEVMVAVAKEAQAAVAGDEPADEKAKERAKALDEKLVKDMMEEHAVKLREMHAKVTDTQ
FT                   SAATSKLQQRLAQRKGGGKVAPAPMEGVTVDVFPK"
FT   CDS_pept        join(complement(441092..441167),complement(440833..440912),
FT                   complement(433329..440693))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633967"
FT                   /orf_name="MICPUN_58477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63713.1"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="UniParc:UPI000199AD6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y3"
FT                   /transl_table=1
FT                   /translation="MNGRWARPALAALAFLALFAGTALADSTEPLFHSGYPTTSSVTGS
FT                   QFDLEVKLNEGGTVYYYVVRSATAATPTASQVEALYNSYVVDGASYTVHKNGTIAVTAD
FT                   TAASVTLTGYDDNEALSVFLVAKDSNGNLQTLTTELDLVMGDDNPPTYASGYPYADSID
FT                   ADSFHFSVVLNEAGTVHFAVLPKGTTAPTTVAEITGCTVTGAVACSPGGGVYVPARPYY
FT                   LSSSLYHVSFNLRSVADLSTCTSAWNNNAASTTNTSLPQACPKLAAAGATEYDVWYIAE
FT                   DDNAQAGYGRSNNVQPASDISSQKLEVTTADVAPPTPASGFPKAKNVAATSAQLSMNMD
FT                   EPGKAWYLIVPNASAAPTAAQVVDQVSVYGGVTVVKKGSWTVPTADTDADVSLTGLDDE
FT                   TAYSAYVVVQDEGDADTATNKYASNSPVAETSATRVQFTTLDGSPPVFEGGPALPAVSD
FT                   VDSTSFSLDVQLDEVGKAYYLVVKRTTDSEPTPPTPAQVLAGSFSGTVACGHVDVSAGK
FT                   TTASKIIADTANKLTVSACQDPGDSSQLALPGEGTGGSTTGSCSSCPTILPDQRYWVYV
FT                   VGQDDDLNNMTSTRTIVVRTTDETPPTFKDHSSKTTPYLSGNEPSAGTPGKSNDGVTLS
FT                   VTLALSEPGTAYFMVVEASKTAPTPAQIRYCGDASIGTAFGTRPPWNTYTPSDSTTNTA
FT                   FVCGARNVPEKDTGYEMELSGIPSETSVKVYVAAEDFEKYRPSHPALKINPPVSNLQTA
FT                   ATAIGPVTTADIDPPTWQAVGGVQYPRVPYTEDTDITDDDAKISVALDEPGYVYYVVVP
FT                   KDYTYNAQFTDGSARSTPTVAEVMAGTGPGGGGNVTAGTQDVAAGGTVVNITTASAALT
FT                   NETAYDVYLVAEDKATVDGVDLRNKQTTVVKLTFATRDVTAPKFATGYPKVDTEPEKLE
FT                   VTAKLDEAGHVYFVVIADGDTAPTVDEVIAGVDYGGVTVVKKCGQATVNVSSFDAPEPA
FT                   NEYKCEVSGLSQETDYDVYVVAVDNVDDDKDSGDAFPDANKQAAVTKLDATTKDATPPV
FT                   WTASYPGIEDLTGDTFNLTLNLDEIGVAYYTVDAYDKTSPDVEDVRNGVDVYGGAVFAK
FT                   GTANVSAANTKIEHVVTGTFVSETDYYVYVTAADDEPVPNKQTALQKIHIRTPDVTPPE
FT                   FVGEWTSAGTIVDVDGTSFKLVVQLNEPGTVYYHVVPKGETPASASSARSLAVSGGSTS
FT                   SFNPKACGSFAVASANTNVTHAVTTNTTSGCASSTDCKVCPKLTSETEYDVWIVAEDDG
FT                   GHGIPLAATTDAKNLQAEVTLVKAKHPNTEYDNSGVNFSFATADVTAPSFTNSTPGYTH
FT                   VSGEGFDLQLQINEAGKVWYALVNSTCATAPTAEKIRAGTDGCDSKTGVAAYGSVDLAK
FT                   DTFTLFTIDSIGLESRQEDSYATYVYAEDDEPTGFTSATTPNRGAVQKYTTDPSTADIL
FT                   PPLFNELYANESESRTGFGALKTTFNISVEMDEPGQVYYVAFPAWHAEAAHASKNMPGK
FT                   QAPTAAQVKAGKDHAGAAAEVSGTFAVTAGGVLTKSTTDDPLTDGIVYDVYVVAEDDAG
FT                   DDTRAHKPGLAAVDNLQAAPTKVQVTTADGTAPLFSGNPCDSKKHEVCTSILHSEEYRH
FT                   SKYPTMSDCAADKFTLTVAVDEPGSKVHYMAVADATDYSSANAAPVTDPTLEQIKAGVD
FT                   YTDVRTSASVTKLAAGSITATLAGTEYDVDVTFTAPSTGYYSVFVATEGPNGNLGDGDV
FT                   RRTARVQPTKLAPCFVSNLGGVSVTTETVRWTATDDSLVAKMHLTSPAVVSYVLLRKGS
FT                   PAPSPTQILNGKDSAGNSPACYDYVNLAAPRNNVRCFFADNSKTDTAGSTDCTADGYGT
FT                   TTDDTTACTIATFANLSNAVEYDFYAVATHVNGTVKSDETGPDSTTGTPIYYGEFTRVP
FT                   VKSTGRTTDSVPPFFKSSFPKVKAIKGNEAVLEVRLNEPGTVYWVVDENTAADPTPAQV
FT                   KAGTDSNDNATALIAKGSIAMPTVISKTPNYAPYNVTITGLKPKSMYNVHIIAEDDDSG
FT                   DYGGNLQTAITTVAFTSASTDAHLGGLVARVVNGGDSANLGLVPPFKQSITYYAVFVNV
FT                   TTSTVQLTPISNDTESIGKIKVNGTARASQSEFAVTVPHGKTIYEFEVTAGDGVTKKIY
FT                   HLGITRAVDSTVTNSSLVLLQVKYDDDTIVNSTQMGGRTWPKCVKGCDSNAPARCSSAN
FT                   PQCVMDSRLTRYSVRIPNRVQSITVEAETAESGASVMMYTQGSTGVDYPGGLPGYTTGK
FT                   SLSSHPKIDLSALSARGGSEFHLVVTAADGVTKTTYVVAIERYGPGVYTGWKPVVPTTA
FT                   MRGDRYGELYGADDPLTTRVGVDPSVRDLNVIPAIDIVPPRWVSSYPRTYQGSASTELD
FT                   LVVQLDEPGVVYYLILPDTARAPTAREVKEGTSLRGDAVKAGNVTSLRSLTQETTASVG
FT                   GLTASTAYDVWFVAEDDAKDLQLAPKPNLQVSPVKVDFSTAS"
FT   CDS_pept        complement(441572..442933)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633968"
FT                   /orf_name="MICPUN_100449"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO63714.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199AE26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y4"
FT                   /transl_table=1
FT                   /translation="MGSRSIRLIGALCILLTIPPVGARAPTILPDADGRTPLDAPTDGR
FT                   ACHGPHIELGVGVGCDFSGFFTEALGLHVALAARGTCVRTPTLSRCEPALRGLLTPHER
FT                   EAASTAGRFQDDASQPDVDVRWHNGEDAPCPWERDSVREAEARGTLAVLRSMTEKVVLS
FT                   DTLRRCCALVHETWVPTEWHRKLYRREGCPNARALPEAVDDRIFRGKIPGDGDSVRSDS
FT                   GADSGASLRDSKKTVFLSVFQWQHRKGPDALLKAYWNAFDAKDDVVLRIRAKVPGWAHN
FT                   PFRTANDGVKHWARALWNTSPGKLAAVEVIEVKDGEDVTREQMASMYRSAHAFVLPSRG
FT                   EGWCLPCAEAMASGTLLIASDFSGTTAFADSTNSLPVQCVVINAQKGCEPDVEGLAWRL
FT                   RWTHDHRAEAAALGTKGADDIRVKFGMSAVATLWAEEGRRGLGRFDARRLVDVD"
FT   CDS_pept        443102..443587
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633969"
FT                   /orf_name="MICPUN_58479"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63335.1"
FT                   /db_xref="UniParc:UPI000199AE27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y5"
FT                   /transl_table=1
FT                   /translation="MAVDLFKIGLYLNALEAVFAIQFWAVAVPQLSFIPLIPPVTDLTW
FT                   LPSVASSDGGRALIAWYGAVHFGNGLASILILKNEGGKAPKWYALSFGLAQLLIAVFCA
FT                   IEPMKNATGVFPIGSLFHGAAGVALLSPIWRPLLDKATGAPVKTRSGRKSRTPKRYQ"
FT   CDS_pept        complement(<443899..>444292)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633970"
FT                   /orf_name="MICPUN_58480"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63715.1"
FT                   /db_xref="UniParc:UPI000199AE28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y6"
FT                   /transl_table=1
FT                   /translation="GSDSGGHQAEEAGRAGCSGGRHAPERGGCPGRAGARRGHAGAARG
FT                   RNRVADGAQGQGAPRSHRARQAGKGAGAREHAPPGGAEGPARRQGHGGRADRHAREDQR
FT                   GIGRGWRPGRPQDRDATQECHGRRRLV"
FT   CDS_pept        join(444600..444719,444863..444940,445224..445718)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633971"
FT                   /orf_name="MICPUN_58481"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63336.1"
FT                   /db_xref="UniParc:UPI000199AE29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y7"
FT                   /transl_table=1
FT                   /translation="MSALAYLRSQAAEARASGEKPYSLFMVSPERVLGMKRAAEPFRSV
FT                   EDGGDAETYRYAKTPRTAVKTESRYNLRSKTPTTMMKSMNKLGLYVPPAMRNPKDPETD
FT                   GTVQKTEGRKVGFAIPAPRVEVYKSSNRENHPPGFGPSSNNVEGAPSAKELPTPKPAPL
FT                   AAICRNAAVASRKRSSTADVGGKPGVNSSEAGGGARRGSRSRGGRGRSGSSTRTVTVVI
FT                   PKASAGPR"
FT   CDS_pept        complement(445895..448279)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634400"
FT                   /orf_name="MICPUN_100451"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63716.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199AE2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y8"
FT                   /transl_table=1
FT                   /translation="MYGWERRGGDLPNRHAESITRDDVLAHLARTRDVLTGARARKDAD
FT                   DRDGAVRADDTEATGALAAPELEETLDTSAYSTWTDAKAHAAESYARGDFVAAAGLFAV
FT                   AAAMIDPTTSGEDDAGGVNSAALQSNRSCALLAAGRPEDALLAADACVATRPEWPKARY
FT                   RRAEALFALRRFRECADDLALATKLSGDSPDPVLAKRAADCDAALAQLAVLDEMETEQV
FT                   KEKEEEDAKARNEEQAERDRQLAELTAAAEDRERDPAVKALFQRLEKTFEEAKKAGSET
FT                   GPDPFECEHLLNKILTLEPDFTACSFQLALIQRRLGRHAAAIETMRSCLHTAAGFMTGY
FT                   SQFGQMLEHIHGKECRGFQEAELLYANVAQRYFDHPDAWIGLSTLLMRLGRVNDAIAVL
FT                   RAAMVGGPEGKFVKPRQDGVVLMTLAFAQHMRGHSAEPTSLYMLSVTAGGGSAAMFLLR
FT                   RIFEDCGDDENADTYADALTQMKKDAPQELWRAFEAINWMFAAPHWVTVLGKLGLAERM
FT                   RASGLEGRIVPPAYDVYERKDSDDPPIDFVPGDYIAKGKNRVYEGTHPDAPRVRRCERI
FT                   EDVQAFLGDDAECLLAQRCVSDPATLEGGRKYSLHFYVVVFGVEPKPKNEWDETGPHVV
FT                   VNAKVTKGFRLCVAPGRYVEGGEDDDAHLTNRGARGDSGAVDSAEIDDVAAFGARAGID
FT                   WEAEAWPAITNALRETLIALCAGMVGDGDAVGDFSMAAHQSMRIPKIVEAAFVLDASGA
FT                   PWLVDLCQPECSNPRAKTLHAAVEEAMGCAGERESALESLF"
FT   CDS_pept        448462..449205
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634401"
FT                   /orf_name="MICPUN_58483"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63337.1"
FT                   /db_xref="UniParc:UPI000199AE2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Y9"
FT                   /transl_table=1
FT                   /translation="MVELRLKGGGEVPIADGDTVAVGVVDIAGAGVRAMLAMRPPGAAA
FT                   LELELVGIPASADREGAAGPTFGDDVAGICLVQPAPGVSLIAVNRPLSAAEEAPFAHAL
FT                   ASLVTERRAPLCIVAGALRLNVGGEGVVFQHAINGAAPLDLGANGGDGVHRLPGNLPIP
FT                   DGSIAACVHSLRHAGVPTVCALTHGYRVAKLGSEAETDAAAAAARLGTAVAKGLGCARD
FT                   GRADLAANYVWQPDEVAAKADQMYN"
FT   CDS_pept        complement(449272..450336)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634402"
FT                   /orf_name="MICPUN_58484"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63717.1"
FT                   /db_xref="UniParc:UPI000199AE2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z0"
FT                   /transl_table=1
FT                   /translation="MSSLRISSGTDAGPSPNGGHVFDELLDDPPRPFDHDLREAEATSL
FT                   QALLDRFEELLRRDGGEGDEDDDGGERRREETERDPSRRPRRVRSDRQNDMVPVAELAR
FT                   TWRRVGFVPAPGSRRRASTTPSIGVQWVPAPPETRAGQPRRRDPHAAAADDDDDDDDEP
FT                   ASSSSPWIEAMRGAAGEWWCDAEKAPGFFTVTGRGYGETRIDARGRGRSTNDDEGGEED
FT                   GDASGEDETDETIEDTFAVAHSCVATDEDDESDARRWRLGVPCLDPETVIALDLAFARG
FT                   EVRAGEVEPPPVWVAGAVGSGGDDDDDLELSALWGTAPGRGGWSEGSEWSEAGSEEREA
FT                   YELREGASDLERTP"
FT   CDS_pept        complement(450614..452005)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634403"
FT                   /orf_name="MICPUN_58485"
FT                   /product="Predicted protein"
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="ACO63718.1"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniParc:UPI000199AE2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z1"
FT                   /transl_table=1
FT                   /translation="MEPVAVPAGEGDLAVAAKFALESINGAGAESSAAAERNGDRSESS
FT                   SAGSSSSEDDDDDGSDDDDGEAVRPSTEGAEYEFSDGEDADGANRVKPTNYPAIIRDGD
FT                   DSSEWSDSSDEDVEELDMANMPRWLEDIKNGVDRDLDDDACHAEPPRTKNEIPEEQLPA
FT                   PPPPPPIGADEAIVPIGDVISVVGDTVVVQSLPNTPPLDEESILCLDTRRGLGAVEEVF
FT                   GPVASPLYALRVPKSRGGGSAEGGGGAEGAAEGAAEGVEVAIASDVNVGARVYVVEGRS
FT                   RVIETKGLYTKGYDNSGQNDEEVDDDDDYSDDEKEAEAKKKRKQKKRGADGVGKAGGAV
FT                   RDGGLAAAAAAAGTGTGTGAHHHHRHRFQPKVPPAAQLAHMGIVGHQHQHQHQPGFAPQ
FT                   QPPMMMQTPAGMVPVMHQPGGYVQTPQGLVQMVPMMVQPPQPPRAQGQSYYQAPGQTNP
FT                   PPPPQ"
FT   CDS_pept        join(452582..452692,452824..455934)
FT                   /codon_start=1
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634404"
FT                   /gene_name="XPO1"
FT                   /orf_name="MICPUN_106897"
FT                   /product="Exportin1 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="ACO63338.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG315058"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AE2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z2"
FT                   /transl_table=1
FT                   /translation="MAFAGAEKLLDFNQPFDVPLLDQIVNAFYAPGGDPSVRAEAEKIM
FT                   TGLQENEMMWTRADAILEQSQNPNTKFFALQVLDAVIKYRWNALPDDQREGIKNFISNL
FT                   IIKLSTDDASFRGQRAFISKINSVLVQILKHDWPARWASFIPDLVGAAKQSESLCENCM
FT                   NILKLLSEEVFDFSRGELTQAKIMELKNALNTDFPQIHELCEFVLQHSQRPALIQQTLQ
FT                   TLHAFLSWIPLGYIFESTLLDTLLKLSPNPQFRNVAIQCLGEIGGLAVDQKYDSHFVKL
FT                   YVTVIEQLQQILPRSVKIAEAYANGSDDEQAYIQNLAIFLTQYFKHHIGLLEKTPEYQA
FT                   HLLIGLEYLLNISYTDEPEVFKVCLDYWHVLVCDLYQSDGDAAGGGGMAEFSFAPAGAA
FT                   NGAGANRRMLYSGSMSQLRMLMVSRMAKPEEVLIVEDENGNIVRETLKDNDVLVQYKIM
FT                   RETLIYLAHLDHKDTETQMLDKLANQLNGKEYSWNVLNTLCWAIGSISGSMAEDQENRF
FT                   LVTAIRDLLNLCEITRGKDHKAVIASNIMYVVGQYPRFLRLHWKFLKTVVNKLFEFMHE
FT                   THPGVQDMACDTFLKISIKCKRKFVIMQVGEHEPFVNELLRSLPDTIRDLEPHQIHTFY
FT                   EAVGHMISSEVNPATREEYVQRLMDPPNGTWNQIMAQAKAQGAECLKPQEVIRNIANIL
FT                   KTNTSACTSLGQPFQNQMSNIYADVLNVYKLYSELISASIAEGGPYASRSSLVKAMRTV
FT                   KREVLRLIETFVERCEDPHLVAQQLVPQMMDPVLGDYARNVPDARDAEVLSLFAAIINK
FT                   VEGAMIDEVPKIFEACFECTLTMITANFEDYPDHRLKFFSLLRAITNHCFRALFALQPA
FT                   QLKLVVDSIVWAFRHTERNIAETGLNLLLEMTKYFQVSEFCNQFHQSFYLSLVQEIFAV
FT                   MTDGFHKPGFKLHALLLQNLFCIAESDQLSAPLWDVNTLGPGAYPNNAAFVKEHVSKLL
FT                   SASFPNMGPAEVQVLIQGMFDYKADLTMFKNHLRDFLVQTKQFKSSDNSAMFAEEQAAR
FT                   QAAERARIDAVPGMIPANQVDMGDD"
FT   CDS_pept        complement(456075..457550)
FT                   /codon_start=1
FT                   /gene_family="HOG000260001" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634405"
FT                   /orf_name="MICPUN_58487"
FT                   /product="Predicted protein"
FT                   /function="selenium binding"
FT                   /biological_process="selenium compound metabolic process "
FT                   /protein_id="ACO63719.1"
FT                   /db_xref="GO:0001887"
FT                   /db_xref="GO:0008430"
FT                   /db_xref="HOGENOM:HBG452364"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="UniParc:UPI000199AE2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z3"
FT                   /transl_table=1
FT                   /translation="MITTIAASLLSLSCSKVGGRVRISARASSRSATRPPSAPFAFLPR
FT                   VAAAASLSACASPAFARVSRVHRAPPLAPPAGRGGFSAMGAVSSKDDHGDSTDANGGGR
FT                   GSQGREYVEMGPRIMKVFPDEPGFDPRRDWDIVCDVRSPAEWEDDHVPGSVSTPVLDNE
FT                   ERARVGTIYKQESPFLAKKLGASLVAKNLGKILDEHFQDKEKDTRVLVYCWRGGERSMS
FT                   LAHVLSRVGFKVGLIPGGYKRYRAGVLEFLRTMDGFRYHLIAGKTGCAKGKMLDQLKAQ
FT                   GAQVLDLEAMAQHRGSVLGEDPAWDNRQPSQKFFDTRIWEQARTFDRSRPIFVEGESSM
FT                   IGRLQIPKNTWAGMRKGSVTLLEVPMESRVRWIRGGYKHFETTDVSRLVEKLQKLVPKC
FT                   GKKKVAEWEEMIASERWDEFVEDILLNHYDSAYADAAKRSGRDDENAEFLMLPNTEDET
FT                   YARAAAELIAKHDVSAPPPIVVEREAEKEEVAA"
FT   CDS_pept        join(complement(458980..459258),complement(457863..458828))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634406"
FT                   /orf_name="MICPUN_58488"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63720.1"
FT                   /db_xref="UniParc:UPI000199AE30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z4"
FT                   /transl_table=1
FT                   /translation="MASGRPKRRAAQPPPIEPDIEGRDAATGSCHCCGGMLRRHPESAK
FT                   QCGKCGARYHTYDCGNRRSEAGFTNFDQCPRVGVLPSSILHASTRPGPCAEVCLCTGGP
FT                   VVCHTRALRDSRRVKRQNSSTGLPMGGGEEDFDSATPTDERTSAEDSATIQQRDSPTIL
FT                   RIDDPDAAGDVDGLDNDDSMVDDPAAPGGSGQTRHHRERLPAGLRAEIEALRAENEQLR
FT                   RRLAMGGSTSVPVSMMLEPRPVDAMMHDGERRANSPTVGAVKVFFPEEEPEPEPDREPF
FT                   NCFNASRTMYIGDAWSAEIVQAYRERLALKGGSDAGPLTEQADKRKIFWRNVLFSVRMV
FT                   VLLSFLFWSIAWHIESAALHGAEWHYTFFAVLYVFVTVWAYQGYRNLLAYGRMVVADLR
FT                   RKREKAGVAAASGRV"
FT   CDS_pept        459484..461139
FT                   /codon_start=1
FT                   /gene_family="HOG000265520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634407"
FT                   /orf_name="MICPUN_58489"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63339.1"
FT                   /db_xref="HOGENOM:HBG607957"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniParc:UPI000199AE31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z5"
FT                   /transl_table=1
FT                   /translation="MADGGRPITAADLGALFSDRCLVNADEPRTDAPGDDALLDTTGSS
FT                   IVRSDERIDGPPRYGRRLADAWRPANDAYFGGGGAFPEIHVVQFPAAIGWDARCDEDAA
FT                   RKSRGRGVCSSQGTSQAVPPSPAALDVDFDQLQTIAARMMLRLGPDPNDPTHAPHAANM
FT                   AAARDVAPRRSTNEWDSFVDFCARVSAEAKAARGPYAKISADDVVSHLLHSHPHAARVT
FT                   RVSSPDPATVAATYLVCDGGVGKPVVVTDGGKDWPGLGWSARELGRRFGKSFVRCNDRA
FT                   PARREDARDERTGGAQRSIAIAMLEYSRYCSERPGVDNVGSLRVADAPFYANGLQHGVF
FT                   NPKDASDGRGLGSGFIDGESDSSSTREAFPPPAFTRHCDQVVDIVANTHGAILPNAPPG
FT                   ARDEMATSLSAGLSKVFVGPCGTVTRLHQDCANAHAWLGQASGRKLFVCYPPSDAEHLD
FT                   VMGGEKETRQSRIDPIAPEDRQPRGYLRNATPTVFVLEPGEVVLVPCGWWHYAAALDSS
FT                   VTVMRNFFTAMPESNHTSLVHTIIAKARESSLCC"
FT   CDS_pept        complement(461562..462605)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634408"
FT                   /orf_name="MICPUN_58490"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63721.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199AE32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z6"
FT                   /transl_table=1
FT                   /translation="MSLPLAASASTRASGASASRPRAPATAPATAHRPARARGGRPSQK
FT                   LQHPNHIASRRRGSTTRRAAIAADTAESDAADGVVPAFGEGSPAWPLVHADLKSGKFGK
FT                   VRTVSVADAKDLMARGASLADVRPRIEFEEFRAGVDGDDSLDVRNVPYMVPHRSVAKRW
FT                   QGYLLCTKDGLKERDWRFTRSFAERFPDKSAPIVVGCKTGGDIGMEPIRIETDPSTGRA
FT                   RQVIPEGSSQYGDRSKSNSLMAIYELQQAGYTNLYHLDGGVTKWCVDGERHQGDPYKFY
FT                   FHPTILPGILFQLIMVEGIVVRSNMAYVKKFHPESYDQINDTNALYGIINDLIANSPIN
FT                   WMFDYYS"
FT   CDS_pept        join(complement(463295..463399),complement(462861..463193))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634409"
FT                   /orf_name="MICPUN_105563"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63722.1"
FT                   /db_xref="HOGENOM:HBG610361"
FT                   /db_xref="UniParc:UPI000199AE33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z7"
FT                   /transl_table=1
FT                   /translation="MSMLALAVRRGAHVFRDAARATGVRPLASFHCSAQTMGAFNDNVT
FT                   FSHIAREWRCKWESKEGDLAELQKVLDSKLAAIKAVDGVVSVQRVVCGGCQDYKVVTKL
FT                   DADKFGAWEEAKFAPEPEFLAEIEKLGVKRIETQTYTLETL"
FT   CDS_pept        463957..464895
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634410"
FT                   /orf_name="MICPUN_58492"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63340.1"
FT                   /db_xref="UniParc:UPI000199AEE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z8"
FT                   /transl_table=1
FT                   /translation="MATEKFAEQQNIGDLRKEDPCLLFFKQNATALIGAALILQICFLG
FT                   TISFLTATARQLDAALLFLSLLAKTVFLTLLLYGTGWCVENRGWRVAYTRKIIHVAFFA
FT                   VPFWFDAHMPLSEAESVIWALWNINMVGWILLLITKPVRRLIPIVQTMYASSDRPEDKG
FT                   LSQIYAWIQIPLSIVIIGGFSVVLRVMGAAKWTMIPILAVAIGDGLAEPVAVFWEDRKW
FT                   FGGTHKYRTRGLFSGDRVFTRSIEGSGTVFVGTLVSVLIYLNTMSNGQLIFFVCVLPIV
FT                   ITILEMVAPHSLDNPFLLFFGYLITCCASLI"
FT   CDS_pept        complement(465081..467735)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634411"
FT                   /orf_name="MICPUN_58493"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63723.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199AEE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E5Z9"
FT                   /transl_table=1
FT                   /translation="MDADFGQQSQAFTLLHDKNMLAPASAASWCPTMDLLALATSDGQL
FT                   ALSRLDWNKTGGERENRLWTANPDSPVTSLGWRPDGKILVSGHADGAVQLYHAEDGEVL
FT                   HASTPHRGSAVTSLHWQDAPAEDSRRSACAYQSATSRFALPTNGGGGVHDRPRRDGAKA
FT                   DAGAGAGAGAWTHPPGAGARALFDHFDPPTRLTVLCSGDARGDVVMSAFGIFPIASARV
FT                   GDCPADFPIASARTAGGGTAGGTAGEVLHASLAPDLSRILVAFRANGGVDAVGASAATP
FT                   LLARRSVEMCTAASHGSQIAALAAELEREVHSCAATWRKAREDFDARMNALRERVGEGR
FT                   SQGGRGRGQTRTNANKRADDSMDMDDSMGDDVDTTRDGHENENADPNKELDAGTHRLTI
FT                   EDLLLAYLATGRVDPGVEQFLAHEFQPRDVRRLARSVDAAATKVHAALSERIAPAAQSC
FT                   ALRIAELRALARWRERSGAIGLDEHAADVALAAAESCALAAFSAARLATAAAARLRAFF
FT                   TLLLRTQRQVAFGSPDGFGAGDDADAPPALNAVLVEEFLRDGLTRDTLGDRLGSNRAAG
FT                   SDAAVSRQVPRGGPSDTAVILGGAAAAFTAAVRAAAAAAGFGDDGTRSPDLKYDDDDAL
FT                   WAACARLKGSCAQLLEAPRDAMSRSLVWDRAFPIVRSGSGSGSGSVEPPFLPRVTHGGW
FT                   SDDGESETLVFHAGVGSSHVGMLRLLGGVPESALALEAPPGHVVVDAAAYTEGRCLVLL
FT                   QPEEGRGGGAGDGGEAASVVMADPRALAARGGVTGPRGLEGGVGGDGGYALVDADALGA
FT                   APVVSPGCVPARGVLRMPAGGGGGGARRRSLPGTVATAPLAVGRQKGLAAVLVGQKRIV
FT                   LLDLEEDECDEDE"
FT   CDS_pept        complement(468574..469926)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634412"
FT                   /orf_name="MICPUN_58494"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63724.1"
FT                   /db_xref="UniParc:UPI000199AEE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E600"
FT                   /transl_table=1
FT                   /translation="MADVESRGGDESTPLIAGKSANRGGSASASTRDAHLDNCKFWLMC
FT                   AVVFNHAFQDFFKSVLDKEAGGRPWCQPDVAPDRFGVYALARGTYMYLNLLGMPAFTLV
FT                   SGICSRGLLRCATDDDGAGLAARSRRMVESLVVPYVVWQTFFLIYGTYGSKEFEPAPAH
FT                   PVPFVSPVGVTWYLTALFAWRCSLQFIAKLRNVVAVTFAAGLAVGFVDTPRTENGGLPF
FT                   LDYQRAVAFAPIFYVGATVLTEDVMRRLTDDGDGGASAGWVKIKRAFAWAATAATPALF
FT                   AIAFAFGGGSDVESRGILPGICFDEAQRWAWTMDPYVGGVDAAAGGGRGDVERVVGVAV
FT                   LLRLAFYACSVSLAVAFFVIVPRRERWYTARGSRTMYAYLLHLLVIRSYELVRDGCGLR
FT                   ERMPLWASAAVSLAALPSLTSVGLMSARCKAWTRWAVEPDFGRWLFPDDHA"
FT   CDS_pept        join(470327..470437,470590..472172,472356..472650)
FT                   /codon_start=1
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634413"
FT                   /orf_name="MICPUN_97374"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63341.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG611628"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199AEE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E601"
FT                   /transl_table=1
FT                   /translation="MAGVGEGPLGTKLHSSATKVSYPRPTRVKNKAPAPTQITAEQIVR
FT                   EAKERQEETFRAPKQKITDAEELAEYRLKKRKEFEDLIRRVYWNESVWVKYAKWEETQK
FT                   DFARARSVWERALDHNYRSQSLWLKYAEMEMSHKFVNHARNVWDRAVNLLPRVDQFWYK
FT                   YIHMEEMMGQVANARAIFERWMEWEPDHNGWNAYIKMETRYKEWGRIRHIYERYVQCHP
FT                   SVKAWVRWAKFEMSLGDVARCRAVYEDAVETMEREVDVDQLYVKFAQFEELVKEPERAR
FT                   AIYKYALDNLPKEKAQEVYKAFTTFEKQYGDRGAIEDVIVGKQRVKYEEEVRANPTSYD
FT                   SWFDYTRMEEQHGDIEKAREVYERAIANVPPQNEKRYWKRYIFLWINYALFEEIDAQDP
FT                   ERTREVYRECLKLIPHKSFSFSKVWIMASQFEIRQKRLDAARKILGMAIGMHPKEKIFK
FT                   TYIDMEMQLGNIDRCRTLYEKALELNPFNCSSWVKFAELEKSLAETERARAIFEIAVGM
FT                   DQLDQPEILWKAYIDFETEEGERGRCRALYERLLERTQHVKVWISFAQSLKENQPDAKE
FT                   ERVMLLEAWRAFEEGVGGGDDRVAGVEKKMPRRVKRKRPIYTEDGTPAGQEEYYDYIFP
FT                   EEQGAAPNLKILEAAYKWKRQKTTGDE"
FT   CDS_pept        join(473081..473356,473601..476312)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634414"
FT                   /orf_name="MICPUN_58496"
FT                   /product="Cysteine synthetase/pyridoxal dependent
FT                   decarboxylase"
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="ACO63342.1"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniParc:UPI000199AEE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E602"
FT                   /transl_table=1
FT                   /translation="MQTIPASTRVLSNQPRSIRMFGSGSQVASGPAGVALRRAAVIVDS
FT                   RSRRGIRGRVVTRAAQRPEPPRAFSTDLSDNQNLESLMEREAQPAVQTEADLKQKQAEA
FT                   RANQPDNNYPVTTGQLIGSTPLLDLSQYSLNEKVKIFAKCEYLNPSGSIKDRIAQHIIG
FT                   QAEASGELKPGMTVVAATSGNTGAAIAMACALRGYDYIVITNEKTSKEKVDAMRAYGGE
FT                   VIVSPSGVAPDHPDHYQNIENRLCAENPGTYYGVDQYNNPYNAEAYEATLGPEIWRQTS
FT                   GDVTHFVAGGSTGGTVSGTGRYLKSENADVRVVMADPKGSVFWDHVVKGVSADDVCVSK
FT                   SWEMEGVGKDSIPGCFDINVIDGMVRGNDEDAFAMCREVAANDGLLLGGSAGLNLHAAR
FT                   VLSGEVDDGSVIVTVFPDNGVKYLSKIYNDSWLESKGLEGAAEGNGAVSPDVDEKEHDS
FT                   RIHWKPEIVTRQEQAAAAAAAAAAAVEGHHLLTEEQTEAELKFLEDIAPKLVRYHRESI
FT                   GGAERVHSRLQSPDDLAETFAAAGVPLDLADGAPVDELALDAAVQAVMDNSVRSSHPLF
FT                   LNQLYSGVDPVALAGDWLASALNANVHTFEVAPVLTEIEKAVLAKTARMWLQPTLGSAA
FT                   QTPSHDGLIVPGGSLANMYSLLLARDRVDPDARNRGTTMELVAFCSEQSHYSFRKSAMV
FT                   MGIGMDNMVKVKCDADGAMIAEELEKEVLAAKARGAVPFYVGTTAGSTVLGAFDDYHGC
FT                   ADVCKRHGLWMHVDGAWGGAAALSPARRSVLDGFEKADSFCWNPHKMLGLPLQCSIFVT
FT                   KQPGSLAKANAAKADYLFQPDKNNAGADLGDRTIQCGRKADALKIWLSWKHRGDKGWSD
FT                   MVDRSFGLAEEVERMILERENRDGSFVLAAHAQCANVGFWYVPPRLRPFKHAGASANQL
FT                   TEIGFVAPKLKDRMQREGDAMIGFQPIDSMNLPNFFRLVLPNSRHLSKQMLSDMLDRMD
FT                   EMGKNL"
FT   CDS_pept        join(complement(477089..478236),complement(476671..477013))
FT                   /codon_start=1
FT                   /gene_family="HOG000100063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634415"
FT                   /orf_name="MICPUN_81672"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63725.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG715489"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199AEEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E603"
FT                   /transl_table=1
FT                   /translation="MFESLTPERAIELAGAGAFQVRLTALLMLANAGDAVEVLSVALIL
FT                   PTAGAEFGLSASQKGVLTSAVFAGALLGSVAWGLAGDRIGRRRMLATALAVNAIFALAS
FT                   GTARTFWFLVTCRVLAGVGVSGCNTAAFTALPEFLPCHARGKHTVALASGWMVGSIYSA
FT                   SIGWAIIPTKGWRTFVYVSAAPAIACLVGVVTWMPESPRFLATRGRGEEATEVIRRIAR
FT                   GNARETRVPRDARVEVRVEEVEVGSSGASPVGAFVGAPQRRRKGGFAWAWIAPLRSLCA
FT                   PPLGSRAASIGFVWFSLSWGWYGVMLWLPEYFARLADTSDGASTNEPPSTNVYAENAAV
FT                   AWANLPGNIASAFLVDSVGRRATLTWCMASSAAFLAVFALAVCACAFNALSVGGWNALD
FT                   LFTSEAFPTEVRSTAMGALGACGRLGSAIGTGVAGAAVEGGLMMPLALCGGAMLAGAGV
FT                   TGCMTLETKGRELEDRAAAGGGREGFFELVDEEELIAG"
FT   CDS_pept        join(478445..478570,478676..479131)
FT                   /codon_start=1
FT                   /gene_family="HOG000085051" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634416"
FT                   /orf_name="MICPUN_108241"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63343.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000199AEEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E604"
FT                   /transl_table=1
FT                   /translation="MRVALEEAEGALARWEVPVGCVVVRDGEVVASGSNRTNEKRNGTR
FT                   HAEFEAVDELLARHGGDAVAAGFDRCSLYVTVEPCIMCAGALSLLGFERVTYGCGNDKF
FT                   GGNGSILSIHDDGCAPCVEEPASSSKSHAGSDGKVSNDDARAANTYPSVGGLFAEEAIA
FT                   LLQDFYVRGNPKAPKPHRPLAPESAARAGG"
FT   CDS_pept        complement(479332..479733)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634417"
FT                   /orf_name="MICPUN_58499"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63726.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="UniParc:UPI000199AEEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E605"
FT                   /transl_table=1
FT                   /translation="MAAKNARADGTKVEPPADDKIQAISVSAQKKPLFHYVSLAKKFLA
FT                   KSEDVEIRGVGSAIARCVSVVEILKSDGLAAAVNIETGTTTSDKADDGMADKERLKPTI
FT                   LVKLRRADDFVTKLEKLRLIRASDDANEK"
FT   CDS_pept        join(<481257..482020,482177..>483041)
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634418"
FT                   /orf_name="MICPUN_65753"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO63344.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199AEED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E606"
FT                   /transl_table=1
FT                   /translation="GAAVRFQDLGGISEFKEALLENVALPLTKPEIFTTFGIKPPRGVL
FT                   LWGPPGTGKSRLARAAADAAGANLLVVRGPELIGPVVGESEAALRGVFKEAVRTRPCVV
FT                   MIDEIDSIAPARQGGDGVTGGGGKGGGDEDAMSNRVVTTLLSIMDGVSAENLDLHRVVV
FT                   VATTNRPEAIDRALRRPGRFDKEIEVGVPTPASRREIFAIKLRDVAHELTDADVDELSK
FT                   GCHGFVGADVGALVNQAAYQALRRRVKEKEAWWSDACKTRTVTRADFEFAKKRVRPSAL
FT                   REVQIEVPKVSWDDVGGNHEVKQLLKEAVEWTEKYPEAMARLGAKPPKGVLLYGPPGCS
FT                   KTMLARAVASESGRNFLSVKGPELYSKWVGDSEKAVRTLFRRAKTSAPSVIFIDEIDGL
FT                   VQTRSDGGGGDGGVNVHDRVLTQLLTEMDGVDAAGSKVAVIAATNMPHLIDPALLRPGR
FT                   FDRLLYIPLPSDPVDRTEILRVTTKKMPLAPDVDLDALGAQLAGYTGADIAALCREAGM
FT                   AALEEDIDITHIHARHFATSATRTPP"
FT   CDS_pept        484756..486147
FT                   /codon_start=1
FT                   /gene_family="HOG000239474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634419"
FT                   /orf_name="MICPUN_82243"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63345.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG319535"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR015724"
FT                   /db_xref="UniParc:UPI000199AEEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E607"
FT                   /transl_table=1
FT                   /translation="MDAVVKVFCTHTEPNYSLPWQRKRQSASTSSGFVIPGRRVLTNAH
FT                   SVEHHTQVKLKKRGSDVKYVAKVLAIGVECDLALLTVEDDDFFEGIAPVQFGPLPHLSA
FT                   PVSVIGYPIGGVAISITSGVVSRTEVTNYAHGGIDLLGVQIDAAINSGNSGGPAFNSKG
FT                   ECVGVAFQSLKHDDAENIGYVIPTPVIHHFITDYDRNKTYTGFPSLPFSWQRVESPAMR
FT                   KWLKMRTGQKGVLISAVEPLMKDKINLKKNDVLVSIDGTDIASDGTVPFRAGEPITFNY
FT                   LVSEKYVGESAQVRYLRDGKMQECSITFNAMKRLVPWHIEGTPPSYFIAGGLVFTTVCV
FT                   PFLKNEYGKDYDFDAPVKLLEKFCHGRVEEEGQQVVICAQVLAAEVNRGYEDLHNTIVQ
FT                   SFNGVKIFNLKQLAQAVESSKDEFMRFELDHEISVVMDTKAANSATKAILKTHAIPSAK
FT                   SADLR"
FT   CDS_pept        complement(<486958..487920)
FT                   /codon_start=1
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634420"
FT                   /orf_name="MICPUN_82115"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63727.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AEEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E608"
FT                   /transl_table=1
FT                   /translation="MALTSERFELGPRIGRGSAGDVHTARDKLTNDVVAVKLVDLEEAE
FT                   DEVEDIQREISYLVQCSSPFVTKYLGCWLDPGSTRLAIAMEYMAGGSVADLIRDDLGGP
FT                   LSESACAVICRDLLYALDYLHGEGKIHRDVKCANVLLTATGEIRLADFGVAGTLTQTLG
FT                   GNKRRTFTGTPFWMAPEVIQAHESDGYNSKCDIWSLGITAMEAANGTPPYSDLHPMRVL
FT                   FFIPKNPPPRLEGGNFSDAFKEFVAACLQKDPDRRPRANQLVNHRFIAHAPERCDELTD
FT                   RVNKRMHGGVDRMTSSSVGGDDVGVETTETRHEAAPSWDF"
FT   CDS_pept        join(complement(491279..491501),complement(488040..491260))
FT                   /codon_start=1
FT                   /gene_family="HOG000036616" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634421"
FT                   /orf_name="MICPUN_97378"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO63728.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG357584"
FT                   /db_xref="InterPro:IPR004578"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI000199AFAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E609"
FT                   /transl_table=1
FT                   /translation="MSGVKRPGEGEGPDGKRAYAGPSADFMDAEPELPEEYEDPDDDDV
FT                   FLNDVMDQKVSARIERSSVPSFFSNRGVAATQHPSPDRIPDGVFPARAPPRRSQVNVAN
FT                   DAEREHWKRKPAPTLDASKDNLCFQQLDIDYVIGEPHAMLGPDRKAQGDSARLRIFGVT
FT                   AGGNSVCVHVHGFEPYFYAKVPDAFKDEMCEPFRVSLNGAMAANQRGGNQRGNGTFIGS
FT                   VEIVRDKQSLMYFQEGKTSTFVKVTTTLPNMVATARGIIEKQGVTVPGLHHTSLTFQTF
FT                   ESNVLYTLRFMVDRGVVGGNWVELPAGGYTIRESQKQSMCQYECDVKFDKVVSHPPEGQ
FT                   YSKLAPFRILSVDIECAGRKGHFPDADHDPVIQIATMVTCQGDDRPIIKAIWTLDTCAP
FT                   IVGADVLSFKDERELLRSWGKFLRSTDPDLLIGYNIVNFDFPYLINRAERLNVEDFAYW
FT                   GRMIGSKLRMKDTTFSSKAYGTRDSKEITIEGRVQFDLLQAVQRDHKLSSYSLNAVSAH
FT                   FLGEQKEDVHHSAISELQAGTAETRRRLAVYCLKDAYLPQRLLDKLMYMYNYIEMARVT
FT                   GVPLSFLLARGQSIKVLSQILRKAKQRGLLVPHIAKKGGGEQADGGVAYEGATVLDAKA
FT                   GYYEMPVATLDFASLYPSIMMAHNLCYSTLVPRDRVQFMASEDVTRTPCGDTFVKSHKE
FT                   KGILPEILTELLSARKRAKADLKKAQDPLEKAVLDGRQLALKVSANSVYGFTGATVGQL
FT                   PCLEISSSTTAFGREMIDHTKAMVEKRYTTANGYKANADVIYGDTDSVMIKFNVPELED
FT                   AMKLGEEAAEYVSATFIKPIKLEFEKVYFPYLLISKKRYAGLLWTKTEKYDYMDTKGIE
FT                   TVRRDNCLMVRQVIETCLEKILIHRNPKGAISYVKNTISDLLMNKLDMSLLVITKSLSQ
FT                   APENYAVNAPHVELAKKMAVRDPVTAPVVGDRVAYVMIKGPKNAKSYEKSEDPIYAMDN
FT                   NIPIDSHHYLEHFLAKPLLRIFEPIMGAEKAESELLKGDHTRTIAVPTPTAKAGGIMAF
FT                   AKVRLSCVGCRSSITDEKQSTALCTHCLGKEPEHLQKALNSVNALERDFNRLWTQCQRC
FT                   QGSLHQDVLCTSRDCPIFYRRKKVQKDLMDAENTLKRFDW"
FT   CDS_pept        495677..495871
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634422"
FT                   /orf_name="MICPUN_108243"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63346.1"
FT                   /db_xref="UniParc:UPI000199AFAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E610"
FT                   /transl_table=1
FT                   /translation="MNRLSKAANEVMSRIVGLKPTPMQPFTHGLSTPDTTPRKPRKVHR
FT                   FKPVELDSLKEGASVKVEA"
FT   CDS_pept        complement(496314..498167)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634423"
FT                   /orf_name="MICPUN_58505"
FT                   /product="Nucleosome/chromatin assembly complex protein "
FT                   /protein_id="ACO63729.1"
FT                   /db_xref="HOGENOM:HBG715018"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199AFB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E611"
FT                   /transl_table=1
FT                   /translation="MKVKTIQVLWHAKAESTAGAPKPAPVLSVDFDPATGRLVTGGADK
FT                   EVKLWSLKEDADGNPDVEHLETLTAHTKAVNVVRFSPGGDILASGGDTGEVLLWRRAPE
FT                   GTKNLHGDPTTWRTANTLRGHSDDVQDLAWAPGGAALVTGSVDNSSIVWSEASGRGLIR
FT                   LEGHEHYVQGVAWDPQGEFVVSASGDRKVNVYATTPRSRVPVEPTHLGGWCKKLVCQKE
FT                   VRRAVNVKGLLFHDDTLESFFRRLAWSPCGSFLAIPAGLHREEGGATQGGGHAVYLYQR
FT                   GRFARPAIRLPCVAPAACVRFSPRLYRRKTPVEAPRTPAPETAAGEVRHEETAAAETVA
FT                   QAVGAEPAVDGAQQPGGEANADDDAAIPGDGGAAPAADAAAAVTVEPAPDFDLPYRVVF
FT                   AVCTTDTVAVYDTGADAPVAFVSGLHYATITDAAWSPCGLKLVVSSSDGYCSALTFTEA
FT                   ELGRALAPEEVPEHIAHVLPQRRVKSAEERARRAAEAAKAAAERSAAAQAAARVAQSAP
FT                   ARTEATAAAADGPKRIAPQAVTADGPKRIAPQAVTADGPKRIAPQAVTADGPERVMPTP
FT                   AEPARRVVPVPTAEVGEKRPIDSVDGEAEEKKPTRIAPTPM"
FT   CDS_pept        498363..498917
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634424"
FT                   /orf_name="MICPUN_58506"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63347.1"
FT                   /db_xref="UniParc:UPI000199AFB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E612"
FT                   /transl_table=1
FT                   /translation="MSDMTTIPHAKAAKPGPWCNTAPTLRQRAKRRRHSLGGADELLAP
FT                   RSLTDERTRPAEVVSKDATPTAARGEDAGVPTSDLTGSSPPEPSTIKYNEAPRKKAPKW
FT                   LYESKRFAWTERDEFGSMTRHEPVNPVLLAIARADSSVAWPSETTSPPASTPFGRELRK
FT                   VMERAVMEKVRREAANKPTNE"
FT   CDS_pept        complement(499018..499947)
FT                   /codon_start=1
FT                   /gene_family="HOG000100065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634425"
FT                   /orf_name="MICPUN_58507"
FT                   /product="Peptidyl prolyl isomerase "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63730.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199AFB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E613"
FT                   /transl_table=1
FT                   /translation="MAATPTPEEGKYKDIPSILPLAPGGVYAVKWEQREKWAQCIETPE
FT                   VPYTPPLGEPNPDNPLCFFEVRSGGYYLGRVVFELKADTHPITAENFLKLCEYRCYAGT
FT                   MFKVFPGNWIRGGDFTELDDILYDANDPDFFDFASLLPDAAPGGQSIYVTDAGPYFDDE
FT                   NIDAYTHDGPGVLTMYNPGAQNCNGSQFMITFPRVEPEVLDGSHVAFGQVVEGWNVLAA
FT                   LEQLGDARQEGLTFQRITVEQCGVVRHGRGATGGGVAASMSVEASASASVRRRARGVRR
FT                   VTSGGKKTPSKAAKFGAGRALAARFAYA"
FT   CDS_pept        500232..500882
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634426"
FT                   /orf_name="MICPUN_58508"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63348.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AFB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E614"
FT                   /transl_table=1
FT                   /translation="MSGAEEEAECRICGDLVPTSELVEPCGCRGGMRWAHSQCVQTWIS
FT                   TDKGPGRRNDSCEVCGEAWVGEYDVPEPSVQSPEEYAHRMHVLLSSAYVRVMMDVPRAH
FT                   DEHLLRHLGPHLPGPWLEWLRRDAGRRRSAFVRWKERAVRAMSLGGRQNVGSVAVRRYQ
FT                   ASSPDGRNARTRATGCGCFGGRATGNGAGARGTRRGGRDADDATPGTPRDRRQ"
FT   CDS_pept        complement(500955..501893)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634427"
FT                   /orf_name="MICPUN_100468"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63731.1"
FT                   /db_xref="UniParc:UPI000199AFB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E615"
FT                   /transl_table=1
FT                   /translation="MAPSFNSPKQELEQGICGQHGWSSSYFQAPSSRWCVEVRWGVGPR
FT                   NGRVFVSDDVSDGASKAGVKKGHAAAATVAIAGLRDIVYAANSRQNLTIVEAFGAQFDH
FT                   TCFVTSGLEGWAKLWEINPTEVFIDVEGNQVTPPVLVQVCVPFRVFGEQHDRSLCLLEV
FT                   PNSSRARRDPGVSEDMNRLLGDPKITKVFCDGTSGADRRSLGVVDSDNYVDLEDIASSL
FT                   VGATGVRRGLARIMNLAWPNPEVRVAKDTRDKQSVLFFAAIEQGKKPRPKELDEIPNRI
FT                   RRYAAMDAWCTMTAYRGLRQQAQHEGLLMTD"
FT   CDS_pept        join(complement(502309..503145),complement(501985..502200))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634428"
FT                   /orf_name="MICPUN_81629"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63732.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000199AFB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E616"
FT                   /transl_table=1
FT                   /translation="MRRGTALTLALDVAPYALVAVAVFTAAFGAPVLTRLCAVVLATYA
FT                   GNAVFGECDLASRALGDAPRSAYRGKTVWITGASQGLGEELALHLGSMGAKLILSSRRE
FT                   ETLRRVCEAATAAGAEDARALTLDARAGSAAMREKGAAALALARKMAGAGDGIDGTDAD
FT                   VGVDYLFHVAGGSQHAAAEDTADEVDRDMFELNTMSAIALTKALLPSMLARRKGTIVAV
FT                   GSMAVKCPAPGQATYAATKAALSAFCHSLRGEVADRGVSVTVAHPGPIATGLGGQTRKE
FT                   RRLDATLVAKRIAAGAALGLDEVVLATQPIMLLRNFMQFVPSVGFRVLNKVGPKRTRAA
FT                   RLGVSMYELK"
FT   CDS_pept        503387..511252
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634429"
FT                   /orf_name="MICPUN_100470"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63349.1"
FT                   /db_xref="UniParc:UPI000199AFB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E617"
FT                   /transl_table=1
FT                   /translation="MSTRHGVAEPEVGQLVFQAVGTLAFDDLDDCAAFPAPKGYARHVA
FT                   CSSKYGVTCFADGGGVRVIETTALVAHAASTKEKMPREQLCPPDAFATIAIPDVSCVAF
FT                   SPCETILAVCVGPQVRFLETRALVACAREPTATPTPEPFAMASLGADESSDRVRDFLWQ
FT                   PGGASGGLAYLALAGPEDSDEGKLFVGTAGADDGVDIADRVVAVAMAPPPDEDPDVSIP
FT                   VAAWATAAGDVVYAKLKDRGLAAEMRGVAIGKIDDGDGEAEVDVEGLAFGPRPGLALIV
FT                   AAREREDPDRHHVLVLDAGTPEVSNFWDVVSPPPAPSCTRLEGTFDIDDDETAGLRGPY
FT                   LHGLTVRQWGVALASHRKAWDNQLCALEVAGSGAGPRALQIDDDRCVPAIPLAGADEDS
FT                   NFVTGLAADHGGRGGRMPHPADKSRPPLPQGPTVLVATADHRVTVMRVGHLDDALGGRY
FT                   ADEVRVSEARLDVVDVPSGAVLAAEAAGSAASSPAKAAASQATSAVPSPVKAADQAPKA
FT                   GGFSAAFLAKANAGYDAAQKALQEDLDKAAGKASADEPAAPKAGAAGASFGFGAAPASS
FT                   SSAAAGASFGFGATGSAPSFSFGAPAPAPASLSSAGFSFGGGTATSSAASSAGGFSFGG
FT                   TPAFGASSAAAPAASAAPASPFGSTTTAASSTFSFGGAAAGSAPAFSFPSAAATSAAAT
FT                   AEEKKEVVKKEEPEPAAPKAGGFSAAFLAKANAGYAAAQKSLQEDLDKAAGKASADEPA
FT                   APKAGAAGAFSFGAGSASSSAASFGFGAAAPASSAATGGFNFAPSASPAASSAAFSFGG
FT                   AADVSTPTAFKSAPKLAFTPIVGAADEKKAAKPDEVEAPKPAPAAVPFAAPPAWGSSSA
FT                   TTTKEAPKPAPAAVPFAAPPAWGSSSATTTKEAPKPAPAAGGFSFGTPAAAAISPAPAT
FT                   PRPAAPPSTPVATPAPPATADHVEFGLRLLESLKDGSLDLASAQKQLKDLMVSGTPPPA
FT                   AASPRPSPSPSPAGPGPKGFTPVKITESAAVVGSPTPGWGKKIESLRAAFGATPPGLNA
FT                   GGDPGEAGFKAIMEDIAAAMEEATAMLDDVTGLVEAVEGGGGQSGGAPFAASDIDDIGA
FT                   QAAELGRGVAAAAAATSSLRPAAANVWAENTRDEAMRSELESLFERAAEDAEAAKEDAE
FT                   EERAEAKERERAAREAGGVDRVRHRVGPRAAEIASARPLPPALDRLRRGIDRDMSRLTD
FT                   AMARLESAVERKERERRRAKLLERGAQAAASTSKSAALIPWGPTSPYGGRKGIALHSAS
FT                   MPRAGAVPSSLIRAGGYGSAAAGVSRLSLGSGFGGIRGAARGNLKSAAGAVPVPDAGAG
FT                   VGRGVTDAVAPAEREEAVRELRKRREMIDSQTKRLEEVLAKIRAGEAKENNLAKNSPKP
FT                   STPPAKPSQQQQHRVTGVGESPPASLAAFSPISRFAFDSPAVGGISNSNPAENSEPAAS
FT                   RKPKSPPGGRKLTAPSEESDPAEESAVVRAVLSKISAPRVTSTAKKERPPAGTGFGSAS
FT                   FASAAPPPPSFGAAAAPAVTGVKPAAPPPLFGAAPAPAAGSTAAPAFGAAPAFGAAPAA
FT                   GVGGGGAAAGAFSFGAAPAIAPSEKREEAKKDEPEPAAPKAGGFNAAFLAKANAGYNAA
FT                   QKALQEDLDKAAGKASADEPAAPKAGAAGAFSFGAAPASSSSAAGASFDFGAAPASSSS
FT                   AAAGASFGFGATGSAPSFSFGAPASSSASSAAASDAPSFGLGAKTESKPATSTFSFSSS
FT                   GSSAGFSFGGSGASATSESKPTAGGFSFAPPAITTGKPAEEKKEEVKKEEEDPKKEGEP
FT                   KKDEPKPAAPKAGGFSAAFLAKANAGYAAAQKSLQEDLDKAAGKSSADEPAAPKAGAAG
FT                   AFSFGAAPAASFGFGTASTTETKKTDSSSAASSGGFSFGGATSSTLSTTTGFSFGATAS
FT                   STEKKEDGKEEEKKEEEKKEEEKKEEEEEKKKVDVKPLFGSTTTAASSTFSFGGAAAGS
FT                   APAFSFPSAAATSAAATAEEKKEEVKKEEVVKKEEEPKKEEPKPAAPKAGGFSAAFLAK
FT                   ANAGYAAAQKSLQEDLDKAGGKSPAAAGASPAAPAPAFGLGAAASSSSSFGFGSSSVST
FT                   ASTPSASTAFAAGSTSAFGSTSAGAFGGSGSSVFGSSTPAGGSIAAFGATSSTSSGFAA
FT                   AATSSTSSGFAAAATSSTSSGFAAAATSSASTGFAAAATSASPFGAVAAGGTFGKPATI
FT                   GTGAPAASAFGSATGAFGGAAKPASGNPGAGASPFGQSPGTPRSPSSPSSPFGQASTGG
FT                   AFGGGGGAAGGGGAAGVASGFGSAFGGLGGGSPASSAAGGGNVFGKGLSFGSQPSTPTT
FT                   PSSPFGQASTGGAFGQASTGGAFGQASTGGAFGQASSTGSAFGQASTGGAFGQASTGGA
FT                   FGAPSTGGAFGQPSTGGAFGAPAAGSAFGAASSAFGKPSGLGANAAAPFGAGAVASGGF
FT                   GAASSGFGKPSGLGANATAPFGAGAAAGGGFGAAAAFGSGAAAQQTSPGGSGFGAFASQ
FT                   GSGFGAAAKMGGGFGAAATGGGSSPFGAAAAGGGSSPFGAAAAGGGASPFGAAAAGGGF
FT                   GQAPGGFGQQSQQGAFGQQSQQGAFGQQKTSPAFTQMRR"
FT   CDS_pept        complement(511328..512932)
FT                   /codon_start=1
FT                   /gene_family="HOG000264884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634430"
FT                   /orf_name="MICPUN_105565"
FT                   /product="Small conductance mechanosensitive ion channel
FT                   family"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63733.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561067"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199AFB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E618"
FT                   /transl_table=1
FT                   /translation="MATVTGWRTGFAAPRCVVAVRPRGRAPRCLAGVTPTPGATGAAPA
FT                   SARPRHGCSTSQRARVTPQRCGEKSVRRGSNAVASAAGATPAGAQETIATIMGDALPPM
FT                   IQQPLGLTLSQTFLYSAAFAVGLVVLVGTLRPALVVLHNAWDSMWGGRVKHKPFTDSFF
FT                   GWSYKILRTALLAVALAWTYVIIVPVASTGVHSLFPPERCVRMLRILYLGYAMDSFRKR
FT                   YLARLAGALRRRIYGKMEPSDLIPAHVYDRETGVLVWALTGLAAMDSLGLPLPWLVKGL
FT                   GASTVVLGILASVVLRDTVANYFGGLIVIAAGWFTPKEVIRILLSGRREISGRVEHIGL
FT                   LYTKLINRAGKVAYIPNSAMVAYKVENLSRAPYREFREQLAIPFKDLGHVPQIQERIEA
FT                   FLRSTAGADMLRGVSLAPRCTLTGINSFAGGAVLEVVCYNDYRTLRQEGFTTMRLRHHI
FT                   FLGIAEIFESLGVDFAIAGGQGSNPGGGSYQDVGDNGLYGWDSTAQATGGHKREDALID
FT                   QLDDRAAVGMYAKTPWL"
FT   CDS_pept        join(<513676..514146,514366..514559,514665..514838,
FT                   514899..>514992)
FT                   /codon_start=1
FT                   /gene_family="HOG000198046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634431"
FT                   /orf_name="MICPUN_69481"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63350.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG611434"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B060"
FT                   /db_xref="UniProtKB/TrEMBL:C1E619"
FT                   /transl_table=1
FT                   /translation="RYRLLALLGCGSFGAVCKALDRRTGRVVALKRVPDALQTVDAARR
FT                   VLREVVVLNRLDHPNIIKIFSIFHTPATSGARVLDPDSFTLVPVSVDMYMAFEYATGGD
FT                   LYGLRGDMSADEVRSLMHQLASAVKYLHDVGVWHRDIKSANILCGRNRLGGRVGKSFAE
FT                   REMLTGVVATPCYRAPEVIMSEGKYTGAMDVWALGCIFGELLQRQSAGAHTPHLTISPL
FT                   LGENLGEDETRTLDAEMRDARDLVRESRVRARLNLFFDVIGTPSWHDVDAVSSERWRRA
FT                   GEQAVDLLLRMLTFDPRRRASPDEILAHEY"
FT   CDS_pept        complement(516126..516737)
FT                   /codon_start=1
FT                   /gene_family="HOG000235063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634432"
FT                   /orf_name="MICPUN_82028"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63734.1"
FT                   /db_xref="HOGENOM:HBG328888"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199B061"
FT                   /db_xref="UniProtKB/TrEMBL:C1E620"
FT                   /transl_table=1
FT                   /translation="MGPPLPTADLHARAKGPMDAPVTLSAWLDYACPFSAKLFKTVTTQ
FT                   VLPHYGDKVRFVFYHQPQPWHPQSSMLHEAAIGVYDLGGVDAFWKFSAALFDAATDFYD
FT                   ANTYDKSRSKIYEELAALAARSAGVSEADLSAKLARIEKAGELNTGNACTQDLKFFVKL
FT                   GRQTGIHVSPTTQLNGMVCDTSSGWSLDQWKEFLDPHVGA"
FT   CDS_pept        <519602..>519787
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634433"
FT                   /orf_name="MICPUN_81985"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63351.1"
FT                   /db_xref="UniParc:UPI000199B062"
FT                   /db_xref="UniProtKB/TrEMBL:C1E621"
FT                   /transl_table=1
FT                   /translation="RSPAKEERSPAKKERSPAKEERSPAKKERSPAKEERSPAKEERSP
FT                   AKKERSPGKEERSPAKE"
FT   CDS_pept        519884..520540
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634434"
FT                   /orf_name="MICPUN_108247"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63352.1"
FT                   /db_xref="UniParc:UPI000199B063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E622"
FT                   /transl_table=1
FT                   /translation="MDLRVRLGELESRLEATRRMRGVDLRENDGARDESWLEDARNRSE
FT                   PAGKERKGVDDFNDDDNDEAEDESNPWFAPPSPDAEGSRLGAMPAAPTSSNDDDDTAGG
FT                   GSRRVPTDGNESDTGTQVTSALRELEARELEEREVLGSNPQSAERRRRLEREEARELRE
FT                   LLRRQEERRRRRRRRLERRGEKVADFLPLFAAAALLGGAGRLVRGVFFGKKPGRR"
FT   CDS_pept        complement(520660..520956)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634435"
FT                   /orf_name="MICPUN_58516"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63735.1"
FT                   /db_xref="UniParc:UPI000199B064"
FT                   /db_xref="UniProtKB/TrEMBL:C1E623"
FT                   /transl_table=1
FT                   /translation="MQSIAASNKIAPANASVRPTSAKAARRAASIVPNATQDSKGAKEP
FT                   AGEESNFWKKMFLADGKEEVSSSDYQKFQAEMAAKKAANKEKAAAKEGGCVVM"
FT   CDS_pept        523499..524236
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634436"
FT                   /orf_name="MICPUN_108248"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63353.1"
FT                   /db_xref="UniParc:UPI000199B065"
FT                   /db_xref="UniProtKB/TrEMBL:C1E624"
FT                   /transl_table=1
FT                   /translation="MRGVDARSCDYDELVAAAAGFCPSMGVLGSSFPPLASSESAGSSE
FT                   TVRAGKLGGFACLPSADGLASFLCEPVSFGSCAWSDEACGGETEYAATRSASSSLGGVG
FT                   GRGARGERAGGLVLTTPSRASYVDLRYGSKDDVESQGSSDLGADEAADGSTSAEGRARL
FT                   DDGGGSNNPRGLIHQTRETIAALAVLGVAALLMTTRVARAYVLDPIFSPVVSPTVLNSV
FT                   GIDPETPLTPAEKKGARYYGGLD"
FT   CDS_pept        complement(524330..524584)
FT                   /codon_start=1
FT                   /gene_family="HOG000235089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634437"
FT                   /orf_name="MICPUN_58518"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63736.1"
FT                   /db_xref="HOGENOM:HBG561071"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199B066"
FT                   /db_xref="UniProtKB/TrEMBL:C1E625"
FT                   /transl_table=1
FT                   /translation="MGTPRLSGLARQALSLHRALLRAARRKSPEARAGIEAAIRAEFER
FT                   HRHLDPRDLQAVEHRIRAGRKKLALIDDPNVVAASGMSR"
FT   CDS_pept        524763..525395
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634438"
FT                   /orf_name="MICPUN_81389"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ACO63354.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015598"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199B067"
FT                   /db_xref="UniProtKB/TrEMBL:C1E626"
FT                   /transl_table=1
FT                   /translation="MSDEGRKDTSHFDHTIKLLLVGDSGVGKSSLLLRFCNDTFEELSP
FT                   TIGVDFKLKYMDMAGKRLKLTVWDTAGQERFRTLTSAYYRGAQGIVYVYDITRRDTFEA
FT                   LAEVWSKEVEMYSTVDECVKIVIGNKVDKAKGGREEGWVTREEGETFARESGSLFLECS
FT                   AKTKVSVREAFEELVKGVMETPSLMEETANKDSVKLGGFRAQKGPCC"
FT   CDS_pept        join(complement(526123..>526224),c
FT                   omplement(525462..525914))
FT                   /codon_start=1
FT                   /gene_family="HOG000075825" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634439"
FT                   /orf_name="MICPUN_81610"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO63737.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG316396"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniParc:UPI000199B068"
FT                   /db_xref="UniProtKB/TrEMBL:C1E627"
FT                   /transl_table=1
FT                   /translation="PLNLFGLPARYAAALYTAGSKAGNLATVQAEFKTVIDAANADKKF
FT                   KVFLEDPTMPKAKKVKALSDFCDGAKFAPITKSFLVVVAENGRLDQNQKIYDALEEYTL
FT                   AAAGQKKATVTSAQPLTPEQLKDLTAKLRGHVDAGEDLKIETKVDPKLVGGFTVAMGED
FT                   FFDLSLMSRIRAMEQELAKPV"
FT   CDS_pept        join(526972..530891,530971..531001)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634440"
FT                   /orf_name="MICPUN_58521"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63355.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199B069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E628"
FT                   /transl_table=1
FT                   /translation="MARHISRSRRFVLVLALLALNAPVVRAGGFIHAVESWFSPTLDEA
FT                   PAASSPDAPAVEPMAQNLPTPDVKTVVDDLVTARDSSKAPKTQPRAEDAAAVEDMMRRI
FT                   KGTDGQVVLLHGGLVDGGDSAADTAVLAGLGSDEGLVFCHLAPAQGAQVSQLASPGHAL
FT                   DAGDDKAYFHGGYRVWDHGNDFEDVDEVAVFDGASSKWECTGEACLEAPAAPDEKEVAD
FT                   EHRGGRSAEKEKKVRSSKSKKVAELGVEPVGGLTLDELSRWYDAQEDIEVKPIPKGGLS
FT                   KKVAELGVEPVGGLTLDELSRWYDAQEDIEVKPIPKGGLMPAPRLGAGPVDEAAADVGA
FT                   RQNAAVSGKTLEDLREWYESQDDIDVRRVAKDGYMPKPVRRLLAKAHEAKKEEKAKAEK
FT                   AESKKEAESKKEDEVEASAKRSSSVGKKEEEQKNEEQNHLSSSRPSSHPSSHATPHSRS
FT                   SSRDSDKKDSAEEKREREEREEKEREHAAAIEAELHPKVPVFPGKRDEHVAIVTPKAIA
FT                   LDEGSNKKQKALIVFGGRDENDARLDTMYALGLEDRRWREIKYSPPEPPAARHAVRADE
FT                   KKKSSEGKGKKGGASDDEQSRAGPEQGPLGLPDVVAQAHEDGSLYPLARSGATAVATDD
FT                   NVMFLFGGFVVEGRLGFNVGELLAFDLDKREFFYPKVSGDLPVRRNKHTAVVDDEKRMW
FT                   VWGGSVWDHTGGSSAYASTATHFADLSDPRNVKWTKADTTGFPPSQRRLHSAVHKNGVM
FT                   YVIGGEDYHSKEFLADVHALDLRTLRWSQPHVAGAAGGGRIRAAAVGIKLGNPAGALAS
FT                   CGEGTPVPAITGELQPKDDKAVTEAKEKQPEPRAGEKTEKAAESKAAESKSEKKPEEES
FT                   KTADEGKKEAKQQQQQHKEAALGVEGVDHRAIAAGWMPRGNVLVESQRLWSVDRDSESR
FT                   VLSIASSLAKLDIPGVPKPVLVPALGKSHHEKEESDEKEEKEEKEDDDKGAADAPAPSE
FT                   EDDAYVDPFGNPVRPMAPPTDPDPDYADDYDKDDKKDKDDKDDDEDHHHHKDSDDKDSD
FT                   DKDSDDDDDEGPTPDPVMPWGFDDEKDDKDHHHHKHDAALGAAPEQPAADGEDVQARSE
FT                   ASLGARDPMALLAEARREADAARAAKMRAIEGMMRRTSSSSGGGYGVKAASAAAALGVA
FT                   PEDRDREDAEVAEDATAGTGIASLGARVTADERASGMGRAKAAVGVGVVVAAVAAFGVV
FT                   AVVGAVTRLAAPGGSDRGSDAERIPLVMQGRGGGSRGGDAVDDAQLAATGEESEHSWQR
FT                   RAATRWGTRRANGDVRDDWADVVAKPKMASYK"
FT   CDS_pept        complement(531370..531543)
FT                   /codon_start=1
FT                   /gene_family="HOG000264882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634441"
FT                   /orf_name="MICPUN_108249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63738.1"
FT                   /db_xref="HOGENOM:HBG749352"
FT                   /db_xref="UniParc:UPI000199B06A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E629"
FT                   /transl_table=1
FT                   /translation="MPYRSESMIVFAAREAKKMWPFLAGFAVVGFGVTQATLGITEADK
FT                   KKSAFLNPGGHH"
FT   CDS_pept        join(531764..532473,532588..533122)
FT                   /codon_start=1
FT                   /gene_family="HOG000029809" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634442"
FT                   /orf_name="MICPUN_81523"
FT                   /product="Equilibrative nucleoside transporter family "
FT                   /function="nucleoside transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63356.1"
FT                   /db_xref="GO:0005337"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG561073"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniParc:UPI000199B06B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E630"
FT                   /transl_table=1
FT                   /translation="MAARPEDVDIAASAARGSSPPEDRRGFVYRACFFLGAGILFPWNS
FT                   YITAVDYFERVHPGKHVDRVFGVLYFLPNLLMLVLVLRFGNLVPPSVRVRLGFSLFLLC
FT                   LLVPAFTSNLGILCAGIALNGVADALAQGSLFAQVASMPETYTQALMAGTSLSGLIVSV
FT                   LRVVTKASFPATDSGAAASASVYFVCAALWVLACLYLYGELERSEVFRWHVARAARARR
FT                   AGEAAAAGAGEVGEERAAGTTLRDAAAIASRVRYHAFAVAITYVVTLSIFPGVLAEDLR
FT                   DDSMGDWFPVALIAAFNLADVLGKCVPGVFPAAATAFSPRTTAGMAAARVLFVPAFTIV
FT                   ARWSDGSSGGGVVAPGVALTLALGVTNGWYSASVMMTAPKAVSAAECEACGTIMVFFLL
FT                   SGLTAGAFCGWLWLV"
FT   CDS_pept        join(complement(535710..535864),complement(535347..535599),
FT                   complement(535148..535195),complement(534706..534843),
FT                   complement(533328..534512))
FT                   /codon_start=1
FT                   /gene_family="HOG000264881" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634443"
FT                   /orf_name="MICPUN_58524"
FT                   /product="Predicted protein"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63739.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG561074"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="UniParc:UPI000199B06C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E631"
FT                   /transl_table=1
FT                   /translation="MAPPATARPPVGAEPPQDALTYVRAVKSRFQATKPEVYEAFLEVM
FT                   RDFKNARSDTPEVVRRVKELLGGHPDLLDGFNCFLPEVRAPSSRDEAGMKKTTAALANP
FT                   RGGWLRAGESSGARAPARPRDSRGPAGRAPPMPYKFNATKDSAAEAANSDQPTIGGGYN
FT                   LLKRIRRVYAHDERPYHAFLAILIRFRNAEFTTEQGPGRWGRRVSISKSRIGKKSPSVL
FT                   RSVVFPRVSSTSSDGATSPRSLTRRVPSPTPTHFPAQVIKNVATLFYDQPDLLHGKDGL
FT                   EFFVPKTCKPPQPSQWFQWTVKTHNRFGRVSFRVAVRMLLLCEKRSRSQPPDLTKRKVR
FT                   LIGAKGTGADSDSEFSDSDSDSETDSDDGKPKDPGHVDPEALPPVWDGVTALVMSEFEK
FT                   MTLEIKPMSDDQCWEDAKAQKEENARNEEALGRGKRAKPDQTTTTSPPESPPPPDGAPR
FT                   SRKSARIIAKVNRGAMYTSYRHLSSGRHMNSGGKHHHHHHGKSRKSLIAGMKQSGVHHS
FT                   VAALSTVNPTLPPMEDAELKLARNPKEMSLIDRSGLHKLPPNCMERIIFFLAQAEGREE
FT                   LTAQREALMKSLGKNR"
FT   CDS_pept        join(complement(539862..543868),complement(538023..539801),
FT                   complement(537919..537953),complement(536800..537881))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634444"
FT                   /orf_name="MICPUN_100477"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO63740.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000199B121"
FT                   /db_xref="UniProtKB/TrEMBL:C1E632"
FT                   /transl_table=1
FT                   /translation="MSIAVTSHKPGDVLEQGVECVFIAECGVGKDRACDEVQILLGVNG
FT                   WTGKSWRTVHDCARVDPSTGRVSVRWRVPKDLAASDAYVVKVQSHPSTGPTPQICAEVS
FT                   GVKVTTPLEIVRVGRDEVQVRWSPGALPADFEKRDGWRLALDVAPVANANESHEDVVGD
FT                   LFLQAATRGLTVHTRRRSVLYDVTKEESATRRKRLKLTTNRTYRVALAGFTVGELEAVF
FT                   STSRAECRMGMVRLAAFGGGYNSAQSGARRVTLGDAEYRRRPPDPPRPRAKTQKEKGAA
FT                   KGVKGGVKGGVKDGGDAERIGEGDKDGDDAAKDASAADSDLVSSNGVGGDATTPTTTPI
FT                   PTTPTTTNTSGEPPSDHASPRDSPRDVDPRLANIDPAGGFEVGERGVGPFGSGRGVSVL
FT                   IMRATDLHVVFERTWDVSGGRKPAEARAAAEALRAAFAPEPAPAANDDDEKEDRRRDRG
FT                   PRPGELARGSATRREWGTHFVAVTTAGAWAMAPGKDGDDHGVAAAMDAMVSALGGSPSQ
FT                   RADVRAAFKGPSAPGQPAGIAMLAACDPSGGSTVWCVAGRGPKDRACVSLTLGCAGGEW
FT                   FPAFTGGGVSSGAADGETTDARVPWKVWGEEPWHLSPVGHAAPVGHEKVGTSPLEAIAS
FT                   RRRRAPANFADEETVAAFAAESVRVSRYRTIVADAKAEMIAGARAGGKEWDASGGGGGG
FT                   GGGGGGGGAGRTEATGLTSALLGFATAHFSAAGWVPLCRLRDATNPKKARGGGGFDDSA
FT                   ESSLADGPPAGAHRMSSEEVALVQQTESLVRSLAAARSARAMSELVAAGAAEYLSRRLA
FT                   ALLSPEGRLLPMGGGRAHVGLDAEGEGGGWGAKSKAAIERGLADAREKATRAVTSAAAA
FT                   AAAAVGPHCGVPADLANGLSATDDTAARSDPEVAAEARSLAQALASLCSHNGAALLPEA
FT                   VRRCGAQDALLRSFLGGWRGALGDGAAPLADVEACVEELANADLTPVALTLSAPLNLPG
FT                   GGADSDSDCATSEDEDCGGEDGGGSVKAASGSRRRLPTVGIEAKKKSVDTVPYATLTAL
FT                   RAGFTYLPSTFKSSSEGVASRVGGKIHVLDIVAPAKPGETIELPDPTPLIAEEEEEEEE
FT                   EEEAGRGLEPAGAGEPRGGVEGAEPCDGSDAGSVDMCDDAEADEEGMAELMGSPMRVLP
FT                   FTESAKKLIREDPNAQGGSKNGSSRDLTLAKDQPRTPATPPKPPASIKGGVAVFRAKDG
FT                   DWDAHVAMVRQAPRLCLLAQAKGANAAVFLWPARGDGYPPTQPLLPSPNFDVPVGIPAF
FT                   VLPATDLAPATTGVEVDGWELSVGGGWLRAIGSSAAVAARCGDALVAACSTRPTPAAAA
FT                   GLRKLAARVDGARARLARAKEEARRKAEEEEAARRRAEEKGDEKGEQSYWDVAKGFFGY
FT                   GGGNEKEEKRNETPEEKGGDEKKEGGVEEEGDGEKRTGERVEPEPKPETETEPEPEPEP
FT                   EPEPEPEPEPEPEVEPPIVVDPDEITKAKRWSTAMRIVYALGDRGKPFLDKSFPARAGG
FT                   SGVRVLCLDGGGIRGVASIVVLERVMAAAGHKYVGECFDLIVGTSTGGIIAIGAGLLRM
FT                   SVAEVADLYENTAEQIFVSDAWATIARYGPGHNAARSFESLMTDIMGKEFDQPLYASCA
FT                   HERWYTAGIGGVGGGGDDDEDGDGQRGNGCRPGGPPRICLVSSIVSRTPSTPYLMRSYR
FT                   RTSTATDAASGEMPGDHRPGAVSALRATTAAPWYMAEHAVLKELSLGRATSDFESAGGK
FT                   SSPADGEDSGESEGDVAIEETSTHAATRHDDASRVTTTLRFIDGAIASNNPTAVGVFEA
FT                   RRLFPRDRKLCVVSVGTGAALPREVPGTGYAQSQAVSNLIAATCDVLQVDATVRHVLGA
FT                   GDRYFRFQPTGQAFGCELNDTRKETMEALRREATEYLDTEAAKAQVAELAALLRNVSNF
FT                   RSASEKKDAWRAEGRPPALSRAFAAGQGLASARRGPRAASVMAEPFPEPADDAPFAVGG
FT                   VVENLPWDSYILRGALDTAAQLRLVDRIASLAGHASERWPERAAGQDHPAIVASHATGA
FT                   VERPRECRRACGLARCRGHCGRDVGALYARPDDVFDLARNIAARIERQRGASAGASSHD
FT                   PIAFDATHFWSLVYGDRTPGRRCFESGDAAGGVGVGVAGGAAPGRNCGRMQSHLDRPIG
FT                   WTLSLSVGRAVTFNLGRHPTPGSMYESSTNFANAAPGQGGTGVDVVLRSGDAALFRGHA
FT                   VFHAVDGFADEEPPGVDGYGMTRGAPNGEGISFSAPEGWASRLLAPSRCEPPRDGWAPA
FT                   RLALLFRDEEDAR"
FT   CDS_pept        544153..545766
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634445"
FT                   /orf_name="MICPUN_58527"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63357.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B122"
FT                   /db_xref="UniProtKB/TrEMBL:C1E633"
FT                   /transl_table=1
FT                   /translation="MSTKRVRRDAPGDASVLLALPLELLPEIFSHLTRREAAGAKGTCR
FT                   VLRDVCRSLESEEPGRKLYHRLRLMVACSSTAEVVEFSLRGQDPPKRVAVGRAWAKSDK
FT                   VKRFRRKDGPWLTGIALSPDGDRLYCQCYHEVGTVVLDGKTLEYKRMYLPPQKEWRFPP
FT                   EHPDTPLMPGDWQIQGPEGIACAGDKVYTTFADGKVGCIYLNKAKAYAPMSLAAGWIDR
FT                   YVHNLGSLWMEGTDPIYAFCQTATARHCCEIYARLGEVYEQTWRPNAPTPSWKLAGPCC
FT                   FHRHAPGAMQEPYHQDMIEQGLEDNVFKVYGYVAWGCDVGPDGALYVAVDRDHQPTGNN
FT                   YTLPPGKCPIPTCERRKTGVIMRVVFADYRSVSSQAIIGQEFYTKGEHLARPSGLTFTP
FT                   DGDMLVASMDGCVSKFGGPRSPRRGEFLGVFHSLKARDERYIEGMSKEIKEMVDEGGVP
FT                   AGLATLGLDKIPLQPLDVWAPRRQGGRVFISVHRALEKSDPLRGWYDDAGVIVCDGAGN
FT                   EIDFIRDPHIAEHCNMMTGE"
FT   CDS_pept        join(546023..546082,546145..548316)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634446"
FT                   /orf_name="MICPUN_58528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63358.1"
FT                   /db_xref="UniParc:UPI000199B123"
FT                   /db_xref="UniProtKB/TrEMBL:C1E634"
FT                   /transl_table=1
FT                   /translation="MAFVYRARRSTGMSSTATSECRIPRRAQKTLHIQHVSPDAQPPQA
FT                   LGPGSYGGAREHKSTRGAPFGTAKRDTGMVRPGRVPGPGAYGDWALSVTGIGAHRPSTV
FT                   SKGFGGGPRLAPDASLASPGPGTYYDHGANLWIKRVGSGREGPSSRSRGSPHRTLSATT
FT                   TTSSSSTARRAERSKTPGAARPPSATPPSIPSRARSHGYVDPSPDSASRDMIPAPVPRG
FT                   RVHAYDGVGDDRIGPDRYSPTMTAVDVSRCTDFASSRSRRAPVPASPRRSPGARHLDEV
FT                   TTRLAPMAYAGGADERDAANDPSKESKESKESKESVDEKGSVESPEKASPSVVRGVPST
FT                   AGHVAVRRGSASDSGRARRRRSAGMPTPGPGEYAGAASSGFDRLRSPSRLERLGGSERG
FT                   RRGMESARAHGRSSAWDDDIASPGGGKGAEGAAGVKGTTRKPPPLAVDATGRLEDSAGD
FT                   VSDRFSDRFSLRTRRASSAMGRRSPLPQTGFGTSVRSSLSAGAHSPGPGAYDAIVPGMN
FT                   SPSPSSRKGTFGRSLSGENLSSLTPSPGSDSPGPGAYDSPSGRKTPSSPSTRSHQVAGF
FT                   VTAARKNVAGAGFVRGLSAGRVSLDSDDGAARERTPNRGFGRQAARGKGDAPVPDFPGP
FT                   GAYDAEYGTNDAWERRKRAGVDRSATLRTTLLSKHNFEAKSPTHGSPGPGHYDCVGSNW
FT                   RGGAGGGRSGFRSGSERGGDPAFTSPSPGPGLYYPRDTIVRRSHNVTAR"
FT   CDS_pept        join(complement(551806..551882),complement(548692..551638))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634447"
FT                   /orf_name="MICPUN_100480"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63741.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B124"
FT                   /db_xref="UniProtKB/TrEMBL:C1E635"
FT                   /transl_table=1
FT                   /translation="MKRSAALQILGVSDDLDANALRQAYRKLALKHHPDKNPGDPDAEQ
FT                   KFKEVVSAYECLTREDDEDAVADIFESADDMRDFAASFFESFFFGGGFRGGQTFTFAEG
FT                   RFPRPDNRRDANGGKKGGGSKRDDDDESDEYSDDDDYDDDYYDDDYSDDDYADLHDFFS
FT                   QPPPGWQPPPGFKPPGRGGGGRGGWFGEKPPRRSSRGEGSGSVDDDELFERLERMRKEA
FT                   ARYAAELARKDDEARRAKQPLEKLQRPTLVSRTDTSITLNLHRSKNTNQTLPKDRCWEL
FT                   SLTKERERDYSVFTSVKGKTVVTVSDLIPGTRYCFKARVGRVEPDGDVSEWGPYSVESA
FT                   YATSGKAPPEHHGRASHGAKADADKGAAAENGDVAEAIHGTMSKKAKKRAAKERAAAEE
FT                   AEAAAKGASAAQQAAAETSAAADRQAALRRAAEAAAEREMAEMEEIRRKMESKKAKDKT
FT                   ADAASSQAQELAGHQPAGNTEGLSKKALQRKKKKEKLAAETAQRLEREAASAPAVTDEE
FT                   LARRLQAEEGGYKYQPGTFESDEALARRLQAEEDKYKTHAPPSHHHHHHHHQQQHHQPE
FT                   HQQNPANTQGRQQQIAAAHQYAAQRQQQQQSAFAAAPNAAAVPPLPRGAPPPPPPHPPP
FT                   PPPGGPPPPANRVPTPKAPGAPPLPPGPRPGTNSRGAAPPPPMPPPGAPPGGMRQNPYA
FT                   AAAQNPYEFAATAAGAYSSGDSRADSWQQERQPDDGGNPYYSGNSHTWQQHQQQHQQQH
FT                   HRDERWRTPDPWAAINGGGFELPSDDDFVGAVRDHADERPTQRIQRGGSNNGSSHSGYP
FT                   VGSPGGSAYGSAPREGGAWSNGVGGAWSNDETETGWTDSAHGYGADSMTDSRTNSRIES
FT                   AAHGYSQQQLQQHQQHHQHHQHQYSYAPGSSPPVGSHGTSLAGMDSYGGIFGTSPGSAH
FT                   GSYGGGGGMWSTLEPSKPPAVGGASQHAAAAAHPPVVKRGGLGGVSLEGDMDGLNLGGG
FT                   LFPPGGSTFSFLEDNGGS"
FT   CDS_pept        join(complement(552722..553219),complement(552311..552580))
FT                   /codon_start=1
FT                   /gene_family="HOG000264888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634448"
FT                   /orf_name="MICPUN_58530"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63742.1"
FT                   /db_xref="HOGENOM:HBG561079"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniParc:UPI000199B125"
FT                   /db_xref="UniProtKB/TrEMBL:C1E636"
FT                   /transl_table=1
FT                   /translation="MSFAASLARPLGARSLRSTRSDSPTHHRSHRRAARIRAAEAEPAP
FT                   TETKGRFRRRDPDAAPKPAPLGSGPDANAPPSGIKVIPVEQRSRDAFQGVAKVDGEAED
FT                   PALRSAKLAAGDALAILAFAAIGRGNHGEGMFFGDVLGTALPFLIGWFATAPLTGTFGE
FT                   DARSTKTSNAAFAAAKGVIAGVPAGLVLRSIGKGAVPPVPFAIVAMVANGVLLVGWRTW
FT                   FAGRGAGGAGAGGNKKGNPLEFMSLLMSLTKRW"
FT   CDS_pept        join(553359..553797,553910..554037)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634449"
FT                   /orf_name="MICPUN_58531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63359.1"
FT                   /db_xref="UniParc:UPI000199B126"
FT                   /db_xref="UniProtKB/TrEMBL:C1E637"
FT                   /transl_table=1
FT                   /translation="MRSSIARRAAARVVSDFVSHAPSARGGAAAPSKGIKVINITPYAA
FT                   SEVTGGGGLPHARAGVSAQTKPSQLDQHWVNAFHKIHGRGFASSAAARAGLSPAETKKR
FT                   MDEINDNFAEAREEIEAAMEAVGTTYFNEEAEYAKEVTEKTLGMYYKLCEEMDPEERAA
FT                   TQRAMGMKMEQLKAELKQLDHAHDD"
FT   CDS_pept        join(<554639..554812,554947..>557986)
FT                   /codon_start=1
FT                   /gene_family="HOG000231280" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634450"
FT                   /orf_name="MICPUN_81929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63360.1"
FT                   /db_xref="HOGENOM:HBG283016"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B127"
FT                   /db_xref="UniProtKB/TrEMBL:C1E638"
FT                   /transl_table=1
FT                   /translation="IPGQADTEAITAVAFSQCKSYVAVAERAERGVITVYDLTTTTGSP
FT                   RKRVLASTDVGSKEYVSVAFSPDGKWVIAQGGAPEWNVTLWNWERCKQLACVPAKPLGS
FT                   DAGAVRQVRFAAHDPGLASCAGEGLFRTFKCAESGVRALPDVKLPPAKSGAIKNYTAHC
FT                   WLPDDAEVTDGGEEGAERRERCILATDGGELLVVELNEVKATIPALSDWKGVDCVIPYG
FT                   AGGFVCGGADGTVSVYEKTDEKELYKRVKHFVIKQSPGARVTALALSPTDETLLCSTDD
FT                   NQMYEVDMSNVDVVKSEDIECQLFTQGHHTQGVTGVDLCVRKPLAVTCSSDKSVRVWNY
FT                   LDKADEICKYFAEEAHSVAFHPSGLHVLVGFSDKLRLCNLLMDDIRPYREFSIKGCREC
FT                   SFSNGGKYFAAVNGPVIQVYNMYTCENVGNCRGHGGKVTGIAFSADDKRLLSTGLDGAV
FT                   YEWSLSTFQREKENVIKSNEYASVAIAPDDTYVFAVGSDATLKQLDGEDLMLNEEFALT
FT                   GTGGDGGQTQTQTFTRVRLTNGGRRLFAATSTGAVRAYELDGGRIAGEGKEFKELRCHT
FT                   GPVTGMRVNFDDTLLFCVGEDGVLSVFDVKERAMEGATKAGEGMVFAQEVLMTKADLED
FT                   IRSRMHELEVQVNELTLQGEYQLRLKDLNMNEKIKDLTDKFQGELEGERSKYDALLQEK
FT                   NELEMDFADQMKTTENKHAQATAATESSFQNKILNEIERYQALVEEKEELNRGWDEQNT
FT                   ALAESHDRLVADLTEEFAGKLQEEQMHSETLRLQLEEARAAANERENQLEEDADLEIDE
FT                   LKEKYELRLKEQRDVSLRLKGENGIMKKKFTTMQKSIAEQKDEIAGLFTDKKNLYATIA
FT                   DLEKDVAGLKREIRDRDETIGDKEKRIYDLKKKNQELEKFKFVLDFKIKELKRTIEPRE
FT                   QDISDMKNQITEMDKELERYNKSNTHLDLTIKDLRNKLLGMGQDVKRKQKAIEDRDSAI
FT                   HSFQKDLHEATKHVQTPKRLAEEVKSLYAKHMTQKIDDKPPDKDIQREYNRQREYLEKT
FT                   IDQFKRKLAKDVETHKKDNMALM"
FT   CDS_pept        558607..562098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634451"
FT                   /orf_name="MICPUN_58533"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63361.1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B1DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E639"
FT                   /transl_table=1
FT                   /translation="MPPPERDGPVDVTLVLEGGRVGAELGSMALLELGSALAAVTEIRG
FT                   GTGAPAPRWIGDAVPSTSGGAPETVLTAGVTFPSLAAARAAVRRCALTRMALAPVASGD
FT                   PSAVASAMGPERAAKCAAQVLAPGRKGVPRVVLERVGAELWDAGVGRAVAADRAWLIAV
FT                   ATSEGKPGHEEKQRVLDPSRPHVYLHPEGAMCEVIAWGLDTRAALKTVEAPNAMPPQQA
FT                   FLALNAARVRPGDVVCDPCVGGGAVLLAALKLGVRRVVGADVDDDALAAAAGAMRRDGI
FT                   DVNDDDDEDARCALGRASLLDTPWRGPVAVGGEGECFDAIVTDLPYGVRSAAVGVGDGP
FT                   NAVCTPRAMLLALLDLANARLRRGGRIAAWLRKPGDGDGENTAGAAALTEADVAAAALT
FT                   RGFWVERAAGEARKTGVSRALYVMVRVEEAGCQLCQGMPRDEEDGVILPASETFGSLAH
FT                   ELNRRALVMHATLRRNENYGRVESDGGQDVWRAAWVGDLPGLRSRLDSHPLVAAATEPA
FT                   GAGNTPLSAAAGHGRVSCVAELVHRLDRLNSDGFEGERDAVAAALVRASEFGHASAAAY
FT                   LLRECGADPGMIRRGGGGDGGNAFHAAAERGHADVLEALLEHIRRVPESPESHAALVAR
FT                   DANGRTPAEAAARWGHADALRVFLQTVHSGSNGDAVQTEESTRTNFANLCAIAVRWGHE
FT                   DALRAIVECGGWDATRAALGDVVAAEAARWSRGKIAAILQSWSTMKDTLKGTNDTTLNP
FT                   PRVEGARVVRWEPRTGGAVLYCPKFWDPDDGVRSLRTQVEGDFLPRTHPLVTPANRRGR
FT                   RSPVPRDQAFYAASYAAKAPDALDKTLDKTLDETLEGEGVWWCSYRYNPSHTQQPAPRA
FT                   PPPVVKELSREVHRRCGQVCNHAVVNRYRDGFDAIGAHGDKATDLEDGSFVVSVSFGAT
FT                   RRMVFEPRVEAPAVDGSERVVRAKDVKDAQLALAAALHADEEWREIAELKKTAAARSEA
FT                   KAAAVARERARGAALRDSDPRVAAAANRARETREAWRAAKGAASFAVDLEPGSAVFFNM
FT                   EFNAAWTHAIYPVGGYAREAEEEEEEEEDGEEGKVEGDGEDEESDEDVDELRTEPAGAA
FT                   VGERFGVTLRRCKTVFDPVRQARAEGKPRGWRRGIWRPLGDMVDPAEAEREWREGD"
FT   CDS_pept        join(complement(562927..564625),complement(562197..562684))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634452"
FT                   /orf_name="MICPUN_58534"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO63743.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B1DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E640"
FT                   /transl_table=1
FT                   /translation="MKEKRKSSTGDAATPKSGGAKTPNKKVKAAADAEDDSADVPLNDT
FT                   EIAYLAWMKKKGVKLNGVSIGRFPHTGRGCVATRDIKEGDVLVEVPEAAIITADGSVAG
FT                   SALVAFGLGGEALLHEYSPRLEREALVLAVMAEMSRGEESEFAPYLAALPTLRATHSPL
FT                   GWSGAELSELEGTSALNRMTSAEDESLELPSMTADHWKHVARPFLQRNPEFARMPGAGA
FT                   DDDDHDDEDDDAAEENARRMYLHATALVAGFSFTLGEDDDSVEDADAAAAADDDSDSQV
FT                   STGGDTVQAMVPFWDMLNHVEPESSSVRLDHDEDANTLRMIAIRPHAKGEEVFNTYGAA
FT                   GDAELLRRYGFVMRRNPHGGGVEVSTAECLAAAEFARFESDMHEDDDSESDYSDEDDED
FT                   DDSEDRFDGKMPPISDSDDDDDDDDDEEEEEVDSEEDEEDGEEEDAEGDSDDEDLMAMD
FT                   FRPGQIAREETLERLRMLRRWGILRNSKQTFEVSRTGKPSLALRYVARVLSMNRFQFRR
FT                   LLAADAYERGERDDQEGAYSDEEDEDDDGFGDYKPLTVEQVWNGDTVLTDEGDDDVSED
FT                   EDEELQEREDQMGRVSVTLIALAERALTGGRYPTDSLRADMIKLKRLGAEAPGEREHAG
FT                   LGGWRGAVGAKEDSRRVGDILFPPSWRDEERRAMHRQRMALVVRIREKRALVALKRWAA
FT                   NPCRTEDDILPPLLRADAEEDVDATLCRVIPKDD"
FT   CDS_pept        complement(564808..567342)
FT                   /codon_start=1
FT                   /gene_family="HOG000157471" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634453"
FT                   /orf_name="MICPUN_94195"
FT                   /product="Glycosyltransferase family 66 protein "
FT                   /function="oligosaccharyl transferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63744.1"
FT                   /db_xref="GO:0004576"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG314442"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniParc:UPI000199B1E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E641"
FT                   /transl_table=1
FT                   /translation="MSPISGHHRKRDDVHPLEGAFGSFARVAVLAIAAYFAYDIRLFAV
FT                   REYGRIIHEFDPWFNFRATQYLADNGWKKFSTWFDYMSWYPLGRPVGTTIYPGMQVTAV
FT                   SIYNTLKALGSNYAMSLNDVCVFFPAWFGAVATMLVAFLTAECSGSANSAVIAALVMSV
FT                   VPAHTMRSVAGGYDNESLAVTAMCLTFFVWCRSLRNERSWWIGSLAGLAYVYMVAAWGG
FT                   YTFVLNMVGLHAATLVLLGQYSTSLHRAYSLFWIIGTLGAIQFPVVGLAPVKSLEQLGP
FT                   AFVFLGMQVLAFGERLVKSRGAGGAEAWRIRVNVYAGAAVAACVAIAALAPTGYFGPLS
FT                   VRVKGLFKMHTRTGNPLVDSVAEHQPGTPDAYWRYLHYSYYVAPLGFVVSSAHYVKTRD
FT                   ASALFLPLYAVTAYYFANRMVRLIIFLGPIASSLTGVGAGYLLDDLIDNARWAQRYLVV
FT                   RDGAEGSDDSEDDSNDAKAAATNGKEKPAPFSPNLAKKAGKKAAKSKSGSQGSVADDFK
FT                   AKMIEPLVKTYNSKNGRATRSLVCVVLLLWGCSHARPFWDYSHMMARGMSQPSVMFKGT
FT                   LQDGRTVMVKDYVEAYHWLRDNTPEDSRVMAWWDYGYQIAGMANRTSIADGNTWNHEHI
FT                   ANLARALTAPEEKAHRVIRHLADYVLVWAGGGADDLAKSPHLFRIGKSIGHDTGTVDMY
FT                   EIQSKFGVDQYGRPTPMMANSLLYKLVSFQGKVSEERFREVYTSKFRKVRIYEVVNVSQ
FT                   KSRQWLADPENRMCDAPGSWYCPGQYPPALAKFTGIIKPAYRMPAFAKQQIEERARREA
FT                   EKKEAAAQKAAEKKAAEELRKATDGQAAHEDL"
FT   CDS_pept        join(567610..567831,568005..570461)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634454"
FT                   /orf_name="MICPUN_100485"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63362.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B1E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E642"
FT                   /transl_table=1
FT                   /translation="MGSTVIGKKPAKVVARLGRRGRRGDDADDGQGGLRHTPLNAAWAI
FT                   LQAYAIIAIATSSYGSIFASPPPPPEQSAMLNLTNVKNVLFGDGVLEDIHNVDRFLGVS
FT                   TAGYHLSRLTCRKTIDAVAGTAKAAQYAAWYATDGAIDLAAPLAAEYAEAMMIPEAWAN
FT                   LKSSLAYTNRGVANCLRISWTVVGPPLRYALPFLDFVWDGLEPPLVRAKDAVVDAADDA
FT                   MYTFKESFNEAMGPTVDEWGRALTPIRRAPANAFAAFLTYAWRPAVYFCTYPELYGDLP
FT                   PAVPPTLPRSSLRWGERCRKTLWGEWTTCSARCGAGYRQRVNHCGKRQVIRCAGPGIVG
FT                   CDEVCDSGAVRDCAGRCKGDKRVDCKGVCGGGAEVGCDGGCSYAAAQTDKSGKCCVFPS
FT                   FVLPKTGLCNTTMDEDTERLAQALATKRRLLEDKAMRVTGALPERGVADLRERRRLREI
FT                   AERSVNPVSPKAKGVEPIRPKKYPGTGRVQPPDDSDVVENRTERMLGTKRYVKVRPARD
FT                   RKGKRGVFGAVFAVVAWPFRFVGWLVASILGLLLTRVLLVLVLLGGFGAGAYHVVNVAI
FT                   QQMESELRREGGDDENDEKKPSGNVVDEILSKLVDLAKTAIVLVREWSDKRANVRAAAA
FT                   AAAAAAAKERERVTDAQREAFASTVVGAAHADAYAVRRRAIRAMVTMSGSPDLDWRHRL
FT                   RCFNGLVRLANGGSNRPYLIAEMGGLEEATKALSRWMADKSLDQPHSALQLIRALVHAP
FT                   AAQRMLANLDVVRDGTSATVMLELLLTAPGVVPLQRSGLASLWALIHLAGPRSGVAEKL
FT                   LDAGVFEHLEDEWEDSHADEVVAHGIGGCVMQLAKGDARAQARLTELGAQALVSKIFDE
FT                   HPGVTYRGRFSDLRAWLRAGK"
FT   CDS_pept        complement(570578..571150)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634455"
FT                   /orf_name="MICPUN_108250"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63745.1"
FT                   /db_xref="UniParc:UPI000199B1E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E643"
FT                   /transl_table=1
FT                   /translation="MATLYTVLLLLTHGVCVQTIQATTLKDLEGSWQSYCNAQQYEHLC
FT                   SFDHAAETAKYEAAFVMAYMGIVGLVLYVFLMVYFYRQDLRAEITDKRKTTTTTSSSER
FT                   YRADDAPDTEMGGAGGGGSPPRSAYDNSAYEDEAPARAPASPRFESAYADSPDSPPPPA
FT                   RVENPFDKPAGGGGGAGASPVAKNPFE"
FT   CDS_pept        571743..573308
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634456"
FT                   /orf_name="MICPUN_58538"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63363.1"
FT                   /db_xref="UniParc:UPI000199B1E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E644"
FT                   /transl_table=1
FT                   /translation="MQDQSRTVRKTENRTVRADHAQAWSLKNVLSCISLFWARKEARRV
FT                   AEHRPGDSSRKLPYVSRISENSSVLRHSARRAIDTALRDPEHRLQTSVASDRGAPSARK
FT                   KNSSEHVRAAVGHCRAPRVMLAVATNPAPIKTVRWASRCEALCVDTGAKITEELCDSPS
FT                   RIRTEATQQLREARALAHQQAATSLCERALRAAELAEEHGKLKDAEMILAAIVTQLRRR
FT                   LAAPEIASWLDRQRLRLASIDAEIRDKTEEHRRLQRRLMSSVSANGGQRMLETPVLIRT
FT                   KSLEELQADEDELGVPEAEGAEGEGAPSRAPGTPEPVGRQLLPPRRRVENDENAAPGED
FT                   ETHAACDVVASASLERDRDSSDAGGAHGRADLRDGEGAVPAADVAPEEAPSEVDPGADR
FT                   ASSSSSPLAPNEVALMARACFAQSRVHTLRGRREEAETAREAGATYARMCTHVFGDTDE
FT                   ADCIRSGSPVGGREREGERGGGGGKRPREEDEEEEADATTTGKSAKKESLGRVDAAPRE
FT                   GVFA"
FT   CDS_pept        complement(573361..575073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634457"
FT                   /orf_name="MICPUN_100488"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO63746.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG691938"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199B1E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E645"
FT                   /transl_table=1
FT                   /translation="MGEDEGAGLVGDGKGGGDDFKTCYPNKWYRRYVLFLLFLIATLQT
FT                   TDRNIPAILLPKISPEFNMTDADAGMLNGAAFVLIYALATIPLARIADMCGRKYLLAGS
FT                   LIVWSALTSLSGLSQNTTQLCFLRVGIGLGEAGCTPAAQSLIAVMYGPGERASAMAMQQ
FT                   LGLAVGTAAANFIGGMLIDSLGWRGVFGVLGIPGLVLAALIVATLEDPPVEQSMGRYQS
FT                   VPGSPGGESPGGSKANKPSAAAAAATLTSGAFWAEMWRGVKDTFEHLRRRATFIHLSIG
FT                   VMIQVGVGLSIMAFLPIFLVRSHEMTIKSAGLSMSMVGGVFGAIGIVTGGIVGDWLVQA
FT                   SGDQRWMLWFILICNVIAAPLMVVAVLVKSRTDSIYLSAVVVALFMVMVGPPGAIVQSL
FT                   VPNHMRATAAGFFGVLANLVGGSVGPLFIGWLSDRLSGRYGLDSIRYALAYSMIFCVWG
FT                   QVHWYLAARAMPGDIVEKTATKKPRDFCAVGGDEDGGRAGRDLEGGGGGFYGSLGGGSS
FT                   AGAGRRRGGAGDDTPKASARRGSDLGFGVFSTLSIRIGDEPRERRGGTHYGSV"
FT   CDS_pept        join(575406..575531,575640..575717,575880..576344)
FT                   /codon_start=1
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634458"
FT                   /orf_name="MICPUN_94197"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63364.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000199B1E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E646"
FT                   /transl_table=1
FT                   /translation="MTHDNEFLEGLVKSGMMILLSEIGDKTFFIAAIMAMRHSRLTVFS
FT                   GAIGALGVMTALSAAMGWAAPNLISKEITHYLAVGLFFFFGGRSLYESVVAWDGGGDEL
FT                   AEVEAELADEDEKKKKGKKGKKDASSFLLSPVLVETFVITFLAEWGDRSQIATIGLAAS
FT                   SDPVGVTIGGIAGHAVCTGAAVIGGRHMAEHISERAVAIAGGVLFCLFGAHSLVTGLEE
FT                   "
FT   CDS_pept        576676..579093
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634459"
FT                   /orf_name="MICPUN_58541"
FT                   /product="Autophagy domain-containing protein "
FT                   /protein_id="ACO63365.1"
FT                   /db_xref="HOGENOM:HBG561087"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniParc:UPI000199B1E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E647"
FT                   /transl_table=1
FT                   /translation="MASLSELLNPTGGMEEHDYAQLPSMIEEEYEEEYDDQPGAMGPDG
FT                   HGFLKGEVGSSLRIRNLDAWFQALYQYYKEKGFYCIVTSRVVNLLTLGFTIFLSGFILL
FT                   YLDFAYLSGQCAEDGDECHILRDATFRNPLRHRSFLYNLVVVCYLMLFSLYFLWSLVRL
FT                   AHDFKPLLEMRAFCNRKLQLSDRDIQTITWPEVVARVVHLQATTRLCIVKDLNEHDIVA
FT                   RILRKENYLLGMLNREVIGLKLNIPFFRNRVWLTKAVEWNLDWAIFNGMFDDDFSIRPS
FT                   FYDVTALRLRMRYLAVVNLVLSPFIAIFLAMYFVMNNAERFYRHPGVVGQREWSTHAWW
FT                   KLREFNELSHFTEQRLAAAYKGANNYVSQFPSPVVSMVAKFVSYIVGALAAVALALPLL
FT                   LDDKLLHANVMWDKDILWVTMVSATVLAVSRGMVGEENRVFRPNRYMAEVVRHTHYLPK
FT                   NWRNLAHKPEVQAEFEDMFAFKAGLFLQEMLSIFAVPFILWYPMCESAPDIVQFVRQFT
FT                   VHRKGVGHICSLSAFDFRRHGDARYGAPTNARRDARSKQGKMEKSFVSFHAHYPTWEPD
FT                   AGGREMLTSLAGFKSALYANVGPEGAGVHNATEGGASRFGVASRFGNGNGGGGGSKFAA
FT                   PGSASMFLGDDGGGVGGMARSAVARAGDDDGDAPRDERQEEENQVLLQQFYEFHGGDGN
FT                   DEGNDDGGAAARAADAPRDATPPRSAVKRRPDPPASFEMTESASFTPPSSMPRLSSSLP
FT                   GTGPGTPPTINGTSGAPTSAPSADTTDSDELDAANFDDPPDLFQLENGTRGF"
FT   CDS_pept        join(complement(584265..584597),complement(579175..584169))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634460"
FT                   /orf_name="MICPUN_58542"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63747.1"
FT                   /db_xref="UniParc:UPI000199B290"
FT                   /db_xref="UniProtKB/TrEMBL:C1E648"
FT                   /transl_table=1
FT                   /translation="MAPRGEPGPTPDSPRARAPGDARGGTTDPASRAPATGDGTEASKL
FT                   WYEKLWEEHQRNTDATVKFFEEEHKKNVQKFEAAIEDIKKTAEEAVDGLQSQFEGRKSL
FT                   KKLREERDAALKSMRNAQTKLVAASREVQAAETALKDAGGPKRAPQDAVKRCTLARSSL
FT                   LLARSEFGAARAAKDAAETAVTQAEVQLAKQLKERNVMNLLFKRKLTPEEEEEQRLQLE
FT                   ETRRISAALAIQRNYRARLEVKRQNAKKAERRKRAALAVFNVLRAVLYAFVIYLSLSWA
FT                   RTEGRYALARIKSNVAEAATNRWAVARGSIESFAPLAHDYARYGVASGIEAGENVVLRK
FT                   RNRELRDSAASLESQLDSTRRALETTRGCAGDAAGAGPSNETKDVAARARVAERRADAL
FT                   GVEVHALRALATRCGGASGGVRSDGPTDEYDTSNPMRAWLDDPGVGFSAQVARAAVDAA
FT                   SVASEERVRSAVHAARAASDEADGFKIETELLRSLVDDGFLPAGGPGGKSGWGAAGGGT
FT                   CWAEAAAAASRARAETAKDAAEAAKAAAARLMDEKLAAYAAARREAEARADEYAIELEA
FT                   LKAAGPELAGVSSTGPGLGASSSFSSSSSSTNGNGGLTSGLATVPPFVVAHPDPNARLK
FT                   IVGAAKLVAAARVASERVEQAAEALRDAEARAEARRIEVETLEFLLGGNGTAGGAMERA
FT                   RGYVVGAPKAAEAARDAAHALTHKRLRAEEEARAQAETRAEVYRVELASLRAVEAERAK
FT                   ANARRSRGGGPFGTGSGSCALPPGVTRDGEVATLVKEVARLERELEAAKADLASGAYAA
FT                   PVSIADAAAASTRAANEAAIEAEAASAAASDSLASVASVRSTKSLPRRFAAFLISVVTG
FT                   EPADLAIHNALLERRITAMSRRMASAAGPACAAALSDAIDDRIDAERHAAALQNELDAA
FT                   QRLTATVAAESFLGGDAAAEALRTASDAHRMLLVKERHVAKAALETCRSHAAAAQQRAF
FT                   ASALAAQHASELSERRERELELERVEDRKDRAIRRAVRGVKTRSIDPGTMSSGEDDLDE
FT                   LSDEKWDESPEKKSGKYDDDSSAFWPELPASLAALESAYEAARDDAFRLESTVETLRGR
FT                   VRDAERRARVAPGTADAWGAPRVEPWGLFNAVACSAFFLTLFANRRVAGLAVAHALLRA
FT                   RWSRATARARDLRVQLDAAVDAAAVARQRLYQNVSDEKAIGTTVDELRASIRAHAALND
FT                   AIRADNDGLRKQLLDASAFDSEAHYASVVAERHTAELLSLRAEVEKLRAARLDVSAEAA
FT                   SGAAAGFEEMGDDLREGGAVASHRQGVFAARDAAEREAALLREEAKALREANESLLATS
FT                   EKLRLENHELLSELIEDGTLTQGLSAYQAAKFLKQQAVEAGEQAAAERIVRTELARRFT
FT                   RLVAEAKNARYSTAFIFLGASVAVGLVTYAHLRGDAMSAMLSPAPAPLRFIAPHLTVLG
FT                   ALTAVAFALWAVAYSKPSPEAAAAMTPITRVALVDEDDVELMESDWTRTSPEGKRRARR
FT                   VAPPSTDASSMDEGRRGERPRPSRAAPPEERITERLDIRELQAAVVGADAMIKPSSWGA
FT                   GLAEAAARGFRSPDEHPEAAEERRARDVEIARIRRELQHAKQHAARVRSGKPPSRAGRE
FT                   ASGGESSGRRGGPSDQPARLSVFKAKDVILTEQEERAQLAAAEASAREGSLQSQVDMLR
FT                   DKNELMSKELAKLRRKAERAEEEAEAARAEASLYVSTRNSPGVSMKTSGRASPSTSPNA
FT                   APAPVSPAAVKQALKKKGR"
FT   CDS_pept        complement(<585121..>585567)
FT                   /codon_start=1
FT                   /gene_family="HOG000198052" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634461"
FT                   /orf_name="MICPUN_72715"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO63748.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG745405"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E649"
FT                   /transl_table=1
FT                   /translation="KDERPKVLYIGHVPHGFYEEQMRGYFSQFGEVTRLRLSRNKKTGK
FT                   SKHYAFVEFKHPEVAQIVAESMNGYLLFESVLKVRTMTEAECHPEMWKGANRKFKQVPW
FT                   QKKAATQHDRERSADEQKARNSALLRGERRRRKKIADAGIEYDFP"
FT   CDS_pept        complement(586273..587058)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634462"
FT                   /orf_name="MICPUN_108254"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63749.1"
FT                   /db_xref="UniParc:UPI000199B292"
FT                   /db_xref="UniProtKB/TrEMBL:C1E650"
FT                   /transl_table=1
FT                   /translation="MGDWAHYQSLVTTNLTHLPAGRFVYGRRYLQPFEFSAFWHSAETN
FT                   RAGARAARCEEPGADGGDGPAVHTNGNAGTNRGEPLVSGGGQTSCSSVASGDASFGTAA
FT                   RRRRNGGGGGGGSFWGSNSGRVGATGEWRRREPDGRGAGPPTPPPPGSSSASRRSPPIP
FT                   VPCAKPRESHGATWPGFDASTRARDKAAAAAAWVPRGRWTNERRVNEALEAVPVNSGDV
FT                   NDALARTSLGSPKPDGSLAPARASELTRALSQPSALASH"
FT   CDS_pept        589741..590466
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634463"
FT                   /orf_name="MICPUN_108255"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63366.1"
FT                   /db_xref="UniParc:UPI000199B293"
FT                   /db_xref="UniProtKB/TrEMBL:C1E651"
FT                   /transl_table=1
FT                   /translation="MFQEVGESEFRIIEHSGFYFGFAFGIVQMITFYCVDTLAPNFSGP
FT                   LLPVFGFMVGYATNWFALKLIFRPIHPTRVCCCVVQGAFLKRQDQVSEKFSELNVELFC
FT                   NAKNLWEEMMFGRLREEFGELVKRNTRRFTDVTIGKGAGAVKMVFGADAYARMREKIAQ
FT                   NLVNELPRCVPVSYEYQDKALEVEATVCKAMKGLPPDEFEGVLHPVFEEDEIKLIVVGG
FT                   CLGALVGFAQYILLFSGGI"
FT   CDS_pept        590691..593414
FT                   /codon_start=1
FT                   /gene_family="HOG000033015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634464"
FT                   /orf_name="MICPUN_58546"
FT                   /product="ATP-dependent DNA helicase "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO63367.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG467281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI000199B294"
FT                   /db_xref="UniProtKB/TrEMBL:C1E652"
FT                   /transl_table=1
FT                   /translation="MASHRASRLLEPFARRLRLSNRAPPRWGPVQRRAAAGFSSPAHSA
FT                   EPMFRADAPHLEGMNDEQIAAIVAPVAPMKVLAGPGSGKTRVLVGRVTHLINELGVPPS
FT                   HILCITFTNKAAREMRERLVASVGEENARQITAGTFHSVASRMLRKHVHLLDGYGRGND
FT                   FVIYDEADTKSIIRKIMVDVFMEDKKKADPALAKSRISAAKSAVDACVGMDGRRMARAL
FT                   CDTRPSLKRDPYIRDQFPRLYDEYEANLRSSNALDFDDLLSAAVALLRTSEEARLFYRQ
FT                   RWRHVLVDEFQDTSLSQYELIRALAAETARVFVVGDVDQAIYSWRGAEVANIRTKFDSD
FT                   FAGAGTVLLTKNYRSTATIVKAAQAVIGESRDRSPLELDAVRPGGKDVAVVATEDEIEE
FT                   ADFAAREAARAARSGVPLKDIAVLYRTHSQSRPLEEAFIRAGVPHVVVGDTAFYTRKEI
FT                   KDLVAYLRVLFNSRDTVSLQRIINTPPRKIGPGTLEKLEAWAAGLPWVDGMPQPLGMAL
FT                   LDRTWSTPDQDDLLPPAADMGLAAGAYKAVSGFVSVMRELGEAVEVSDPGALTEEVVRR
FT                   IGFEEYVADMENGDERVGYVKELVSIASDPSAVESLDGVDGGGAAGGGDNGATKRKSTG
FT                   HAGLGEFLEGISLLMSAETRSEDEGADAVKLMTLHAAKGLEFDTVLITGCEDELIPFKR
FT                   GDASSDAAEHDEEVRLFYVGLTRAKRKLFLCRAFKRQRFGRTVYADPSPFLEVIRESLV
FT                   GGKPPQARRAGMGINPAEDDANTDESPRRAALGSDSLAEHLRRTTGAKAATGGSPAFRK
FT                   YAAGESGGYAKANAWKRRMNSAREGGGGGVLGGRRGTREAMGEDDPEAAARRAARRASK
FT                   GSSRDATRATKPRATGVAGAAGGPRAAPRRSRGKIE"
FT   CDS_pept        complement(593491..594369)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634465"
FT                   /orf_name="MICPUN_58547"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63750.1"
FT                   /db_xref="UniParc:UPI000199B295"
FT                   /db_xref="UniProtKB/TrEMBL:C1E653"
FT                   /transl_table=1
FT                   /translation="MNPRRAQLASMLTLLAVVVAARHAAGQAIPSAETRARTTSQTETQ
FT                   TARVSHRPAGRPGVPAASAAASGRDALPSDVSAPRLTSRRASLRLCDGGDPVPTTVFSE
FT                   ETLCLEQPLPGVTRGEARRRALHAASVDVTFAGDRVAPEHVSDPELVTPSDVDDDDTAG
FT                   GGDELLHIDDEETFEEETSDDDAVEDVFVRFTLSVAGLPAGAKGALEAAVTVVPVGRFS
FT                   YDIVWYELSVTYPTFYSHQVDVTIQEGHDAGKPEEEIEQDVEDLKEGSATFFPCTNFIA
FT                   GPFCDEAGISA"
FT   CDS_pept        594544..594909
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634466"
FT                   /orf_name="MICPUN_58548"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63368.1"
FT                   /db_xref="UniParc:UPI000199B296"
FT                   /db_xref="UniProtKB/TrEMBL:C1E654"
FT                   /transl_table=1
FT                   /translation="MLPLAILVPPSLAAGVAGTWWAGRLAATRALGAAEPPRGTFAGSA
FT                   AGVAGAACFWSAMGATVFPAFDAMSSTPAKIESFRDFTRSAGPPTVARCGGVLACFFVA
FT                   GASKTATDVLMASPKAP"
FT   CDS_pept        join(complement(595756..595870),complement(595570..595607),
FT                   complement(594989..595411))
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634467"
FT                   /orf_name="MICPUN_108256"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO63751.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199B297"
FT                   /db_xref="UniProtKB/TrEMBL:C1E655"
FT                   /transl_table=1
FT                   /translation="MDTNRLAKELREIQSDTKSGVTVEVLGDNLAHMQGTLKGPEESPY
FT                   EGGKFYVDIQLTNSYPFEAPKMRFITKVWHPNVSSANGAICLDILKDQWSPALSIKTAM
FT                   LSLQALLSTPEPNDPQDAVVARQYLDSYEEFVKHAKEWTAKYASENRKDEKEEKLKEMG
FT                   FGEAAVRNALSRAAGDEQQALELLLTGL"
FT   CDS_pept        596097..597095
FT                   /codon_start=1
FT                   /gene_family="HOG000282239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634468"
FT                   /orf_name="MICPUN_108257"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO63369.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="UniParc:UPI000199B298"
FT                   /db_xref="UniProtKB/TrEMBL:C1E656"
FT                   /transl_table=1
FT                   /translation="MALASAAVATPAPSWRATNRVGERVGMTFSVATRSRPRAAARRSV
FT                   AAAASSFEVPAEYVALAADLVDAAARITVKHFRTPLEIDDKNDASPVTIADKGAEAAMR
FT                   ALVRERFPTHAIFGEEEGIELGEGGSQEWTWVFDPIDGTKSFITGKPLWGTLVALLHDG
FT                   EPVLGVLDQPVLKERWVGVKGQPSTLNGEAISTRGCKSLGDAYMYSTTPYMFEGDNLTP
FT                   YKEVAKHVKVPMFGCDCYAYGLLAAGHCDLVIEADLKPYDYMALVPIIKGAGGVFTDWK
FT                   GRELRWEGSQEALAAGKFQGEVIAAGDAETHAAAIKRMEMALGVYFVKPEK"
FT   CDS_pept        join(complement(598189..599487),complement(597888..597971))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634469"
FT                   /orf_name="MICPUN_100497"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63752.1"
FT                   /db_xref="UniParc:UPI000199B299"
FT                   /db_xref="UniProtKB/TrEMBL:C1E657"
FT                   /transl_table=1
FT                   /translation="MCRLVEEPLGPGTLHGGLLDGRREWPEIVQVLACDPDSFEPLDLT
FT                   EGVYESEAGSETRVMMTYDDGEWDGAPRRGIGRRDANIANIAPLPGETWLGCWAATCAF
FT                   VAAGTNATLGACRTDRPKHTLAPLPEKGYPGLVAPICLQRRRRQLLWLMFGGAGASDVD
FT                   ERAQIGIGIVCVYATLNYVRYLRSLGARTRVFEAARARAMATAGRLASIGRWELAVALT
FT                   RAAVPEMESDPPNAPKAVQEINRPRRFRWSVPNANNIRSFLRMSLSSRQWCRLCLLDSS
FT                   FPHTKSEDPSVVRHVESNIAVSDWFIDQVYAGTVVRPDNLQDIERLSLSVILTSQAIRE
FT                   MYTVVCKDGKRVLSLEEAVTRDLARTAGGLSVQGNYPSALARLAAAMQARARALGIMAQ
FT                   HLGLDAMSVEDACCLGPPLFIWPHECEHEQPLYKAVRALVGIVKITSACDSERRPSLPA
FT                   QP"
FT   CDS_pept        599955..601184
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634470"
FT                   /orf_name="MICPUN_58552"
FT                   /product="Protein kinase"
FT                   /function="kinase activity"
FT                   /protein_id="ACO63370.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B29A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E658"
FT                   /transl_table=1
FT                   /translation="MTSPVPATATSSLRALLNTPLQAVFEARLESPTQTWRPSSGSGGA
FT                   TQRVVTLRHNDTVGMALTKLARHRGGLTGAPVTIEPDPLHADCMDHGSRVDRDDGYEAA
FT                   VLLGFFDTGDALRALIDALPDEDRKRATGEIIAPTRNVLAWMKLLEQMQKGVTNRRLVQ
FT                   VLGDDAELLYRPNLRGVTLGEAVREGFLHNKSANGFVHRLAIFDEKGEITRVFSMSDAV
FT                   RYLALRSDDMGGLEDMTLAELGLGQDTERLVTVDPSVPAIEAFARMCHKGVSGVGVLDK
FT                   TQGLIANLSASDLRGVTPEHFGMLGLPVAEFLALLHGTSYAGFSHIESQNRSNPFFANA
FT                   KEKAKVLVVAKSDDVLGKVLQLVRERGVHRIYVCERGNKPVGVVTLTDILARVALAADP
FT                   LVSDVVERFA"
FT   CDS_pept        complement(601245..603677)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634471"
FT                   /orf_name="MICPUN_58553"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO63753.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI000199B29B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E659"
FT                   /transl_table=1
FT                   /translation="MGNKGGKPRPASEAAEPAAAVRDEDAPPPLFAADAAGLGDAAISL
FT                   RRCGVACVRVDDAAAALHRACFEVAKDGMDSCEEMVRDGDPLVLADSADSGHATGVHAA
FT                   GWGSSYNQTREGFVFSDGATFGVPRDDPYAAARFEAHCRAMHDSALALARGVLAALERH
FT                   LDVPTGWFEETFGPIANNSQWHVKRYRPERADVHARSIAGCTKASKSEQNDKTVLLPVH
FT                   TDPSLVSIVLHDAPASSDGAAGLEFLSQQGRGVWVEVPKHGHDVATVFVGSVLDRITRG
FT                   AFPAARHRVAVRDPGSLGLSRVAATFFWRPAPNATLKMPPSRSLPDPGEYKQMLFSTWC
FT                   KRVAKRYEAHKTPRPKGKKNGESGESGESGPEKKKENVDPKEEETRRKNVRRERRRREM
FT                   PRISRDPDARDERLALLGGPILGREKYLGGALGSDGKIYAIPGFARRVLRIDPNDGGVE
FT                   YVGPEYPGEFKWLRSVTCPKSGAIYGLPCHADTVLKIVPGPEPIITEIGAGEIGVGLWK
FT                   FHGGVLSPHDGCIYCIPQFAERVLKIDPATDSCELIGPAFPGRNKWYGGLMGTDGCIYG
FT                   VPQNAESVLRIDPKGPNGAECTLHGKYPSGGWKWHGGTVGVDGAIYGIPAHANTILKII
FT                   PGNPPRMTEIGENLRTGRHRTDGKYKFLGGVLGKDGCVYFIPSDSDYVLQVDCETDEVR
FT                   EVGESLENERIVQNKWQNGFCGDDGVIWGIPLKGETVLTVRPPAVKGEGRVVVKTVGGP
FT                   FRGLNKWEGGVMSANGKMYCMPLNHKRVLEIDPFVGGVRAITASMEGMAATAGMNHD"
FT   CDS_pept        603898..605859
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634472"
FT                   /orf_name="MICPUN_58554"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63371.1"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniParc:UPI000199B350"
FT                   /db_xref="UniProtKB/TrEMBL:C1E660"
FT                   /transl_table=1
FT                   /translation="MASSPPPRHDHHRQRSRGRVTPSYVSFPTCLCMLLCALLCSFHTS
FT                   PGGHGAVAAAEEGDGEGDGISQGPYLKVSKVSKHLERARTGEDLRVDADISFRREGLGE
FT                   DDPYLVSLHDRYVVTARIRYVSMFGEERVADMRRVPDAKPTSWTGSIPAEDLPGYGQMV
FT                   RYGVEASAVAREFPFDSLRDSKPKGDKKYATVVDLVAVADETSLPTLHWFVKAPEDEAN
FT                   AMWDEPVGCFLMFPENGPANKGGKLRFYDAVTVRRRGSGRRGQNAAANMWGKRGSKDWP
FT                   KRKLKFDFDGPSFRVDWGDGQRRKVEEVNLHSGYDEPGPGATYLREVLAASAFERVGVP
FT                   APAAKHVVLRRNGEFFGLYVMVENVDGEFLERKGESPSGPLFKAVHWRQSNLRPRAPAW
FT                   APCRYDAAWESGWGACPEVYRYSTSPRHLDEAGARDELDALLSALDAINSRGDATPMRA
FT                   AIDTTLVTREMAVQTALLHQDRCAKNYYVYRSRGTNRWSRIPWDMEDSFATDYRNKAGR
FT                   CDDDGGDACDWAQYCVQSCWKWNSPFFCDRDHPQDIFTESDGRSTWNHLVNGVLTDVDS
FT                   RTAYLRELKRATESLHHSGWLEGEARRLRDVISSDARRDAAKWGLGDLDEGVNALVRQI
FT                   RDRKSILESNYGAWWRDL"
FT   CDS_pept        complement(605940..607205)
FT                   /codon_start=1
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634473"
FT                   /gene_name="Nmt"
FT                   /orf_name="MICPUN_58555"
FT                   /product="Myristoyl-CoA:protein n-myristoyltransferase "
FT                   /function="glycylpeptide N-tetradecanoyltransferase
FT                   activity"
FT                   /biological_process="N-terminal protein myristoylation "
FT                   /protein_id="ACO63754.1"
FT                   /db_xref="GO:0004379"
FT                   /db_xref="GO:0006499"
FT                   /db_xref="HOGENOM:HBG314670"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniParc:UPI000199B351"
FT                   /db_xref="UniProtKB/TrEMBL:C1E661"
FT                   /transl_table=1
FT                   /translation="MADEDHERPAPSDLAEEAGRSFAGMSLDDVKDHAFWETQPVGQLK
FT                   PELDKSGPEGPIDDPMTVDEVKKEGYHLPPSFEWCTCDVTDKKVNDEVFELLDNNYVED
FT                   DDAMFRFQYSREFLKWVLQPPGYVKDWHLGVRVVGTGKLVAFITGVPAKLSVKGKKLDL
FT                   AEINFLCIHKKLRSKRLAPMLIREITRRINLSGIWQAAYTAGVVLPKPIGTARYWHRSL
FT                   NVKKLVEIGFTHLHSRMTMSQTIKFFRLDKKPATPGIRPMEDKDVPAVTALLNNYLKKF
FT                   AVAPVFDEEETRHHLSMRDGVVYSYVVEDPDKPGKITDFVSFYSLPSTVIQSSGGHSTL
FT                   RAAYSYYNVAGKADLTRLMEDALILARQKDFDVFNCLDLMDNAQFLKDLKFGIGDGNLQ
FT                   YYLYNWRLHNKLGPGDIGLVLT"
FT   CDS_pept        join(607590..607667,607761..609209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634474"
FT                   /orf_name="MICPUN_100502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63372.1"
FT                   /db_xref="HOGENOM:HBG389350"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniParc:UPI000199B352"
FT                   /db_xref="UniProtKB/TrEMBL:C1E662"
FT                   /transl_table=1
FT                   /translation="MAFQNDTLYAVTGLFAFSASIMAMTQIAMHLKNYTQPAHQRFIIR
FT                   ICFMVPIYAICSWLSLLHRPASLYLDTFRDCYESWVVYNFLNLCLAYVGGPGNVVNRMA
FT                   GKEVDPSCWAMTCCLPPLPIDGVYIRRCRQGAIQFVLLKPILAGLTLMLTWGGVYGDNE
FT                   IVADRAYPYIAFVYNMSYTLALYALLLFYLGAHDLLKPYKPVMKFVLVKSVIFLTFWQS
FT                   IVCAILVSDGVLETGADGRALQNVLICVEMIIAAPFMLKAFPWSVYSGMGTKGMFNNIS
FT                   HAISIDDVVSDTVHQFAPTYQEYVLHGTEGGPTRKIRLKTHVMMGQEMMNARNGGARGG
FT                   GARGPGGGDERPGAGMLANAGFENSYGMRDVQDDYQDDDDDVWDGEGDVADGEGEGDGE
FT                   GEGGRGTGRPAAGAMAPLGMERREETGTVFDMVIDRMDPVRVEHSLLDGGGGGGTAGGG
FT                   TAGGGTAGGGTAGGGQAGLAPTPPPPRGNRRWDATPAPAALAPPPAFPKP"
FT   CDS_pept        complement(609411..>609890)
FT                   /codon_start=1
FT                   /gene_family="HOG000232629" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634475"
FT                   /orf_name="MICPUN_71451"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63755.1"
FT                   /db_xref="HOGENOM:HBG318148"
FT                   /db_xref="UniParc:UPI000199B353"
FT                   /db_xref="UniProtKB/TrEMBL:C1E663"
FT                   /transl_table=1
FT                   /translation="DLDYLQELIAIQSGGPKNIGFFGTRNMGFLHQELVEILSYALVLT
FT                   ENHIFTSGATGTNAAVIRGALRAERPDLLTVILPQSLEKQPEESRELLEQVENVVERGE
FT                   KDHLPLGEASRLCNEDIVGRVQQVICFAFHDSNTLLDTCMEAKMSKKIVTLFYLD"
FT   CDS_pept        join(610577..611148,611190..611340)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634476"
FT                   /orf_name="MICPUN_58558"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63373.1"
FT                   /db_xref="UniParc:UPI000199B354"
FT                   /db_xref="UniProtKB/TrEMBL:C1E664"
FT                   /transl_table=1
FT                   /translation="MGLFVPVVDQERARFERGSGGDDTASRAHRAFHDPHSLHRGSRPE
FT                   DDTERDVGSQYAKKGNLVKVDGKWVKPSKDRDGRGSKPGVSHALGSEPQRFIPEKEFRG
FT                   ARLGYYFAMGKHGLGYYKDDPRLYRSNQWRDTWEELQAGDARARQARREETKAAREDRR
FT                   DASAYDPHDYRGGRDRHRGGSRDRSRDRWTRRWGRRQGPARSAEEQEREQGPGWARVAS
FT                   QGDDAGGKGEGRAREARG"
FT   CDS_pept        complement(611415..613883)
FT                   /codon_start=1
FT                   /gene_family="HOG000264895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634477"
FT                   /orf_name="MICPUN_58559"
FT                   /product="Peroxisomal protein importer family "
FT                   /function="binding"
FT                   /protein_id="ACO63756.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561098"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B355"
FT                   /db_xref="UniProtKB/TrEMBL:C1E665"
FT                   /transl_table=1
FT                   /translation="MSLRDLVAGPGGGGSCAVPDERASSTNPLGRLADAVLGDRKGRHP
FT                   EHVGPRGAGPGSPGPGAFADQFLSEQRLRGNLLGGDDAGFSALPGQYRGTPGGPREGGW
FT                   AAEFQQQRGAPEGYLSRAPRDLGAPPPMTPPVAPEHPALTAALHSAVADPSIAPASAST
FT                   PPPRDLTLTPREKTVIRNRSAIMARHVHGMAPEHALRARLGAALSPLSIDPTPEGAMDG
FT                   PRQFTMGGHPNGPALADASADSRAGWVHDFRRNENNQFQHQHPLHHQHPQQQQQRGARW
FT                   ADDFAAMSLNPGANAVQWTEEYSGRRASPRVDEIAPAAADGVRSDATADTWAEEFNAAM
FT                   PGGEWAREFRREQDAREQGRAAGAERAHVPTEAQAETAAHAGRIAETMSSDQNPKFQNS
FT                   QFLNFMSRMSRGETVVEGNDVVEVTPGAQQGSAAGERWGEEFARARGGGDWAAEFAAAG
FT                   GPAADWARQFQQNQSVAQRDRDPAQGWADEFADVPEEWAAEFEEMKRGNPDWALENVWD
FT                   QIESEGAALRNAERSHYQFTDPNPYLGRKDALEVGRDLFRRGVLSEAALALEAAVRADP
FT                   KLVEGWRLLGTVHAENDDDRKAIAAMTKANEADPNNLEVLLSLGVSHTNELDQDEAVGH
FT                   MRAWLRNQPRFRALEAEHASALGRTGGVDTPASVLELFKRAASAAPRDADVHAVLGVLA
FT                   HLCRDYDAAVDAFNRALDIAPNDYSMWNKLGATQANSARSADAMAAYQRALDLKPNYVR
FT                   AWCNMGIAFANQGKYADSVAYYVRALSLNPQAESAWGYLRISLGCCGRIELMEAVDRKD
FT                   LELLQREFPL"
FT   CDS_pept        join(<614402..614748,614851..>615380)
FT                   /codon_start=1
FT                   /gene_family="HOG000243414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634478"
FT                   /orf_name="MICPUN_69358"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO63374.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG609554"
FT                   /db_xref="UniParc:UPI000199B356"
FT                   /db_xref="UniProtKB/TrEMBL:C1E666"
FT                   /transl_table=1
FT                   /translation="ERLVAIGDLHGDLNKATRAFRAGGLIDSHGKWIGGATVAVQVGDQ
FT                   LDRGGDEVAILYMLERLRKEARDAGGELIVMNGNHETLNVAGRFRYAFEPGIEDFRRWR
FT                   GRQLLGAALKANRGRSGNAPPPGSASGRMYADTGPGCTMPRLAALAPGGPMAKRFLAHQ
FT                   PVVVAVGSTLFAHGGVLPHHVQYGLERINQETSEWIRGDGKPGPPPVHVSGGRSVVWAR
FT                   DYSWPQRHKCDCGVLRRALDGLPGIDRVVVGHTIQQPEGVNAACDGRVLRVDVGMSEGC
FT                   GGSEPEVLEIL"
FT   CDS_pept        join(complement(619221..619259),complement(618934..619067),
FT                   complement(615670..618826))
FT                   /codon_start=1
FT                   /gene_family="HOG000264896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634479"
FT                   /orf_name="MICPUN_58561"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle fusion with Golgi apparatus "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="ACO63757.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0048280"
FT                   /db_xref="HOGENOM:HBG609553"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B357"
FT                   /db_xref="UniProtKB/TrEMBL:C1E667"
FT                   /transl_table=1
FT                   /translation="MSGLVGRVKNVAKGVGGAAKEFGRIVIHGNGINPDEIDDGGAEVR
FT                   PTHRSPYARGAHPDGVLADDRRSAAHELRDLVQESRVAQFAIGVIGLPTLITSLTEERN
FT                   DTELVHGVLEVLVNALTGGVAGVDGGADTAVREGGEGAHLAHAGAANADAFVRNPANLE
FT                   LALSLLDEEDFYVRYHTMQLLTALSTTNPFEVQSAIMSNPTGVGRLMDNLTEREVIRNE
FT                   TLLLLISLTRGSEDLRKIVAFEGAFERCFNVIREEGAADGGIIVQDCLELCNNLLRGSP
FT                   SNQSFFRESSFLHQLPEMLSLKVPSQAKGGPPLAPQKAANLLCALELVTMLVSSSDVGG
FT                   PAKSAVVNVEGGDDVAAEIAARERAAKEQCRAANQAALAKAGMLDTLLAMCLGVEAVDS
FT                   VPVRVFALRCLGDMVADSRRNQDLLFAAAVRVADVAGKGGYQTTERSEPALLACLRVAL
FT                   RGLDAAERTAAEGVFARCLRGNAELQIMLISTIAPAGEEDDDGERNVSLGGLLARALTG
FT                   KSPHRKGDDPTPIGAPNELEVSCHAAAVLRHALDGNATAKARILTIPLEMPKSSSEPPD
FT                   LLLPRIMRFLSAAVRSSSSSALGEGAGGGGGGVGGAPGFTNAERIAAAAAARKDAEKLQ
FT                   AVLLRLLIAWLHGCAPAVNSFLAPAAHLPMLADLARDSGSSAHVAGLASVLLGCCLCAE
FT                   TLDGHVDAHAVLDVVTARVGLNEFFGRWEEMRKTPEFIAAAAAPVLAKPLTRVTAQKLV
FT                   NRKVGESDGRGEEDATGGLYDHSMASFIDAFEESVKERVITLYARPKPVTAGDFTGSWE
FT                   AKAGESAEAHAARLKSLLRSQDAELAEQRARNAVLAEQLARGGGGGGGPGADPEASGSI
FT                   PDGVESSQVKAAMEHAKAALDAELRAVKLELEESRSATAGAEESLRSLSEAYNGLEAEV
FT                   FRHEEENRALRERLEGLGAEPKPLTAPTSSEADLAAAREEGRAGAIAEMARRIEEAEEA
FT                   AAADVVAAEERGRRSAIAEFAAKLDTSGMDDDVGAVAAAREEGRREGAAELARVVQEKD
FT                   AEAAEAAEQAESELNDLLVCLGQEESKKEALLQRLIERHGEDEAELEELMDACVAEEDE
FT                   DA"
FT   CDS_pept        619460..621712
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634480"
FT                   /orf_name="MICPUN_100506"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63375.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B358"
FT                   /db_xref="UniProtKB/TrEMBL:C1E668"
FT                   /transl_table=1
FT                   /translation="MADTEHRFKYVFIPADESIPVEEREGIAVGSAGGDILVDLLRPHF
FT                   LGGGSFVDADAARREAERHLGPEKAARLSPDRLVAATESGSTETFALVHPASTNGYRGV
FT                   YLYTDECGKLKSLPENPRALELAQRCGIDVRHPFHGDAFVGAVKTSPPPMRNVSFTQHE
FT                   LDPGSPWMLIAPAENAVYAETFREFMSAVEGKATREELEHRRTSVTEETEGRRSRRTSE
FT                   GEEIPPHGLRLRDGVSTYHASLASCVDAPVSVENSCAAGGVGVVTTRRITRGEAIWSEA
FT                   PLVSIQSPSNVDEALCCGWCHRAVGDIDAYLSLTCGAIDGDAARGNGTDRASPPWIAVR
FT                   SLGPSLAALAEAEGTPPIVRCKRWRNRGCKEVYCGDECARYHALAGHDVLCCSDSPLSS
FT                   DGDVREEEASGGGGGDEAERAASSSASALREFFSGNDNLHMIARVVGAMASAVASGQTW
FT                   DEATLRFRAFVGIPWWETSGSTGAEKRLAKRSMRLMTESAHAAELNVAREADAAAEAGD
FT                   EDAFRLARDVRNVLHSFPDVLSRLGLDGVGHLLGVCDMNQLSMTIDGPMRNVCRKLLRV
FT                   DEYEGADAAKQTLDVLLPIALRAQAVRDAEDAAAGKPRWGGEDRYEGDEEEEEDRYEGE
FT                   VRLDETADAEDLFDASRRLFGGFKGQALFSLLCLVNHSCEPSTAARFSSWKGRAMVRLE
FT                   ALRDIECGEELTMSYIDESETLEERTSALASYGFACRCNKCVGEGADRSNDNSDVD"
FT   CDS_pept        complement(<621787..>622548)
FT                   /codon_start=1
FT                   /gene_family="HOG000264536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634481"
FT                   /orf_name="MICPUN_72068"
FT                   /product="Predicted protein"
FT                   /function="biotin-[acetyl-CoA-carboxylase] ligase activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO63758.1"
FT                   /db_xref="GO:0004077"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG320081"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniParc:UPI000199B359"
FT                   /db_xref="UniProtKB/TrEMBL:C1E669"
FT                   /transl_table=1
FT                   /translation="LPPGVVCVADAQVSGKGRGGNAWTSPPGCLMFSLLTRHREGRTLP
FT                   FIQYVATMAAVDAIQESADDALVAAGAKGHRRGTGSAVDAKIKWPNDLYSGGLKIGGVL
FT                   CTSTYSDGGFDVVVGVGINLDNAEPTTCVNDIVRRRLKRDGLPVDGAVQTRVSRERLLA
FT                   GFMNRFEAMCAALDAHDSFETLEGAYLRQWLHTDQEVTLEEDGGRGKVKLVVKGITGTG
FT                   YLLATDSRGARYELHPDGNSLDFFKGLVRKKL"
FT   CDS_pept        623139..625292
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634482"
FT                   /orf_name="MICPUN_50255"
FT                   /product="Glycosyltransferase family 47 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63376.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199B35A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E670"
FT                   /transl_table=1
FT                   /translation="MALRRRGVVPLLAVLLACAARETWAGNAVGSAIARLRGETGSGVV
FT                   EETFSWDDVPSKISTDGSGRRHRESAIDPPVENRAVENPGECVFDPPAPGGHGWLSQRG
FT                   MCPGVGGNCTPTGGLALSGSPPSLPSNCSKECYNIGTCNQELGRCDCPRGTEGESCESG
FT                   LKAPRRKGAGDCLNQCNNRGRCDSGFCKCDAGFFAADCSTYLDLDGKPRLIDDEWEGRV
FT                   RPPPRIYIYPLPPKFNGHVDLRLTDRPLEQMIYERLLSSHHRVANPEDADLFFLPIPTR
FT                   AAFRGGLDNVGGWPGVNDFFHEAIEYVDNTWEWSKKHEWRNTIMVFTGDWGPCEWFSEK
FT                   YSKKENDPDYEAFWKKRRRINEVIANAIVLTHWGLTIADDLYLGGGPCFDPAKDVLIPP
FT                   VNPHFGLGPFDPDGWKAPMGTRRIEFDVGLRGSDVPFGSERAMTEQDEPRRWLLFFAGA
FT                   WVDKPAYADRRAIAEAMAGREQEGIHVVQHAGQFYEKNYASSTFCIAPTGSGWGRRMNL
FT                   ATQSGCIPVIVQDNIAAPYDDVLPYDEFSVRVAKADIPKIPDIVKAITPEKLDRMRQQL
FT                   ACAARALQWSSILGSDFGEGGENDAFALLMLTLQHRLVTHVKPEGWEKLWAPNVPIKDA
FT                   CDIPKALSCLNQTQPICKRPCSKQLRRSGRDKIVEMHGSYFPPGGALCTKDDTPSKEVG
FT                   EEVGEEGLTVTLGPSTVSNTCES"
FT   CDS_pept        complement(625367..635314)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634483"
FT                   /orf_name="MICPUN_58565"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO63759.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR005108"
FT                   /db_xref="InterPro:IPR008976"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B404"
FT                   /db_xref="UniProtKB/TrEMBL:C1E671"
FT                   /transl_table=1
FT                   /translation="MEQSRNRTSSGGAFGQSTRRAGSTMPLPPPASAKSMSGTKQMSAS
FT                   AGAAGSMGTSKPLSSKNWTYRPVVTKRDSLPTTQLPDEPGDLPPMWSTSKWGDVRRSRT
FT                   ADVSTGKRARVKSGPGGSGPSDILIQVAGKEDELKKKLAAYASFNQTERDLLQSAFGSV
FT                   SRERGGVEGLCTRAEFMEVFSRLGVRMSPAIVDAMFGKYGEDRTGRMPVDLFVTAVLSS
FT                   GNRIIAMEERRVGAYKAGDKAGYAFAGRIKYWPCRKGVYAPSNWDPALTARSARAPKAG
FT                   LSLEYVYGYGGLKNTANNLFYNKAEHAVYYTAAVGVVYDRHNHKQHFFHGHDDDIKCLA
FT                   MHPDTCLVATGQVASTAGPPIVCVWDSRVHPKTGELRGLVAQLPFEGYPSIVALQFSPD
FT                   GDRLVVITGDIDHTVHVFDWKTADEALGAIGGPGTVTTGEGGPDEPPTPGLITVGKGGK
FT                   GDSFPHVYGASWNPFGKVDGGGDEEDATIKHKWSEFVTYGARHVKYWRLFHRDDGTPYY
FT                   GKKGSPGLPENSRFSPVTSPIDVMSICWMPPRGNEIVPGGGSALVAGTRDGDVLLFVTD
FT                   PTKGLFCTRKLKAHNPGPKIPELSGGGVTLNGVRCLALRDDGETLVSAGGDGAVMWWTT
FT                   AQLTAAARSKSVPCEPHTTRVLNADDSNRPPAIRSLDCHLYSSDVMVGTYRCDIWEIDD
FT                   QDGPHVMLYGHSADVRALAVHPRHSHVVATGAESGRVYLWNCNGRVLKAKCNTHHPVVG
FT                   LGFSPDGKHLAVGCKDGTLLVLNYDNMLSGEFNQVVKRADKSRCEFHHCNEAIDEVKYS
FT                   PDGKLLAAGSHDNFIDIYDVTGDAVPGRSTGVAYHRLHRLRGHSSYVTHLDWSAFDPKF
FT                   PDRRILQSTCGAYELLYYDGNTGTQVRNAMRDERWDTQTCTLGFSVMGIWPRGIKGESV
FT                   DGTDVNACDRGPAPDGEGEILATVGDSGKVKLFNWPCVVENAPYRRMEWSGDQNAGPRD
FT                   KPKGKPVGYVGHSSHVVNVRFANSGRNLISVGGHDRSVFQWRVDSEAKEQKGVAKRRVE
FT                   PKPYIMDDLTPKLAMTRVPDTSAEEENALNKSNKSDKAEQCDYIVTVVTGDAKGASTGA
FT                   TVVFSAAGVDKDGKTTVIREQRLDNSPENFSRGAKDVFRLRAADLGKLTHCRIGHNNAG
FT                   ENPGWLLQSVKVMNVTKGWEHTLFPQNLWLDRNRGGETTVTLYTSREDAEQAAGAALSN
FT                   KRYIVTITTADVKGSGTDSNVWIDLVGVSGKSTGAIKLDNSANNFERNRVDRFEIEAQG
FT                   MGTSIARARIGHDNSGFGASWCLGEVAVRCLESGNETVFDIPFEGIWLEDGGAHGTAVD
FT                   IFPLGPDGKPTMKSINYKIEVITSDIKFAGTDANVSIDIVGSKGTSGKRRLDNSRNNFE
FT                   RGMRDVFFIEMPDLGDLTAINIGHDNSSIGAAWHLDKVIISDEAKPGKAYVFPAGPKGQ
FT                   PGGRWLEDGLCTVTLTPMDEQGGVLYSVTVQTSDVMFAGTDANVSITLIGEKDGKPTKS
FT                   VPNVKLNNSKNNFERGALEVFDVGPFPDLGKLTAIEIGHDGTGMGSGWHCAYVEVVAVT
FT                   RPDERFFFPIDSWFDVKEPPQKTRQMIKVGVNDPNSNKTTYKIDIHTSDMDNAGTDANV
FT                   HLIVFGDKGDTGKLMMDTSVDNFQRASKDTFSKTGVKNVGRISHIVVGHDEANLGPSWH
FT                   VQQITVFNLATGETVTFNADCWIAKDKAPHYSSEITLSPVGADPIKQCQYQVTVRTSDV
FT                   RWAGTDATVSCRIVGDKGKTGMKELENGSFDRNSEDVFTFRSIDVGTITGFEIGHGGGG
FT                   AGSDWHLSNVKVANIDRPEANPVFFFHDDWCKEDVYVNLKPETSGGATCRYNIAVHTSD
FT                   KRFAGTDSTVTCRLIGDKGESKMLTLENSANNFERARIDEFVVQTENIGKLKGLDIGID
FT                   GKGMGASWHLNMVSVANLGDGQKIFFHHDNWLDDKNLRVTLKPAAPSDASIHNYVVQVV
FT                   TSDLRGGGCDANVSLVIFGDKGDSGELALDNSVNNFERGAKDVFHLQAKDVGKIERIRI
FT                   GHDDTGSLFGPASWHCASVEITNTTTGARQAFSVNRWFSKAKAPNQISQVVHPGDGDHK
FT                   AFGYVVTVHTSDTRGAGTDANVKLALRGKLDGKTTAMGPLPLESSEDDFKRGAVDLFRV
FT                   QGPRMGEITEAVLEHDGAGMLGGSDWNCKMVEVLDEATKQKTVFWCDQLVKKDIPVKLA
FT                   AGGAAAVNDRHRYKITVHTADERGAGSDANVYIIVYGENGDTGKRDLDTSADNFQRGKS
FT                   DIFVIEAPFLGEIRRVVIGHDNSGFGPGWKLDDVIVEDINAASDAPDWHKKRFFTADCW
FT                   LDEKVAPYQTECELLPASGGQRMKKQLVKYFVTVHTSDISHAGTDADVLVELKGPNGTM
FT                   GWTALPEQRGDPFGRGKVSEFTIEGTDVGEQIDKCSVKTEGKKWHCALIEVRHERTGET
FT                   FMFPCDEWISEDAAKERVLLAGVGVEGAAKKVAKGQRKYVVTTVTSSDSYSGTKADVFI
FT                   KVKGPKGEFTQTLEDKTMFGARFEEGKEDAFTFDAADVADVDPKDKSWLIEEVTLGVSG
FT                   GGMMASMMGSDWKLYTVTIQDVATGADLTLVCDDWVKDDAPQVWRRADGDKKTGLRVAS
FT                   ASGDEGEFKYRVEIVTGSKRNSGTDSRVSIALKGDKKPAEWWTPTLLQTEGSFETGATD
FT                   TFMLSRGEDLGTITGIKLSHKSGGMFGDKWYCDKVRVFPITTGRQWVFEVNDWVNDDGI
FT                   ELGAPTLATAGYEKKAERAAKAVECSKVGEFIPTDGEFKLSFYTGAKSGSGTDAVVSAQ
FT                   LVGVKGKSGDMDMDQSPELFDSKSVDSFTRVVEDDLGDLTEINVWHDGSGGGLFGGADW
FT                   FMDKVVVEHALTERTWEATHGDWIKGPRAKGVSLKLAPVKTGITLEGLEKKAADFGASA
FT                   AKGKALEGESPAPAPAPAPAPAPAPAVPAEAPAPAPAPAPAPAVPAEAPAPTPAPVPAP
FT                   AAAEADPVHSLVAGAIEKAVSPKKTQVEVPPVEAVAPTEPTGSEITPKVADEPGSPAPT
FT                   SPMETSFTTQTLKEDLEASAKKAEKVQAETDEFAKIEAEIAKSSPPEEAPKEAAAKAPA
FT                   STITTTSEATETTAASTAADIPAAPQTPKTLNPAGQNYDIAIDQSSSFNDPIQFPIAVR
FT                   VVGKLGEVVAHVPPNSTAVEGFTKLKAKSEQVIGDVTQVRISVVGGPLSPLTPFHVDAV
FT                   TVTHVAEDGESWTVNVGAQIDQFHGELRAGIKASKEMPCEEWQEATVKDKKTGKSKMYW
FT                   YSAERKKSEWKEPAKYFPVKFKKAK"
FT   CDS_pept        join(complement(638051..638098),complement(635628..637934))
FT                   /codon_start=1
FT                   /gene_family="HOG000264893" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634484"
FT                   /orf_name="MICPUN_58566"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63760.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI000199B405"
FT                   /db_xref="UniProtKB/TrEMBL:C1E672"
FT                   /transl_table=1
FT                   /translation="MPPKKKESHAKRMAAQMKKRQEGNKTSGVREAAQVANKSDGRIDA
FT                   REGMATTVFTVESLGLKSTYTGPTKKKGKGKQGTYRRAATTVLAGEAKYDVERRVRDAR
FT                   RALCSDPPAFEEMRCADFDLTRGAVTLMPARPKWDYELKRGKLHSRERKAFVRWISGVK
FT                   NRLREEGRGYAPAFEQNIEVWRQLWRVLERADVAVLVVDARHPLLHTPPALYAHVARRL
FT                   RKPLVLVLNKVDAIPRRAAEEWGRHLLAALPGVDDVVGFTSKDGGGGAGGQKEVRKRIG
FT                   MPAEGTTGGAREKVSRRELALDSKLADAHLLLLSDDSGDDSGADSDPYASESDAEDVTN
FT                   GDVTGGDVNPTPWRLRVGTNALLRVCTRLAAKGKRVAVKKAEAAAEAAAAAAEDAAEEA
FT                   EAKAAAREQPKEEYEDQYGDSDDDEHDDEVAAAALQAEEEEATAAKDGRVMIGLVGHPN
FT                   VGKSSMVNYILGRKAVSVKATPGHTKTLQTLILDDDTCLCDSPGLVFPRIDIGLAEQII
FT                   GGLVPLPIVREPYSAVRWLAELKERTGARWSAMAADSSMSHQDKALANALAATVDKALK
FT                   IPQVTEFDPEILQITGAEDVLNETLPWSPMSLLHQYAKVRGFAHRGGDPDEHTAGNTVL
FT                   SLVLEGRLPYAVPPPEGEPVIGVHVGADGRPVTHAFDKYADSEAAVGGAGGDVSDEDIP
FT                   DDDDDDDDDDEDQVINPFRLLGIDAEGESQYGSGDIDDGGAGRFKMKGLDGKGAAASYF
FT                   GRGGGGGMASMFLTEDDLKESKKGTRTKKGR"
FT   CDS_pept        complement(638246..639145)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634485"
FT                   /orf_name="MICPUN_108261"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63761.1"
FT                   /db_xref="UniParc:UPI000199B406"
FT                   /db_xref="UniProtKB/TrEMBL:C1E673"
FT                   /transl_table=1
FT                   /translation="MSVVTSSVANLKPAARVSPRVASRRSSVTVRNATIGDKFGDAANK
FT                   LKKSIPNVKLPDVPNVKLPDVKVPVPGEKRSPGYVPAGTGEKLYVGQGKYIEADKDGFV
FT                   QKTGRDSQLVGGFAGGEKGFWKYREILEDDPTIVKKKETKIPGVRKGTKEVNLAKDFGG
FT                   LAGGFPGGEVGVKAYNATGNIPTRDAPPTIGWGPPVLLLAAIGAAGYYLNPGDPVEEFN
FT                   TAVSSVEGAKATIDASLSPEQENLVLEGAGVALAVLLGSSVVGSAVKKVGEGLGNVLKT
FT                   GLLGAAALGVAGKILEIW"
FT   CDS_pept        639505..640695
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634486"
FT                   /orf_name="MICPUN_58568"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63377.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG316594"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B407"
FT                   /db_xref="UniProtKB/TrEMBL:C1E674"
FT                   /transl_table=1
FT                   /translation="MENMAEVDPYRVLGIDPKPNLTDAEIKKAYRKLALKLHPDKRKDS
FT                   ERERAQQEFDQLQKAYDILLDPEARAALENLAKARQATRQRHESQDAKRRKMREDLERR
FT                   ERAAERGRNEEEEAKDRLQQELARLRKTFATRRKGYDAEATKGTGADANGRSAHGDGAQ
FT                   KGEDKKATAVDVPEHMYRTLKVVWRKDISDYAASGLREIFDAFGTVEDVVIRDGKRRKG
FT                   SALVVFADAAQAERAGRAQCGDAANPLLAVRAATEPRGPAFGCSGMDTRPQTATKRPTP
FT                   APEPAAKFKPAEPLFPGAANKPLFPGAANAGGGALFPGGAGRTSLFPGGVAAASGGGAG
FT                   GLFPGGGGGVGAAVGVGGGDYESVVLDKMRRAQERARIIAQMEAEDAAAEEEEAGS"
FT   CDS_pept        join(complement(641525..641566),complement(640829..641254))
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634487"
FT                   /orf_name="MICPUN_106902"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO63762.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199B408"
FT                   /db_xref="UniProtKB/TrEMBL:C1E675"
FT                   /transl_table=1
FT                   /translation="MASASSALPRRIIKETQRLLSEPAPGISAQPQEDNLRHFSVMIRG
FT                   PQDSPYEGGVFELELFLPEEYPMAAPKVRFLTKIYHPNIDTLGRICLDILKDKWSPALQ
FT                   IRTVLLSIQALLSAPNPDDPLSEKIAKAWKVDEAEALKTAKEWTQRFAIKN"
FT   CDS_pept        642031..643005
FT                   /codon_start=1
FT                   /gene_family="HOG000264894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634488"
FT                   /orf_name="MICPUN_58570"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63378.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG317281"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="UniParc:UPI000199B409"
FT                   /db_xref="UniProtKB/TrEMBL:C1E676"
FT                   /transl_table=1
FT                   /translation="MVATRRAKRAASSASKRTGYVFCLLLAAQYGLQPFLKVFIADGVN
FT                   KVSLVLGTELAKVLIGVVGMLLDGSLASNFAGWNPRGAAFAVIPSLIYAAQNYLLVFGY
FT                   QSMDSITFNCLNQSKLVSTALCLYLLFGTKQSVVQMVALAGLLVAGVMLQDGGGDGGSS
FT                   SKGTSSSDAKLAVGVAAVIAASALSGVASAACQYAMQRIGTPAPIFTLEMAFVAIPALL
FT                   VSQAGLIAEDPAVLFRGWDARTLIPVFASAFGGICVGQVTKNLGGIAKGFAIVGGLVLT
FT                   GLAQGVQEGRWLETRTLVALVLVVSCVWAHNTHPPAKPKSKRQ"
FT   CDS_pept        complement(643072..644871)
FT                   /codon_start=1
FT                   /gene_family="HOG000215945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634489"
FT                   /orf_name="MICPUN_58571"
FT                   /product="Predicted protein"
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="ACO63763.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="HOGENOM:HBG603351"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniParc:UPI000199B40A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E677"
FT                   /transl_table=1
FT                   /translation="MLIAFLLVVLAASVGAARESRETFQEEALVRPLPDGRIAFVAHFR
FT                   QETSLVARHHETFPKAIAQIARATGVADAELSFTQGRWMYRRWGRPPVGAKPIGAELWA
FT                   AFAAESDEVADEGWANLTAMFGGQFCASLSALRDEQVVVEPALVFRPWDGSARVDRDGI
FT                   SSDNRRRHGSLPAEAVCTENLTPWLKLLPCRDRAGIAALLGSRSSVFGAEYVSFTARVR
FT                   VRGDALELTQSATLVVDANKIAREPEGGHRLTSLLGVDRGGGANGIRACAAATSTAVHV
FT                   QTKGGTAFAFGGRKVHTAVADEGRRVDTAVAADEASRPAWLSWDVSAAEDFDVAVRPGG
FT                   GDEGTVAPELYAERVVTGSGYHRGGISIELRRPEGSKSASGTRARLFQTLPWYVRVFIH
FT                   TLAVEMDGVPVPVPTSGADVGANGGAVEALRWVPGVDRRRPSTMELQVLMPASASVARV
FT                   SFKFEKAFLRISEFPPDANRGFDLPAALLSLPPVSPRDGHEFGESRLLDLVEGVASEVG
FT                   DTHSEGVYMQGALLTLPTPDFSMPFNVTTMVCTLMSLLAGALLTTLTRRPGWEGFGKLK
FT                   AEQRKRLKSLEKEARKARAGKSE"
FT   CDS_pept        join(complement(647145..647238),complement(645097..646718))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634490"
FT                   /orf_name="MICPUN_58572"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63764.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B40B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E678"
FT                   /transl_table=1
FT                   /translation="MATLTGSAGNAPQRFASLSGIRRSGSGFEMDDTTAPLYSNKTSRE
FT                   GFAHWTTSHLPPRKRLGDGKRRFETNLPYGEFAEVPEVHVDPLDTPEKPERNPFWEQIF
FT                   QRAQKRSPSPRKRKDKKGQISYKGFRPSFNFPKALGPKRVGRFLGQKVGQVGQLGRRLF
FT                   RPPLHLLQFAAVLILNVTYSVTYNIGVETFGGLPGHVRQLAKWLWGASERKGEDPHEHL
FT                   KSKLFPEGVPLSPGKIKQKMQDGLHGLGKNSRKLTGMVVGGMRRTCSGFQSQESQNEQR
FT                   RVDFFVKEGRRCNSMCDSAGAVENFRQAVAIRPSDPDLLVCLSKSLSDRVFTEDVFHNH
FT                   PLARAISKEAAEISERAIELNPKCAEAHLCLGAALGRLSMWSDNREKVELSGTIKERCE
FT                   EAIRLDPTSDLALHVLGRYQHQMANLGRIVRALVRVMYGGKLEPGTLEEAEALFRRAVE
FT                   IAPKRLIHRVELGKLLLDMQRKEEAHDQLVLAMTLPREDINSEHERRDAAELLKKHWGE
FT                   KVVIPTFTDPPPTPPPRLSSVSRRSSFDTSGRRSFDDVRENPFLTRAAQQAAAA"
FT   CDS_pept        complement(648046..650226)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634491"
FT                   /orf_name="MICPUN_58573"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63765.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B4C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E679"
FT                   /transl_table=1
FT                   /translation="MPDLEEMGAEGSPAMTSHAGMETTFAEGSGGTASPSMLAMASLEV
FT                   NDRLQHIDELVEKGVDHVQSPLKRRGTPPRSFWVEEPDAHSGGGLGLGGLERQGSLRRQ
FT                   GSGGAGPSSNRSARSHGSDDIVLPGNAGAARGGGELWRPDGLASPPGFASKFAKKPREE
FT                   AVSADGKGVQDPNHVDAQMDAWLRQTVERMPIKPDHVSGVRGPLMNVTAVDDKTVDVVM
FT                   TTSFRAHFSQPISQLGAGAGGGGNRLELPAPGSVGDGAGAGAGRIREIGDGGSRESTRS
FT                   AVPTTPLGERAQLSLRAGAYPGSTGRFAIASPDDYVQSGGSGGSGGGSPKSYEQNRALV
FT                   AGGDVPLLNTMREWEIAPADVQLHERVAVGGFAEVFRGTWNGTIVAVKQLLERGQDVVT
FT                   RLREEAVVLSRLRHPNLLLFMGWCADPPFIATEFMRRGSLHNILRRNGAPLGGPRTHHV
FT                   ALSVARGMQYLHSRSPPILHLDLKSPNILVDDKWRVKIADFGLSRVRRNTLLSGRSNIH
FT                   GTFEWMAPEMLRAENFDEKADVYSYGVVLWELLSAPLTPWNELINVQVVAVVGYDRQRL
FT                   VLGLAAEEAAREDAATRTIGELFWACAGNDPRGRPTFQKVLERLEAALTLMLPGPDGTP
FT                   GAAGTTPKGTTTLEVTAGLGRVAGEGAAGPPANRGAWRGASQIETRADEDKNIAKGPTG
FT                   LVIEEIAGERGEGAAKDEDESGVPYVVDEDGH"
FT   CDS_pept        complement(650514..651416)
FT                   /codon_start=1
FT                   /gene_family="HOG000201102" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634492"
FT                   /orf_name="MICPUN_58574"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO63766.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561107"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B4C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E680"
FT                   /transl_table=1
FT                   /translation="MSAIHAYTARPVAGANPRAGAPRVAGSRAFVAKARRSGRSSVATR
FT                   ARGANFDPNDPMTWNAPAAGEGDDEAFFQEMGAPVEDLMQLSDEQLGQLLGQEGVQVPI
FT                   MIDDDDNASADAPAAAVSDIDLPPATAGEAINKGLALYKSGDYPAALAAFTNALDLPGT
FT                   GPIRSRKARVAPAGPSQGFADASVSLNEQIAVHYNCACCHARMDDPQAGLVSLVRALEC
FT                   GYDDYKNIRSDPDVASLRADARFEGIMGRFEPQGVFEGVFSMLSKGTTAEQRKKGGAPK
FT                   GGGGAELIEGLFQAFKDRK"
FT   CDS_pept        complement(651671..654043)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634493"
FT                   /orf_name="MICPUN_58575"
FT                   /product="DEAD/DEAH box RNA helicase "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63767.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B4C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E681"
FT                   /transl_table=1
FT                   /translation="MALITSLSRGITIRAAATTVIAARATRSRVAPAGIRAVRTTRSSP
FT                   FAPAAAGRSANVRASGFRFRAISTDSAAVPVLEEEDDEEVSNLLGKVDNMYKDLSVDDI
FT                   FDDMEDAARREDDDEDDEEDEDDNKRDPMHVDNFPLSDITKAALRKRGIETLFPIQASV
FT                   LEPALQGRDVVGRARTGTGKTLGFSLPIIESLLSNPSNRTDRSRNPRCIVLAPTRELAN
FT                   QVEKEIQATVPSLRTLCVYGGVAISNQERPLRRGVDIVVGTPGRLIDLIQRGSLNLHDI
FT                   EYCVLDEADQMLAVGFEEDVERIMEEIPEQRQTFLFSATMPSWVTRITQKYLADHVTID
FT                   LVGSQEQKVADTIDVMSCACSHTSRTTILADLVTVYGKGAKAICFTQTKREADEVTAAL
FT                   GRRMATEVLHGDIAQAQRERTLKRFRDGRFSVLVATDVAARGLDITDVDLVVHYELPHD
FT                   TESFVHRCGRTGRANKKGAAIAMYTPREKSRIRSIVRETGVKFRVINPPTAAEVMTSSA
FT                   EQASIEIDLVDDELLPYFTPTAEKILAAVKNGGADGRSESEVLAAALAALSGHTEPPPP
FT                   RSMLTGDVGQTTMIARGNMILPRDLLRAMSEVSRAAADGVGRIRILADNSGLCFDMQHE
FT                   QVKPLLEELDDGYLGPIGVEVADSLPELVEERDRGYGGGGGGRGYGRGGRGGGFGGRGR
FT                   GRGGFRGGGRGGGYERRSFSDRGERGSFQRRDDGGFERRGGGDRHGGSYRGGGYDRDRP
FT                   RGGGDRGGGGGGGGGWDRGGYGGGRGGGGPARYGGYD"
FT   CDS_pept        654766..661359
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634494"
FT                   /orf_name="MICPUN_58576"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63379.1"
FT                   /db_xref="UniParc:UPI000199B4C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E682"
FT                   /transl_table=1
FT                   /translation="MSSEQPLKSVYRSANISLRKADLARQNGDDDEELYHLNQFAKTVR
FT                   LTLQTHRLWERRKDDKDAVELVSKLPEMDARIRELGGTPYTPPDAAPPPRSDSAPSVLE
FT                   AAATQLRVPGQASAAARGAAAARAATRGALLRRSRANSRSNSRPASPERTRPAPPAAPA
FT                   PARPPPHHHPSRHPESARVPIKDDDDDAPGSPSSAEKYGARVQGEVARLFEEAEAVRIA
FT                   ALERKVEMMRARMDATSGAAHGVAGGLSPSKAPRSSTEVSAAMDPYRTLLPSASASVAA
FT                   AIVSSGGSALAPPSGGFADRLESIDAEVTRLRKHIADAAAATGTVTGTSFAQRLDDVER
FT                   EVRETRRASLDKAAYVVAPAPEPRAASSAPVTHHPVTHPSADAPGAWIRRGETEMSATP
FT                   RAPRAGPVMAVGSSWLVKQLSPGTARPSAPAEEPSPPPPPPPPPPPAPAIPSSPPRVTL
FT                   PPAPDIPVPSTRPSAPASEPVATVSDSETKFKAPGPEALAKEQKKKGTSAPATAPPAPA
FT                   PEPPSPATLPPATLPPATLPAPPDDLNAVAAAAAARAIESSLASSRAGSPSKGTRSGPG
FT                   RPDAVLATMDGAKAAAVAAAEAAATAVSERVRRELRFVAERQDALTRRGEAEFNAVVAQ
FT                   VLPLHEETNALRTSLSQLEVRLDSVAEHVASTDGVNMAASAAAVAAAAGAEVEALRAHV
FT                   AKQQKASQDWTESAIAHYGQQAWDHTQRLLLERDQSEQERVKHLQSQLEESHRWQREFQ
FT                   RDVAEKFVQQESAVEAMRRQMMQMAAAMEDMQGELAQQGGQKQSQMNVIMQRLGALESA
FT                   PPRHSVPHPAPGEAGPADGEEKVTSTSAPDARLDTIEARLSTAEDLLGQTAMASARATA
FT                   PIAEAVGDIVPEIHSLRDRLAKMEGLDYGESLNTLNDRLSALEATGMPVAAQGTIGVEE
FT                   IVPEIHSLRDRLAKMEGLNYGKSLNTLYDRISTLEAMGMPVAAQGTIADDDRSELEARI
FT                   IRAESSAAAAAATEVQILKEKLSEFGMRLNRAEEVAAEAAEAATTTSPGTEATKKAVPG
FT                   LRSRVAEMEVEVAARLSDVESRIAELAETCVETAAFIAATPAPTRGARGAPGGSVRGSP
FT                   RRVTPSPRKSPVPPESHASERITEERQVTLHEIALDAVAEVEDRLAVKIAEVEAKMFEL
FT                   ANGGGGEYPTNVETEFASPAGVPVSPRSPGGGGRTPRSPGGGFGVRGELDAVKERLQEL
FT                   SDSFVQVDAIAVDNESLGRRVAELESLQQASAAASTANFNAHESKLAELADVVRRVENL
FT                   EADVVRRVENLEADGETSSELAVAMAGRVHEVKKEIAEIQDTKAIVSSVKSSVAAVQAK
FT                   VSSLAAETAETIEAIRGRQSEMEAELRNVPGLVQSTTRKVSVKVDNLSAEVADLRKHRA
FT                   ADAERMVENEEQVRQAKAMASTAAYLDKENVAPRLNALESLDLKTLRQRLVDMEVMLLD
FT                   AAMAGEEETETRIRERAEFEAGLTPREKFERRIDALEESKRTRARASVTASWGRAEKKQ
FT                   AEGIVIDGSSLNSAAVDAVKGEIENLQRRIEQIERDFVQSRVDATTSDENAAAASANAE
FT                   AASTAAISAAASAAGAAELVADEVEKLRRRLAAVEGQGGNTGTPGTPKRVAPRSPDSES
FT                   RPRAPDSLPPPAEHPAESTMRGAFQGVTAEEAAEAAAALGLSSKGPAPISPMAKAKTAA
FT                   ARARLAAQHEAAKLGIKLGDPSIKPLEDLAASMSPRVDHSDPVALATAADRQLAAELAT
FT                   VCALVEREESRRLEIREDEMRSRIEGSSDRATDAVAIAETRAAQRRWEIAMESQLLRLR
FT                   KAAHEAEERHAVAAAVVRGVDEVGPAQEVAARLSYVHGKVDAMLRAEGVRLERATSRAA
FT                   GEGQQPPWGAGPGLKSPGKVKAAEIYRHLAELERGVSALARTAPAGTVAAAVGVSRSMG
FT                   KKNTEELVEVKSLRHMVRAVQTELGGLQKRLDAVDKRTTGAGRAEQDIYRAQMSEVRSD
FT                   VKALKRGFAETRKMADDSLKRAVKSESTAAGAHAHAEELGAAVTAARGETARLRERVDA
FT                   LAHGADAGLRAIDGKVERVKSSCRGAKATGRMAEARAVALAGELGRVARHVGLDGVGEA
FT                   LRTGTLFQPPKEIKKRPTTLEALAAAPGVGLGTPASAAGDEEDDDLFDLPSLAGDVGVG
FT                   EDASIAPPSPKAVDKSKRKVTWRANVDP"
FT   CDS_pept        join(661483..661930,662012..665520)
FT                   /codon_start=1
FT                   /gene_family="HOG000004809" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634495"
FT                   /orf_name="MICPUN_81374"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63380.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG445702"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B4C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E683"
FT                   /transl_table=1
FT                   /translation="MSDVQALVNYYARAGYGRHVQTVCGEALRSRPGDPTLSFWRAFGL
FT                   ILEGSYSEAIAQLESLMERREISLACVAASIHAHKMARIVDEESVDALEDRMHREEGDA
FT                   NERALLACANFYALAGGPDSWRARGMAERALRMARGDGFDAKTLLGTTENDRARTRKAK
FT                   RWFDEVLDTEEGEGHLEALMGRVKVMERLGQVAGALDALNRVAVIHPSFVPAVAEKAKM
FT                   RMRAGDWDAALETAQGILERDPKNIDALRLRAFYLLGVEGNAAAGRAMIGQLTDALESL
FT                   EGRNARLFVSCSRDLARVAGGTSTTLSALGRMLERARAIEPQDVDVLNEVAYQQQLAGN
FT                   YAGAVGTYREAARVAEMDGTLDNLDSLYGTIHCQLLDGQLTEGGQQLEFLTDVASERGI
FT                   KLVFLTALHAARVKGDVATPLAELEGLLADHTASVQRKPFAYDYFVHMDPDLLLQCAEL
FT                   YLSQESGEPRGKGEPMSPGMERATALLEAVCGKAPGLLSAQLLLMRTRYVAGAHDAAAR
FT                   TAESLLEMDQGCADAHLVLSRIHLSKGDHAAARAALDEAVASDFKVRESPMFSIISAQC
FT                   KVSDGDLEGGLKELEAAMKLPGVRAPLTARQEEEARRKKTIPVSVQDRATVFIMLAEVL
FT                   HKLERAADADAQLKTATSEFAGTPEEVRVMIASCEMAMEKGGDGEEKALTLLSRVTRES
FT                   PHYAKAKMALARIYLEKRKEEEKYIHCYQELAREINDTKSWAALGEAFITICEPEYAIN
FT                   AYEHAATLDKTNDPAFKRNMAKAYVTCLFFKAAVEYMEKECRKDPDAIDLQMDLSALYI
FT                   RLKKFGEAEDWLAKLVNRLENAVDTASLERGVECARMLAKVCEGIKDREGRIESLTRAH
FT                   TMRKSLVLRARADREEYKKQIGLMSELCVEIAGLHQARHDVKSALGFYEEALKNDRTNV
FT                   PALLALSRMRLNSGEIDACQQSCSEVLRYDADNEEASLMLAELMFQKENYETAIYHFSQ
FT                   LLEKNPCNYRALAQLVHLLRRCGRLDEVGRFIKLAHSTSESPQYDCGLNYCKGLVSKFE
FT                   NKPQDALRSFNLSRKDIQWGPNAVYSMVEIYLSPESTDLWDEEAMMDGGGDDQARVAAA
FT                   ESLLAEVHPNRREEPRHVILECYARMMSKSQHGIAEALNILGDIIIQEPNNVPAVLAVC
FT                   TCHMLLRQVPKARNQLKRVEKMPYNASEADEFERSWLMMADIEVQGKKYDHAIDLCHKC
FT                   LKYNRSCAKAWELIGQVCEWEQNYVEASENYERAWQFCGMSNPRVGFRLAWCHLKSKRM
FT                   VDCIDVCKKVLSEHPDYPKIKRDILQKAQAGLRP"
FT   CDS_pept        complement(665561..667384)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634496"
FT                   /orf_name="MICPUN_50263"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63768.1"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR012981"
FT                   /db_xref="UniParc:UPI000199B4C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E684"
FT                   /transl_table=1
FT                   /translation="MDDATRNLEDLKLTPDEVKKFETAFKDPEFKKMFAEYAKEISDPK
FT                   NKAESDAYLRQLEYENKVESVYGKGVQLVIPAAGFMVKTTDEATGRKVFVNVCHSDKCE
FT                   DAKGSKVAGGMQWQVPHTLGGCHEETDKSGATCDAYDFVVSTHTFELCQRDDRIKNMVV
FT                   ETAIEAVNRAHDRKCPLRYTLPRKTFMGPKSGPGVQAIRDKADNKGLKPGEGKVTPGGR
FT                   IAPKGSPAGDPPNGPGRDASQSKPSPFSFDRAVKRPAAGTAAAKEPEGECEPKHTVVHR
FT                   DEGGDLSKGFGRGNSSNEVSKRRDNRPKHLVVRVETPKLESIAGAELDVSDTRLFFQVP
FT                   GKYRLDIPLPFEVDGDEGKAKFDKTSRRLEVTLPVKPARVEPPLRFTEPRVTEEAEEET
FT                   EEEKPLVEEIPSEKVRETASESSGPAKIDQAEAKAAASAAAAVAAKREFEKRGETENQR
FT                   RWREMHEKRAPEPKPPPPPAPEPVEVGEDVDGFMSAARFAGARTGYVFKRDDRGLGYYL
FT                   DNPKPASRPREPEAPPEPEARPAAKSTVSDLESNPEPKNGRATEPTLDDSDAEDEVDVD
FT                   DWDEDELHGEFGRKIVPRGYNSILDIDEEIF"
FT   CDS_pept        667799..668818
FT                   /codon_start=1
FT                   /gene_family="HOG000218838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634497"
FT                   /orf_name="MICPUN_58579"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO63381.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG714567"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniParc:UPI000199B4C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E685"
FT                   /transl_table=1
FT                   /translation="MFRTTDGKPGVRKLIIDTDPGVDDTWAICLALRSPEVEVIGITSL
FT                   FGNVRTKMATQNALYLMEKFGRPDIPVVEGSLTSIVGAEKERIADFVHGDDGFGNTNQP
FT                   KPTLVAVEGKTAADFIVEKANEFPGQVTVVAMASATNVALALRQDPGIKHKLHEIIHLS
FT                   GAFFVNGNVNPCAEANAFGDPEAADELYGSGARVTVIGLDVTQKLVTTARDMARMRARN
FT                   HPHTNFLHDISQFYMQFHRDTVRQEGIFMHDPAALLLAFRKDLFRCKLGRVRVATEGLC
FT                   RGQTIMDAGEKLWSFPNAWTENSRPPVEVALDVDVPGAMRVFRERYGIRSKWSSWLPF"
FT   CDS_pept        670320..671390
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634498"
FT                   /orf_name="MICPUN_108264"
FT                   /product="Glycosyltransferase family 66 protein "
FT                   /function="oligosaccharyl transferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63382.1"
FT                   /db_xref="GO:0004576"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniParc:UPI000199B58C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E686"
FT                   /transl_table=1
FT                   /translation="MVRLVLLLGPACAAASAVALAALYEWIADEAMTVMEAIDPERKRA
FT                   AEQAAAKAKEAEGNGSRAARRAEKKGFGKPTKHFRISDTPAYMAKWFRENPDARKAIAA
FT                   IAFAVCFSIGTSFLNRSWMMAKGMSEPSIMMRARNRDGSIVMLDDFRESYWWLRDNTPE
FT                   DSRIMAWWDYGYQINGLGNRTTVADGNTWNHEHIALLGKCLVSPELEGHHIVRHLADYV
FT                   LVWTTRFAGFHGDDLAKAPHMARIAGSVYKDVHPTDFYVDEMGRPSDYMRQSLLYRLHS
FT                   YGKATDVEPLEKYEEVFQSKNSMVRIWKVLEVDEESKEYVRSGANRRCDAGGWYCPGVY
FT                   PEALEDVLKGKVDYQQ"
FT   CDS_pept        673095..675170
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634499"
FT                   /orf_name="MICPUN_50266"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63383.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B58D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E687"
FT                   /transl_table=1
FT                   /translation="MMFLRQAAELGDSRAMLAMGNAHYWGNFGVPRDFERALRYYERAH
FT                   NQGALLGTVGVAKMSLKGEGAPKNTTKAMDYYHAAANRSSPDALNGLGYLHFYGDEVER
FT                   NLTTALSYFKRAAELGSGDGLVNAGLMLRGGMGCERNISEAYGYFVRCAAMNHQSCQYN
FT                   AAMIEAAGEPELGIPRDCDRAAARMRQVAEVGKWMSPMADGLKAHLAGEDATARWLYDH
FT                   AAAMGVAQAKYNAAFLHEQRARSVRVGYDTIYGTIHGTAEDDDARGHGDESTTSGWAAA
FT                   LRRERERERRTREAAAQVREHLRVVVGDNLATSHHPGTSSRDDPMRLSGALSAEMLRHY
FT                   STRIGFDPSADSIDLAWAALHRGDCAYFGPRRLGGCEVSDHGVALREYVEAGRAARAAM
FT                   DAGRPDAVDAGPLLARALYSEAWMRSRGEGCDVRDVGRARRLLREGLAKGGWRSCLALA
FT                   PPYVGLVLSDNLPFAAEAVDFLAAAFRASRGGPGSSSRPPGSGARFVRRVADAFGGGTW
FT                   RAMHTIESAPDRIYPRWRLYSSAMYAFFVYTVGMMAGWHYVVRPSARFMFGLELAPLPF
FT                   QVWGHGQRMLLRDGAWVPDLGYYGSLRERVRRNMIRDRVRARLREMDRAEAEEAASDEA
FT                   TNAASPPREEAAFPPEGEPRPPPPPRVDVARETPETLPPEEELGDDRSYSPFEPID"
FT   CDS_pept        675329..678091
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634500"
FT                   /orf_name="MICPUN_58581"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63384.1"
FT                   /db_xref="UniParc:UPI000199B58E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E688"
FT                   /transl_table=1
FT                   /translation="MDQQPLQEAVAEPMAAPAEVPAAPVIEPDPPAPPAPEAPAPAPEP
FT                   PAPEPAAEIPPADPTPDPEPVEETQPAAAPEVAPEPEPPAAPEPVTDEPPAPAAAPEPE
FT                   PPVVAEVPEAEVPEVPAEAIQTAPDEPEPEGRPRRKRDRGDAGIDAGGRAQSARTGGLL
FT                   TTASSRQERKALEEEAIYRRERTLDMYHAVESLCFYNAKEIASQMQVVDGALTVRVPHG
FT                   PTVMRVIVADFLEQLPVHILGLRALSKEQREAWFPGDETHWNLESADQLPGYIRRALTL
FT                   LETLCEVAASGKHRRLYQRISSDAVNAVQDLAMLSALELASRKKIKRKIGFRGADDEET
FT                   KRDAAEFLECARTAAQTLKAVCTLYEWRDQYVAAAAATYPPKSDRKPDGAPGSDSLFDA
FT                   VVNAAFCAVRRATPVPSVGTLRSILDVAPARGMLAGAARLACVDGCAAVLARGGVDRLR
FT                   PTLRLGLAAVRLAAAAPDDPAPAVALACARALHAGETAFPELTPEQTEAAAVREGLLPV
FT                   ATHGCALLQTLLDLDLEEPTPFSFLDAAAADDGDDGCAALLAAAVGSVLRQTSEQVNAQ
FT                   TEAAAAGWRGEEGVGWVFAGDAEAEAARAEGGGMMAMMEAGGGEEEEAKALNPKADATD
FT                   GTTDADGANGEGGEEPESPPEKLALPAPVGKGSGALILAAMRSAEALSVDSATQDATME
FT                   ALAAPLARALALPEDVFKQWWCGGAAAKFVHGDDSDIAAAAAAAAADAGVQDGPAGVPA
FT                   LTQVTVNADPGCRIPYAVREELAKAGTLRVAERALLLHHLLGNLHIHDARTSDEFDRGK
FT                   FLGLMVEELGGSRGHEEYAGDDGGRLGLAFRNLGALHAHVEKDLPAGTVAEHDVQIVRT
FT                   LVDEWRCHLPGGGGAAAAASAAAASAAAAAAAAPKPKNDPDDAPISTLA"
FT   CDS_pept        join(complement(679452..679815),complement(678173..679338))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634501"
FT                   /orf_name="MICPUN_58582"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63769.1"
FT                   /db_xref="UniParc:UPI000199B58F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E689"
FT                   /transl_table=1
FT                   /translation="MDARRVDTEVDLALRSATRQKGIDALERACIVRLMRRARRKIFLS
FT                   TAGDRRAEKTSAPIQKLWLDMWSVVALIVDHHRNRRARPRPSPRVTVRTARTGIARTNT
FT                   MGYNRGEKIPGYRGYIPGRNHIIGHSYTEGTKLAEEAVIAMRAGHNPAGIVELLESRPV
FT                   GGKDLTMQKLQRGPREGGYFPLPVDESIGAPHLGKRKPLLDESLGLKDFRLSEVKVGTN
FT                   GPGTMRAKPTASIPELPYSLKKTFTGREVKTTPDDYAGDDGQMPGYTGHLHGRQHTYGV
FT                   SYGNSTRTVTHVRADVAQGPEALLAKSGALNDFVEPKPQGASQAETGQRERGIPGYGGH
FT                   VPVKDFVLGQTYGAAVKLAPGAEDAIRAGARAEQLPGLVERRPSDAPELTMQTIKPTVR
FT                   GHVIPYEPVPLPYRVSKGEVKVAFKTKGEDKKWRNVIQDDVREVMRGTHKPPGYTGYTP
FT                   FKQHVYGESTGKMTRRLRGQAFEDPTTSYDLLNYKDKRPNYEDGDAPRTIG"
FT   CDS_pept        679874..680245
FT                   /codon_start=1
FT                   /gene_family="HOG000075655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634502"
FT                   /orf_name="MICPUN_58583"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63385.1"
FT                   /db_xref="HOGENOM:HBG561114"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B590"
FT                   /db_xref="UniProtKB/TrEMBL:C1E690"
FT                   /transl_table=1
FT                   /translation="MAKNAGKTVLVVDARNPDFTIEPDDEKFGGDAGTAPISDCGTAKR
FT                   PNALNIPFDRATGSLPADGVESLNAKAGGDKGVPIVTHCGGGGRGQKAKDYLIGLGYTN
FT                   VVNGGGPKVTELWERFGSL"
FT   CDS_pept        680444..682204
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634503"
FT                   /orf_name="MICPUN_58584"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63386.1"
FT                   /db_xref="UniParc:UPI000199B591"
FT                   /db_xref="UniProtKB/TrEMBL:C1E691"
FT                   /transl_table=1
FT                   /translation="MGGKPRLEFLRGWIGIAIVNARERPAVAMSFAVGAAAVLPAACAA
FT                   VTIAFFIFVVFFAALSFPIGVTTAVWWVSTRVLVRHKTSDSEIKIAEPSAKPEAVPAAD
FT                   PPRDAVAPRELPVDVDDDPRALATPRPHDPLSTTMTTMSAEDLSTTLTSAGLSDGEQDD
FT                   EANDPTACLTHRGLDLRDVPFNFLPNLASLRRVRVLDLGGNELSQLPGLELLAGTLQHL
FT                   RLSRNWFAAVPPEVKELWALRELDMSRNFVRNTEDALPLAALAKLEHLRVLDFRYNRKL
FT                   FKQETVDALRTMIPQAEVVKLTVSFPAPEGSFVGARPSDRDAATLRAQLEPWSTLALRR
FT                   RLVEDFGEPPTDPETVQRPEVMARLLELYEEEGGALGRRVVRVSGTPVSVGACNALLKE
FT                   LREWSARRKKGAKGHQQERPSISAESYMIIRSPTDFEAKLGAGSRKARQAADKFAKYAK
FT                   LWELAESALREVDPAFADSFTALAVTHGFRGSPHIDKQNIGPFYGLALGDFPAGSGGVC
FT                   VECDARTVAVVDTREKLGKVDGRFPHWVAPYIEGAERYSLIYYQTMGEPTPITTAVFGA
FT                   DAQLAALDEE"
FT   CDS_pept        682320..683435
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634504"
FT                   /orf_name="MICPUN_50267"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63387.1"
FT                   /db_xref="HOGENOM:HBG610804"
FT                   /db_xref="UniParc:UPI000199B592"
FT                   /db_xref="UniProtKB/TrEMBL:C1E692"
FT                   /transl_table=1
FT                   /translation="MDASLAAWSLSARVSACHRVIRVARTVRRPDSTGACRRWTTATTS
FT                   PDSSSGIEITSPKDARRAAAGARRMAEDAAETAAVLATTATSRKNARRLARYARWGDGV
FT                   KGFMEPGLLRLLLAIDDLQAELGVSGALAEVGVYHGKSFAPLALLRRPGETCVAVDCFD
FT                   AQEHNVDESGVGSRDAFLRNLEAAVRECADNEGNEEEEETVGGYDDDEKEHEEDDEEGW
FT                   LAIIEGDSTAVDAGNLTNAAGGPVRLFSVDGCHTAEVTASDVDLASQCLHPDGVVLVDD
FT                   VFNPDWPGVVTGLSKWCTEVKGTDWELAPFAIGFNKVALCRRDTHATYLTATKDAGERP
FT                   YGARVRKTAEFLGWECAVLSHGWIATFHANE"
FT   CDS_pept        complement(683511..684521)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634505"
FT                   /orf_name="MICPUN_50268"
FT                   /product="Rhomboid-like protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63770.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561116"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000199B593"
FT                   /db_xref="UniProtKB/TrEMBL:C1E693"
FT                   /transl_table=1
FT                   /translation="MTVWWNAAAAAAGGGGRPGWLPPSSNGGDGTRRSGRRLGSLRGID
FT                   SGARTGHSRLPSGVNAIGRNIAATLSRNPGHAISVTSGLALGASTLYYDQRPPPSRRYD
FT                   GRSLTSGDPNRALTDALLWATAGGYVLQLLSGHAFTAVGAKVNAKIAQGEVWRLLTPLL
FT                   LHGSALHLMVNCMSLNNLGPVVERQFGREQFMAVYLGSGLLGNFLSYKRCPNNAVGASS
FT                   AIFGLVGALGIYLNRHRDLFGDYGDKVFQNLLGSVGLNAMFGLMSKRIDNWGHFGGFLG
FT                   GAVVAWTVGPNLVVVGAGERVDERREASRTVARRRVVNRPLLQTYTGEFMEEFRK"
FT   CDS_pept        complement(684886..>685434)
FT                   /codon_start=1
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634506"
FT                   /orf_name="MICPUN_81816"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO63771.1"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000199B594"
FT                   /db_xref="UniProtKB/TrEMBL:C1E694"
FT                   /transl_table=1
FT                   /translation="PEETFSSVPGVVKTRVGYTGGDRADPTYASVCAGDGHTEAVKIDF
FT                   DPTVVSYAKLLDLFMAQHDPCVPMSAQYQSAVWPQDEAQLGAVMAAIERVEQTRGRTVY
FT                   TKVEKPKRWYDAEWYHQSYNNKNKARLAAAFGVFVLNNIPHGSFPGQEPLKTVLGGAVF
FT                   LSLLPQLVSPFDRLLSMLD"
FT   CDS_pept        <685877..>686404
FT                   /codon_start=1
FT                   /gene_family="HOG000200811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634507"
FT                   /orf_name="MICPUN_72245"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63388.1"
FT                   /db_xref="HOGENOM:HBG596225"
FT                   /db_xref="InterPro:IPR018790"
FT                   /db_xref="UniParc:UPI000199B595"
FT                   /db_xref="UniProtKB/TrEMBL:C1E695"
FT                   /transl_table=1
FT                   /translation="LKSVWYGAEALGKVVGANKERPSSTGGSSSAAVAEAMAKNGGKLE
FT                   REQVVALLKEDYDQSYFVSGVGELAAYDPDCEFADPFVSFKGVDRFKQNVGNLGGMMRD
FT                   IDLKITGWDERADELETSWRFSCVLDLPWRPKLAAAGGTTHVFDPATGKVIRHVERWDV
FT                   RPGVVVKQLLLPS"
FT   CDS_pept        complement(686749..687804)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634508"
FT                   /orf_name="MICPUN_108266"
FT                   /product="SWR complex protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO63772.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="UniParc:UPI000199B596"
FT                   /db_xref="UniProtKB/TrEMBL:C1E696"
FT                   /transl_table=1
FT                   /translation="MVMYNDEEYENLLQFDQDWSREETDYLFDLLARFDLRFLVVHDRW
FT                   DREKERTVEEMKDRYYAIARKLLEARADNPEEAAAHPIIKDPFNSRHEMDRKLALGDQM
FT                   ERTNALEREERAILDEVKAIEERRRLEARALSNRAAAAFNPYRVDQTRASIDVDEMREE
FT                   AEAEHEEGRPSLPTAEGADKRPPAGVYARGVHVVAVAGEMATAAVGAGGARGVRRIETA
FT                   VEELGVKPPVVSTRAVCTAWLKLREEVTEMLELRKALAKRQEELCGTTPASEAAAAAAP
FT                   AAKAAAEVFQQVGLLDTPRSKAPEVTLGPDGQPIGVRPAKREQKRKMPARYEDAPPSPP
FT                   RRSAEKRARKS"
FT   CDS_pept        689053..689598
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634509"
FT                   /orf_name="MICPUN_108267"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63389.1"
FT                   /db_xref="InterPro:IPR010750"
FT                   /db_xref="UniParc:UPI000199B597"
FT                   /db_xref="UniProtKB/TrEMBL:C1E697"
FT                   /transl_table=1
FT                   /translation="MTMAFMSGHDFDLGGGNAPSMQHSHHQQKKSHKKKAPVPPQPGER
FT                   VAANIGEVSGDPGAQEWIVAVVVAHKPEEGAYEVMDADEESDDGSGQVYHIPEDLVIAM
FT                   PRSALCREGQNFHPGTVVLAVYPMTTTFYRAVVVQSARKLGSEYGDFLLEFEDDGDADG
FT                   LPQRPVPYMHVVKHPQYR"
FT   CDS_pept        join(complement(690035..690090),complement(689698..689953))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634510"
FT                   /orf_name="MICPUN_58590"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63773.1"
FT                   /db_xref="UniParc:UPI000199B598"
FT                   /db_xref="UniProtKB/TrEMBL:C1E698"
FT                   /transl_table=1
FT                   /translation="MASSQGGMYYGPFRGPLYGQGAIGVVDPFLGVARSVAVVPTVSFG
FT                   GVPRVFPTGPAGGIVGPYGRPGPSVVGASRTVVAGVNRPGAGVNRPGGRGLLRTSTIV"
FT   CDS_pept        join(691357..691409,691973..692786)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634511"
FT                   /orf_name="MICPUN_105585"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO63390.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000199B599"
FT                   /db_xref="UniProtKB/TrEMBL:C1E699"
FT                   /transl_table=1
FT                   /translation="MATSGQQPPEAAHAPPQSAAQAQANAYHEQMKANYAAAYAANPYL
FT                   LHPQIMAMNAFASAANPHPPNLVEVQTLLKRYEHMTQGMQKVPSLKELNARAPPYAPPG
FT                   VADAAHINALPPAVKVPPAVAAPNEEPNAVAGAGEEDAEGMPAPCAGKVCANCRTSKTP
FT                   LWRNGPLGPKTLCNACGVRFKLGKLPPPGGWPPGHVPPPAPPRKRPALLDSNGQPVKRS
FT                   KAEKGALLEKDGEKVKKKRRPRLAPDLEAEEGGEYLRAGKVAKTTALLTDYDGAVLLMV
FT                   LAGMYSH"
FT   CDS_pept        complement(693230..>693667)
FT                   /codon_start=1
FT                   /gene_family="HOG000161169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634512"
FT                   /orf_name="MICPUN_73513"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO63774.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG594005"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000199B59A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A0"
FT                   /transl_table=1
FT                   /translation="VELPTQEQMMMDDVMNNNCMVKMVLSCVMGGVLGAGMGIFFGAFE
FT                   PMQPGEEKLGVMQTLRNYGRQSLSKSWSYAKGFAAFGALYSGSECVIEQTRAKHDIYNS
FT                   AYAGCFTGGVMARSGGKEGMAMGCATMAALSVCMDRFMDIH"
FT   CDS_pept        complement(693995..698599)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634513"
FT                   /orf_name="MICPUN_58593"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63775.1"
FT                   /db_xref="UniParc:UPI000199B654"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A1"
FT                   /transl_table=1
FT                   /translation="MSAPDTSGWGEPELRSEIQRLRLREAKAKKKYDQAREEASEKEDE
FT                   VGRLMEKLQDVMVSLDQSREECEELRQQGLGKTFAGVNSASPEDADELAAVKSTLADRD
FT                   AELAKARDFRTKAKAKIQDLEGKLAAARAATSGASGSGSGTDQADETAVALAKANRINV
FT                   RAVAKIKDLEASLAAAIEATAAAETRAAAAESAQRAGPSAEIVSELQSRLDLARSELDA
FT                   VTKTAEANAKAARDAFDAELRDAERRAGEAGEARAAKAESRAVAAKELADARLRAAEQR
FT                   AAAAESAAADVATLNAELNEARTVAKNAEEKCEWNQKKLRKAIEKGKGIEQERNELRAR
FT                   LDEAEAEVSKLKSEAAAREAAAATRAEAAERALAAAERQKEETGAQLAALRAEAAASKS
FT                   SSAASLDAARLLEADLESERKRATSLEADLESERKRATEAREVAAATAEAAANERKVAL
FT                   SKANAELESAKRALSERDAKLAKAKEFRDKAKARLSEAESKEKEYEGKLAASARELDAA
FT                   RRDAESARQTLIEARRNAQESDASRTAEVARYEERVRELNERIESEVGELEIELSGQLD
FT                   ARTAELESVKAEEAALRKQLEAVKKELDSANDNLGKAKDFRAKAKERIAEQDAKLKDSD
FT                   ARIKDAEAKAAVAEGKVKGAQDKASAAEAKLMDAEFEATAAEARAQDAEAKAMASEARA
FT                   KDAESSNLKDSEVKIRDAEMRVTAAEVKVKDAEARAAASEAKMKDAEKALREKSIELES
FT                   IDDMFKSANETSAAARTHLDEARKEFNTRLERDRKEHASKIEELRRELEAQTEVAKAES
FT                   ERARAAAEAADAAAAKVASTEGEAAGEIARAKAAAKEELDAATRRATTAEDQLRVANRE
FT                   LERVRKDFLLCDTELEAAKGGARDAEREKDRAMKDLQMAQERIVALAAEAEAAAAEREG
FT                   ASLPEAAAMEALRREEDLRAELNDLTAELDDARRDADNAAAEAEAKRQRLETKLGETER
FT                   ALAAANERQSAQASEHSRRLERASEELAEMHRKLIQTQSEAAESADATDAVRKRLEGQL
FT                   TDAAALAESRVTQLERQLEVSRDETNALREQIASLEAQKSQTEQKSRELADAERRVANA
FT                   EQRLRVANETAELAAADLRARLSSAERATEAAERRAESERLARGEREGELERAVATLRR
FT                   ELEQRAVAGSNPSAVTSREEVESLEAENAELRRRVTETFQALQGAHTVAEQTKRAAQET
FT                   VRAAKRAQAVAEADLAHVREELAAANAANALTSHAAEAQLDMDQGRLGEVEAALEAQQL
FT                   ALEAAQRNVARESDRADAAAAAAARRVAELNDAREEIDRLRAALESFGGHRGGRGNLTM
FT                   ASTPADTPGDTPRSDPWTSSTPAPFNPGHRQRPNARPPLNPNPREPSTAAKAAAAAMGR
FT                   VPASAYRSRSASPSPREGGRGFESLRGHFAENVGADAVDPNPGAVAGRGRSSGSGGGSS
FT                   QRQRPRRPGRLHDWSDYPYDEDGGGGSSGRARRGGSGARDALDQELANARDVLDLIRGG
FT                   AASSYAGSDDDSPR"
FT   CDS_pept        698793..699983
FT                   /codon_start=1
FT                   /gene_family="HOG000204444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634514"
FT                   /orf_name="MICPUN_97395"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63391.1"
FT                   /db_xref="HOGENOM:HBG738863"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="UniParc:UPI000199B655"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A2"
FT                   /transl_table=1
FT                   /translation="MDGAKAEEVEQERAAFLKICRAFQGYAADAAEEVHRWERMFERLP
FT                   PAHQSLLAHHRDKHVEAYRCVGRNDKFLSDMLATYMGDDVPPHLRVPPAEKTDGVTRAL
FT                   HRVAPVDVEKVRYVLKNLARDWSAEAAGEREQSHGPIIRELTARHPPPGPDRDVYPPRV
FT                   LVPGAGLGRLVMEIARRGYQAEGNEFSYYMLLTSSYILNHASRANEWIIHPWVHSNCNH
FT                   QSDADQLAAVHIPDVPACHAIVDGAAVGGSMSMCAGDFVECYGDDQNVGAWDAVCTCFF
FT                   IDTAHNVVEYLQTIASCLRPGGTWINFGPLLYHWAEGAGYVGDGEELSVEMSLDDVCVV
FT                   AESVGLRIETREMAEARYTSDARSMLQTVYNCALLVAVKVGDEGKGEGESKAKASP"
FT   CDS_pept        complement(701501..702925)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634515"
FT                   /orf_name="MICPUN_50273"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63776.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B656"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A3"
FT                   /transl_table=1
FT                   /translation="MLDAFKVANGGKCVDSLDFKKGQDLALDVLYPPKKKDNSRRRNII
FT                   LAAVFGSLGGVIILYIIARVYRNRIRRREEEDLFPSTATSEGTPEKTSTAVLSLEPVNS
FT                   NSFINWLMGEKVISNSRVTIIEPIATGGEGTVSLGKMNGKPVAVKVLKSLKEAEHEINI
FT                   FRNIPRHKNLVRLLGYTNLDKRWSLVMEYCNYRCLHSCAVSGVLFDIPGGSTSGTKGKL
FT                   LVKILKETLDGLSAIHASRTYHNDIKLENIMLSCYKHPLMCNCIRNGQLDNLCVKICDL
FT                   GMSKTAAFSSYSSGNLGGTICYVPKERADVAGLVRSLNKGNTLLKPQKQWTTNDIYIIC
FT                   DVYAFAITAWELVKSMLAGREIRVGDHGQVCESSPLAMFNGARPDVSEFDPELAAAFAR
FT                   WWAHDPTARTSSVEIARQELKHVIPCIHKLAALAVDPSTPRSNTPASSAHVTGRSNAAS
FT                   HGTGSTRSSDISVTIA"
FT   CDS_pept        join(706317..707379,707435..707445)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634516"
FT                   /orf_name="MICPUN_100528"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63392.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B657"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A4"
FT                   /transl_table=1
FT                   /translation="MVELDSELAARIEAAWRARSSQPNGAECPHTDEGWDRNFRGRDGD
FT                   VLATRGYYPRVSGETAATLASAGIQLEAGVLGYGKRCTTKPARLLRDGSSVAVKIYHDV
FT                   HRPVADHPHEEGAPSREIEARHEEIAEYAREMNIQAGRDMHHPNLLRILAWSARPRDWL
FT                   CCERFDCTLWQHVRSTQPWRTRASQFFRILAPITCAVKFLHSKGNVHKDINSHHVLIRL
FT                   GADGDYAAAVLSGHKMCKAVSSERQGASGMGGNMTRSSTQSSSRRGNISWMDPACLDKP
FT                   YTQSCDVYSLAVILGELLTGEEPYNGEPVGAVVLKKMSGILPFHLTSETRTAWPKTCEL
FT                   YDHVTHRRSDGTPNGTR"
FT   CDS_pept        complement(707562..708035)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634517"
FT                   /orf_name="MICPUN_108270"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63777.1"
FT                   /db_xref="UniParc:UPI000199B658"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A5"
FT                   /transl_table=1
FT                   /translation="MKTPRVRPAVEEVIENFHNVQRWRDDATVMGVLNKFRHVQRYCKE
FT                   AGVRIRFEDVIVKNRADADERRGRIAKMRRAADDALERAREDVLAFAPMERSTKREAGG
FT                   GGGAEGPATERLKTERLKKLQTLAFALAAVAAVLLAAAVRALGGGRGALGSSP"
FT   CDS_pept        complement(<708759..709220)
FT                   /codon_start=1
FT                   /gene_family="HOG000200812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634518"
FT                   /orf_name="MICPUN_82253"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63778.1"
FT                   /db_xref="HOGENOM:HBG505676"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B659"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A6"
FT                   /transl_table=1
FT                   /translation="MASAEDVRREEVELEKRRADAVLTACNLGIVEELERLLAEGATFS
FT                   CRDKTGATPLFFAAARGHADVIDLLCAHGVDPNDDDSLGRTPLHAAAAHDRADAVRALM
FT                   RRDAWIEAPDHADDTPLHLAARMAGVNTVEALLRHGAKVDAINKLGLTPL"
FT   CDS_pept        join(709572..709718,709824..711269)
FT                   /codon_start=1
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634519"
FT                   /orf_name="MICPUN_58598"
FT                   /product="Homoserine acetyltransferase "
FT                   /function="homoserine O-acetyltransferase activity "
FT                   /biological_process="methionine biosynthetic process "
FT                   /protein_id="ACO63393.1"
FT                   /db_xref="GO:0004414"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG692920"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniParc:UPI000199B65A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A7"
FT                   /transl_table=1
FT                   /translation="MATDDHMKIEALGLPPGGEMMNFGRFDLENGFHIDEVTVGYTTYG
FT                   TLNEAGDNAIIVGHSLTSNSNVNEWWGELLGAGDECSLDTESDFIVCCNYLGSPYGSSS
FT                   PVTPDPAKPDGRWYAADFPTPVTIRDNVRLQRKLLDHLGVKHLRMAIGGSMGSMLALEW
FT                   AATYPDFVTELVLIAGCGRHTDWAIGIGEAQRFSIMADAKYKGGDYDPNDQPKAGLATS
FT                   RMMAMLSYRAPASVDERFSRSVMGLGPGEKAKHMRKPSSHVDLDAVAHANESAQSLPYF
FT                   QVESYLQYQGKKFIRRFDANCYIQLTYTLDSHDVARDRGEYLEVLRRLTHRTLVVGITS
FT                   DVLYPFKLQTELAQNLPNAEMYAIDSPHGHDAFLIEIKELNKAIVRFRRGERADPNVAH
FT                   ALGTIEEGEEKLASGLESVAELRGAVLALEDELAKSRAREELEARRGDALLAQVMQLKH
FT                   EMEEMREASVGGRLGEDGGVYSYGGGTVNGAAHGLRVLPANPPMSARRFQPVFGRVKSE
FT                   EGGNAPATALGAF"
FT   CDS_pept        711361..713019
FT                   /codon_start=1
FT                   /gene_family="HOG000264768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634520"
FT                   /orf_name="MICPUN_58599"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63394.1"
FT                   /db_xref="HOGENOM:HBG561127"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199B65B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A8"
FT                   /transl_table=1
FT                   /translation="MRKYQLRHCKFRFSLSCDCTHEVARPRVMANLAMMSGAGVRRWTP
FT                   PASPARSSRVLVHLSIPRGRNPTIRRFSSVIVAEAASAVDARQLEYAAWRKERGVQAKN
FT                   VEVAYFGDVDDTVMRYRGMKAMGRVNEGDVLCELPRESCLVLADDAELPFPDFCTNELW
FT                   AKLVEKNKWAIRVALNLLREVDKGASSGFHPYISQLPKDFDLLSEWTDEELKELQYPPA
FT                   VRAAEAQRKENDEAMELLRKHSPGTLESVTPEKMAWALNMVRSRVFSGRLSDNAVTKAN
FT                   LLPRALAAGTAFAAFLTSQTTEGRWLAVFAMLALVVFDANDGDTDPGSPNAPKLAYVLM
FT                   PLIDAFNHRTMPKTEFEFSSDAFRLRSPAGYTAGEEVFISYGLLGNDELAVRYGFVDPT
FT                   NDQDTCVYDGLLAWLRANHEPLKKAAGAAPDRAKAVRDARLETYASMAVIKANGEADSN
FT                   VLWALRCMLATPEEWAAAGGNAEGMKLGGGAPEKAACTALAAACRARLESMGTTLEEDR
FT                   EKLERGASGRERIAIQYRARKKEILRACVDRYDVK"
FT   CDS_pept        complement(713174..713704)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634521"
FT                   /orf_name="MICPUN_58600"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63779.1"
FT                   /db_xref="UniParc:UPI000199B65C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6A9"
FT                   /transl_table=1
FT                   /translation="MSDSERGFDADIEGALDTSDEMTVGEQLARRRASRDKRSISKRHG
FT                   PSRLGVGTPGGSRDGSSSHRSRRASAVDVEMGGSDDGRSRGVGSGVKEKRRRARRHSSP
FT                   GFTLSDADSDLTKRERLTRRMEAMRRLPRTSRYAQQQMEIIAKALAILDREPPMRTSNE
FT                   NDELSRLLAAVSL"
FT   CDS_pept        join(complement(714971..717228),complement(714440..714689),
FT                   complement(713808..714323))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634522"
FT                   /orf_name="MICPUN_100532"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63780.1"
FT                   /db_xref="InterPro:IPR003659"
FT                   /db_xref="UniParc:UPI000199B65D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B0"
FT                   /transl_table=1
FT                   /translation="MTSPRTLASRSAIIALLACALAVASAAPGVVEPTTGISSDVFDNI
FT                   RSQGRRLSEIIRAGLPAPELRSALGGRIARARPEPTVRGRSLAAKKICEWNPCGADEED
FT                   CEDCDLKASVVYDFKPETPEGRTGFDILEPIVTCMDITLEEECKMKPSCIWYTDETPGY
FT                   CDGDWNSINTAPVPASACTAAEKVDVTMTTLIAREAIACQKFQTESTCNAAQGLTCEWE
FT                   DGMCSVGGLKFFLDLVTGSAKDLHTIVALGRQADACATKTTQSTCAAVTECAWNSGTSL
FT                   CDVADATVKSIAGVENLSGVLSKWNTCQSKSQTDCTGDCKWANGNCELTSKKVSETLVD
FT                   GMSDGAFKTFIADGTYCTNSRASDRTTSQASLSSCYTSGGKYENGTSLPGDCVISDEIK
FT                   HVVAGKPECFYFPGESWFEAILKAPYPGYDKRCPNVMDRFMIKDEQCQKASTKAECGTG
FT                   NYKECLWKEYPDDEGGNRCEFNGEYIWKLIVGDVDGDHLISIMSSCGKQSSEAACGAFE
FT                   KDIDFFGLKYPDKSKVKTTLGFANIDSMDKSNAEELQKAVADAVGGDVKADEIAVKGVQ
FT                   FPVESKIELSTSKSEIDKDRAGFETKFKTGLAADLGVLPSDIVIKDIKESSRRRRGLLS
FT                   SHVQVDFEVDGAPDAVRAKALASQVQSAGGLSSLKTNTGATPTIPAGTTPSYELRLDVE
FT                   PVSSDPNGVAAKLNTATITMGGQTAKVETKAKVEKNTAVLYPPPPPPSPPPGVSAANGA
FT                   KILTEEMDRVRTVERKPGESPALKLTEILNFTPPGDLEQYVELNHPAVLWVLDADKDGM
FT                   FGEEDIHSFAWMMGEYTKDWPQYQWRDQIKGFCYMQLYDRVLSNDGAGGDSVQNARNAP
FT                   QWLKDLEATRPPAPDDPKNPAAGTGMPAFQAWMEMVIEENSPRTFDHDDFPGTVYVERD
FT                   TMHDLYCMFQVNKCWGTFGKRNFQDFLCWLQNDAEVKGLLPLDDDELDDFVPMETVRDM
FT                   VEDIMRGYRCINVHVNTE"
FT   CDS_pept        join(complement(721374..721530),complement(718203..721273))
FT                   /codon_start=1
FT                   /gene_family="HOG000264926" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634523"
FT                   /orf_name="MICPUN_58603"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO63781.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG317117"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000199B71D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B1"
FT                   /transl_table=1
FT                   /translation="MDGLTHLQSPGDTNGTLTPPMSPKSTPGPFSPGSEGRTPTSSEPN
FT                   TPSKGSIGGAVKSSGWKNLKPYPLDRKWKEQLPLGPKDRHRHGTLPNGMRYYVQKTHKP
FT                   KDRAALALAVDVGSIAETEEERGVAHLVEHLAFRATESNDNFAIVKFLESIGAEFGACQ
FT                   NAYTSMDETVYELLVPIDKPNVLEQSLDVFAEFATKIRISDGDVNDERGAVMEELRMGR
FT                   DARGRASEAYWKMLMQGSLYAERLPIGLEKVVREGDPEVFRRFYKKWYRPERMAVVAAG
FT                   DFENLGAVEKLIKQAFAKCAPAEGQPKENPKVERPLIAPHVEPRITCMVDREATKTSVT
FT                   VTFKYEASECATPSGFFTKTVEDSFKLALDNRLYKIMRKADPPFFSAACSIEEATRTTT
FT                   IFSLQIVCEEGKAKQGLEAGLRELTRARLHGFSEQELRIAGAKQLADAEQLFVERDQTY
FT                   CTSLRDELVGHFLRGEFVVGAEEEARITRACVERVKTSDLKEFAKRLNFNNSCVIRAME
FT                   GRALTTEKDIAGAIDTIQREEHAGAITENEMFNVPERLIEEDTLPPPGKIEGERKFPKL
FT                   GFKIVQLSNGMQVAMKQTDFLDDQVLVRCFARGGLSEVDQKDYLDALYANTIASELGSY
FT                   GVKPEILADILAGKRCDVAAKTGTYYRKVDGEASPTDIESTLQLIHMLFTSDVKSMLVP
FT                   EELEAVLRMQEEAIRNRSRDPVSIYNQTIRHLVYGKSFQSQPLRVKDVRKMKPAKACEH
FT                   FNASFGDPSEFTMVLVGAFDERRVRPMIEKYLGSIQPSPNPKGRVLQVTPAPFKFPRGV
FT                   VNRDLRVAMVEPMAQASITFPVNIPNPDYNHKTGQATPSLEGSVALTREKLTCVFASSI
FT                   IERRLLALLRFKFGEIYTCAASTSFAYQDPQARGPYFRGDIMINFSCDPIAGHRLAQLA
FT                   MEDVGAMQREGPTAEEVTTAVELETRALEVRVQENSYWREYFEALHNSRLSPLMEGDLD
FT                   QLYQVSERTRKELMDGLTPEMVRAHLLRCVNLKNRVVVVLRPQRPLWQRLLLPSPTTAE
FT                   GWAVIAGYAGLTVAAVSLYDRYCAKKE"
FT   CDS_pept        join(721679..724584,724742..725222)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634524"
FT                   /orf_name="MICPUN_100534"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63395.1"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniParc:UPI000199B71E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B2"
FT                   /transl_table=1
FT                   /translation="MSAVSARPAAAGFAPRHLRRPQAARVMIPRAAGSGETPQKGTRPP
FT                   RRTLPPREGRPPPASSAPSPPSTSGAAGEDIGAGARGGRGAATRGRGARGRGARGGRGG
FT                   RGGRGRGRGREGDPNLSAEISKRIGVNQDLAKASKIDDVRFVVQKNGNAEAFNAVNVAT
FT                   AYSRLGRHVRDWERGTLDGAEWYLALERRARALTPEMSAWAASSVTWALGRTGRNPGAA
FT                   FWVDLEAKLCTVADELEPQGVANVLWGLAALEHRASPRLRDALEAAAVKHCRFASKEGG
FT                   RDVKRGPVRAPPRRDDRRRPNEGQSPGFKPYELTMMFWALTRLGDEPGMELRGLFEAQC
FT                   GRQLHLLKPQELSMVASAYGRVERVAPLLAAVAEESVMRAGLNNFKPNEIANLMWGLAK
FT                   VHARQLSDGVNFGDLDDRFALDDPEGFGALTRLLAPGVSGKALVRQDLLDVFVDEFSAR
FT                   AHEFTSGDMALSAWAIATLTAKPTRYETRFELDGDGSSATVEVAQANELPSKVAALEPI
FT                   ESAAVVRVKDFSPLDFANLLWAFAKLNHTPGDRFQAEFEEAVIEKISKFDAQVLANTVY
FT                   AYAALQLPGARNVLPLIGLHFKDRLHEFKPRELLMVLWAFTRCSYDPGADAMARFERAM
FT                   RPMTDNLAPDEVTQYLWASAVLKYRPTEGALRGFETRIVDCPSRFSGTPIALTLWAYAT
FT                   LNLPPPFAVMDRFGDELELSRADEFYPQDLSLGFWSAAVIMTQPKADDVPMVNALDTGA
FT                   RERVLRQMAKHLGSLGATSVSPEGLSAIYMAILAVEMHSPSLFAELKSNWGHLAAAAES
FT                   SWRATKGKGPTVSKLQKAVGKTLDELGVEYESEKLVRGGLIRPDFVVKGKAKIVVEVDG
FT                   PYHFSVEPSAASDAGEELEDWFGGGGGETPDALEKDRFGFGSVLRPLGGTILRNQLLSS
FT                   WGWNVVTVSYRDWVKADNDTSGGAKREYLKGLLDQAGYSCLPKDDRGAGLAHTGRLGDR
FT                   CPFFAVAGEFLSSSPNLDVGAAFGEGPGEPVSLPLSDPTSFMATWLKWWLALRSARISA
FT                   FSSRSSFSSAIAASYSFSSSDFECSESTRIASARLTFASEAADATASRRNAASSVASSS
FT                   RLDTSSGIPSHSPRSSRVVLS"
FT   CDS_pept        complement(726268..727641)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634525"
FT                   /orf_name="MICPUN_100535"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63782.1"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI000199B71F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B3"
FT                   /transl_table=1
FT                   /translation="MPLDWPDQARFLEVIRSLRSASRSKLDEIVALARKDARKYYKHSV
FT                   AILVKQIQVKKPRQRVPVLYAINSLCAAGDDDEVKKLFASRFSRDILKCVEAALKCPPQ
FT                   HLAGVRRVVVKWRRRSAFPPPIVAAAAALVGGYAGWDPSLIDNRDDDNKDSDGFDVDDY
FT                   VPSSDECSDGEGEDKGMTAKDDGGDGADAKPSIDAADDEAGLTAAEPSPPVKVPRAKKV
FT                   RAWGAAPKRPERPAVQSQNGGTHAQTGPTGTEAKPDDEPLAWNPPPPSAPIATNPASNP
FT                   PPPASMAAARGGVIGAARGVIGAGVEGTAQVSRVASNSSPPRRRSPPAGPKKDRSSRGV
FT                   AGAGKKGGGRDGDRGRDRRRSRDSGRREPKVEVDRWGDPVRRVSREPSADDGYGGGVDE
FT                   PRRRSPPPPPAAARARSPPKVRSPPRARSSSPERRAPKKQKKRAPLPPSPEKKRTPPR"
FT   CDS_pept        727977..729467
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634526"
FT                   /orf_name="MICPUN_58606"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63396.1"
FT                   /db_xref="HOGENOM:HBG609584"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199B720"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B4"
FT                   /transl_table=1
FT                   /translation="MGKRRLQEEADDRRRRRLGDTDGCQNDYDGWKPPAGSSAPHPVAR
FT                   VAMSTVTPRDFFDRYVARRRPVVLTGGLEGTCWETAWKGWTDDALATCAARDDMVRVET
FT                   RSSVTGAYGVGKYETMRFGDFVQRFRRGDETCYLTASPAAVDAQGRPQVAAPPASRLLG
FT                   DANGGPPFRPKIAGKLVPANVNVWMGASADGASSGLHHDHHDNLYVLLRGTKRFELYAP
FT                   SEICSMYTVGAPVAVHRNGRINYEESGRTRADGDDGSVAARVAAGAVNAAYAELEAAES
FT                   AMANGEEGGAARVEAAERAVDAAMDDAAFTAAGGRGAEGDGDDGDDLDGDGFFGGHDDF
FT                   DDVDDSDLDADVDSDEDEEENEDGGDGAGGDGAGRGAGGGGGAEADPPSFSRVDRDRLS
FT                   EFPRFARAHASARVQTEIRAGEVLYLPAGWFHEVTSKGDGETNRHMALNYWFHPPAPGG
FT                   EDASTYAFETPYGSRARQAMWEDDWAMWEELHQSSEAK"
FT   CDS_pept        join(complement(730787..730840),complement(730319..730609),
FT                   complement(729687..730004))
FT                   /codon_start=1
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634527"
FT                   /orf_name="MICPUN_90780"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO63783.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG601563"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniParc:UPI000199B721"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B5"
FT                   /transl_table=1
FT                   /translation="MPAHNNQLPNAHFKKDWQGNAGACRVRTWFNQAGRKKSRRIAREK
FT                   KAKAIFPRPTAGALRPVVRPPTQRYNFKTRLGRGFTLEELKAAGIPKKLAPTIGIAVDH
FT                   RRRNRSEESLALNSKRLKEYKASLILFPRRTAKPKAGDSDAGELAMAKQFKGALMPITK
FT                   EDKPLEMVSVTEEMKGFNAYQKLRTERMNVRQVGPRIKKAEEEAKKAEEEAKTAKMK"
FT   CDS_pept        join(<731558..732145,732233..>732784)
FT                   /codon_start=1
FT                   /gene_family="HOG000044388" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634528"
FT                   /orf_name="MICPUN_69395"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /protein_id="ACO63397.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG651799"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B722"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B6"
FT                   /transl_table=1
FT                   /translation="QGRDCLATLPTGFGKSMVYQLPAMWREEMDRPGVTVVVTPLLSLL
FT                   RDQLRGCEDLDLNAAAWCGTADKRDTERIDRDLRLDADDGGPGIRLLYTTPESLGSNAR
FT                   LRDALRACARNGFLTSIAVDEAHCVASWGHDFRPAYLALKDFRDDVVGPGVPFQALTAT
FT                   ATPRVKEQIVSALGLRDPALIATSLNRRNLRYEDVALAHLAAMAKETKERWPGSAGIVY
FT                   ARTRAECERLAALLQDKHDVDCEVFHAGRTGEALARTQGNWAGGDVHCVVATVAFGMGV
FT                   DKADVRFVAHWGPPTTLEGLYQESGRAGRDSNPARCVMYVGSNELDELRKVTGGGGDAH
FT                   AAVDAYARGVSRCRRVGLLEHFGERRAGGCGEGEERCDVC"
FT   CDS_pept        733407..735710
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634529"
FT                   /orf_name="MICPUN_58609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63398.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199B723"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B7"
FT                   /transl_table=1
FT                   /translation="MSLLDYGRQDDLWRGDDYLFHHDRPESVQGQYASLKEEETLLRQA
FT                   RDRLARGNKSTQLSPYRPSREAYARWQAAVTIQKMWRGALGRQKAMDRWIAVYQIQRFW
FT                   RGALVRYRMARWRGRPIGPVRKEKAARQRANERELARQKRAEERERRRLRENAEVNAIL
FT                   ARVESVRRGVIQTPSASGTPRSSYGGFAYSPNSTFGSAPATEEPVTPTAMVLTPTSTMR
FT                   SDAPSIDPMPGQTMEVPIQMRDGSVQMLPVMVMPQDSAHRKQRNASVEETANFLMSLAS
FT                   SKASGIGEVESTKFLMELADRTLRMPTPDVDLGSTVASTSISLASPGRNAGLGDTPATP
FT                   TKPTPPPAAMSARRSHPGSLRGVYQRVKERASGDPSRTADGDASGAGAARRDSFLSVPE
FT                   GPSSAPPSASRRNNNLPPDMDDYATYVSPEPTPPPQPQRRPRERFAEAVEDATKAAKAR
FT                   EVTARAGEVAAAATAAESTSSPEAAKIAELQGLIAELDAVQRELLHEIHAEFPEVESAA
FT                   RRSTRRPPAAQLSAPGPPREISFAPTPSPVRAMRERRKAAEEEDAMERYAAMLAGTMER
FT                   EREAGGGTAGGGVSPAHYDPKPAHSGRARPAARFTPASASRRSSLGSVHGSAGATPARR
FT                   RPGSRDPGMAAAAAARRRAIEVEDEEEARISQRLGRVYLAGESRTRHANALVSKYAVNG
FT                   RAGESMGDSGRRGGAARAGSRGSPASILDTLRSDASDPYEAYESHSYSSHKPAGIGNFW
FT                   EIRQGIAREFHSGH"
FT   CDS_pept        <736243..>738411
FT                   /codon_start=1
FT                   /gene_family="HOG000232962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634530"
FT                   /orf_name="MICPUN_65888"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63399.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B724"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B8"
FT                   /transl_table=1
FT                   /translation="SQISSQIKDIRAQMEEDEDLNTLMAGLRGTNIDDSDFAADGVKMR
FT                   VVDLDKIKAEGGDDDRLPLYYDPELIAQYWRRRPGAVAQRILQLSTIAGSFITGIIADL
FT                   VTNKTSENSVKRAIQLREIVTSLGPAYIKLGQALSIRPDILSPQAMTELQKLCDKVPSF
FT                   DNKIAFDTLERELGCKWQDIYSELGPDPVAAASLGQVYKGKLKSNGDIVAVKVQRPAVL
FT                   ETVSIDLYILRRVGVALRSVPQINTDVVGLLDEWAERFFEELDYVKEGDNATKFAASIK
FT                   DDLPQVVVPRTYSEYTRRKVITSQWLDGEKLSQSTADDVGDLVNIGVICYLKQLLDTGF
FT                   FHADPHPGNLIRTPDGRLAILDFGLMTNIDDNIKFGMIEAIAHLIHRDYDAIVEDFVTL
FT                   DFIPEGVDLKPILPPLARVFDQALEGGGAKNINFQEVAADLAQITFDYPFRIPPYFALI
FT                   IRAIGVLEGIALVGNPEFALVDEAYPYISKRLLTDDSPRLRESLRYMVYGKGQVFDADR
FT                   LIDVLEAFETFSVASRTSRGNMEGEAATAATTAAAAPGGFDLNQIFAQIQAGLTPPAAA
FT                   ATTARGGDQDAQTREALQFVLSPQGSIFREFLLDEAVKGIDALSRDNAARVLQQVGLGD
FT                   ATVPLLLPGALLPRSVRLSPRVTDDDRATVESVTKLLNFLLRGSRTADPSKVVRELGPL
FT                   LPAVATEVLPELISRLNSRVAARTIREVF"
FT   CDS_pept        join(complement(740595..740923),complement(738627..740409))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634531"
FT                   /orf_name="MICPUN_58611"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63784.1"
FT                   /db_xref="UniParc:UPI000199B725"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6B9"
FT                   /transl_table=1
FT                   /translation="MQFGECFWRNALLPAVQRARPAGQLASYRTSASPRPPYIRVYRSS
FT                   ELAHAFMAVKLKLGKPIATPESTRRSSSLWSRFCPNDFAEDTEPDPRVVAKAAYLKRVG
FT                   RVLTVLKYLMILGAALSLVTIYGLTDTSLVQEVSPKNLDDYRRILAEHPNVKCECSASS
FT                   IKYSDFGSMNVSLYATCGWVEQDLKKVPLGADQYGVKFSACAATGWKMLCEDLQKSCQR
FT                   GEKVTRWMFKEFNNTPVASMELLSEEFLNQTLATKVDSLREMPELVTMTSIDISAANAA
FT                   HNLPRIVDGIGDIAQRVQLLTLFDAKKWNTSHQQYGAWKEFEESCIASSTNKEITLWNG
FT                   TTFTPSVPCDPANDLYTYFKAGTWKEQEMKLQCYTKECLFGGYRTVIRQEADLNVFDPA
FT                   SFLGVDTRLTFDLYGALIKDTIKYALPETHVGTWLDVHTDGWFLDNTRQICSNPSTWHD
FT                   TKLVPTMKFSAWLEWLFSTVGQSWPESARDSEWHAPNGCDVYTSSSKVSPFVEGKNDRK
FT                   TYEQFRIHVDSKIQENVQKVIAGELTPLGPVKEWYIGFALNWLSTELKWDDVMYNLLFP
FT                   MWGETSPQLARIGKENWTNANMIETVELSISYGTYFDACAPKTCSYVVSGRLPASTLAS
FT                   IILGVLGGFASVCAVLFHGIYSVIRFFALGPERSDEDEEEEEVMSGHPPRAAGLFTGAG
FT                   PPRPSGYAA"
FT   CDS_pept        741591..748658
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634532"
FT                   /orf_name="MICPUN_58612"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63400.1"
FT                   /db_xref="UniParc:UPI000199B7E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C0"
FT                   /transl_table=1
FT                   /translation="MGVPLLSVEMRGDSDPQLSSKAQEILERRREAQKRVAEAQRRAAE
FT                   EKAQADLADAEAAAMAAAEKAAAEKLAAERAAAEKAARASVALAPKPEKWEPLPDLPLV
FT                   KRANNPFGLSFTVDIKTTTVEERRRRRERDEMTPRGPKAGAGASAPGATSEAGGKPPLR
FT                   PGGGKQQPSTRTGMHLTAGVGGFRFVVDFKRMLKVLPRPVVRPTTRFESPEAPARKALP
FT                   FNARGPLADSGFQAGPTYEEAAAEAAALEAKAAAQLAVAEEKVAAALGDAAEWKRRFED
FT                   SEDRLADALARLAAEEARRQDLEFELRQTKQDAADVEQRLTASLKAAEAANEKLREGNA
FT                   ELTRGLEGSTIKIHDLREQLQSSTQLLEAERASGSAQRAEFDKKMAGVQKRAKDAEAEL
FT                   SAEIAELQAKLATVTAQAAEAATAAEEAWNKENMRARELVKETVELREKSAKDREALKD
FT                   QHEAEVKKLTAAHAKEMDNASSVHAAAIEAARVAREKVETDLDGEREGRLADADAAKAA
FT                   AAAASKVARELEEELARVKDELEKVQAELESQVSEYEKTSASSFDAVKSLKNQIASLGD
FT                   TLASERKDRQGERDTAEKKLADLQKKANAARDVASAALKEERRAREREVAGAREEAKKI
FT                   AADVEKAKGEVKKLQDKLAAQKREMDAELESTKSATSSTVGSLESTLAELRAAKEALDA
FT                   KLAEERAAREASDAFNKKQLGIAVDARKEADKKLEDTLANYRKTAAAEKAKLDKKMAED
FT                   AKRHEKETSDLEKALAAEKSAHRVTDEKATAAEAAKNALTEELAALKSSSAKKEAEFTA
FT                   DAIKAADELKKMRIGREAAAAASAEEIKRLNAELEKLREESKAEIKKLEDKIFEQKAEL
FT                   EASLGATKAKASSIQSNLAQITQEKTMLEKKLADEIESRKQQMDKFKAQLGKALEAKQA
FT                   ADRKVDQAIAAEKRAVENAARQVEQEKTMLEKELAEKRKEIEKKAASEANAAAVKRHNA
FT                   EQSKLEAILDSEREGRKADRAQYDSDLAEAIQKARNEAEAALAALRAAKDKLEADLLAK
FT                   SDADKKKSAAALKDAKGALAEAVDAKSKLEREMKAQREAASAEAAAAAEADKARAAAAA
FT                   AAEQKLSAELSAAKEQASKLEADLKKATAAREIASKALDSERAAREKDAAAAAEETKKL
FT                   AAAAAAEAKKLAAADDKAKADLKKLQDKIKELEAELAASTGAVSSAKSSAQASEAAIAK
FT                   LKKEKEDAENKLAKAEKDAADQLKASKDGNAALAEANAALASANKAKEANAAEAQKLKV
FT                   DLSDVTNKLKALEDKKKSADAKAKSDAEQAAAALKAAEGKAKADADKAAAAAAAEAKAK
FT                   ADADKAKAALKAALEKAKADAAALAAAEAKANADAEKAAAAAAALKAAEDRAKAAESSA
FT                   KDAAENLKELDALRADLEMFNSRVIALTASEASLKAELEEANKKGADLEKVQKELEAAK
FT                   KAVEASKKEEAALKKKLEAIEKTTSTADQEKGAKLASLETEIEKLRAELEAANEATKKQ
FT                   VANAVEAAKKAKSETDKLKAEADKAKADMDKLKSDAKNAKTESDKAKAEADKAKADMDK
FT                   AKAEADKLKADMDKAKAEADKAKSDAKNAKTESDKAKAEADKAKADMDKAKAEADKLKA
FT                   DMDKAKTEHKAELEAASAAAASTASAKGDAAAKAEKDATAAKADAEKAKTALKAALEKA
FT                   KADADQLDKAAKDLAAEKAKAEKAEKDAAEKAKAAKEAAEKAAAAEKAAAAAKDIADKL
FT                   TKERDEANKKLGDATTQVTAMTAATEGRDAEIADLKRLLAEAEEAAKALEKEIQEARKK
FT                   KKEEDSDSDSDEGEFTGMSLKELVEAKKAAAAKKGEGVEEIDDEPLQPPKNKKGTPDSD
FT                   KENTEAGSSPKSVIAKGPSFTVGCQFESNEAESFRTELMVVRGQMQVLAARLMNLGKQD
FT                   LVKVTNEDIEEQRKKSAEEEEDDDAVKALALTEDWDDKKNDGTLITPRDPAGGENLRPL
FT                   VENLRKRIAELVTKGQAARARILALEGELTAAINEKDSAAQWAQMCHRRAIGSEEAAVF
FT                   ARDDLRKLKQLTRAIRMGEMDAVGEKLDSVRASMRIEELTDKLEAEQETHEVTKLMLED
FT                   AEERATAAELRLETEKKKKKARTEWDKIMSSTFKRAGATPVKERPEEEAAALLEDGAET
FT                   PEKAETPVSPAPAASGFSIFGFGSSTPAPEPAPAEAAEASSDEETISAEALSKDAKEEP
FT                   AADDDDDDDDEEEAEEEEEEKEEEEEVKPESQPTSSASAGGGFFSFFGFGAAAPDPEPE
FT                   PAGTDDDDETISAAALTPGVEQVAAEAAEQTLNTTTGSEEDEDESGGSGFWKRAHQKAK
FT                   MDDDSDDEK"
FT   CDS_pept        complement(748726..749382)
FT                   /codon_start=1
FT                   /gene_family="HOG000115733" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634533"
FT                   /orf_name="MICPUN_81517"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63785.1"
FT                   /db_xref="HOGENOM:HBG563238"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199B7E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C1"
FT                   /transl_table=1
FT                   /translation="MAPIKLIYFDIPGKAEAIRLCASVGKVDFEDVRISRETFAEMKEQ
FT                   GALPYGQVPALDVGDGRMLAQSSAILRYVATLGGLHPSDPIEAARIDSIVAEEEDFFSG
FT                   LTISRYAGRFGYGHMTDEFRAEVRKNLNDEILPKHLSFLEMLLTNSTTGWLAGTEKPSA
FT                   ADFVFVPRLKWLVSGANDGIDSDLLDGFPNVKALIAKMMALPEVVSWYEKNPPPQ"
FT   CDS_pept        join(749514..751155,751195..755189)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634534"
FT                   /orf_name="MICPUN_58614"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63401.1"
FT                   /db_xref="UniParc:UPI000199B7E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C2"
FT                   /transl_table=1
FT                   /translation="MGRWAGRVRRWHHVIVILAWLLAISALPVSGQSNDSNATPPASPN
FT                   PPPQPSPPPPGWGYEPSVPQYRVSRGVAYPAVPMRLRRETSVMLQVQLEGPGIVRYIAT
FT                   PEGYSVEVNATTGERNFSPSVAEVRDGSWGTGVLAAGIINVTVANTTFTANVTNLTKIG
FT                   RNDLWVATSAPDDLATAGAVAMLDATTRDATPPAFVPWYNASTPITYLAPDGVDVAVAL
FT                   DEPGWAYVHVLAPERQVPSGEQVKERALANYTWSKWTEVTEVGKLYGSAVFGLQSATRY
FT                   AVYLTVEDLWEPERNILEPAMRWEFYTFDDVPPRGAISLGTVTNEGFTIMGESNKNGTV
FT                   RFVVVPSANEKKPTFWDVMFGVGYGQKQPTSTLAENTTESYERWFYGKYDDDPRMTFGP
FT                   VSAKGVFNVSGVGANALGAASAAVAVGVASGSAVVEGLSSETAYDVYAVVSDAAENPAT
FT                   GQTINHNVTVLTILNVVTLDDTPPALIGENTTGGTVANVKPASFDLVTRLNEPGRVWYV
FT                   VTPHVAPAVAVYWNDTCFDRYSHAYFKPVSGLLDPREHEYVCPSEDAVDSGLGDRVRWI
FT                   GAPTVEEVMMGVGPNRTQAAACGYVDVPTANVEVTKTIASVFDPSAEVDRCANWTAAYD
FT                   ENVTGGVYTAMDDRAASDAENDGRRGVGDMWVYGWYHGEYLTEKYAIGNWSKWVANASD
FT                   LPAYPEHPTCRTCPRLSPEGAYDVWIVAEDDGNDPAYNLSAAGNGTITDSVATSRNRQA
FT                   HATKVMVINPTDWHGPTVVMADNTTATFVPGYPKLTSLNGTAMKLEVALNESGAFVFSL
FT                   RPGTNDSAALNRSQIESAAGWNVSYQALMLKPWMEEKTMTFDNYNYLHNWFLKDPPEEA
FT                   KKYPDLQLGANAGVIWAKNATVPVIHVITDVPRPSSWIGEDRQGPTLAIDYFVVDEEPT
FT                   RGSSLTQPNWDGSTHHLAVRMKDVLAPLWTAGPFVSGVAVPASSVDDLFLPAGSKVGSQ
FT                   YARLVVNATVDEGGTVYFVVCAVPATGGDEPTPTVEQVINATVCDDGSYPKIAAASFVA
FT                   ASNVATEWQSLGYPLVQGSKYVAYLVAADDTTTGAGYNAQDNVTVVRFTAEDMRPPVFS
FT                   DFVGGAPAVVNGTSGGSLTLTLALASPGRARWVVVDGGSPATEPTRAEVVAGTGAGGST
FT                   PLARGTVVVSNESYVDSVVTTVIDVTSAGLGAVSSAAAGYSVFVATVPGDDDSYSGNGD
FT                   RHEDVPSTNAAKVAPGLVVDPDATMSAADALDAGALCVGIEALGETSVTLRFAVTGAPA
FT                   TVAYVILRHALPAPTPAQVLAGTDSKGRAPLAAGGSDFAYTGSASVAGAANLTTAFNAT
FT                   AVGAGVTNLTRGTRYDIYAVAALTPVDARNGPDGAASPYASASVPPRLVKRVIRTLDET
FT                   APFFLPGFPRVGAVAPRGVTVAVRVDEAAAVWVVALPTGAPVPSAADVAAAAVHLAGAN
FT                   STPAVAAANATSTSAGVASMALAGAVGDTDTMGTGLDADLGWEPMMLSLSGLSPSKRYD
FT                   VYVTARDFHRDDLPVGFPAKLGTLQGRATKLLASTPDETASLVSLVPSAGSLSPPFSSE
FT                   LSSYRLLVPGDATAAATVSFTATSADLRWKVLADGAELKPGASTPTFIVGEVARTVVFE
FT                   VEGVSAPSSYSVLLVRADAAVAAAAADDTLAFLAVELDTGERLNSTSMGGAPWPKCAMR
FT                   CRPPGSPDGCLADRRGCALDPHRRLYRVVAPVAAKRATVTAVTSRPGASVRVFLGPPAA
FT                   YAGAPALNSSSADEETWGLAGSVPTPMSTVVDLARVEVLSPMPEVAAIYLGVTSADGTR
FT                   LTYYTIQLRRKGPGAYEGIENRPRNAQDDPPPREYDHFSHPETVSPVDRVATDNPLTFY
FT                   PDEL"
FT   CDS_pept        complement(<755653..>756711)
FT                   /codon_start=1
FT                   /gene_family="HOG000220863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634535"
FT                   /orf_name="MICPUN_66699"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63786.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B7E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C3"
FT                   /transl_table=1
FT                   /translation="LTALERAEILEYPRVYFAGIGAKKVQSKEAGGSDNHGYDDERGDY
FT                   VMRKGDHLAYRFEIIDELGKGSFGQVMRCYDHKMRRTVAVKVIRNKKRFHHQALVELKV
FT                   LEHLRHKDQKDEHNLVKMEEYFYFRSHLCITFELLSINLYDFLKNNNFRGLSLGLIRRF
FT                   AQQILVSLKFLRRQRVIHCDLKPENILLRQPNKSSIKMIDFGSSCFEDERVYTYIQSRF
FT                   YRAPEVILGVTYDCGIDMWSLACILAELYTGYPLFPGENEAEQIACFMEINGVPPRALL
FT                   DKSERGKKYFDSSGEPKLVTNSKGKKRTPNSKDLGALLRCTDRGFIDFLSRCLRWDVAD
FT                   RITPDAALRHPWI"
FT   CDS_pept        757955..758335
FT                   /codon_start=1
FT                   /gene_family="HOG000250143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634536"
FT                   /orf_name="MICPUN_58616"
FT                   /product="Predicted protein"
FT                   /function="racemase and epimerase activity, acting on
FT                   carbohydrates and derivatives"
FT                   /biological_process="rhamnose metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63402.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016857"
FT                   /db_xref="GO:0019299"
FT                   /db_xref="HOGENOM:HBG649684"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="UniParc:UPI000199B7E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C4"
FT                   /transl_table=1
FT                   /translation="MVKCYAQTICLKNDPRGIEEYKRHHADCWPEVLGALKAVGVLRMK
FT                   IFLLETRMFMYMETEDDFDPEVDFPRHLEMSPRCVEWGKLMSTFQTPAPEAKDGEWWAY
FT                   MEEVYDFESQHDAKLGPRGSIG"
FT   CDS_pept        join(complement(758517..759254),complement(758437..758484))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634537"
FT                   /orf_name="MICPUN_58617"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63787.1"
FT                   /db_xref="UniParc:UPI000199B7EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C5"
FT                   /transl_table=1
FT                   /translation="MAHDAPPSPELDDRTIETAIALDIDPFAEDHLLWIARSAQNDAEL
FT                   PPGWHRCTLADLSEGYANPALGVERPDHPRAEEFRVLVAQERRRTAARAHRPHPEQPRK
FT                   RARTGNASGGGGGGDENATSRMGKTLHVDARIAAMEASHRIALKGAQRKVAELERRLIE
FT                   REEAWENERMEAEARTHRVVVEAEERSRVGLEDERRAMRDTIRRAVERERKVAAEEATR
FT                   AVKTSLRSVKAAEAEDARRRELEAGGGAQQDARLRAGGA"
FT   CDS_pept        join(759628..761479,761512..761534)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634538"
FT                   /orf_name="MICPUN_58618"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63403.1"
FT                   /db_xref="UniParc:UPI000199B7EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C6"
FT                   /transl_table=1
FT                   /translation="MRRFEYDEAYEDEDVYDDDEPGYHPVDDDEPDLDLNAPGLDIAGG
FT                   PDGATDWDLGLTEDRLAELAGTDDLATCSHLEIRADATRDDLSGIGRAMPALARLRLSS
FT                   SVVPAARAFGSAFQRLQVLWIARSGLEDLAGIGALVQLRELYAAFNDVSDVSPLAELDH
FT                   LRAVDLEANRVADEDAPDYLGMCPALNTLSLEGNPLSRRRHYRRLVARAVKGLVTLDDR
FT                   DVTEAERLGGAGGGEDEDGGRDGTGGEDGTGGEDGTEVDVGTSGEDEISMVADGIKYAA
FT                   VGIDDPDAVITRDEVTGDLSIEVAEDPLADHGPPGGGEFFPSRPSTSASVQPIGARPGT
FT                   SSNSSDSYASSRPSSRPQTANSLARSNSLGAALRSAASSRPGTARSRPGTAASAGSRSR
FT                   PGTAASWGACRPGTASRPGSREWGMHRPGTSGSGASRPGTAMSAEGWGFGGDSLQDSLF
FT                   WKKNRVKETRAGMADRGDSADGGGFADGGASKLTIGAGTLVGNPAKLLSRRKKEAPAEA
FT                   DEVADGDESKEGVDEKDDILAQLRRWKIEMAESFSRFQLERDVDLEFEVPEKFEAMPPP
FT                   PPRPPQPQAQQASGGYAPAPPPPRFTPQPPKMVPHPPPPRGGGGIQAA"
FT   CDS_pept        join(complement(762601..762725),complement(761623..762511))
FT                   /codon_start=1
FT                   /gene_family="HOG000203918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634539"
FT                   /orf_name="MICPUN_105588"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63788.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG329518"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="UniParc:UPI000199B7EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C7"
FT                   /transl_table=1
FT                   /translation="MEWTTIESDPGVFTELIQEMGVKGVQVEELYSLDEGSLRAMAPVY
FT                   GLIFLFKYRSGEAPSAPVETDASSSGVFFASQVITNACATQAILSILMNCPASVQLGEE
FT                   LGNMKAFTAEFDADLKGLAISNSETIRKAHNSFARPEPIMEEQRDQAPSDDVFHFIAYM
FT                   PVNGRLYELDGLKRGPIAHGECTDDDWLGKVCPVIQSRIEQYASSEIRFNLMALIKSPK
FT                   QALEERLAKIEARKERCAKVAAGAAVDAGMDVDGGDDLDGPLPSGQDAVAAELARLEGE
FT                   AAVAREGIEREAQKAQRWRDENIRRKHNYIPFIFNFLKVLAEKKKLEPLIAKARGQ"
FT   CDS_pept        763193..764116
FT                   /codon_start=1
FT                   /gene_family="HOG000029190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634540"
FT                   /orf_name="MICPUN_100547"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO63404.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG462742"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B7ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C8"
FT                   /transl_table=1
FT                   /translation="MCVAISGASGFVGSRLVAKLLAGGHEVRVLTRDVNAARMALRGSM
FT                   TGGNVTFVSPEKWAAAIPGCTGVVNLAGEPISTRWNPAIKAEIMASRIKATKRIADAIA
FT                   ACEPDRRPGVLVNASAIGFYGTSETRTFDEDAPAGGDYLSKVCQAWEATAEEVERTCDG
FT                   ATRVVVLRLGIVLDRDGGALGKMLPTFQIFAGGPMGDGAQWFSWVHREDAVGIVVESLT
FT                   NPEMRGPVNVTAPNPVRMGEMCAALGRTLGRPSWLPVPDFAIQALLGEGATVVLQGQKV
FT                   APNAALKAGYKFKYERIDDALQNILR"
FT   CDS_pept        complement(764294..766111)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634541"
FT                   /orf_name="MICPUN_100548"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63789.1"
FT                   /db_xref="InterPro:IPR004119"
FT                   /db_xref="UniParc:UPI000199B8B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6C9"
FT                   /transl_table=1
FT                   /translation="MGLPNKDLLPDDLEDLVFDALRRANLPTHCVLIHYDAIVVQRKGG
FT                   VIVVPVAVRTILAPPTDEEAPHAYDTHLVIKHVDLNNWDFKNDGTARERTRESFAKECA
FT                   FYRDVVAASRASRGGRNEVVTRAFDPINGWGMAQMETGADGWAVPTAHLVEGDETSDVF
FT                   TLVMADAMGKRGGKGREFGPEPSSPDAHRALNSDSIPGIADGDFENIAPPAPPERQVST
FT                   QGAFGEVTEKLGMTPAEAEATVEWLAAFHARHWLGLPDSPALPYDALWGRGGHWTLEKR
FT                   EHEVRNIESEWAKLVTSFPGVPALEKHRDLGERLARRAGDIARCAHARTQTLLHGDLKA
FT                   ANIIMPNAVSGALVPIVFDWQWAGPGCAAADLMFFIATSLSLEAAEMEDALVTLYHERL
FT                   TARLRARGSVEAERAADALDMETLKRDMDANAVDYVRFCAGSVWGPLTPASMEKHKYEQ
FT                   NLGIARRSSWHLTNLVERAGRAMDDLERREFKTHEDEAEEARREAERLEAEKRREAQFT
FT                   RTVSGISIFSHGEYQSLCGVPVGVPVPVEGAANFRSDPLDPLPEAESLPGGVGDSASYE
FT                   VFTQLPAEVVQSLEEHWSGVTAMPEIVGT"
FT   CDS_pept        766636..767757
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634542"
FT                   /orf_name="MICPUN_108275"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO63405.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199B8B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D0"
FT                   /transl_table=1
FT                   /translation="MSGAACASIAPPRALTHRRALGNFKRDALYAERTAVAVPARNGRN
FT                   RGTSSRNLTTCSADLGSDPLPRGRDISTWALSRRAWATVTDLGSTLPPLLPWAAERVAT
FT                   WQEAWQKASALASNMPIAVVDLMPVEGQESESKSPFETEFGAYIYDKGYRQLFRALGYP
FT                   GADAEAALALVKINRPAGDSSEGRICLDLSCGPGIITTRLASGLRGYEILVASDVSEAM
FT                   TRRAAEQLDAVSARSTIRPEPGAAPLPNFAAVRADVASMPFGDSSVDAVHCSAGAHCWP
FT                   DPMDGLREVERILKPGGVFVTSTVVLAPPIREKYAKGGDCTDAQSYDDKVRTMNTPFWD
FT                   TASVVAMLQKAGLKGVEIVKEDKCFVMLAARKP"
FT   CDS_pept        complement(767907..768638)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634977"
FT                   /orf_name="MICPUN_58623"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /function="phospholipase A2 activity"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="ACO63790.1"
FT                   /db_xref="GO:0004623"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="InterPro:IPR010711"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="UniParc:UPI000199B8B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D1"
FT                   /transl_table=1
FT                   /translation="MSMWRVVSCVLVAFTVIAATADAAEPVKLDLNDLLGNLGGAQGGG
FT                   RPRSSDVCPVGQAHAPTEDESYKIECNGCGPKGMQIKEPFGLYRCCNNHDLCFATCGTS
FT                   QDFCEELFTSCMSKVCRSFGSGERREACQKQANGMSGMTRMFGGGFHLTSQRSDPERGK
FT                   QGACDCYLPEDAEARWLTTFTDFYVQHAAMERDAAMSKAEDVLSKYKGHARGEAYFKMI
FT                   KKYGNSTKELMFVWDEVRPEL"
FT   CDS_pept        768745..769212
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634978"
FT                   /orf_name="MICPUN_58624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63406.1"
FT                   /db_xref="UniParc:UPI000199B8B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D2"
FT                   /transl_table=1
FT                   /translation="MQHCLTGNGATRTTCLASVSGRIERPRRAAGVTSRAEAFTSSGAV
FT                   RLRPRVIRRRRVGLTTRAVATQGGGGAMAPQGGGGSGGILGWLSRQFVNQLKAIPLLRW
FT                   PRHGFFSPKTFATTLIDAIIVMFSLVFFVLVLGAADYIALKIFKVLTLGKA"
FT   CDS_pept        complement(769374..772814)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634979"
FT                   /orf_name="MICPUN_58625"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63791.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B8B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D3"
FT                   /transl_table=1
FT                   /translation="MGKTPAQQNRLKAKQQGMSHDSIKEQQAKEIREQKKLANKDINFG
FT                   REKGLLKKQEVAKQRLKDMNDPTTELGKATARAARKAAKEAEEFLLRTKGISIKQKEVP
FT                   EGVDPKTILCEYFRYGCCAKTAEKCKFSHDLDIGQKIREGSKGTAKRNIYDDDEADEAD
FT                   TMELWDQAKLESVIAKKHSTEKTQSNATSIICKHFLEAVETRKYGWFWACPGGSDCKYK
FT                   HKLPKDYVFKSDLVAMMRAAALNKKSDQDELREELEKLKDGPKTPVTLEVFLQWKTKKV
FT                   EDKKAKAEQERSDRQKKGQFTGRELCENNEAKGDEGSDADDAEFKELLRLKKLAEEEEE
FT                   KRVAAEAAAALEKAKSSGMEYGYSEFDYEVGISTEELENNRPKDEDESDYSDDDEGGEP
FT                   EMDEDGKPKAIIKRPIGRKKKEAEAEEEEEEEEGDNDKPGKPKRAGSGFVPKKLAGTVF
FT                   EERERVDKKDIDPNALENILGAEKAAEIDESQLDPKELGRLLAEKKAKEEAEAAALIDK
FT                   VAAEKAEKEARKAEKKAQKEKERAAKKAEKDKKSGKKQKGEDEITTLEEAMKGVSVAAQ
FT                   EAAIAASGHLTKSALKRTVTGNLASRPTSRDIKINNFSMGMNGRELIKDCDIEITIGRR
FT                   YGLLGQNGCGKTNFLECLAQREVPIPDHIDLYHLREEAEPTDRSALQTVVDELKNEMVR
FT                   LQKLEEYIMENFGPEDERLESIYDRLDEIDPNTFEVRAAELLHALGFTEVMIHRATKDM
FT                   SGGWRMRVALAKALFAEPTLLLLDEPTNHLDLEACVWLEGYLAKYKKCLILVSHSQDFL
FT                   NGVCTHIIWLTQGRLTYYTGNYDTFQKTVRDDEIVQQKKYEKEQADIKHLKEFIASCGT
FT                   YANARKQAESKQKIIDKMVAAGLTPPVVKERTFTFNFPDCAKVPPPVLPFDNVSFAYNG
FT                   KKENYLYEDLDFGVDCDSRIALVGPNGAGKSTLLKLMTGELTPTRGSVVRHPSLVIGKY
FT                   HQHSVDVLDKEKTVLQFFMDEYPNSMTFKRDLDEWRGYLGRYGVSGKMQTTLIGELSEG
FT                   QQSRLVFAMICMGKPNLLLLDEPTNHLDLECIDTLAQAIKQYNGGVVLVSHDFRLIDQV
FT                   AEQIWVCEDKTVRLWNKDIRAYKKHLTQKAEREAAAKKI"
FT   CDS_pept        join(complement(775306..775314),complement(774900..774986),
FT                   complement(774722..774793),complement(773709..774572))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634980"
FT                   /orf_name="MICPUN_105591"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63792.1"
FT                   /db_xref="InterPro:IPR003035"
FT                   /db_xref="UniParc:UPI000199B8B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D4"
FT                   /transl_table=1
FT                   /translation="MPKKRGGGQSKSLTLEELSANFHLPINDVARKLGLCVTVLKQRCR
FT                   EHGITRWPYRKVKKLDNIIHALECPGDGGVADATRRLETVKRTREVLITDPNSKAHLRV
FT                   GKLKAVRRRSLGSKSGYGSGGSGSDNSGGTAFGVMRHRQNSSGIDGLLEAATTLSDGET
FT                   PGTPTREPDAIRDRSPRISGALQALTGGISAHDTDTGAGAEAAALALNALKPGGAFQAV
FT                   RAAVDVANKAAAPAAPAFDANAYAAAMAAFAGHMGNAAAAAATPPPAPPTPANPMAALM
FT                   ANPMFAWMAAMGNVAQAQAQAAQAAQAAQAAATPPAPNFLQMAAAAAAAAQAAQPQSAH
FT                   QPL"
FT   CDS_pept        776102..777940
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634981"
FT                   /orf_name="MICPUN_58628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63407.1"
FT                   /db_xref="UniParc:UPI000199B8BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D5"
FT                   /transl_table=1
FT                   /translation="MFAVCVSLLLVWLATAEPSSFSDRGGVEARHRRGARRWTLSVGRV
FT                   PDTDGPIAIEKKVLVDADDGPSPAPMGGGGSKLDEPVVGSTKKTADADEASFERGCGDV
FT                   SKMFKDVAARYDTMKDTGVLVVDWSENHFNGIGDEMQHYQELLAIAVGTGRAPFLRTQR
FT                   RECEGTGLAGAREPSSLKHLATKCHFDLGDFFTGAHGVDWKWDDAKELKVRDALGADDA
FT                   KELVVTWSIHGMFFGHDDKDEHPTGEYAAAPDVNLVKVMMEHPKFREHKLVRLRIRTNF
FT                   GHWCHPKELQRGSWGVCESYRYVVGIEEYKDRADESPCPGCAVGGCFGRAMLQPREALR
FT                   RKLAPYVQKMEDEGWAATVAFHIRTGFADMSQVVPPESPRADNATLDTLDAFLASEAKR
FT                   VKYPPPVCPDKDFGAATYFERTDGPLRTFLKCVISTAKNLAAKAGDRNKWGTFMLTDSP
FT                   AVRAAVEREFVELDGRVVVTDGAYGNVKFANSGVCVQHGAKQSGSCDASDPRPAWERSM
FT                   MDLYLVGRVDAVLMLYQSKFSVAAMMRGAVRYGQRELYQNTRITHSLVDPLVNEMKNGG
FT                   WSRANEERKRMWTKLWDLFGPEGSREGLRTSSYASQ"
FT   CDS_pept        join(778298..778435,778513..780312)
FT                   /codon_start=1
FT                   /gene_family="HOG000016456" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634982"
FT                   /orf_name="MICPUN_58629"
FT                   /product="Predicted protein"
FT                   /function="deoxyribodipyrimidine photo-lyase activity "
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO63408.1"
FT                   /db_xref="GO:0003904"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG286981"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR008148"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199B8BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D6"
FT                   /transl_table=1
FT                   /translation="MAGGAPPGKGQPEPAMGGAGGNGGETGQQQNNEMQVTQQQGQAMS
FT                   VVHVLRLGLRIVGLGGNMAGLTDEQRARAEANKAAALARRAALAAQIQIPPRDDVTSQV
FT                   APERLRRLNFKRVDPRGRYVLLWVQSAQRAMHNDALEYAVQRANEHDVPLVAVFGSTAG
FT                   FPHANERHLAFMYQGLVELRETLERTRGVQLLAYTPVGGGEPGEVIVAASAGAREVIVD
FT                   AGYTRPLLDWRRTLAKRADRLVTEVECDVVVPLYGPGGGAGRSEPAAATLRPKILSRLP
FT                   ALTRNELEPTPLRRRLAARLDAEALLLGGEGEPGMAGFARVPLWESVDACLDALDAAVL
FT                   GVGVDRSVKPASGYHVGGEREALRKLDRFLESKLTNYASSRNDPSLRLQSHLSPHIHYG
FT                   QISVVYVAHRARKVAAARPELRRSVDVFLDELVVRRELAINFCLNNPAYDAYEGVPEWA
FT                   RRTLATHATDHRSFVYTLEQFERCATHDALWNAAQRELVVSGKQHNYLRMYWAKKMLEW
FT                   SADPREAWCWAIHLNNKYSLDGRDPSSYTGVGWCWGLHDREFPEAAVTGTVRRMSEAGM
FT                   RSKFNAGVSDYLNRWGDGDARSRAGKRSAAKAAAESAAGAPGTGTPRAESRQTRLEEMF
FT                   SKKPKTGSGG"
FT   CDS_pept        join(complement(781556..781813),complement(780660..781444),
FT                   complement(780371..780527))
FT                   /codon_start=1
FT                   /gene_family="HOG000234557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634983"
FT                   /orf_name="MICPUN_81742"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO63793.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG735909"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI000199B8BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D7"
FT                   /transl_table=1
FT                   /translation="MDTESPAAASPSKKPRHDDVVENKRNVTINACLRPTSTATHEDVR
FT                   AAILKWLGAGAVGLRPSGGFLALPKFCDGHHIVTEHVESVTEMDGEDDIATYKEWVLPS
FT                   RDFHGLWESLVYGDDVKLRLTKYAGNALLFSQRGVDPNLIAWNRVVLLHGPPGTGKTTL
FT                   CKALAQQLAIRFQDTYPTSVLVEVNAHSLFSRWFSESGKLVSRLFQKIQDLLDDEGSLV
FT                   FVLIDEVESLAAARKAAASGAEPSDAIRVVNALLTQVDGLKHRSNAMVLTTSNITEAID
FT                   LAFVDRADIKAYVGPPGFEARYSIIISAIEELIAKDLVQVGESETRLPALQVLREHAKT
FT                   GGVNDLEATEGFSGRALRKLPFLAYAQAHTNGRCSLLGFLNGFRRAIMQERKDQTSLKQ
FT                   "
FT   CDS_pept        complement(781991..783199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634984"
FT                   /orf_name="MICPUN_58631"
FT                   /product="Predicted protein"
FT                   /function="rRNA methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63794.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008649"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="UniParc:UPI000199B8BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D8"
FT                   /transl_table=1
FT                   /translation="MGHGSRSRRRDEAEGDDTSDAAREEAREKQREHKHRQRRRKIERR
FT                   HAAVNEILSRIAPPSRASFTALEDVPAWCDGNPIEWSSIGPSCDPASMANDGEEATMRG
FT                   DDANKGASAIVAAAAKPPVVNLRAMRKRWQVESFAVVLRELERERAARDDADTLPPMRV
FT                   VDFGAGSGNLILPLSKCFPDMRFTAVEMKRRSAELLERRAAAAGLTNVDVVVDMIEKTS
FT                   FDFDVGVALHACGNATDFTIARCLAAGAAFAVSPCCIGKLKFSLAGGSSFSATNKDWTT
FT                   KGGDGDGDGDQVVCPVITHPRSKWMAEQLAGPGDFAALAQAADTGHGDGANADTITDLG
FT                   ARAKMNVELDRAEAAREAGYSVESLKLIRAADAPPNKSDLLVGVPASRAGALKRLRPLV
FT                   SCS"
FT   CDS_pept        complement(783254..784633)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634985"
FT                   /orf_name="MICPUN_108277"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63795.1"
FT                   /db_xref="UniParc:UPI000199B8BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6D9"
FT                   /transl_table=1
FT                   /translation="MSVEASASGRTLRVDQCPPNTRLLFDNPETLISHRWDPKRQKNAF
FT                   VARPTEAFTVAQWEIDKYVRDAPKIEAEAEAPPADEGVRSLRPPTFPDDRSEKAYVAWC
FT                   NPEGSVRGAAVHRIKKHGAGVAPPGYLVDHRSKREPPRANASLAVRGSLSTWIAPGEDT
FT                   LGATIVGTSTVRQTHAPLSSTEYVSRRIGKGSFGEGFGSGDVAAVATPPRARDPLRLTH
FT                   GRAPGGPDDWKTAHFHARSRSSHGVPADALDPVEAATRTSRFGVYTRTAGVTAVGSINS
FT                   SGFGAMNSTAARLGLTTTSGPRAAFTRSDNSGGSFGLVGDSWRERVTAGAERKRAAEVA
FT                   GERRSGNGRGGGGLPVDDGEVERIRAEREARIRVPMPSAGASRPGTANVGSPVAGFRED
FT                   FEFGDSAVTEQELVSKESHLARLRTISRSLNARQTHIVGRRMEKARIQIEEDVAARFAL
FT                   R"
FT   CDS_pept        join(complement(785839..786177),complement(785466..785747))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634986"
FT                   /orf_name="MICPUN_58633"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO63796.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B8BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E0"
FT                   /transl_table=1
FT                   /translation="MPSFSHSSRAAPMIVASVSLKPVATARVSAGKLRARPSSQGRGAA
FT                   RRPGGFSAEHEARLSSENPTGGNTSMDEASVVDPYGHVADVMSSPARTLTTGLPLEDAI
FT                   VATTMERYQTGACCGVLSRTDLDRVKSLGGYTVEDVMSSPPRTCKQRATVASVAGMMLK
FT                   HKIHRIPVVNDRDVPIGIVTRTDIFEPLLAKSQDLLVNQETRR"
FT   CDS_pept        join(786316..786376,786510..787057)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634987"
FT                   /orf_name="MICPUN_90789"
FT                   /product="Ras-related gtp-binding protein "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ACO63409.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199B8C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E1"
FT                   /transl_table=1
FT                   /translation="MGAGSQQYDHLIKLLLIGDSGVGKSCLLLRFSEDQFTSSFITTIG
FT                   IDFKIRTVELDGKRVKLQIWDTAGQERFRTITNAYYRGAHGILLTYDVTDEGSFNNVRN
FT                   WMRNIEQHASDGVSKVLVGNKSDAEEKRVISTEQGEALAKEFGIPFFETSAKANTNVND
FT                   AFFAIARIIKAGLKTSGDGGGAGVKLGPPPKAKSGTSCC"
FT   CDS_pept        join(complement(787388..789142),complement(787333..787353))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634988"
FT                   /orf_name="MICPUN_58635"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63797.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199AD6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E2"
FT                   /transl_table=1
FT                   /translation="MGRLVKKSEQDAKQSSLLGFFRRPLGDANATRESTAAPSKPEPTG
FT                   GRADGDDPPVESTGPSGAIDATAAAPSCEDRAGDNLTTAPNAPRTHPSQRPPLRMADAL
FT                   VRIERAINGWERLFASHERARGDERAKEASARASRTAECARALRVEAYRHRIETRRESR
FT                   GARQWTRSIRARQHRGDGGRGKRTLENAGISLNIDRLREVGTCTLPANPNEGSAVSAAG
FT                   DPTLSLSFDPTGAYLAAATAGGLLAVQSWDTMRCTGGLLYEPRFQRRGARGNPSIHRSL
FT                   SSVAWRQGGDVVATASGDGGAVEIIDLGAGGTTTRTLLADTDRGSSAFRTGDGQGAGLL
FT                   DVLFCPGEGNRVLAAGRRGRVYLWDDRCAGGQPRAELTAPTDRDSPFNCARASDDGQTV
FT                   ITGSGRGMVHVWDLRGGTGGTKARAAAFSFGSQNKTSHQLLRSVDVAELLAQVPVIRDG
FT                   PTSGPSRSAVHWCEQDPNDQRRIGFHLARGWSGVIDMSGPRGWGGVNWTGPLVTHAHCP
FT                   PSQWEVSETGSGEAVLAPGVCGAALAHRRTGAWVTAGDGGGSAVAVGCPGRDGVRVLDF
FT                   SPAPGARHWRRRRKR"
FT   CDS_pept        join(789531..789564,789759..789775,789914..791188)
FT                   /codon_start=1
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634989"
FT                   /orf_name="MICPUN_100558"
FT                   /product="Predicted protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63410.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG497188"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI000199AD6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E3"
FT                   /transl_table=1
FT                   /translation="MADDDNAEEIEMWKVRRLVKGLQEARGNGTSMISLVIPPKGQINL
FT                   TAKMLADELGTASNIKSRVNRQSVLAAIGSAQQRLKLYNHVPPNGLVIYCGTVLTDEGK
FT                   EKKVNMDFEPFKPINTSLYMCDNKFHVEALSDLLQCDSKYGFVVMDGHGTLFGTLAGNH
FT                   REVLHKVSVDLPKKHGRGGQSALRFARLRLEKRQNYVRKIAELTTQLFITDDRPNVNGI
FT                   VMAGSADFKNQLLQSDLFDQRLQPHIIMIVDVSYGGENGFNQAIELSAEALGNIKFIKE
FT                   KKLIGKYFDEISQDSGKYCFGVKDTLACLEMGAIETLIVWEDLAVDRCILLNSQTQEET
FT                   IHFFTPEQQANNDNMKDPETGVDLELTEKIPMMEWLANEYKNFGCTLEFITDRSEEGSQ
FT                   FVRGFGGVGGILRYQVNLADFEVASDHGDSSDEYSSDDEGYI"
FT   CDS_pept        join(complement(793141..793701),complement(791431..793110))
FT                   /codon_start=1
FT                   /gene_family="HOG000007098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634990"
FT                   /orf_name="MICPUN_94241"
FT                   /product="H+-translocating pyrophosphatase family "
FT                   /function="hydrogen-translocating pyrophosphatase activity "
FT                   /function="inorganic diphosphatase activity"
FT                   /biological_process="proton transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63798.1"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0009678"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG593668"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniParc:UPI000199AD6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E4"
FT                   /transl_table=1
FT                   /translation="MAKSIMSDEGADAFIFITAIIGVIFAWFQYKLVAKVSLTGGSNTL
FT                   SNSGLDTSKLIVIYDAIRDGADSFLRAEYTICAYFIAAFGIVVLLMTSYVEKEFHIDQG
FT                   GLTAISFVAGGITSIISGLIGMKVAVFANARTTVMAAGPNPWTDAFNTAFRAGSVMGFS
FT                   LCGLSMLVLYVLAHLFAVHFKDWDDALHLMEALAGYGLGGSSIALFGRVGGGIYTKAAD
FT                   VGADLAGKVVSGIPEDDPRNPATIADNVGDNVGDVAGMGSDLFGSFAEATCAALVVAAQ
FT                   SGSLIAQGGWAGLMFPVAISGGGILVCLVCSFIATHIQPVKKEVDIEKVLKVQLGATTI
FT                   LLTAVVYILAYIFLPSKFQIEAVSGTVINFTPVKAWGCTIAGLWSGCMIGFITEYYTSH
FT                   SYKPVREVAQACETGAATNIIYGLALGYKSAILPVTLLSVVVYLSFYLGDMYGVALAAL
FT                   GMLSNLSTCLAIDVYGPICDNAGGIAEMAEMPETVREKTDALDAAGNTTAAIGKGFAIG
FT                   SACLVGLALFGAFVTRAGLNLASVSLVSPLIFASLIFGAMIPYWFSAMTMKSVGQAANE
FT                   MVKEVARQFREIPGLLEGTPGHAPPDHARCIAISTDASLREMIAPAVLVMSTPLLFGIF
FT                   LGVDAVAGLLAGAISSSIQMAISASNTGGAWDNAKKYVEKGAVVINGVVQRKGSELHKA
FT                   AVVGDTVGDPLKDTSGPALNIVMKLMAILSLVFADFFRSINNGAGLFDLPRN"
FT   CDS_pept        796998..797531
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634991"
FT                   /orf_name="MICPUN_108280"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63411.1"
FT                   /db_xref="UniParc:UPI000199AD6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E5"
FT                   /transl_table=1
FT                   /translation="MLLQVTVALAVAEEAMKFEHRDLHWGNVLLQRCGVDETRRARLNG
FT                   VNLTYPTNGLAVNIIDFTLSRLDMGDGKEDVAFCDLEADPELFEGPAGHCQSDTYRRMR
FT                   KATKGMWERHCPKTNALWLHYLADCLLSDKEFPMTAGQKADLKGFKKRAMGYKSANEAL
FT                   WDDMFVGVWRSSHM"
FT   CDS_pept        join(complement(797740..798482),complement(797684..797708))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634992"
FT                   /orf_name="MICPUN_58639"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63799.1"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199AD6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E6"
FT                   /transl_table=1
FT                   /translation="MDACHKLAKLFLGGVLGKPPNAPTGLKVVERCDGLEVRWAPGAPT
FT                   SRYNSDVFVVELAPRTPKVVEALGPAFSGFAEFHRGPETRFSFDKLGAEQDFAVRVRCE
FT                   NRAGASGWVEIAARTRQVPTRCGGTGPDGAYAWDQTPTEVEVTVPAPPGTTPKQVSVTV
FT                   KPRRLEISLAGVTAVAGALCGEVVCGEDGDFEWELRDAGNGEGKELFMTMEKRLRDVVS
FT                   YDPAEQWDCLVAERGHPRVDTAHLRWTRATSTR"
FT   CDS_pept        <799525..>800328
FT                   /codon_start=1
FT                   /gene_family="HOG000083293" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634993"
FT                   /orf_name="MICPUN_75845"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO63412.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199AD70"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E7"
FT                   /transl_table=1
FT                   /translation="DRLVAQLEGMGARVYLNDDDVDDGELIKSAGVKGGDVWGSLVGYE
FT                   TQKREIEDTLLLALLHPEVYDGVASGTRKDAKDATNRPRALLFEGPPGTGKTSAAKAIA
FT                   AHASVALIYVPLEAVASKYYGESERLLSQVFQLCDRLEGAVVFLDEVDALAQTRGGEMH
FT                   EATRRLLSVLLRRIDGLDSRGRTVVVAATNRKQDLDPALVSRFDAAIEFGLPTEQCRGD
FT                   IMGCYAKHLTREELATIAAATAGMSGRDLRDVAETTERRWASKIIR"
FT   CDS_pept        800562..801803
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634994"
FT                   /orf_name="MICPUN_58641"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63413.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG561153"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="UniParc:UPI000199AD71"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E8"
FT                   /transl_table=1
FT                   /translation="MSAVALAARVIPTQFAPPDGRQLDRPVARASRVRVSRATVSPRAL
FT                   QRADGDDFELLRELGKVSYAVEQQAGEATLKWRGGDDGTVPDSFSVVGAAPLAGGVAEM
FT                   KLYAGKVVGWEGPDGGERGPRVPDVLLKEYCNEPAASMADAEVDAYTKLYSNPNDSTIG
FT                   QTWDGQAVGTPFDPASIPVVPLIAYFTSDSVDGVGTSLWTVQAWGPGGVSRLAEYPGKQ
FT                   QDVKKPSFWPPVQRVRDVGLGPRHRFVRNAVKGVLAAVDAIHRRNVAHNAIDASSFQMS
FT                   TLKDQKADELEVRLMNLGFAGDLTEDKRRGDLRCAAIVVAELVFSALSAAGSDKGRTSA
FT                   AAIQRLFEQVFSLDMTQAREYCVEEPEWEAVVEFWDYRDRQGDGWALLGDMWRGELSAE
FT                   ELLARAEAIETPYD"
FT   CDS_pept        complement(801918..803081)
FT                   /codon_start=1
FT                   /gene_family="HOG000264892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634995"
FT                   /orf_name="MICPUN_108281"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63800.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561154"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AD72"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6E9"
FT                   /transl_table=1
FT                   /translation="MSLLTKEQRAIFDEAVRAHALEILNGGEEGLTSPIGSPSKHHHQR
FT                   PGNRVKKGENKILAVMDAEAHPCFALDENDPNYDSAELNDYELRQTRVGPRTDVIVAYK
FT                   NAVTAIIEEYFQTHDARETQRALDETNKPLYQHFFVKKLVTMSMDRGDREKEAAAVLLS
FT                   ALYPHHVDPEQLQRGFERLLESVDDLAIDVPAAADDLAMFIARATVDDILPPRFLHTNL
FT                   EGLLPGLRVGEKAAETIDLAHGHLHAHHGTERILRAWGDSDLTPLQQAKHAIQECLTEY
FT                   VSSGDVNEARRCLRSLHMNYFHHEFVKRALVLCIEAPEGHETAPRLLGLLKVLGKSGEV
FT                   SASQMKIGFDRMDVVVEDLVLDVPKAKTRLEGLRLMAKEEEIHPMRE"
FT   CDS_pept        <804232..>804468
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634996"
FT                   /orf_name="MICPUN_74037"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="iron ion binding"
FT                   /protein_id="ACO63414.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000199AD73"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F0"
FT                   /transl_table=1
FT                   /translation="LGPDSETKAIFVDESTCIGCRACVTWAAGTFEMVEDQNAGRARCT
FT                   RQWNDDEETMQIAVEMCPVDCIYWVKRSQLAILE"
FT   CDS_pept        complement(804823..805191)
FT                   /codon_start=1
FT                   /gene_family="HOG000230683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634997"
FT                   /orf_name="MICPUN_81540"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63801.1"
FT                   /db_xref="HOGENOM:HBG601520"
FT                   /db_xref="UniParc:UPI000199AD74"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F1"
FT                   /transl_table=1
FT                   /translation="MGFYHAVDWTESWIRCVLAMEVLTLIAAVALRKSETAQTVLFVWC
FT                   MLVAFSARTLNEWGGRHWRSFSKQNYFDENGFFISTVLSTPMMVTQVVVLVNFFRLMVS
FT                   MMIKTKRAQLRAKAKKDE"
FT   CDS_pept        join(805477..806803,806854..806870)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634998"
FT                   /orf_name="MICPUN_58645"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63415.1"
FT                   /db_xref="UniParc:UPI000199AD75"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F2"
FT                   /transl_table=1
FT                   /translation="MSSYADPEGLADSMDRAAAMLRAAADELHVIDEPFVPLLGVNFAG
FT                   RVAVFVSRLPWLRIVAVLVTVTCLLVAWVKYNHAKLVARFDAFVTKKVLTKMRAKLACD
FT                   VQIDAVRVRPGATPTTATATVEGFRLGNPPTGEFNAPFLVSMERVLVRCNPLSLAGVRG
FT                   RGNFVVGWTFGEVELVAVHGAVVYVDEVFDPKQGKKIRNFQGIRRQTAAQLAEEINREE
FT                   EALKAAQEEKRLAEEAAAALKEKNIEVKETSFFSSVTDTFSAAQAEIDKQLKEVTAQAA
FT                   ALPGNISSGIQSAGADVTNKLNALITLLERVNQKPPEETEEEKRKKRKLVLNVEQLTFT
FT                   EWNIHILAVSEKAFKFKSWQLEKFTGKVGMLARECAAGLLNEIIKDFQQEILDSLTKDI
FT                   SAVGEGLLSIGGSVVGGVAEGGNMIVGGVGAIGKGISDTGQAIDHLSG"
FT   CDS_pept        complement(806990..808948)
FT                   /codon_start=1
FT                   /gene_family="HOG000264957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634999"
FT                   /orf_name="MICPUN_50295"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /protein_id="ACO63802.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG651799"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199AD76"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F3"
FT                   /transl_table=1
FT                   /translation="MLLPGLTLVVSPLLALMTDQLHGLPPALPGAALRSDQKPAQLFGT
FT                   LDELRAGRLKVLFVSPERLLNERFLSDLRCVPGGVSLAVVDEAHCVSEWSHNFRPAYHR
FT                   LGRILQSRLQLQGPVLALSATATARTERHLRSQLCIPKEGAYRNDTIRPNLTLAAMRVP
FT                   ANSRDPTLFYMLTKEPEYSEGSVIVYTAFQNQAETVAAYLQTKGVVAKAYHAGQEPKDR
FT                   ARTQAQFFGGSVRVVVATVAFGMGLDKPDIRAVINYSLPRSPEAYIQQAGRAGRDGQPA
FT                   RCVSFIDPQDFTRLRSLSFTDGVDRPTVLKLLEKVFLGKQKDAVAEGRQTVGALIVQKL
FT                   ERELDMRGEVIETVLSCLELWDDAEISRRCAATASEDGADGVEALEGDASNEGVGHLIR
FT                   VLPDMRATCELRFHGKTPEQLATQCPLVAAVLQIGGKPKAGAYRFSVAEAARRMNDGLE
FT                   EVSAQLQALSANGEAAYELTDRAVGYEILHPPPDLRQLAAALADHLARVEASTVEKLDT
FT                   VYGALVAAADCEDDESQGASLRTSLEAYLGGDGAFHVPDLADVVSKEEPRRLRDDVREL
FT                   LTTRSGGKTGGAGAMSARAVARVLHGLGSPAYPAQEWRRNDIGKRMWEKYVGTDFNLLV
FT                   KVASEELLAMRGVVRQK"
FT   CDS_pept        811214..812179
FT                   /codon_start=1
FT                   /gene_family="HOG000264956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635000"
FT                   /orf_name="MICPUN_58647"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63416.1"
FT                   /db_xref="HOGENOM:HBG561156"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="UniParc:UPI000199AD77"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F4"
FT                   /transl_table=1
FT                   /translation="MKFKCTLSSMGVTWLERFVPIFEKMGKELSVLFTPETLHLVQGAA
FT                   DSGGLELHADLLVKEAFDEYRIASNNADKIAVKLETATLYRVLRGLVGSEATHVEVKLI
FT                   KRVIREGLSLPFLNFASTGLVDITQDVPLGGPLNKRELEDLEHIVQANVVNVPYWLNLD
FT                   RQATEGAHQAAERFKAVGPRTELATTKAGSLHLATAKGGSVTLGTEYRGLPVLPVAEDQ
FT                   YETAQGGVDDDDDAAGASERLAEAVASGSAALVAVNTKQLWKGLQGVQTNPSNAMIGVA
FT                   SNRGHMELVFRYDRQTVNGPDAVGLFVRVPAEIDEDFDFD"
FT   CDS_pept        complement(812269..813723)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635001"
FT                   /orf_name="MICPUN_58648"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63803.1"
FT                   /db_xref="UniParc:UPI000199AD78"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F5"
FT                   /transl_table=1
FT                   /translation="MAHDVEAATPLLGGDDARTRSRGSSRPVVIALGSLAFAALIGLGV
FT                   YTHSAGPLPGLDLLKGKERPTPVMYALMGETQGLPQQLRSLQCYAKMARETGSELVVGP
FT                   VKTRAVNGGEDEYVSFDAIVKPEPGTWRAMTKDDRAAFLTHNLDRGCITALREQDTIGT
FT                   TFVSPGDETVRSDPFTSAKDYQSVVDSIKERGGKPSCVASAVYAECEEPGTELDFQASK
FT                   HIELLSSEVRKFLFGAADRNFRVVHARSNAATMGMPVFKSFNSNQASINIDPFVHMCRE
FT                   AKAGQGLPTYVATDDMSANTQMKLQSFGCKTIHSILGSQKLEDWEMAALDQFMMADATE
FT                   HYSMRCTTMDIIASSSRRIRQKMPSKWYLDNARKFHEIADGSNMKQCEAGVKVAEEIEE
FT                   ANQPKGEGKQFAQKAEAKARARQAAEDRAAVAAAGRGDDIEIQGLNDADGGDAFAIATF
FT                   LANEQEKDDPIEKFLREVGRGTAQGR"
FT   CDS_pept        814085..815074
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635002"
FT                   /gene_name="FEY"
FT                   /orf_name="MICPUN_82103"
FT                   /product="Forever young-like oxidoreductase "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63417.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AD79"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F6"
FT                   /transl_table=1
FT                   /translation="MLQRWHTRHLPTDPAEVLGPDVKGKTFIVTGPTSGIGTTTAETLA
FT                   RAGARVVLACRTVKRGQALIDSWNSTQSEPLRCEAMHLDLDSLDSVRTFASAFLAKGEP
FT                   LHCLLNNAGVFDMSGAFNRTKDGHESHYGTNFLAPALLSLLLMPSLKLAGTASAPARVV
FT                   FVCSKLHQFCRRLPLDDLGFERRSYGARAAYAQSKLAEIQFTRELERRLGVMDGEDGSV
FT                   RGDATVRCVTVHPGNIVTGVVRTLPYVVQVAYKIIMSRVLLTPSEGARASLYAATRGEA
FT                   LTGTGRAPYFTSECVAKSPSPPALDDEAAAKLWDATLATLGLPKDFKP"
FT   CDS_pept        complement(815196..816767)
FT                   /codon_start=1
FT                   /gene_family="HOG000257901" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635003"
FT                   /gene_name="DHFR-TS"
FT                   /orf_name="MICPUN_58650"
FT                   /product="Bifunctional dihydrofolate reductase-thymidylate
FT                   synthase"
FT                   /function="dihydrofolate reductase activity"
FT                   /function="thymidylate synthase activity"
FT                   /biological_process="dTMP biosynthetic process "
FT                   /biological_process="glycine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63804.1"
FT                   /db_xref="GO:0004146"
FT                   /db_xref="GO:0004799"
FT                   /db_xref="GO:0006231"
FT                   /db_xref="GO:0006545"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG588098"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012262"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="UniParc:UPI000199AE34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F7"
FT                   /transl_table=1
FT                   /translation="MASEASTVRPFQVVVAATKGEMGIGYQGGLPWNLPKDMAYFKAVT
FT                   SQVNEPGTKNAVVMGRKTWESIPAKFRPLPGRVNVVLSRGHTLVEAGSENSAPVNGGGK
FT                   PEVLPEGVFLRPSLEAALELLSAPEHEAGVEKVFVIGGAQVYAEAMASPHCQALHLTEV
FT                   TPPADEPEKYKCDAFLPQIDPAKFKLYASAKPLREKDGATIQFLTYFGVDPGTGKFRSP
FT                   GSKVLPAGAVAKGVRHEEMQYLDLIKEIMEEGNVKGDRTGTGTISKFGCQMRFDLRRSF
FT                   PLLTTKRVFWRGVAEELIWFVKGCTSAKELQDKDIHIWDGNGSREYLDSVGLGHREEGD
FT                   LGPVYGFQWRHFGAEYKDMHADYTGQGVDQLAEVIDKIKNNPNDRRILLTAWNPAALKE
FT                   MALPPCHMFCQFYVANGELSCQMYQRSCDMGLGVPFNIASYSLLTCMVAQVCGLKPGDF
FT                   VHCCGDTHVYSNHVEPLYKQLENEPRPFPTLKINPEKKDIDSFEFSDFEIVDYDPHPKI
FT                   AMQMAV"
FT   CDS_pept        817271..818668
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635004"
FT                   /gene_name="snRNP"
FT                   /orf_name="MICPUN_58651"
FT                   /product="U1 small nuclear ribonucleoprotein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="ACO63418.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG748517"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="UniParc:UPI000199AE35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F8"
FT                   /transl_table=1
FT                   /translation="MLKPAPQSLRELPRAPPGSLPPPPGGFGLPPPPGFPGFRPGFPPM
FT                   MPGMMRPPIMHGMRPAPNASVHQTGLTPSLLRLFVARPPVEYHPPPAKPKKTQPYTGIA
FT                   DYVKLFTDPEEDPPPPPAEPKETKAEKKTRRAAEKAKENDARIEEDITSWNPKEDPKLA
FT                   DSDPYKTLFVGRLSYDVDEAALRREFERFGAVKSVTVVEDQDGKPRGYAFVEFDRESDM
FT                   KHAYRSADGLRLEGRRILVDAERGRTVPDWRPRRFNGGLGGTRRGGKTENSLVAGRDQA
FT                   YHNRAAQEAGGGGGGGYAGHGYGGGPQQQGHGHGQFGDDRRDSRRGSSRDSRRDDRDRG
FT                   RDRNSSRYDRRDDRSRDRRDDRRDGDRGRDRYDDRDRRDRDRDRDRRDRDRDRDRDRDR
FT                   DRSRGRDRYDDRDRGYKRDRSSSRGRRDDRDRDRKRHHGDDGAYPPPPPNGAAAADDDE
FT                   DKEDGEL"
FT   CDS_pept        818735..818953
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635005"
FT                   /orf_name="MICPUN_58652"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63419.1"
FT                   /db_xref="UniParc:UPI000199AE36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6F9"
FT                   /transl_table=1
FT                   /translation="MTINGASASTGPIRLRHVLSVDAPGTPTAAKREQSAIIALGFDLR
FT                   YSTWGFRNHSCKLGSALPYASCSFGLS"
FT   CDS_pept        819384..819773
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635006"
FT                   /orf_name="MICPUN_108283"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63420.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000199AE37"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G0"
FT                   /transl_table=1
FT                   /translation="MEMSKLAPAFAKLAEAAQEISEIFAAAGGVTLGKRGPGALLLDAD
FT                   GKPIKKKKEKRAPRAPTKFNEFMRTKVAQVKSDNPTKSPKDIFAMCAAMWATAPENPKS
FT                   SAAAALPPAKSEKGSLKSGKGKSKK"
FT   CDS_pept        join(820252..820329,820428..820838)
FT                   /codon_start=1
FT                   /gene_family="HOG000264917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635007"
FT                   /orf_name="MICPUN_58654"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63421.1"
FT                   /db_xref="HOGENOM:HBG716812"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000199AE38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G1"
FT                   /transl_table=1
FT                   /translation="MGERKSTRVKTVAKALKRVDDDTRRQVAAARLDALENDNAEAEAA
FT                   DDDSEYEVEEGEGVGTVLKKKGGGKGGKRTTRGAVATKKGPRSFAAHLDEAMLDRVPRE
FT                   IPTYLTAAAGPSVTSTARKYCSVCGYASNYNCARCGMKFCSRKCNAVHTETRCLKFTA"
FT   CDS_pept        complement(820877..823390)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635008"
FT                   /orf_name="MICPUN_50300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63805.1"
FT                   /db_xref="InterPro:IPR021881"
FT                   /db_xref="UniParc:UPI000199AE39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G2"
FT                   /transl_table=1
FT                   /translation="MRRRRRGTPSKQSAVNKPTASVAVNEDTDDRGHSVRGKLGFFRLV
FT                   GSTVRRSLGFALNRAANAKGADVISPTASHPNTPRSAASDTDESGYSLTDDDTLGELVS
FT                   LAAIRRARADALAAELKADTSNATPVEVVAAAAANEISENNVGPTSIDNGCNASPGRRA
FT                   EAGRQLEAEQNLLRMGVTTHARRGESPEAVIERLQLQLRELQEDKVVYDIMDAAKETLI
FT                   EGLECELSRLRSEQERMNSAQAAADALQRKLELLETDLGVFWKEGESPKPSREGSGCSE
FT                   TSIDDDPIVDTEAHIRVNNAYDLTDLRDSVLGSPLKSLAKIVTAGAKIVKVVDAALKEE
FT                   DEDNLPPSASPLSELSLVKVSQHRHTRSRSRGSIGPNCGGKENFGGDGFVNPFSEAALA
FT                   EYEAENEMCSWASDQTSRVLEDDRTKSKENALSAMGELPEEPKTLIEDPLSVDTVIVHY
FT                   DRELEQREMDETFRRHRRAMSDLSGTTSPRVDDFPPDARAAEKAAVKWEKTTLKHQIAG
FT                   LRERFREALAEANATRDALDGYKDTVQRVEFQKRLLCAQVLELEASLAEKEEESARVAE
FT                   RARERERELLERAKAGARLSRQPDSWAGLPTASFFLPKIVRLWHQLRVPLRHRSQFLLA
FT                   FRGRETFYFEAEYRRLAWLKESLVTAAGWRVPDDDDGRRSVGTEEIAALPPSLREAERK
FT                   LARERRYLRGMARRLERPQLEAIFTQWGIPLRSKRRKLRLVNLLWSDTDEKGRGWLTNG
FT                   SRSTDRSRSIDETDCFVRLRKHAELVLQLRGVEATEDMFGLVFKAGTTSGSASRDAGRW
FT                   RAARSLQSLWTAAGGGRRRLETIGI"
FT   CDS_pept        join(complement(824456..824854),c
FT                   omplement(<823652..824302))
FT                   /codon_start=1
FT                   /gene_family="HOG000272678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635009"
FT                   /orf_name="MICPUN_81659"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO63806.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199AE3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G3"
FT                   /transl_table=1
FT                   /translation="MSEDERELRLTVAAGPVAHASPQNATSPGKESASAKSGQRTRYTA
FT                   DRVFGPQAANDEVYARAARDIVRGALRGVNGTVFAYGQTGGGKTYTMRAITRGAIGDLF
FT                   QAVQGDDERKYLMHFSAVEIYNEIVRDLLPLRLLDDPERGTVIERLICTPVDSSEALEA
FT                   LLREVEARRQVGATGMNAESSRSHMIVRLTIESRVASSADEAAVDTEDRGPALTATLNF
FT                   VDLAGSERASRAQSSGTRLTEGCHINRSLLTLGKVIRSLSEKSERGSDEHVPYRDSKLT
FT                   RILASSLGGNARTAVITCISAAASALEATRAALFFASQAKRVRNRATVNEVIDDKALIR
FT                   RYRAEIAELQ"
FT   CDS_pept        825283..825843
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635010"
FT                   /orf_name="MICPUN_58656"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63422.1"
FT                   /db_xref="UniParc:UPI000199AE3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G4"
FT                   /transl_table=1
FT                   /translation="MNDLTSPLLVGLCDDELDTRIKYHRGVYSKSDSSGPVENALYHIT
FT                   PARFFHSRLPVGHEGIEAYVSEDFHHVGAVEAFLTPEKLLDWANKHLAEQEGYFYVMLL
FT                   DPAALGETQEYAAEEDVKETGRVLIVGPVGVEAISRVYVASRELNNSRTGKFTNVAPPS
FT                   LVVRSRRDDKDDEAAGDAGIREK"
FT   CDS_pept        complement(<825984..>826892)
FT                   /codon_start=1
FT                   /gene_family="HOG000200813" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635011"
FT                   /orf_name="MICPUN_76048"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63807.1"
FT                   /db_xref="HOGENOM:HBG485447"
FT                   /db_xref="InterPro:IPR014541"
FT                   /db_xref="UniParc:UPI000199AE3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G5"
FT                   /transl_table=1
FT                   /translation="QSTDQVLLISPTAFGYNPEAAKDNRFMHAVDEGELETMRRKVMRE
FT                   HENLVDLLGNQKGPLQMTVHLFDHKESHGTPDAVFPNNWFSTAPDVLNFYPMKNENRRK
FT                   ERRKDLVTYLDRMSKCTIDLTYEEETDPPRFLEGTGSLVLDRVNRVAYVAISERSDKGL
FT                   AEHWGKLNKYEVVSFDAKDRNGDPIYHTNVMMSIGTEAALVCKDSLSTEDWEKVSSSLT
FT                   NTGRVIVEITMEQMECFACNCLEVRNWKFFPALVMSTRAYRSLREDQLEVLREHFDGIY
FT                   HVDLTTIEDVGGGSVRCCIAEL"
FT   CDS_pept        827553..>828977
FT                   /codon_start=1
FT                   /gene_family="HOG000046972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635012"
FT                   /orf_name="MICPUN_81963"
FT                   /product="Predicted protein"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO63423.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="UniParc:UPI000199AE3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G6"
FT                   /transl_table=1
FT                   /translation="MTGVSSALCGTPLAARTRPTATLRSSTARRVKNNNCRRVVRCAVQ
FT                   EPEEDIVSRAARGCDPSNEEECIITPRQVVNGLELPSFEDVSTAHFRIRSGVVRTRCTH
FT                   SRTLSALTGMKIYLKHEWEQATGSFKERGARNSLLALDPEQKKKGVVAASAGNHALALA
FT                   YHGRELGIPVTVLMPSIAPLTKITKCRALEANVVLEGDTIADAALAARSYVENDGMKYI
FT                   NGFDDFNIISGAGSVGLEILEDAKDIDAIVVPVGGGGLIAGIALAVKTINPKVQIIGVE
FT                   PDRCPSMAAAMAAGQVVKVPTAPTLADGLAVPTVGPRSFEVLRPRVDKLVTVSEKDISV
FT                   ALLRLVETEKLVQEGAGAAGIAACLAGKLPELEGKNVAVLLCGGNIDTSTLGNVLERGL
FT                   VNDGRLIRFSAVVPDRPGGIAGLCAVIAFVGASIKQIVHERAWLQEDSHAVQVDVTCEL
FT                   TGDEMKEALYKALSEKY"
FT   CDS_pept        829578..831116
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635013"
FT                   /orf_name="MICPUN_108284"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO63424.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AE3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G7"
FT                   /transl_table=1
FT                   /translation="MARATATVHGFEEAFAFARSPQKSSTFCKKMSKELGYPFYACATA
FT                   EDAVRNADVVFTQTPGGEWVLEEEWLRPHATIIASGSDQPTKNELPPSVMAKAKFVTDI
FT                   TAQCSRVGELRSAIEAGLMTADDVHAEIGQIINGEKPGRVGNELIVCDLTGTGAQDAAI
FT                   GSYVMKALDGVVPGAMPPVFDANKPRLPAPKLYDYDTIKSSVAPSRELTESVEDAFSQL
FT                   ANGRVDVPLPMHIGIAETPEAGPGDCHIKGGYIEGAPTWTVKLANVSFYNNVKKGLPAG
FT                   SGVFVVCDATNGGPKAVLHENRYLTDLRTGAAGAVAVKHLAIKDAKSVAFIGTGVIAEA
FT                   MARSSATVHGFEQGYGYSRDMTKNSAFCDKMSAELGYAFTPCSSAEEAVRNADVVFTQT
FT                   PGGEWVLDLKWLKPHALIVASGSDQPTKNEIPPAVMKKARVVTDITAQCLRVGELRSAV
FT                   AAGVMKETDVHAQLGEVINGTKKGRTGKELIVCDLTGTGAQDAAIGSYVMKVLD"
FT   CDS_pept        831824..833266
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635014"
FT                   /orf_name="MICPUN_100573"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63425.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199AE3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G8"
FT                   /transl_table=1
FT                   /translation="MSVDIDAILKMWNVGDVEEIDNPPPVSIRPRGHLSAPWHGGDDDP
FT                   VSGWEPSLQALAAALDRTHCNEQWKLAFAHLRAAPRRNFAFVRASCYSKFVEVLDDLTD
FT                   VELFEQEERDLLVDVFRQRMAAHETDHVPMILDVTFRSKPVADKQRNREAGKESELMDP
FT                   PTRAEMFQALRLLRGLWLHSPRSCEAAGKAGAVEALLHSFIKGVPDPTENTLAWQMARA
FT                   LEDWKRQVEQAEIDGTLEDMKKKAKEKKPGPPFRISCPGGFDEHGRPVGNELLFEFDFD
FT                   DPEVEYGQPDEDEVRLETLEALLALLSGPDQECRRQFMKLGGVASVAEFLVPWLSENGG
FT                   EDEPSELVQRCIVFVGVLIRHALPGDGDKTDRDDKDEGKQMAELAEATLREIIGPDATE
FT                   EILAAAEELYPGFDKTFGEDSPRAGVDVAELESESFAQSMMEQSLEALKASGIDTEAVE
FT                   ELIAGFKLNQSSEGGDGTAEEQ"
FT   CDS_pept        complement(833311..834450)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635015"
FT                   /orf_name="MICPUN_58661"
FT                   /product="Rieske ferredoxin"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63808.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199AE40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6G9"
FT                   /transl_table=1
FT                   /translation="MASLAIGSATMNVVRNGEGARAATCAASGGGHASSAARQSGVLGG
FT                   LPRSGRSPSLTTGFAGTKLREAPRKTRSHCSHRLQVMTTARYVKSGFSTQDLQDNGGRL
FT                   VANLDGKKILIQEFMGDVYAVSNKCPHLNLSMQGKTALLSAKLTDDGCIVCPAHGSQFK
FT                   LDNGEQVGEWCPNLPDLPLVGKIGNGPAPLPVYQTRVTDSGDIEVDIDGSGDNPDSPGG
FT                   SMSMDEEDVGMLRGAELQQLINMPLADSSKGENVVGAEGVPLAIIEAERKSKPLRRYRL
FT                   GSYALASSVAAAQMVSVIQAGVEAWPTWNQQAVADIGMDILVIISGTLLWRTELQNRAE
FT                   SLKTIWAKAQSREESLKRAEAGLGDTLWTSRMRKKKSKD"
FT   CDS_pept        834659..836176
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635016"
FT                   /orf_name="MICPUN_58662"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63426.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199AE41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H0"
FT                   /transl_table=1
FT                   /translation="MNAPVGDTFATLSMESKVVLFSLAFVWVYLVITAVLSWTKSAARW
FT                   IYDLLGFGLDEEEMLGIKHHKKGGNRSKSKSKSKSKSGNGGKVNKPAGDAASSGPSETP
FT                   LGVGQQREGASSVVPKKPSKTHKKPQHAAEKNHPLHINTLKGHTDAVNMVSFSGNGSTV
FT                   VTACDDATVRVFRLDGGATCRAPRTLRIPLDRDATGACFANVAALDDPAATDGIVVMGT
FT                   SGLGETRLVSFAIYDAAGKPPEVRWDKKSAMDGKTAISLSCGGGGEGLGVGGAPIRIPP
FT                   VAVCSSDSTGVRVWAVDSGVEIGRFDTLQFKNHNAAVSMDGNMIAVSTFTSEVKIWLVL
FT                   RSRQGAPMGVDSKRAAMTLKGHRSAVNWVQFSPCSTRAVTVSKDKTLKLWNLSVRYDVG
FT                   EDPKVLASVDLSDECGAGRMPTRVALSAAGVAAVMIGNSLVFYKISHGLAGTSVKLARV
FT                   DAPHGSGAVVKWMEWSQTPHAIDGDAVEVLATAGSDKRVSLWRSPRS"
FT   CDS_pept        join(837070..837450,837790..838123,838248..839080)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635017"
FT                   /orf_name="MICPUN_100575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63427.1"
FT                   /db_xref="UniParc:UPI000199AE42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H1"
FT                   /transl_table=1
FT                   /translation="MKFTPVNLSDDAVWDAEGLRDPFTLVLGHFETLSLGLDGVLRALQ
FT                   NRSDGVVRLKSRVWGLLNTALGPAAFSRMVVANIVPFSGHHDTGKEMWLGFPPFAEALV
FT                   NRLFLCALNCLGPPEKVAGFGLPVKTWLGDNVGDGAADSPRPLWPGEEISVGPKCVHLC
FT                   LFTQARWRNLALRRPSWFKLFGEFVTYLGGEGEAAAQQLIAALSKDAGVDYDPEYAQRM
FT                   EDWQKERLSKYGFYGSEWSPRRTRYFRNYQSMWGCRVDKKVKEARIEHLRQFGAWGLQI
FT                   SAKVIEARKAKLSASVRRHWDDPELGANRRLAQSEESKEWWDDPDFGGSRKEATGLSMY
FT                   KASAAKRGIEDEPICLPAGTRCACGKTITRNVIVGLAVRKTRGRAHPKISFACPHHAPG
FT                   KTVNVALTSAAERAKVIDTVPDDGGPKLEAAIVMRLQLIVERYNRAGVAAHGDEFEKLV
FT                   LKERHLSTKISATGGSRSSTGGSGKKRPRGMDNDEDPRRNGRIRNLPAPIYTTFERD"
FT   CDS_pept        join(complement(839880..841448),complement(839474..839860),
FT                   complement(839364..839438))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635018"
FT                   /orf_name="MICPUN_100576"
FT                   /product="Predicted protein"
FT                   /function="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase activity"
FT                   /biological_process="lipid A biosynthetic process "
FT                   /protein_id="ACO63809.1"
FT                   /db_xref="GO:0008759"
FT                   /db_xref="GO:0009245"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AEF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H2"
FT                   /transl_table=1
FT                   /translation="MRFAARSALALCLCAAAVVSCEGVNTLSSKDNTLAKHPDAQAASP
FT                   EWTLDEEGLGTWETCDTCEQCILDPLPAGVKPPRPNGGGPGRDPGVVHCKKCLGCSVIL
FT                   TRMKESQPMKAIGKDVKVFSGASGAAVMKGVTAERGNVFVKAWCGLKGNYRQTPRNHPL
FT                   PTKCEHDGEDIPSSQRRPCQLKGGIFGWSECNFKFLNALDKLAEDANLTAATPRTWTEH
FT                   VKSFIPWQEGDEAKGIKVDTRMQFYEVAEGASIEALYGGVLDARTMALTKKIPHEDVVR
FT                   AAVFDLLFSEQDRHGQNVFVSETGRLHVIDNEGAFGPINSMLIPGGQKYEVYRIGYNAV
FT                   CCGNLPGTEEENCPGKISDASAPEVMIDYRCHAPGRFIGTALPPGLEPFLRRIEKMSAQ
FT                   AVFDHYEMSHLEHAKTFKVRVSEMLDGGFERAMIAQYARQPPGDGKQYGNDFFYGLQPA
FT                   CCGAKEGAHCKVRIAGREEQSFNNLSEEDKLVWPGNEPGREANTLWPGPVEAPHLKRPM
FT                   GNKLRRDSGEVRIPAAAALAQDNLHLSMRLAVDDDNGVITCEHLLSALEAIGVDNARIE
FT                   LEGSGEVPIVDGSAYQFAYECARVGLVPAHADGSTAEVPRMAWRPSEMITVRDGDAFVQ
FT                   FIPDAVTKLLPMPREREGSWGRIRQMLKREAEARGEEMPKF"
FT   CDS_pept        complement(841538..842536)
FT                   /codon_start=1
FT                   /gene_family="HOG000264920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635019"
FT                   /orf_name="MICPUN_81795"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63810.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniParc:UPI000199AEF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H3"
FT                   /transl_table=1
FT                   /translation="MTFPGAGASSLFALSSTLAPDHVSEIQLQDVCLGEMLGQGAYGTV
FT                   HRGEWKKDGEDDVVLVAVKTLHAMTGVSRQEMRAFTREVAVLSRLDHKGIVRLLGACLR
FT                   LPHVCIVEELMQGGSLWGFIHGDGSCRFGRRLTYEETLRVAKDVAGAMAFLSTKGIIHR
FT                   DLKSQNVLLASRMWTSDWRGGDDEPTWAKVADFGIAKAHGHTLMTTAGATQKAPSGQGT
FT                   PAYMAPELFRGLPDAGMDEKCDAYSYGVMLWECVTGRVPWDWMANHLQVIFAVAVEGSR
FT                   LPLPDASESCGVTEELRDLVLQCWKEDPASRPSFKDVERRVKAMRRHLGRL"
FT   CDS_pept        join(844031..844118,844353..845212)
FT                   /codon_start=1
FT                   /gene_family="HOG000100066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635020"
FT                   /orf_name="MICPUN_105599"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63428.1"
FT                   /db_xref="HOGENOM:HBG411313"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019306"
FT                   /db_xref="UniParc:UPI000199AEF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H4"
FT                   /transl_table=1
FT                   /translation="MVQVYVEPISRRHYAPYFSVAFLYRPFCIIASLIIAFSIALTSGG
FT                   LWVKTHTYVTQPSVRFKYDMLLVFETSKGPGTERVWSTFDSVNYLMGNKLAPVDISASE
FT                   QDVNSDGKVDLIDIKAVVRGVGDVHGVKALMAFDYSLGGRVDLVMNSMAYASHSSPLAG
FT                   SGLYVDGYLRLDQRDAIPAGFTRHDYNYSVFPFAEHGEAKGDTRDASTLRLPVVLNQYN
FT                   FRNESTYLDAKTPVWESGNSPDFTFQARVRIPTSQQVLYRPTTLEIWKFAWVQILAIYI
FT                   IFWWIFTKFEYVVFHHRIVDTRVVSDLQAKSHRF"
FT   CDS_pept        join(complement(845757..845913),complement(845626..845702),
FT                   complement(845426..845491))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635021"
FT                   /orf_name="MICPUN_58667"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63811.1"
FT                   /db_xref="UniParc:UPI000199AEF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H5"
FT                   /transl_table=1
FT                   /translation="MSGILRAAAPLARRLNAVPKGPIAQQTRGMACECPERRAVSYLPP
FT                   SHPGLDYPDPNAPPKVAYPWLDPTNPQNWKEEHLVFTILGGWGVVIMGAKSAFS"
FT   CDS_pept        846576..847214
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635022"
FT                   /orf_name="MICPUN_108285"
FT                   /product="Predicted protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="ACO63429.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI000199AEF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H6"
FT                   /transl_table=1
FT                   /translation="MAVTTRPAVLAKRSVRACGARASASVYTVQRNDNLWNIANKYGVS
FT                   LDDLKRVNSTTLGGNYDVIFPGTQLVIPGGMKKSSPVPSFARPASSSSYNNYSASVAPA
FT                   SRPAPRSSSKTGIGLVTAGAFFIALAVGIMVFKDDDGAQESAEGRYDDQGNWIPTGYEG
FT                   QGYYDPAGNWVWVQQGPSSSQGWGQGYQSGWDEAPQQQQQSGGQWNQRY"
FT   CDS_pept        join(complement(848259..848381),complement(847293..848147))
FT                   /codon_start=1
FT                   /gene_family="HOG000200535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635023"
FT                   /orf_name="MICPUN_97407"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO63812.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AEF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H7"
FT                   /transl_table=1
FT                   /translation="MAQSLIAGGRITASAGSNLLGQHAVDRNQEATVYVGNLDPQVTEE
FT                   IVWEVFVQAGPVVNVYMPKDRVSNAHQGYAFVEYRGEEDADYAIKVLNMIKLFGKPIRA
FT                   NKASVDKKSTDVGANLFVGNLDPDMDEKLLYDTFSAFGVVITTPKIMRDPDTGNSRGFG
FT                   FVSYDSFEASDAAIEAMNGQFLCNRPISVTYAYKKDTNGERHGTPAERLLAANMEKKTT
FT                   THRPHTMFAAGPAGAPPGAGPPGMPPGMPPAGMGMPPPPLVGVAPPGMMGAPPGMMGAP
FT                   APPGMMGGPPGMMPPPGMMPPPMGMPPPGMMPPPGMPVPPPPPQ"
FT   CDS_pept        join(848706..848831,849133..849294,849546..849815)
FT                   /codon_start=1
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635024"
FT                   /orf_name="MICPUN_81410"
FT                   /product="PUA like RNA binding protein "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO63430.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042255"
FT                   /db_xref="HOGENOM:HBG377944"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniParc:UPI000199AEF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H8"
FT                   /transl_table=1
FT                   /translation="MRPLEESEIQQVFEKLFKFVGKNLKNIVDRADQPHCFRLHKKRVY
FT                   YVREDIMKRATNISRDQLVSLGVCVGKFTHSDKFRLMIGALELLAAHAKHKMWVKPTSE
FT                   MSFLYGNHLLKSGLGRITENTPANQGVVIFSMSDVPLGFGVAAKSTQDCRKLDPSAIVA
FT                   FHQADVGEYLRAEDDMVQGKKE"
FT   CDS_pept        849991..>850563
FT                   /codon_start=1
FT                   /gene_family="HOG000111811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635025"
FT                   /orf_name="MICPUN_81733"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63431.1"
FT                   /db_xref="HOGENOM:HBG447250"
FT                   /db_xref="InterPro:IPR019332"
FT                   /db_xref="UniParc:UPI000199AEF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6H9"
FT                   /transl_table=1
FT                   /translation="MSSLYCLPIVFSNLGVEMLYVLEQRLRAQKISEDKAVKVLHDVVK
FT                   AMFDPQFVDELFKPQEVYTQKATRHIFDKLAHSSIMRLSENSMDKLYDLMTMVFKYQLV
FT                   NCLQPREIMDVTLTHLATIKSYMTDRAVIKLADDFEKRARDLYGTFQPFDWCELCRTLF
FT                   HFLQGKNIKVSLLLQEGLQNPDGTIKVP"
FT   CDS_pept        851285..852484
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635026"
FT                   /orf_name="MICPUN_50307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63432.1"
FT                   /db_xref="UniParc:UPI000199AEF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I0"
FT                   /transl_table=1
FT                   /translation="MHITWKRLRLVCRDNLGPCTTKQISTADRTVMGRAGEVTFDRVEL
FT                   AEETAESLLDRFCKTRLLWLRLDESTSHGTDALLGLLRAVARGGEPATREWSVENAARA
FT                   KGLDDALEVIEKLTRRLQGKTVDMPSQFYCSTVLGSEVAAKLKEAAPTAVSEPGFLGRS
FT                   LPQGGCIWIFMGLNDTGTAKQNNKRPAETNEADDGENLAGRPEHTDSVACSGTYHHQIS
FT                   GEKIWYLRPCVDASAWEDSPAPLLPSGRRRLRLHCEENDLLLIDTRAWWHETALPRGSR
FT                   PSVSYAREFFLPDEHGGEENAAAAAERADRFTNVDAMYAERPISAGDIVVTELDDPTCE
FT                   AGRSDDPNCVLCDVEVETKRGEVRSVMGIVAVRDIPAGDFITIAPSDSEEDEGDEDDEG
FT                   "
FT   CDS_pept        853340..854740
FT                   /codon_start=1
FT                   /gene_family="HOG000233857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635027"
FT                   /orf_name="MICPUN_108286"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="amino acid binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO63433.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015783"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniParc:UPI000199AEF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I1"
FT                   /transl_table=1
FT                   /translation="MRLLERSAVEKPGGVLCESRGIRVSTVLGDMSNSTENMEVALSPG
FT                   ATKRLRAPTFGSSFNLHTLEEHLGGEAGASRAVYEIAVSGLNRPRMLSRVSTALFDIGL
FT                   NISEAHVFCTDDGYALDVFVVTGWRADDEAAMNEKLQRRLDQVNWDEGVKPGTSDGATM
FT                   GEGEKALAGASDSEWEIQEVQLNFMEKIASGAFGVLYRGSYCGQEVAIKVLKTGGKSSQ
FT                   EEVYREFAQELSILRKVRHKNIVQLIGAMTKPPRLCLVTEFMKGGSALQYLHQRAPLKL
FT                   NQLLKLSSGVALGMDYLHKVNVIHRDLKTANLLMDENEVVKVADFGVARVKATDGKAMT
FT                   AETGTYRWMAPEVISHQKYDHKCDVFSFGILMWELVSGGDIPYPGYTPLQAAVGVVQRG
FT                   LRPTVPPLCHPVLSQVMQYCWQPDPWARPEFEQIVELLKHTDSQTETVPNKGFFSKLRK
FT                   SMTTSSKG"
FT   CDS_pept        855406..855945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635028"
FT                   /orf_name="MICPUN_108287"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63434.1"
FT                   /db_xref="UniParc:UPI000199AEFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I2"
FT                   /transl_table=1
FT                   /translation="MAAVASLAIVTVPSVTYSRRSSSSALSRVAFRRAPRLACRASSDE
FT                   VDNTPGNSDQGIFMRQITPEEKDAEVKWLGGMLKLWLDDEWSLQEPHKELGLRAAEKCT
FT                   SMRLEGCEDMGSLVMGVAADLIEFDFSDTFVNAFEVANKCSEILMMREGYEVCCINKDD
FT                   MSRQARYEEMVANGEV"
FT   CDS_pept        join(856155..856823,856938..857816)
FT                   /codon_start=1
FT                   /gene_family="HOG000265695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635029"
FT                   /orf_name="MICPUN_81649"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63435.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG561176"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199AEFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I3"
FT                   /transl_table=1
FT                   /translation="METVSPPGSIWRSEALALWALVLPIVVQMGSQQFMVATDLLFLGH
FT                   LGRSELAVGSLCTTIFNLLWFGVAGFGTGFDTLGSQAQGAADFAAVRQWAFLAAAFLTA
FT                   CCVPAAIVLSCGESIARTILSQDEYTSERVGRFCTLLIVGLFAAAWTLVMQKFLQVRGV
FT                   VKPVAWTSFATFLLNIALNVLFIRIMNLGLNGSALATTTSRVVNLILVAAYLRFSDQWS
FT                   AGALTEVWRTTTPCMCKRMFELGSRGAVMVAAEASSFDVTVVFASQISQVAMNAHMAML
FT                   NITGLTFMTGPMAFGIAANVRVGNLLGAGSGFRAKVASRVSVALGVTWMACMAALILIF
FT                   RRQTGEVFVGDKDNEMVMLAAKIAPIAAVFQVFDGLLGTSNGVLRACGRQALLAWMNII
FT                   ALWLVGVLSGYVITFLLKAGVIGLWYGLALGVTVGGVVLFLIVTRLDWDVEVASAAAAA
FT                   LTHGIGGSSASLASVRYEVLEEDSDSPSSTGSGEVEMIGELRRKDNARKSRDAMRAT"
FT   CDS_pept        complement(857834..859075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635030"
FT                   /orf_name="MICPUN_58674"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63813.1"
FT                   /db_xref="UniParc:UPI000199AEFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I4"
FT                   /transl_table=1
FT                   /translation="MQRDSLMRRNDIREDQEPGEAARGFCRRCGSTHRLERSQRAESEA
FT                   KGLVERIRAAGRLDFDAAVPDPRFAVERMYEQGGGKMLGVLLAASPSGVPCGEGDGDDV
FT                   VVIKAFSGQLYGEWTVQGWAPPLCGLTHDHPHYEKEHARIKARVDAAGEMKLAVEELER
FT                   EMKVRTKRWDDDIKAAASRLREERERRRATRAALRDAGDAAAEVVEEELAEESRRGKRE
FT                   LARLREGRSADVGDIEVALVTARREMKELRDEHRSMSHVLLGQIFDSYRLPNFREDGGF
FT                   GHRHSEGRVAEAADDFSGGMSGATLQEAFVSDEHQEISNAVANLPCGCGDCCAPKLLAE
FT                   ASRRGLVPLSIAEVWMGVPTAKEGYRQEGSFYGACRGRCRPILGHMLCGADKLRPRLID
FT                   PSADATENFNIMLG"
FT   CDS_pept        join(859399..859622,859730..859892)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635031"
FT                   /orf_name="MICPUN_58675"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63436.1"
FT                   /db_xref="HOGENOM:HBG561178"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199AEFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I5"
FT                   /transl_table=1
FT                   /translation="MKLRIKPRQENHKWSLYWKCSMATHTFTLDPFDIEVDPGVMTAMQ
FT                   LRRKLAETIGLRPEDELCRLESFVEPWELCMYKGRELEDDKTLADNGVVDDALIVFVRK
FT                   QLIAEGWKILQEDNEDSSTEEDDF"
FT   CDS_pept        join(complement(860494..861215),complement(859999..860419))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635032"
FT                   /orf_name="MICPUN_58676"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63814.1"
FT                   /db_xref="UniParc:UPI000199AEFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I6"
FT                   /transl_table=1
FT                   /translation="MAFVIVAAPRLLPGLKARGYDSSKPRTPAPRLVCAASGKVSYPLS
FT                   QHEDLSVRSLPFVLSVLGPIISASVISTQQDDSPMTEGNMADMMAKLAAAEAEAEKLRS
FT                   ELKESAKAPVPTGTIDELAKQKPAKPENRIDGKGGRETLFGTAKNSGDAWLKDGMQFLA
FT                   RDQPSELGESVEMSKEDQDTVNRRLAIGLLGTGIFVGLSQISVEAPAPSKPLFFYLVPL
FT                   VKTRELLKQAADLAENGYWDELSTVCRQIVVANSAKENLFKAAAYLDARQEEKAKQVAF
FT                   DFLELTEKIDYNKYFESMGAVSGQKAAEYSKFSKKAAIAAAAKLDEFFALMDRDQLEAA
FT                   RSQVMAFADPAPEAEVVTDDSGASTGEVATGFSDGYEAEQ"
FT   CDS_pept        join(861671..862279,862565..862663)
FT                   /codon_start=1
FT                   /gene_family="HOG000237936" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635033"
FT                   /orf_name="MICPUN_81720"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ACO63437.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG284653"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000199AEFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I7"
FT                   /transl_table=1
FT                   /translation="MEDSVFAELELAEAAQKVGGVRVRQHVNPLKASLQSQAPVPAWTD
FT                   VYASTARPLVVDIGCGGGRFDLMMAKKYPETNFLGVDIRAPLVERGNKWGEYAGVVDNL
FT                   HFAECNATVSMGKWLKSYAEDCGSKVETVAIQFPDPHFKKRHHKRRVVQPALVRALAEG
FT                   LTPGARVFLQSDVKDVSEDMRDKFERFGAHLFDLDASLHDNPLGVPTEREVQTTSTNGR
FT                   CYRVMLVRNNTTV"
FT   CDS_pept        862958..866971
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635034"
FT                   /orf_name="MICPUN_113650"
FT                   /product="Kinesin"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO63438.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199AFB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I8"
FT                   /transl_table=1
FT                   /translation="MGADEDTAVGAALAEMDDAISHAMEEEKELPVTVALMMRPLVGPE
FT                   LVDGCQACVFPSATEPSVTLVSDHKFTYDHVYHPGTECDGPTEKRLFEQCVEPLVNGLL
FT                   SGYNATVLAYGQTGSGKTHTMGTAYEPGGATEGVIPRVMNALFSNIAALSDDVTVNLKV
FT                   SFIEIHKEDIRDLLGSNNQNVSIRDAPGATGGVVLMGVKELPVNTLEKMAGALASGSQS
FT                   RATAATGMNHRSSRSHAIFTIHVERKGADPADVTRAKIHLVDLAGSERAKRTKAEGQRL
FT                   KEGIQINKGLLALGNVISALGDDKRRMAGGHVPYRDSKLTRLLQDSLGGNSRTVMVACI
FT                   SPADANLDETLNTLKYANRARNIMNKPTVTFDENASQQVAKLRRMLATARAEVAHLKLN
FT                   GVSGFSSSSDTNGFVDSTKLEAMEARAMIAEAEAARLRADLVAAEETAAAAQAAELAAT
FT                   VERDRLALKIEDSGMNPEQDEGGSNVIRSYLSTIALLRSEQSRLRHQLKAFQEGRADPY
FT                   GEDPAANYDLDDNALDFEEEHEDLEDEEEPLEIDEDLENDELHAELATVERTLQAKEAR
FT                   MRAMSSAAQKLQDEVDAATMARGDSAPTLGSPEQQVVEELREKYGRLLKSLESEKSELA
FT                   AERDKLLDALAAAAKQGDDVRKEVEAKNRARLQELEKRLKELHKLAAKHKEAQRLREKS
FT                   DQAAKTLQADIQRLRAARVELVRRMEQAAKDGISKQREAERALEAARKEGRRHAIAAQK
FT                   AQAAVDRQAAVLRRKTEEAANARDQLRALQAAAKANLRKKPGATASAPPVAAPVVAAQL
FT                   ASAVAPAVEVAPIPGPGKGGPGTGLGLNARKAWLESEISAAIEQAELRHALEESLARRA
FT                   ALGRRFPHLASPGKSAFERTPGHALTPGGSVDEAVEEEMRAVTEQIAMLQERVYQSEER
FT                   EEVRGGMKRWSRVRSLGEARSLLTIMFNTATNARRKTDPGSLPSGASGASGVVEEADAV
FT                   LRQLKSAKKKPKKFVRPPWQAVGPSSLSGSPEEAQEEKPEPKKKVSTIEYAETSESESE
FT                   DEVDLAEHDDPEWNEDCQTPAVIGGRVRRVLAKEAKDAVKKGPACTVCTQMFSKRVEGH
FT                   QKSHKRCPFYSMYLLDKDIKLLELQDDIEAKDELKAKTAELNAETNRLHKAVMDGVIQP
FT                   PVEDAELSPEDDSGSARDSISSDGTFEKTTESNRGEGDTPSGAPPDVPLSELITTCREA
FT                   RRRAESLLHASGGNTGMSVGRSPFGDVSNSAPGSASVTADVRKRMSFGGASMDAVEFTG
FT                   VTVGRGSTGGVPEETEDFQFKPIVDATEEFKFKSVVNATEEFRFQSSVNPDDL"
FT   CDS_pept        complement(867052..867798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635035"
FT                   /orf_name="MICPUN_58678"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63815.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199AFB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6I9"
FT                   /transl_table=1
FT                   /translation="MAKENKRKPKTPKSARAKQKPAEAATAVATDGVAKKKKKVRVPKT
FT                   PKGKAAQSPAGKGKGKGDKDKDASEKWKHGDWACAKCGAHNFRGKDTCFRCKYPKANSV
FT                   KAASAETAQQYLQSFTSKMDSVQHLWLAKNVYGRDVNDACFDLFASYVRKVDNKSKLQL
FT                   LTGAQKAVERASKIVEALKDTPTEVEENGDTRKKAKGMKRKGEEKGVKKAEKEKPKKKS
FT                   KVEKAEDKPKDDKKAAKKEKKEKKKK"
FT   CDS_pept        join(867949..868369,868448..869214)
FT                   /codon_start=1
FT                   /gene_family="HOG000217992" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635036"
FT                   /orf_name="MICPUN_82264"
FT                   /product="Predicted protein"
FT                   /function="RNA methyltransferase activity"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63439.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG335345"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniParc:UPI000199AFBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J0"
FT                   /transl_table=1
FT                   /translation="MAAGAISLFRRCGTRRVLLDLARERVKGDRLASSAASSQRTLLGL
FT                   GLDELRELSAEFALPQWRGQQIHDAIYGEMRKTTIEGMQQLPLGFRQALVDAGYETGRR
FT                   EPVEIVSDEDGTRKALFELRCGSIIEAVGIPVERAKGRRRRFTVCVSSQVGCAMRCSFC
FT                   ATGRQGFRRNLTSDEIVNQVLSMEDVFGRRATNVVMMGMGEPLLNLREVLRAHRCLNRD
FT                   VGIGGRYFTISTVGVPNALSKLAAHRLQATLAVSLHAPTQELRERLIPSAKAFPLDALL
FT                   EEVRMYRKATGRRVTFEYTLLAGENDSEDHARALAKLLRSKVGRGCHINLLPWNPVAGA
FT                   NHQRPSKSAVNRFCDVLAAERGVSYSVRATRGLVAQAACGQLTGAFERKSSRSNW"
FT   CDS_pept        join(869485..869614,869726..869799,869916..870164)
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635037"
FT                   /orf_name="MICPUN_81538"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO63440.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199AFBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J1"
FT                   /transl_table=1
FT                   /translation="MSSAAKRIQKELAEISLEPPTNCSAGPKGDNLYEWVSSIMGPAGS
FT                   PYAGGVFFLDIHFPSDYPFKPPKVTFRTRIYHCNVNSSGQICLDILKDQWSPALTISKV
FT                   LLSICSLLTDANPHDPLVGNIAQQFLNDRAAHDKTAVEWTRRYAQG"
FT   CDS_pept        join(complement(871904..871927),complement(870403..871812))
FT                   /codon_start=1
FT                   /gene_family="HOG000165713" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635038"
FT                   /orf_name="MICPUN_58680"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ACO63816.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR004057"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI000199AFBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J2"
FT                   /transl_table=1
FT                   /translation="MREIITVQVGQCGNQIGCRFWELALKEHAAYNTKARYDDALSSFF
FT                   QNVDTRHEPAIKLPVGDGKGSIRALKARAVVVDMEEGVTNELLSGPMRDVFDTKQFITG
FT                   QSGSGNNWACGSHHYGPMYRDTLLEAVRRQAEDADSLQSFLLLHSLGGGTGSGLGSYML
FT                   GALADEYPDVYRFSVSVFPSEDDDVVTSPYNAMLSCAALAEHADCVMPVENQALMDIVT
FT                   SIQSKSLGSQRGSSLSGLDSGDVGGRAGHGGKPWDGMNGIAANLLLNLTAGMRFDGSLN
FT                   VDINEITTNLVPFPKLHFLLSSMSPVAVSADRGRNIPAPRTMDQIFTEVFGRDRQLASV
FT                   DPRRSTYLACALMLRGGVNISDANRNVERLRRGLKMAHWVSDGFKVGLCDRAPVGTPYS
FT                   ALCLANNCAMQRPLDAMNERFGKLRKRNVYLHHYTEYMDLADIDGAAECIQDLGAEYGR
FT                   LDIARVPDTVPSIEPLGIR"
FT   CDS_pept        872265..875060
FT                   /codon_start=1
FT                   /gene_family="HOG000264940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635039"
FT                   /orf_name="MICPUN_58681"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO63441.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG561182"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AFBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J3"
FT                   /transl_table=1
FT                   /translation="MAGVSGKVYDAGGEDVGIRTKVNDLNVSSKRGVVEGIGPESKRPT
FT                   GTSHQTGPSTPDESAPASLTKVMSQGITVDDEEQLHNSDKENMTVPAKLAGLNLQDIES
FT                   SEHDGDDDFDDGDSVGNMLDRSYDLDGDFGSHAGTNMDDSHNLDADDEEEAEQRRKMDA
FT                   DLEMNLRRAELRHVELELKLVSAEEEVRKAKEALEKAEAEQQEMQRQAHEAWEEVGEAE
FT                   RLIQVEQTRREEEDAAKALAERQARAIIEADELRQQGNEAYRQGNSQHAETYYKRAIDE
FT                   LESCGIVLEEPSHLTLRTNRAAALMALGHTRDALSECELVLEINPYNIRALSRAANCCI
FT                   KLGDLDAAKKHVDEIGLSPDATEEDIHAASEQNQKILVASVERDRLVGNESYRRGDYSG
FT                   ALHWYDAAINAAADAIETDALKSVKVGLHTNRAAAHLMEGNPLPAAEDCCAALRLDSTH
FT                   TKAQVRLARCLLQLGDFSEARQEASDVIARNSAELQSKNEAQNVLKDVDLLEGTMKSVG
FT                   DELQRIQMTLRTGDGGDDFDATSLAKSMLDELETIMVIAPQVPDLVTLKAEALRLAGKL
FT                   EEALSLVSGKKAMNSRRRFIEVRLQFDLGNVSACVEAGEHVRELLQMVPEFKLTLKAAM
FT                   ENKDDSVADDDENIKELASLPDPEGMLILLQNASKINTCKDNGREAFVQSKHSEAAKLY
FT                   GEALVLSAGAPMLEGLFLSNICACEQAMSKYADALSSAGTAVAIAPTFVKAHSRLATLY
FT                   TELGMLTEAEAAYKRMLEMPLESHEEMQASANLASVSARAKNSRPVNWYKLLGIKSSAS
FT                   AADIKKAYRQLALVHHPDKAGRGGVSAAVAKARADMSSILFKLVGEAQRILTNPAERSK
FT                   WESAQARADHQDSYLSRAHTTARSDFYADQFGDRYERYASQYADFYDEYEGFDDGGYYG
FT                   V"
FT   CDS_pept        complement(875166..879716)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635040"
FT                   /orf_name="MICPUN_58682"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63817.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199AFBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J4"
FT                   /transl_table=1
FT                   /translation="MLVGRPARELALALFLLIAAWIHPTHPANTEVRGVTLESIYPEVG
FT                   TAHSFTSVTLYGEGRVQNLPTLGCRFGEVVSTYQAHVPGQTITCLTPALGPGFVIVGYA
FT                   VRTGTKYAPVRDDISLENGANMFEFAQPWRVTSVFPDETYASGGQLLFIQGQDIRPELR
FT                   CAFVDNSPTGATIHFVSSTLVVCEAEEFKSKSSGVLTLQHNSHNCPEGQQITVKHREVP
FT                   MIDYSGLSSAAFGETITITATNLNAAAPMMLSWQARLGCQFGGVWVAVSTQSAVNKISC
FT                   TIPASTAGNVQVVVSDLHSFMPLPLENDTSVALDVPPSGRFKLILRESALVEAIVPATG
FT                   TPSLRSNTRTIDIYGRHLSSDMTSIENLCATLKSTYDYDVHQGAVRLKCSALLFDGGKI
FT                   QTGHAYRIGFNFVSILSGPGDGPGGEIQYLLQNPPRIHGSTATSAYAGDVLMVTGQDFV
FT                   DVASPVWCFFGVATQRAQIVSSAVARCIMTIEDHARASSLHRSASGLQVMLGLGFLEAA
FT                   ESTSNLISITSWLQPHEVAAVMPDVGFSHGGTLVSFSAKGGVGTVRFHPLISCSFGTIS
FT                   PVSAFVASGDTMACTSPALAPGSVLLGTQASRTSDTAVLYRVIDADSIIITPQTVVASL
FT                   SGGVVEFLATSSQPLSQMGIGCVLLSTDQSPTKARYQDGGGSRFSCTLPTTVTGFSTWD
FT                   FSVLTFAANTKLASATTQGPYSNVPAPNLDHSATMPSKGASLLHDDNQISIIDAAPVVF
FT                   VQRRAHLSEVYPGDVLFIISRSGGMEESASCVISSGGSQTTASLDLQTIVPAIAISSAI
FT                   TRCEMPTLYNHGDNVVNGAALTMCLSGLCIENKLQVMQDSAVLFIGEELIPSVVSPSEG
FT                   SSYGGTVVNISLSGSVLNPSKPAIGVQIGTIGPISSIILENGALQFISPGHISGKFPVT
FT                   LGRGTPLVGDADFIYVHVDAAPSILEGKDTDAEIAVSSAVTKLEICRDIPPGEVAELTP
FT                   GRGSSDGGTEVFLVIEGKISHPDDNCGTLRISCRIGTVWPVLGQVTDHGISCITPAHAP
FT                   SKVQVSAPKLVDGPGQQFNYFMLSPVSADKSIGETANDTNYHVTSSPKLGTPGASIDVT
FT                   ATKSLMTPFACLFSSPVRALAPQIYASHAYVISSIMVRCETPSSITVSGVSFVEQVSIE
FT                   RSAPRVSFSAYREAPECYMKQISPKTSSTTGGVVSKVTVECLSSGSLTSIDARVGCRYG
FT                   TLGPITATMGEGGIHNIECAAPAHAPGPVLLALTTNWRDVNFETSSSTDKQIVQLAYEE
FT                   HKGDTSAKAELELLPMHRFDASVPMMSGVVPWLVWGGNLLHVTGRGLPNGYNSVCMVGS
FT                   VLVPAHSISSALVLCDPFPVPMQNRSSNGILAGGLQEMSLSVASSEHGRLLSRGDVTPL
FT                   NLLVISEAPVVGVDVLNGWEQGGGHVNVELGGWAPTGLMDCHFGTVVVHGRGGGGAGWA
FT                   GRAAMGRAGEWWSEATIATDVECVTPARQPGSVPVGVSLAHSTSPSYGNIEYKYL"
FT   CDS_pept        880770..882071
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635041"
FT                   /orf_name="MICPUN_50312"
FT                   /product="Predicted protein"
FT                   /function="protein-L-isoaspartate (D-aspartate) O-
FT                   methyltransferase activity"
FT                   /protein_id="ACO63442.1"
FT                   /db_xref="GO:0004719"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="UniParc:UPI000199AFBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J5"
FT                   /transl_table=1
FT                   /translation="MTNISLEEMNAVGELLRSSAFDAFELEMEVTSDGEITAIALWTDC
FT                   TMFDKVHSGGADQPSRRQMLSFLPKPLSVVEGSTVRLKGRYDASTGHFTFASSECSPNN
FT                   SQTNSVVSMSVERWHFPMINDERRNSAYNRAIKVLRGQRVVDIGGGSGLLAMMAARAGA
FT                   EQVVTVERVGDMAECASRVLEANGFGGKVSVVHGSSLNLKVPDLGFKEGLQPTVVLSEV
FT                   LDDGLLGEGVIPTVAHARRELATLNALVIPAAAKVWAMVVNMPPQPEPIIMPSSSSPKD
FT                   SPARRWAAYDTLRPPEVKKYTSVRLDRVKFMPLTEPFPVFGFDFDAPLDDPSSVADYCR
FT                   EQAVQVNSIAAGCANAVVFWFTLTLNRSGETDGLADICTYPAMTEKCGASGSSRCWNQA
FT                   LQFVKPTIVGGAGTTLTVPCAHSPTRMTFGDIMT"
FT   CDS_pept        join(complement(882865..882906),complement(882691..882790),
FT                   complement(882101..882612))
FT                   /codon_start=1
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635042"
FT                   /orf_name="MICPUN_58684"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63818.1"
FT                   /db_xref="HOGENOM:HBG736553"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniParc:UPI000199AFC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J6"
FT                   /transl_table=1
FT                   /translation="MATQAYLLLYNTAQALGWSAALATTVRSIVVNGGSLAAVYGDSGW
FT                   FVRTFQVASVLEVFHAGLKLTRTPMSAALMQWAGRTHVLIAVTHAIPHLQTTAAAGILI
FT                   LAWALTEVIRYPSYALSQSCPGWLNWLRYTIFIPLYPIGAASEMKLMYDGIPTMTAKKM
FT                   YSISMPNAYNFAFDYTSFVKVVLILYPFLFYQLYAYMFVQRKKKLGPSTRKKED"
FT   CDS_pept        join(883048..883206,883292..883388,883510..883808)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635043"
FT                   /orf_name="MICPUN_50313"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="ACO63443.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199AFC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J7"
FT                   /transl_table=1
FT                   /translation="MSTPGVSEIVPAGASDGGDVAPKPKGKPPKGPGGGRGGRGRGRGR
FT                   GGALGKEKGKRTAEEAEITEEKEPEEDKKRFKWKGSLAKDLRYMMYGFGDAENPLPETV
FT                   DLVEELTIDYLTKFAKKAMEAANRRGRLQTEDLLYVIRHDEKKLARCMELLEMNEQLKE
FT                   ARKNFDTTDAGAADAADAADE"
FT   CDS_pept        join(884046..884291,884379..885131)
FT                   /codon_start=1
FT                   /gene_family="HOG000198062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635044"
FT                   /orf_name="MICPUN_58686"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63444.1"
FT                   /db_xref="UniParc:UPI000199AFC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J8"
FT                   /transl_table=1
FT                   /translation="MAAGRHTNQEHSGGVTSRTPILTLRMAPKKAKISEEAKNVEKDEA
FT                   EDKEKDDDHEDESSSEEEEDEEDFDGSSDDDSDEEILVDFEFMDPKEIDFLGLKALLGN
FT                   YLDGALFNSSELCDAIIAQNTVGTVLKAQGAGDEVDPIAVMSVMNLQRRKEMKWMQETI
FT                   EYLKKNCPKDLKDQFEALLGEEGVGLIINERVINVPQETAQPLVNLLFDEISNATEDEP
FT                   TEELRESFKFKKYILLTRTFLEEYAEPAGVGGGKRKRDAATEMVYPRPEDQFFHKVSKM
FT                   SFQWKSRELGENDDVDSFQPMRLCMVVDANSVPQVRKQVKEMFTGDFEIKL"
FT   CDS_pept        complement(885140..886252)
FT                   /codon_start=1
FT                   /gene_family="HOG000100067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635045"
FT                   /orf_name="MICPUN_100589"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63819.1"
FT                   /db_xref="HOGENOM:HBG561188"
FT                   /db_xref="UniParc:UPI000199B06D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6J9"
FT                   /transl_table=1
FT                   /translation="MNHKDVRNKYSISKQGQPDWCHFCKCWVQTHANAKRMHEQSNQHK
FT                   KAVETKMREIRKTKQKEEREEEATKRALASIEAKAAQAYQADLAGGARPEDTHGPKPLS
FT                   AEARLRLEQESVKHELEEAIAKELKARAEAEYRTQQEIGEWKFDDRSSYYWHAKSSCYF
FT                   DPKTKMFFNTKSNAWSKDGPENAPPVPGDATPSGPEQVPEEQYPLGPFSSKAAKSTPAA
FT                   PVVASQKAAIPAAQVSKVAGWTHAPSGIQPAGRVASSTKPTGKPTGMTSMFNLGYGTNH
FT                   PAYEAAKARSQASAQRAMESAGGRTFQAADIKQLGVVGKDGGAAKRKRVEGESAAKQPK
FT                   VSKEEAEALARRAAARARVEARTMKSFGLE"
FT   CDS_pept        join(886615..886923,887091..887354,887443..887709)
FT                   /codon_start=1
FT                   /gene_family="HOG000264943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635046"
FT                   /orf_name="MICPUN_58688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63445.1"
FT                   /db_xref="HOGENOM:HBG594824"
FT                   /db_xref="InterPro:IPR021788"
FT                   /db_xref="UniParc:UPI000199B06E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K0"
FT                   /transl_table=1
FT                   /translation="MNVICGRVACAPTNSSPRLGSGRSPVSSKRATANLLPKLHSRKNG
FT                   RGSMFVVRASDGTESSTMDYAGALKFLGLSESASSEDMVRAKNQMIARYENQEDKLQKV
FT                   EAAYDVVLMRSLMKRSQGEVSDNRVKYADVLSPGATVKQNLPPWARDLTTKLPPRPAFE
FT                   TPDNETLTQCGIALGVLTALTLAQGCSQPPGVDNPPGLQLSLALLGSVWLLRKKNLTLS
FT                   RSISLALLGLSAGAFVGGAVQGWLRVDIVPLGALSSPSALVSEFGLVGIFAASAFLY"
FT   CDS_pept        join(complement(890748..891030),complement(890375..890569),
FT                   complement(889651..890291))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635047"
FT                   /orf_name="MICPUN_58689"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63820.1"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniParc:UPI000199B06F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K1"
FT                   /transl_table=1
FT                   /translation="MLRQGSPLKVNLWSHNILQSRDGPFSVLRVRRCLGSVDTGSPTSV
FT                   PGGNDIGGYVDTFIKQVDEHWTFIAKPEHMRGILQNDRRCQPTHRNLPKDVLLRFALAE
FT                   DENGEAWVIPDSNAVYPGRGMRVLPSYAALEMCAQSRSFTNSFKRPHVRLPLGIEDYVE
FT                   AQLKRHTQLALAQALSVASSVKRIGRINRTTQNAKQRTQQLTSFVAFLSEAVSDSIAGH
FT                   EKGLRTIDTSELCTNIWLLNQSDRMIEDSPGNTGKFYVGESTFARSFHALSVDEILASI
FT                   ELPEAERFRQSRSNYETLKDAFMRSKLNNEKSSDDGNDNNNVIAVEGVSNDVSSRLSQA
FT                   QLRLKYFRESLANAPNRGTLTIKERRRSKRNT"
FT   CDS_pept        891532..892446
FT                   /codon_start=1
FT                   /gene_family="HOG000030073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635048"
FT                   /orf_name="MICPUN_58690"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO63446.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG588480"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199B070"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K2"
FT                   /transl_table=1
FT                   /translation="MHPVLTAIARLLLGTSLFSSLFLSRPWFDASEGVTLAEYAAAAYC
FT                   PPETISNWTCPRCAGLTANFEPHAVVYDEAWNLQGYVGYSSDFQKLMVVFRGTIGSSLE
FT                   NWIHNLMATRTQANLPGMPDDAKVHDGFYRSWTRSLLQKQVTEAVQDILKERGVVPVLV
FT                   VGHSLGGALATLCAAELMYTYNLTDVQLYTFGSPRVGNAAFAEALRNSTLDHTRMTHDR
FT                   DVVPTVPFEHLGFHHTAREVWQRTVRVGRSPMTLSVEVICDEYGEDPNCQNSICGYPGS
FT                   CASVADHLEYLGVSLGSTSTSPC"
FT   CDS_pept        complement(892570..893844)
FT                   /codon_start=1
FT                   /gene_family="HOG000198059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635049"
FT                   /orf_name="MICPUN_81846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63821.1"
FT                   /db_xref="HOGENOM:HBG597740"
FT                   /db_xref="UniParc:UPI000199B071"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K3"
FT                   /transl_table=1
FT                   /translation="MDTSTGAGDAVGDSDRFDLSSKDREFYTQQRAEQVLAPLMAKGAS
FT                   FSKVKLSTKSFGIDAAKVVTKAFANIASTLKEVDLSDIIAGRPEEEALKAMEIITEATL
FT                   CAKITSVDLSDNAFGEKGVRACTKMLQQQSGIEEISFMNNGISEQAAAAILELLASPQS
FT                   LKKFHLDKNMTGDDGTAHVGKLLEKAPGMQDFKMAGSRFTSEGAKFLAKGLSAGASLVK
FT                   LDLTDNNVNEEGGFALAGMLFKQPNLKHVNLEATSLGPKAAIQVAQALASGCPQLEYLN
FT                   LNACDITPEGVPQVAQAISAMKNLKTLKISENELGDLGVAQICVALKMAGCPVVELDVS
FT                   TNELVEKGAVAAAKLAASRAGFTSLNLDGNYISDEGVEEVKSIMEGAGIASALMPMEEN
FT                   DADMADDVDDDNAEGLDNLLAHLKL"
FT   CDS_pept        complement(894324..895538)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635050"
FT                   /orf_name="MICPUN_108291"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63822.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199B072"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K4"
FT                   /transl_table=1
FT                   /translation="MSAEGSRKPQVVVVGGQFAGRRAAKLLRRGGQFGVTLVDAKSFWE
FT                   YTPGALRCLVEPRATRRLLQPHPPGTVNATAVGFEKTKTQEGDAVKGVKLNDGSNLRAD
FT                   YVVLATGSSYVSPIKAASDKPCSVEDRKKNITAAHKNLASAPSVLIVGGGTVGVELAAE
FT                   IVGVWGKSKSVTLITPHSRLLERMPPRAGMLAQRWLTKKGVRVILNDRIEDWGGSKTGG
FT                   DPALKPSGGTWKLQTRGGEELHASLVYPCIGGAPAAGPAEKSSLGSRGEVNVDDSFRVE
FT                   GLRNVFAVGDCAGTAEEKTAFTADLNATAVAHNIRAAHNGKRVKEYPKVCGAQSVPSIA
FT                   VVSLYKWSAVMQFNKLVFGGPVPALVKWFIETMQVHAAKETPVLTELWDVVEQTNVFLG
FT                   GFMFK"
FT   CDS_pept        <895891..896604
FT                   /codon_start=1
FT                   /gene_family="HOG000220991" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635051"
FT                   /orf_name="MICPUN_73419"
FT                   /product="Predicted protein"
FT                   /function="ribosome binding"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO63447.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="HOGENOM:HBG703775"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR007903"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="UniParc:UPI000199B073"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K5"
FT                   /transl_table=1
FT                   /translation="ELVQTGAVVSAHGLRGEVRVMPFTDFVEERFFSPNTQYLEDEAQG
FT                   RGVGGEYNKAPGSVSKIRIVSGREVTSQGRVECLIKIKGVNDRNAAAALIGRRLFVSST
FT                   DRPQLREEQNGDGDDEFYASELEGCEVIMKEDGKHVGVVIDIYRGAGEHDLLKISVPPL
FT                   PSSDGEASEEKPATNKGPSEHVFVPFVKEIVPVVDLARGVLEITPPAGLLDLRQKSKPK
FT                   KRPKARGPPPPKKQQ"
FT   CDS_pept        complement(896681..899698)
FT                   /codon_start=1
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635052"
FT                   /orf_name="MICPUN_58693"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63823.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B074"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K6"
FT                   /transl_table=1
FT                   /translation="MRARSLASQDALSTTETLRLVVEADSIEREVSISVFGMSKSACAS
FT                   SVELGLKNLPGVLSAKVSLLTEAADVRFDERIIGTERLLGAVEEMGFAALLRDERATSS
FT                   VRNHHVRLEVTGMTCSACSGAVEAALQGIPGVSRVAVSLTTGSVMVEIKHGCTVLPATL
FT                   IKEVEDAGFEAEEIKEVEESSVRLLIEGMTCSACTGAVERALTEMNGVEAVSVSLLPEG
FT                   SAEVRFNPDLTGPRDFIEVIEDAGFDARISSSDKRGASNHAASNEVENYRRLFWASLTY
FT                   TLPTFLINMVLPHLPAFIWMYQGFIQKVTLASFLKWGLATPVQFSIGSRFHIGAYKSLK
FT                   NGSANMDVLVSLATNVAYFTSIYLIFHCLLTGHNFGRDFFETSTMLITFILLGKYLESA
FT                   AKRSTSEAISKLLDLTPNSAILLNEVPGMDSKEYSEETISSTLIHRGDLLKVLPGSRIA
FT                   ADGVLVEGNNVHTDESMITGESLPVLKKIGDGLVGGTLNSGGAFIMRAERVGADASLSQ
FT                   IIKLVENAQLAKAPIQAFADRISNVFVPFVVAVALTTWFVWYIAGELAMYPDSWLPEGE
FT                   TKMIFAIMFGISVLVTACPCALGLATPTAVMVGTGVGATNGILIKGADGLERAGKITIA
FT                   AFDKTGTLTVGHPTVVNFKVFQSGLSESQFLRVVGAAESQSEHPIARAIIKFVRSKLSE
FT                   VQVDTPKDVSDDAYLNLPKVEDVNIVPGEGMTCRIAGSEVIVGNNKLLKDAEVDIPKDV
FT                   LSHVGEIQRDAHTCVLVAMNRQVAGLLAITDPIRPEAAGVVAALSRMGVQSHLVTGDNW
FT                   QTARAIAAECGIVSVHAEVSPAGKAAKIEELKAPPMKKSLSGIVKVEHRNAPVVAMVGD
FT                   GINDAPALAAADVGIAIGAGTDIAIEAADFVLMRSDLEDVAAAIDLSRKTFRQIQYNYV
FT                   WAMVYNLLAIPIAAGVLYPKTRIQAPPWVAGAAMAFSSVSVVCSSLSLRYYTRPSPVMR
FT                   GIEVEDAGQEMVTIQH"
FT   CDS_pept        899960..900658
FT                   /codon_start=1
FT                   /gene_family="HOG000264938" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635053"
FT                   /orf_name="MICPUN_108292"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63448.1"
FT                   /db_xref="HOGENOM:HBG561191"
FT                   /db_xref="UniParc:UPI000199B075"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K7"
FT                   /transl_table=1
FT                   /translation="MATLQDLYGVARRLIMEIRRGLEELEGAEARGIIQTSTSLSRDMH
FT                   AKLRELQKISHQIESQWRILVVQENSSKRDLWKRKVEQVVEECDQIRVSLERFKSRESR
FT                   RQAEERDRVELMQRVTSDDEFRLLVNQYDAEAGAKMSLQRSGGMVDDLLAHGASVLGAL
FT                   GEQKERLKGAQHKMLDLLNSIGVSASLLRVIDRRQRMDAMLVYGGMVFTVLLLLFVWMF
FT                   FGGKKKVKSF"
FT   CDS_pept        join(complement(903306..903402),complement(900718..903227))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635054"
FT                   /orf_name="MICPUN_58695"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63824.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI000199B076"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K8"
FT                   /transl_table=1
FT                   /translation="MNGSQTQDKSSQTTLDTALTPGVVLDTNITLTECEEWFCVNTKRS
FT                   WKDTRNAMIMSASIGIACLILFGLVRHHCKVYRTRLFHPRVAPIHRPPPLRATWNLFGW
FT                   VLDVVNINQRTLYDTAGLDALYFDRSNLLMLKVIGFVAVVNCGVVMPVNYLLGDVITPE
FT                   AIIVGNMSPSDKLSMTNIPIGSALMWIHAAVVVLTTFFVCALLYVDANDFRADRHAWLG
FT                   HSIQAPRFEDEETNRSTTSSVATQPASLDGGSGRLKSLLSRQLSSHIQEAECSACEHEL
FT                   HEESSVEEKSDNFDDFSRIHSEMSIFQRQHVFVPGMVGSIASSRWAVKAQQYAVIVTNV
FT                   TKSTCVEVSTSFRSMFPDVIAAVPVLHHAIVDKNLEKLDQAQLSLLRLEERISTSRNPE
FT                   SERMKKMLSRREFLKDKITSTFSAVKKAQEDSKLDPRSGYSYIILFRSQASAAIAAQTL
FT                   LQDPGGDRGWNVAAAPAPDDVNFQSLWLGPGQRWYRSIVALLTVAFIVSFPIGIFTSSM
FT                   VALSAALCSKNSDILNSEWYCDNDGDGKQSFFFRLLTAWIPSLLLATWNAVVVPFGFAF
FT                   VALYEGSEITLSGIDRKVFRWFYLYSCLNVLAGGMLAGSFFSQLENIIRTPSSIFTLLG
FT                   YAVPQSSGFFLAYISTNAFMLEPLRLLLPHGGVLLWFATGCGRRFAWSGRITRDISAYF
FT                   SPRSQRYGSNYGTQQLIFLICLVFSTASPVITPLGFAYFLLAWLVWRYQLCYVFIRAYE
FT                   SGALLFPALFSRIMISLLLYQMFMSFYLLIKAAFVPAFVLWIIVPPFLWSFHSHCTRCF
FT                   MMKSVYLPLAIAKEMPVASIPVDTYCAPQMHPEFRGWASEVGKAWQGYGPFVRKYV"
FT   CDS_pept        join(903677..903883,904000..905706)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635055"
FT                   /orf_name="MICPUN_58696"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO63449.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B077"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6K9"
FT                   /transl_table=1
FT                   /translation="MADYGHWFSLADADGDGRVSGGEAIPFFRRSGLSQEKLGMVWQLA
FT                   DQPPRGFLERVQFNAAMQLISVAQSGGELDSALLNSIAGGFASFPAPIMQGLTDSSQQA
FT                   PSIVGGGFPAQGQAAPQAQLTTAPGAQMTIGGIGTGEMDVKGLASGEWPPVSSADMTRY
FT                   QQVFQQTDADHDGKLSGSELVPVLLSLNAPKELLKDIWALADTDKDGVLNFQEFVTAIY
FT                   LTERAREGRQPPSSLPPGQFPPVPQGQQPQQQQQPQVAQAPQSRGALDADLFSGGVSTS
FT                   LPSISGMDMGFGAQGGDVMGAGATPPAVNMPTAAANVPVTLGISAPISETATGTSGAVE
FT                   AGYTFRGPVDLDLSGTSGPEVDRLKSARADAEASDKQLYAKEQISMQAKVDSATLSQKL
FT                   QELVLFQRRCDANLVEAADRAERAEREVNELRQRVEQVTAAVEQVSGDLDGSNSRTAIA
FT                   EAEKAKLLQRLQQLQAEQANLASGGVSHAQAALESDLQAMRAQVAAAEAALGPHLDASR
FT                   RASQQRMQLEAKLSELRLYAEGASGNQVPKLPTWRDWSDLEDEGFDTVKLAWGSWAREK
FT                   TSSTPPPPDFQQQQQQQQQQQQHTMASPITNGSTPPPLMQPTRTAVPEGNSSSVGGGWA
FT                   AF"
FT   CDS_pept        complement(905797..906300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635056"
FT                   /orf_name="MICPUN_108293"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63825.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199B078"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L0"
FT                   /transl_table=1
FT                   /translation="MGPVLEKVAGGNAAKLCEFAALVSDPGSTRQPVHPDTNYRRDRCV
FT                   VTTFVALQDVESDMGPTVFIPGSHTARAHLAFKEANEVGGPALAAPNCVATLRTGDVSM
FT                   FDSRLLHCGGGNSSNKRRVLFYFSFEVSGKENPNSGFSSIRDELRGTLTLQDLRNQPIV
FT                   ETVS"
FT   CDS_pept        907379..908314
FT                   /codon_start=1
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635057"
FT                   /orf_name="MICPUN_96376"
FT                   /product="Pyridoxal kinase"
FT                   /function="pyridoxal kinase activity"
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="ACO63450.1"
FT                   /db_xref="GO:0008478"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniParc:UPI000199B079"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L1"
FT                   /transl_table=1
FT                   /translation="MNVSSSTGRALTIQSHVVSGYVGNKCAVFPLQLHGFDVDPILSVQ
FT                   FSNHTGYGCWKGEVMTGEQLQSLVEGLEQNGLLEGYTHLLTGYIGSASMLRTVARLVRK
FT                   LRTYNPNLVYVCDPVLGDNGRLYVPAELTTIYREEIVPLATLLTPNQFEAELLTGMTIG
FT                   SEEDALAACASLHQAGPPSVVLTSLDLDHSASSSSTITLLGSTSQPQAERCGQRFRIVV
FT                   PRIPSYFTGTGDLCAALLLAWTAKMPDKLGRAAEMAVASLQGVLRRTAAAQAVAEAAGK
FT                   TGIGCRELRLVNSVDELLHPKITEEVTWLD"
FT   CDS_pept        909410..911770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635058"
FT                   /orf_name="MICPUN_58699"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ACO63451.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG716030"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B128"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L2"
FT                   /transl_table=1
FT                   /translation="MADHTAVGAMMTPPRSKPGGGGDSADESLASPIVMATPCSIRGTE
FT                   EVVPGTPEEPPMAEAVPTKRVTMQMRHPPKPLHDPNDPGALVLCTAAEAEALSGDGSPG
FT                   VAVVVDPYIAGKLRPHQREGVRWMYRVLHGLEPDAGPHTGCLLADDMGLGKSLQSIALV
FT                   WTMLKQGPRGVPTAKRVLLVCPASLVGAWGAEFNKWLGGVRAQAALAEGGGVDAADAYE
FT                   KWRRGTQPGTESAFDCWPVLVTSYETLRRLSPIAARAEPDLLICDEAHRLRNAQQGSQT
FT                   LAALRAVDVPRRVLLTGTPIQNNLDEYAAVMDFACPGLLGPVAEFHRRFTAPVQRGSEP
FT                   NATSADVAGAQRAANELARLTAGRVLRREASINAAHLPAKTEMVVFCKPTEMQRAMYEQ
FT                   GAKIVQGWTEGKAGASTATAAALCAIGLLRQLANSVDQVVKKTSAKSKRGSKGGFDNES
FT                   PPSKQARIEKEDDNGGLSDGDESDEGEISAGSSTKDADDLRAKLSSSVPSGYSGGVKGS
FT                   GKLATLRTLLREMASNSSGDGERMVVVSGFSAALDLAAGLCAELGLATDRLDGRVPPDA
FT                   RSGLVRNFNAGRGGRVMLLSCVAGGAGLNLVGACRLVLFDTSWNPAHDNQAMARVWRDG
FT                   QTRPVTIYRLLAAGTVEEKVFQRQLLKHREAAAAGYGGESIGGDGGKTDVGRFTRDELS
FT                   ELVRFSSPAKPATLTAVGWQDSRDAVEDPLLRAAIDDDNSMITAVVRLADDGGRAKAIA
FT                   AAKEEFAAAKPKAMKGGKKRLAFQDLLSKSKNR"
FT   CDS_pept        complement(911831..914431)
FT                   /codon_start=1
FT                   /gene_family="HOG000265611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635059"
FT                   /orf_name="MICPUN_113651"
FT                   /product="Inositol monophosphatase "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO63826.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG561195"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR004119"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniParc:UPI000199B129"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L3"
FT                   /transl_table=1
FT                   /translation="MSANRVLKTSTRAFSRLSRINSPHRVRLHRRIAMPTVGAIVAGTG
FT                   ETVRLLDILSTCVDAAQKGCEEIRAVQARRASSGQLASTMKDIDDPRSALTEADLNAQK
FT                   AVVDRIRATWPNLRIVGEEDEDETNEVDVSDPELQLRRDLCDVSSSPSLAGWSEPVEVL
FT                   TVFVDPVDGTREFVEERLDAVQCLIGVACRGRAVAGAIGLPFPGGTLSEPTSVVWGIAA
FT                   PGATSGVTGILGEAPKRPRLSPETRGGVVCITGDSKNASLTAAKRAVDAAGNAMIGGAG
FT                   NKILAVAEGRAEVALMHFGTSLWDTCAPEAVLRAAGGKVTDLFGAPLVHDPSRPGGLIN
FT                   DLGVLATGHDIASIDAKGRDHAAMAAAMRSDEGLREALLKRFTGEASNTPGANEAQATD
FT                   IARSLEGAPLEASWVGERIAETLCGGQNDFKLKGYAAPETSAIRGLMSDACRLELVWDG
FT                   EGSAAGMPSTVFYKKVNLGDLEYARTKSVTQPMKIARDVKSAGVEAAFLACEPVASALA
FT                   AAGVKVPRCFNADLRPREDDPIESSFALLLEDFAPQQGWRSERLLSRSQARAALTALAR
FT                   LHATFMPAAAAARTDGKPNEDVLLAGATAAIWPSGAYWQPDMQPASQMTELAHIWRDIH
FT                   LPNFEKAFAAELPKDVEYASLGDRLQEVAVSVGGESHPFGLDAPSGGESEGWAARWRTV
FT                   IHGDAKSANIFLRENPDEKDGWEVGLIDFQWMGFGLGAVDAAHVLCASCDPEALGYDET
FT                   GKIVDERAGSALLDHYYSELITALATNGAAASVEEAAATWTREEVQKQYEAAVLDMCRV
FT                   VFGYQWVRVKASPETLAANFDSMNRNSYNKSLPNAMWLVRECDALLNKRAGAQT"
FT   CDS_pept        complement(914585..915004)
FT                   /codon_start=1
FT                   /gene_family="HOG000211843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635060"
FT                   /orf_name="MICPUN_100598"
FT                   /product="Predicted protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="ACO63827.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG631382"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI000199B12A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L4"
FT                   /transl_table=1
FT                   /translation="MSTEKKETELISEQEVINTYQTLREEVSQLFRQLNKLKDEQTEHK
FT                   LVIDAIKDLDPKRKCFRLIGGVLVERTVEDTLPALTKTMENLTNVIEKYTEQRDAKIEK
FT                   VEEMEKKYNIRVKGEVGPGDEGGDEERGATQGVLA"
FT   CDS_pept        915153..916058
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635061"
FT                   /orf_name="MICPUN_108294"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63452.1"
FT                   /db_xref="HOGENOM:HBG561196"
FT                   /db_xref="UniParc:UPI000199B12B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L5"
FT                   /transl_table=1
FT                   /translation="MGARGLVAWLIWVNLATAAASVASDKVGVPVRTAGGTAPACSRER
FT                   SRHARGVLDDFFHPVADRNRYRLPPNCPFDRSKDMYLEHEKHKEVVRRTQYKSLYSDKT
FT                   FYNEYYVDKHMDNRHMDKVPPGADVCLADYCEVLRCDEHQAWKHPELRKTVGSSASRSR
FT                   CSQERMRGLRHFCEVLMSGCFPTGGGPDGDAGTAARLREYFTRHHCDMLTCDGVRDMFG
FT                   VLGSHHAVAGGGGYVLVLIVVFAAVGCYYLFVWHAVRDGRRSADLRRARKETLGTRAER
FT                   WLVSFSKKLPFSKGRKKKLY"
FT   CDS_pept        join(916211..916222,916400..917226,917270..917303)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635062"
FT                   /orf_name="MICPUN_58702"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63453.1"
FT                   /db_xref="UniParc:UPI000199B12C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L6"
FT                   /transl_table=1
FT                   /translation="MPSAKKGTKSDDGMTPYEEERDARIKSNALRMKELGVAEAASKVA
FT                   TNSMPTKKRKSNVGAESKAKKAAPAEPTRRSSRARGEVSYKEPTMKDFEDIAAMEEDPG
FT                   VRANAAAKAAYSKERRSGYDPKAPKQGFKPALDLSEGVRDKKTGKLVFKDHPEFTPNLT
FT                   PKQVIQAGTWGGCYFHPRGGKQGIRGPCNITHEEFPKDWFAGLKPDQYRSRRYDKDRNK
FT                   YGVVAGQDQAYWEEHGWIIPQDPRGWFQWYCRFYLGRRTKDDARQISRWVGVAGAKGSD
FT                   GTMTPCPLS"
FT   CDS_pept        complement(917399..918199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635063"
FT                   /orf_name="MICPUN_58703"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63828.1"
FT                   /db_xref="HOGENOM:HBG561198"
FT                   /db_xref="UniParc:UPI000199B12D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L7"
FT                   /transl_table=1
FT                   /translation="MSTVALRVTTCKDKGASVRGASLRTRVNPARSPNRPYWTPPSFSG
FT                   RKLVALRAGDDEAGFKKAKDDDEDVGGDNAVQDALASELKFQTKLYQAQQYIEGKKDEF
FT                   IQKGEEGKEKLDAEAKVFRDRANLELGLKASEIDEQLAEMLDETAAARARNERVQAELA
FT                   ELEEQLTGTSSGRFRKAPPKTAAPKTISAMKQAAIDKEAADVDARMRNTLEETQRKSAY
FT                   TLILLLLVVTDISLVAEGAWDKFFAIGCVIALVGYQANNERLNK"
FT   CDS_pept        918379..919140
FT                   /codon_start=1
FT                   /gene_family="HOG000237638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635064"
FT                   /orf_name="MICPUN_58704"
FT                   /product="Heme binding protein"
FT                   /protein_id="ACO63454.1"
FT                   /db_xref="HOGENOM:HBG717396"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniParc:UPI000199B12E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L8"
FT                   /transl_table=1
FT                   /translation="MKNIFVFVLLALAVTPFSVSAARPMSVASSFITSSQSALRATWTK
FT                   NPNEEAPDAPPWFCHSLDCPKFKTTKKNAKYETRLYPPGLKWVSTVVTGVKYDAAVSQG
FT                   FMRLFHYIQGANSDSAHIPMTAPVRVTLTPGDGPFCENNFTVSFFVPYDGDGVSTTQID
FT                   PPEPTDPEVFIDEDPDGFVAFVRAFGGWTNEEKLIAQAETLGEDLESDGLDDVGDREHF
FT                   VFAGYDSPFRIFRRHNEVWFLAPYPEEVTKN"
FT   CDS_pept        complement(919193..920077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635065"
FT                   /orf_name="MICPUN_58705"
FT                   /product="Gcn5-related n-acetyltransferase "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO63829.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B12F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6L9"
FT                   /transl_table=1
FT                   /translation="MQQIGLGRFQAPSRAPLRCARSGQRDIRGGWALGRGQHGGGAREV
FT                   PEVASRDAKGTRKGKRSGRGRRLGATEGKAPPRPPTSENDKNGGDVNAAGMGQPYLGED
FT                   DGVFGGGDFVRSLRALPAPIFTNEDSYFEEKLGTTFLFGQRPEADLDELNGLFATVGFP
FT                   QRDPTRLKRALVNSHHIVWCVVKDGNKNRSTHPGQCVGFARATSDGVFYATIWDVVVSP
FT                   KWQGCGIGRGMVQRLVDKLVKEDINNITLYTEPAVEGLYRTIGFETMDKATGMAFRHQR
FT                   NARRVRGSEDTTR"
FT   CDS_pept        920466..920819
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635066"
FT                   /orf_name="MICPUN_100603"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63455.1"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="UniParc:UPI000199B130"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M0"
FT                   /transl_table=1
FT                   /translation="MYVVYLVWAYTPEDVLVRLGVTYYPDKYWALAVPCWICVLVLYGA
FT                   WMYEGVNMMSVRNLDDPDLIAEENGFIGSEADEPDLPGSVPSMRDTPVEEVNRVLFLTK
FT                   GRRVRTRRVGEKR"
FT   CDS_pept        921243..922337
FT                   /codon_start=1
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635067"
FT                   /orf_name="MICPUN_97416"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO63456.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG378440"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199B131"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M1"
FT                   /transl_table=1
FT                   /translation="MDGCFDLAHFGHANALRLAKACGDELVVGLVPDDEIRRCKGPPVL
FT                   NEDERRAVVESFRWVDEIIFDVPYDINPEFMQTLWRKHRIDYIVHGDDPCLLPDGTDAY
FT                   AAPKKEGRFMTIKRTEGVSTTDIVGRMLAASQQTRRGFLSPRKSGGSDKGGNESGEKLS
FT                   HFCTTSRRVAQFSGGGGKPIPPGARVVYVHGAFDMFHAGHVHLLEAAKELGDYVLVGVH
FT                   EDEAVRSRRGASHPILNQQERSLGAMACRHADEVIMGVPDEVTRDLIATFNVAAVVAEE
FT                   PCAPALADTPADPNRVPREMGIFREVAKGTARGADLTTATIIQRVADDRAAYEERNARK
FT                   GKAEENYYSLKRKGEVDKAEERGA"
FT   CDS_pept        complement(922450..922818)
FT                   /codon_start=1
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635068"
FT                   /orf_name="MICPUN_113903"
FT                   /product="Mitochondrial tRNA import complex "
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="ACO63830.1"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG324319"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniParc:UPI000199B132"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M2"
FT                   /transl_table=1
FT                   /translation="MSKAIAKMFEPMFAAFAKRYQGWVGAELSKYGLRYDDLLDETMNL
FT                   DVAEALKRLPQEERDLRMQRLKRAMDLSMKHVYLDAEMQKKQTPFKWYIKPVLEEVEAE
FT                   RDERAALGTGQPYNRQIP"
FT   CDS_pept        complement(923241..924200)
FT                   /codon_start=1
FT                   /gene_family="HOG000265127" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635069"
FT                   /orf_name="MICPUN_100605"
FT                   /product="Ubiquinol:cytochrome c oxidoreductase 14 kDa
FT                   subunit-containing protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63831.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="HOGENOM:HBG561201"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199B133"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M3"
FT                   /transl_table=1
FT                   /translation="MSAASFSSCIRGAPVIARRDARAIRRTVARVPMVTRANADIMSEV
FT                   GTAVLTDGQLQGERYVASNRFRLQAGKGPTFEKRWAERKSRLANLDGFRFFTLMRRVEG
FT                   MGGPPKPADADEEYDYVSLTIWEDKSGFDAWRTGEAFKEAHGGGTIFGFVEMLVSSMMV
FT                   LKGGPKPAFYDGLLPVVKPPPEDTPWKAVGGWRDVKADGVNPLDTDVYVAMNRFKVLPG
FT                   KEEAFEQRWAERESKLEGMDGFLTFLLLRRDALKAEDGYNYSTLTVWRSKEDFQAWRES
FT                   SANSAAHSKAGEAEPMFDGPPSPVMYEGVLALLSEKGA"
FT   CDS_pept        join(924437..924768,924858..925218)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635070"
FT                   /gene_name="PMP22"
FT                   /orf_name="MICPUN_50322"
FT                   /product="Peroxisomal membrane protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63457.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561202"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199B134"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M4"
FT                   /transl_table=1
FT                   /translation="MSPHGAASKAWHGLHPMLRAGLTSGTIMAGGDLLCQTIQMQYQPA
FT                   VAGTAENEKVEKPKKCEERSAPASTSGAHWMSAAVREKLGLADYDLVRTARFFGVGLTL
FT                   HGPFFNKTLGILEKVVGPATTVQAAAKKVALGHFFLFPSYTALFYGWLSVFEGKGLEGG
FT                   VQKFTDTWWDIFVAGSAFWPAANMVNFMYCPPMYRVLYLNVAGLYWNAFLSYQNVRATA
FT                   MEAIIKQE"
FT   CDS_pept        925338..926312
FT                   /codon_start=1
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635071"
FT                   /orf_name="MICPUN_100607"
FT                   /product="Adenylate kinase"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63458.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="UniParc:UPI000199B135"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M5"
FT                   /transl_table=1
FT                   /translation="MGPRGLALWIPPGQVKQDLCLSAAAAAPMHTNQRTMQSLRRSIIS
FT                   HRAAFAPVVSVNPLYAPAGAVWGMVAQRRHKSTDALADELVSACDELLAAGKRINWVFL
FT                   GAPGVGKGTYASRISKLMKIPHISAGDLVRDEIKRGTELGARMSAITSKGQLLPDAMIL
FT                   DILKGRVEKGIEEGERGFLLDGFPRTVAQAEELNKFTEVQQVMNLGLREDILVEKCCAR
FT                   RVCKECGKNFNIADIYHPGDPPIVMPPLNPPAGCEDKMEQRKDDTEEVVKARLQVYKDN
FT                   SVPVEEFYRTAGMLTDFEIKSGIPETMPRILKVILDIVRSTPK"
FT   CDS_pept        complement(926367..929690)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635072"
FT                   /orf_name="MICPUN_58711"
FT                   /product="TWY3 methyltransferase"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO63832.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG561204"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199B136"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M6"
FT                   /transl_table=1
FT                   /translation="MASTAGAFAQRKAQTLAELAADSGDFSRAGHVDERARPIVGLVNR
FT                   HPSFFTTSSCAGRVSLFADPTTATRAAGMKGGEWVYVNHDPADADAIVAAVRRKLGEDE
FT                   DGGEGMDPECTLVLRFEPFILSVEASTLEEGARLVAAARDAGYRESGITASDKRFILAV
FT                   RCSIRMEVPVVSCGERLVTDDALRRLVSIANDKHAANSSRAERLMERFIAVFGDELEAP
FT                   ATRGGDGRAGEERGDEAGETSESAPHIEGEWVLMVDKLAAKRCKDAIKSAGWLDQGRRA
FT                   GASDDGKRVALPVTSAGAAELVVANSLGGNGWEDCKSLPALEAIRDGHAELVRSDESAP
FT                   DSPGKPPTGPKLQAKQSRQSPAATIKAAALALLPRTTPQTPAIIAEIPTKWEKLGDLAL
FT                   LPSCSFLSDEVWTMGVRERLYPAVAEALGVARLARQAEVSQGPKRESRAVMLWDPGNVG
FT                   GWVETKELGVTYGLDVTKVMFSSGNGTEKARMGRVHAAGETVVDLFAGIGYYTLQLLRH
FT                   AGVAKVFACEWNPNSVAALRRNLRLNGVESNRCEVREGDNRRVAPVGVADRVLLGLLPD
FT                   SETSWPTAVAALRAETGGVMHVHGNVASGEEEAWARRLESEVAALAADLGREWAVRVEH
FT                   VERVKWYAPRVRHLVADVRCVPTRLGAVWAAGVGAATSPMARNSNEKLAAMLDANEVEK
FT                   ELKVKLPPGSPESVLDGAMSSQPVRRMHRPSPADFRAGPSTHREPCVMTGLDIGPAPWT
FT                   WSPAHVASVPGVRESEVSVHVSDTPHLDFVRKNFKFKNMPFGELLDELTAEAQTEGTGH
FT                   DKKTWYYLRSIGRNPRKEPAHCLEQFPGLAKELRIPSDVLWGGSTDDDQYFSAVLRCSS
FT                   GGLRLWTHYDAMDNALIQLHGEKRVLLFPPAASAGLYLDGSSSPVVGPAVDGVDGKWPE
FT                   EFPAYRAARTMAVEVTLQPGDVLFIPALWAHHVEALHGPSIAVNVFFRELPKSMYPAKD
FT                   LYGNADPIAAGKALDACETAARELSSLPRDHRVFYGGVAVARMMRDLRIEDEVGAVVVP
FT                   GSIAPRVSKQEPDKPVEEVTTAVTQTVTQVSTVNLAGVATGVAVGIALCGVASHVWRRS
FT                   "
FT   CDS_pept        930508..931914
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635073"
FT                   /orf_name="MICPUN_100609"
FT                   /product="Histone deacetylase"
FT                   /protein_id="ACO63459.1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B1E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M7"
FT                   /transl_table=1
FT                   /translation="MPPVTPATAISVLPLHAAVAAGKVEEVQVWLDVHAPLPSEEGLDR
FT                   EGKSVSTPQWPPRPVSDILGPGSASREPPCDQVGDAADAGPGANEATEDGENPVRPGIQ
FT                   NKHRFAGELARLPSIPKRDSDRSSAGVDGVKRGPVDTRNEHGNTALAVAAALADPAVAA
FT                   ELTALLLEHGASPLVLSSNLTPLHWAAQQGNWAALTTMAKWEGGRAVDARAAETGETPL
FT                   MAAASAGQLDCCLSLLTAGADPLAVNVDGVGILALVASKVSQGKRSKVRAAVRLALLNA
FT                   APQLRVLLLHHEDCGRHISFKPHQESPERISAILAFIAKGATIGSLSADELLVSTEFDQ
FT                   ASKEHLLRCHSEEYISVITQLGEQVANTPVAFTPYYQGFKGLPQAKQKKAEFSDTFFSP
FT                   GTMAAALRAAGGVVHAVESVLKGHSRTAFVCVRPPGHHAGVDGATAGAPSSGFSIVNNA
FT                   MIGEWSSDVS"
FT   CDS_pept        complement(933024..934106)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635074"
FT                   /orf_name="MICPUN_108298"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63833.1"
FT                   /db_xref="HOGENOM:HBG561206"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="UniParc:UPI000199B1E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M8"
FT                   /transl_table=1
FT                   /translation="MDALILEPLDASRPLWDVTVVTLAPGATWTDSPGGPGRKPPMVCV
FT                   RLSHTIGDGISLVNVLNEACVSEDGSPVRTVNFQRRPNPKVWDWSTLSPVNILTQIANL
FT                   IWYILKCVYAVLRALVTPFGPHDSKTAFCDTKTKVVYSGKRTLVTCPSFKLADIREVKT
FT                   QMGCTVNDVVCACLAGALHKYQVHRGDPAAERRPLVRAAVPYAFPRKNPAELTNSWTFV
FT                   SLPFFLGPMDIKDRLAKTKRRCDDMKRSPEAHVIAGINTVAGKLLGAKFQSQTIYDFMS
FT                   RHSMVFTNVPGPTAPVVLFGQKVNDFLFGMGNLVNQVSVISYDGVMTLSLVVDPDAVPD
FT                   AHMIGKFFQEELDNLCAKLL"
FT   CDS_pept        join(934755..934811,935171..936376)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635075"
FT                   /orf_name="MICPUN_108299"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO63460.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000199B1E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6M9"
FT                   /transl_table=1
FT                   /translation="MVSTRRSSANAAGKESQPMAVDVEKVVVTMPKDGPGESEEDLYSR
FT                   LKELQRELEFVEIQEEYVKDEQKNLKIELLRAQEEVKRIQAVPLVIGQFLEMVDENAGI
FT                   VSSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVDILPPEADSSISLLSDAERPD
FT                   VKYSDVGGMDVQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTMLAKAVA
FT                   HHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDSIATARFDAHT
FT                   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIECPAPDR
FT                   RQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIRAICQEAGLQAVRKNRYVVMPK
FT                   DFEKGYKSSVRKPGDEFSFYQ"
FT   CDS_pept        complement(936672..937772)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635076"
FT                   /orf_name="MICPUN_108300"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO63834.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199B1EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N0"
FT                   /transl_table=1
FT                   /translation="MLQSSTAGAEGVGVLGTSASAATGYVLRPQESAAWAQRLAPLVTN
FT                   LQGVLSTVGPQKFCQMMDRVANPNDWSLVSEVSAGLQRGARLEVVQDSEIAAAIEASAV
FT                   AVANTGAQVRLKTVAVDQSVVGAPGHNNTGSPVMVCRVDRTVDPTPGLTRVAAFALHLE
FT                   PVSQLSAAEPPYLCLVFAWLGMRQAPSSAAAVVASGEGGSSAAAASAGGSGGGSSAAAS
FT                   AGGGGGVRRPGDWTCPGCHAHNFASRSVCFKCKNAKAGGSGGGGGFSGDVSKSSEPAGG
FT                   PTAGNFRPGDWICTGCRAHNFASRSACFKCKQRKSGGEQSSAATQSSSGGSAPENFRSG
FT                   DWMCNNCRAHNFASRAACFKCSSKPP"
FT   CDS_pept        complement(938883..939224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635077"
FT                   /orf_name="MICPUN_58716"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63835.1"
FT                   /db_xref="UniParc:UPI000199B1EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N1"
FT                   /transl_table=1
FT                   /translation="MQSLMGAATGVEIVPAHTYARLRFDDAADQAVQHLALVLQSHRGS
FT                   PYEGQFVSQAEPRAGTSLRHFPADPAQHGAPEEKKPYGRDLGRCARLASTPSGFPRRRI
FT                   DSITVARWN"
FT   CDS_pept        939580..940908
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635078"
FT                   /orf_name="MICPUN_58717"
FT                   /product="Glycoside hydrolase family 103 protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO63461.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG561209"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="UniParc:UPI000199B1EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N2"
FT                   /transl_table=1
FT                   /translation="MSQALGCSPRWGAEPTRRTGFGPRQRSIRSLVTCIRCVSPSDGAP
FT                   DAPRGGAKSSGRTLLRIAMGAATVAAPWVSPFVASTVTQPGVARAATTWKSMKDLPAIE
FT                   PGAHPALTVRELTPRQREFTAWLDGVREECIRRGISEETVGSCFNELEPLPETVVEKTA
FT                   SSHVLNPEKNLSVEAYLRRMVSKDRVTKGAALLVEHAELLNEVEREYGVPPEILVAIWG
FT                   IESHFGGFQGEHDCIRALATLGFEHRHWKGDYFGNELVEAVRIIDEGHVPPEDLVGSWA
FT                   GALGQCQFMPSNFHRYAVDKDDDGRADIWRSLPDVFASMANFLKQYCEWNPNVRPAGFR
FT                   VTVEGDQLPEDVIGGWWGERKTPKPASYFLWNGVKPLHNTLRLPRSAESVLLMPEGKDG
FT                   PAFLALCNFRAIMRYNPSTNYAMAVSMLAQEIVDEVAAVRKEA"
FT   CDS_pept        complement(941032..943212)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635079"
FT                   /orf_name="MICPUN_58718"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63836.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B1ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N3"
FT                   /transl_table=1
FT                   /translation="MGMSTPTKDRLWMETETGGMSSPSTRDLESEGAGLCSPMGGHRVG
FT                   PGDDDELMCHELMWNSRAASQHHVAALPGAREPIHRRGSVHEFLRGRELVRHARNTHRR
FT                   PGISEFVHDARRPGCGIIPIVPPHTGVGSPPFVARFGRCDRGQRLLAIADEEGVVTIVD
FT                   AAGKLPGLEIDPEFRPEQQWIAHENAIFDAAWCHGDGRLLTASGDQSVRLWDVETAVPF
FT                   RFFRRHNGSVKSVCVRPEGGGGGDGNGGSVFASCGRDGTIALWDMRDSRRTRASSSGIA
FT                   PGPEGEPASAPTAVVERAHEPPAAMGGGTARGFGGRGGERRAVTRSQTNVELVDAAVEE
FT                   FPATTRQRQQRLTSSSRNESRSVRGDVQHSVTSIAFAHDGQVLVSAGAADGLVKLWDVR
FT                   QLSRGSALWEIADEDPPERAGGKNWFRGDGESAAPTKRQRRGRGVVALAMAPWGSSRIA
FT                   AAYSDSHIAVFDLHGPASGPRCHLRGHQGTSFYNKLAFSPEGTHVTSGSCDHHVYVWEV
FT                   DRPLEPPAVLKGHAGEVVAVDWCPNDFTCLASCADDDTARVWTVDRSTLRDADRDGDVR
FT                   GEAGASAGRGAMHTSNSDRDFFRTPAPATRDRTPSTRGLLSGGEWLRRAVEEGQRLDFE
FT                   TPMPIFNARAAPPGVDATCGDESMNKENVDINAGAAVALLTPGPIAARTRRSARRPLLS
FT                   ASQRNSILSYFTPTRGDQGGEDFMDVDADDEY"
FT   CDS_pept        944018..945298
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635080"
FT                   /orf_name="MICPUN_108301"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63462.1"
FT                   /db_xref="UniParc:UPI000199B1EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N4"
FT                   /transl_table=1
FT                   /translation="MTAEERARKMVAAAVEEKLRAGESANKVGLTPKERLGPMGVLKEE
FT                   VTNANARARRLETALQRRDQEVEELKARVNQLARERSALATLKTRQLANSAEVTETAAA
FT                   VAKRLTDSPDPNERPRTPKNSAGQPLSLKTRWHALEMEARRGDKRLLLLLRSYKHMETE
FT                   CADYQRMMETARQGEEFARNELRATKDALEDVSKNYAAAEELLNEAQEREDKLGEKLKN
FT                   EREQRKQLAAELRILRAEKEQNDEEFKRFKDRKNELLERTVKRDHQIDKINKKLSETAA
FT                   ERDAERKERRKLEEEILRVEQRMSTLRRRNKSLEVGNQRSRDEEVEELRASVSRLSMEC
FT                   QIKEEECQMLAGMVSKGGAHSVMKSGGSVSRGGVASVARASAPARGSPLGLGPGAGLAP
FT                   RSRARTSAPEALKNGDALYEEFASALR"
FT   CDS_pept        complement(945384..946151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635081"
FT                   /orf_name="MICPUN_58720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63837.1"
FT                   /db_xref="UniParc:UPI000199B1EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N5"
FT                   /transl_table=1
FT                   /translation="MGLCCGASQARRDRSADYEERRKQELLEALGEGYNGELDFAESET
FT                   ASELPTPGRESYSGEETPNRSPSRSGTTSRSSRESPQRYDSSYQSYETTESDRTESIRA
FT                   AREAEARQGSDGGFTELREWSRAGRPASPARAVPPGAVNVSPGARHSSQGGVSPGRAPF
FT                   GWVRRRGEQPAGVRPDESLTRLAGEAASYEAIRASLNVEQALDRPLAEFLAPVDAVTAF
FT                   KGKRHNLFSPYQDMPKSLLLPYQNYQAYGVAKR"
FT   CDS_pept        946248..947339
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635082"
FT                   /orf_name="MICPUN_58721"
FT                   /product="Pseudouridine synthase"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO63463.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG561214"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199B1F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N6"
FT                   /transl_table=1
FT                   /translation="MALRLAARVHLASRWRGLRHTSTRPIHPRATVIDDPGPENPGLDA
FT                   AGLNIRRGGVEGRDLRETLANAGMTPEQVRDVISAHPQVDTRYDLVNEVQPRINYLRFL
FT                   DDNDRLDGESVSSCIARQPQSLERDFHLVHEDADYAVVNKPWCVRLDTPRGWPGKVRFT
FT                   PKYPGDLSVEDWLERRYPDWDTVRFCHQLDNATSGVLVAASNKRAAGAAAKLFRERRAR
FT                   KTYLAIVFGHPEQDEWTVDVPMGRDPDDPKGFRERVDPEHGKACETRFRVLKRGRLNLR
FT                   GKFEGVPVSKVEVTPVTGRRHQIRLHLQFSGHPIVGDNAYSQDTDSFRTFLHAHKLTLP
FT                   FDEPRGTMQFVAPEPESFAAAME"
FT   CDS_pept        complement(947399..948313)
FT                   /codon_start=1
FT                   /gene_family="HOG000005979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635083"
FT                   /orf_name="MICPUN_82213"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63838.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG744909"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000199B1F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N7"
FT                   /transl_table=1
FT                   /translation="MDVSDAFREAAHRAYASQSGMTPDRADALVAPRDMPPPSARSPVL
FT                   KSAHDTLVLVRELRAFVTRHRADYLREGKDSDTVRDGIESEVRLSVKACQAHITMLKST
FT                   VQEVEAGKTEGVQGVAHMHGVVLILTEFLQRVAASFDQCREVRFKKVLAAAEHRRRRAP
FT                   PRPPTPPRRNVEPTPAASTTETIGDESSIDQQQRQAQAQVHETEGDALVDELTTLVEQV
FT                   RKAEGQVAELSALSSLFATHVQAQAAQIEQLYAQAVESTRNLESGNVQLKKTIKRRGEG
FT                   SFIVGIVLFIATFSLLFLDWLQG"
FT   CDS_pept        948691..949749
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635084"
FT                   /orf_name="MICPUN_58723"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="ACO63464.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B1F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N8"
FT                   /transl_table=1
FT                   /translation="MASASVTPVPVARAAARSCTRSASTGPVSTRRWTSISPPGTSRDL
FT                   RSRGSDEPSSDRTPGSTRTAAFFHDYHHHSFDHTHDRAYQRWLADLTAVVKHKTWSALP
FT                   ALLRFPHAEPDVVLQLAAGEGQTGLVKRILESFPGAVEPGGPAAAGAAVTAASRGHHNV
FT                   VVALLDHGLDADAVDEHDVALILAAAGASDVCGEGCAARCVGTLLERGADANASASRKG
FT                   WKPLMAAAKTGEWRVAELLLNAGADVEARYPNGKTPLYCAAEWGHAKAVEVLLAHGARP
FT                   DVAADRLMTDHTAATSRGVLPAEVAARNGHKACADILFEANAAARRGRGDAKGKSLEPR
FT                   VPETTIKGGESW"
FT   CDS_pept        join(complement(950753..951004),complement(949906..950673))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635085"
FT                   /orf_name="MICPUN_58724"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO63839.1"
FT                   /db_xref="HOGENOM:HBG561216"
FT                   /db_xref="InterPro:IPR019547"
FT                   /db_xref="UniParc:UPI000199B1F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6N9"
FT                   /transl_table=1
FT                   /translation="MSAITIALGGAVAASTAGAARSTSGRSVAKKSAVQVSTRNATVCR
FT                   VIQDVTSSMDVGSSIDTDAEMRRRMVQMDTAKTLRKTIDAMGGTMIQDPAAFVSTDFQR
FT                   AVTTGLFASCAALVARGGVGIEMAGDGGDPAAWASLVGSGLLAYWLSDLGTGVFHWSVD
FT                   NYGSKATPVMGGIIDAFQGHHKYPWTITKRQFANNIHTTCPATMCVTVPLLLTPGLAPD
FT                   TCAFMGVFCSMIVLSQQFHAWSHMKKSQLPEIVVKLQDLGVLISRKGHGAHHRPPFEGN
FT                   YCIVSGWWNPILDDNKFFNKMEKVVFEATGVAPRCWSETHDFDVEEEAPEGWGKEYNL"
FT   CDS_pept        complement(951257..953488)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635086"
FT                   /orf_name="MICPUN_58725"
FT                   /product="Lecithin:cholesterol acyltransferase "
FT                   /function="phosphatidylcholine-sterol O-acyltransferase
FT                   activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO63840.1"
FT                   /db_xref="GO:0004607"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG561217"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="UniParc:UPI000199B1F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P0"
FT                   /transl_table=1
FT                   /translation="MPPKKATKKAASDRTTATKVVNKRRAVAGREPLRVWYMPFGNPFR
FT                   VVAASAVKKLALFVAVVCVGFYLRELVPIPEGVQDRVEHAVPPWLNSSMHLLNGLPALN
FT                   ASALNNGMPLGWRGPSPGQAALERGRRPKHPVVIVPGFISSGLELWDGLQCGKHFFRQR
FT                   MWGTPAMATAYFANRQCWMQHMRLDPVTGLDPAGIKLRAVSGLEAVDWFVPGYFVWGKV
FT                   IESLGEVGYDTNMLQAAPYDWRLSPVGLEQRDGYFTRLKTTIETMVHLHKTPVALLAHS
FT                   YGDQLVRYFLNWVEAPVSEGGGGGGKGWTDRHVAAYVDIAGPMLGIPKTVPSLLSGEMR
FT                   DTAILGQLEGLLGLGVNPLDRFVSGTLGTVAATFRTWGSLWAMLPRGGVDVWGADDHLG
FT                   APDASNDESTGVTMDGPSSESGEIIDDPREPEIGGALRHFLSIRVEEDGGGNGKGNGGS
FT                   EKGNGGSEGKSGDDGASSPTANGTPSIVVEDAARNLTITESLELLFERISADHPRHDSD
FT                   FRRVTLGGRRLAGGGSGGWIDRILRAVGVGQPSASTGGFIGPLPRPAGPSEKFGDPLTA
FT                   PLPRAPNLKIYCLYGVGKPTERAYHYVHRPGQTDRPFALDVSVHGRGVERGVTSVDGDG
FT                   SIPLVSLGYMCASGWRDGSRLNPAGAEVKIVEYNHRAMSLWGGGIQEGRFSGDHVNIMG
FT                   NHEMIETVLEVVTGHGSGVQERIYSGVRQIADNVRRLRVARRGTRGDEL"
FT   CDS_pept        join(953835..955924,956149..956510,956569..956675,
FT                   956828..957928)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635087"
FT                   /orf_name="MICPUN_58726"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63465.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B29C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P1"
FT                   /transl_table=1
FT                   /translation="MVVLDEIPTSGVAPVASALAAPVAPSLDPGRREDLGTGDAISDAT
FT                   RVEGNARYKRKDFKGAEELYTLALSQADPISELIPAILGNRSAARLALGRLADALADAE
FT                   EMASQCPDGHVMAGKAMYRKGNVLAAMGRTEDARRAYQNAVRLTPDEKAKKPILAKLLV
FT                   VTEVAVVEKKKEQVQAELHKQRELIRETKQFHEFNTQAGGKPPKERYTMANRALRDGNN
FT                   VRALKLYASVDPAELDAGKAPQYWGNVALAHVRNKEYPEAVEAARRCIKEDPTYAKGRY
FT                   RLGEALLKRARTAEHVLPNVRKEWVRGAIDEGFNEALRLNPDIDNEETKRLISDGEVLL
FT                   QELDTITEKKDAGTVAVEEREGTKDEEEETKEGSESGSADSADWVKVSEPKERGPKIVS
FT                   FDAITSDDEDHPERIAFIEAMKEHGCVCVRLHEKLVAPVNVFVEAGASASAFFKLKGDM
FT                   KAKHKPIGGYDPPAQSGYHTRTGFHHPRDTRAKSIRGGGASCLRKDEEDLECFVVENEY
FT                   AADFPWPNVKFKERLLDAHITARKTASKCGDVLLTAADVNVMDPDFDRKAEKCGLKAMT
FT                   CRTTFACHPKIDTNHGKSISGHDLQLKSRGQFMHSVNVGTAEPTLVSIIPRVDDPSRGR
FT                   RHSQVYLEMPKRGGDEGLEKLRWPPAGQEEELRDSILVVAGEYLNQMTDGMYPAPRVCY
FT                   TRRVRRVAIEASSEWAPQKTGRVRDTFVSGSAASAVSLAVGMMSIHAPIAYAFVPIRGC
FT                   GDPGSPYDTGVEVVDRTAAGTTGCTKLYQPGRAAEARAVAAAKEAAGTTSGTSESKRDR
FT                   TGDAPMFLRVVGLDERTIQTNQRNLPTMEGAAEETVVNDTVTVKGTALETRGEVTATCY
FT                   DASGTRMATCTTEGAIHVWDRVDGPDGAPGHWRQTAAWAAHRSACRAVAFAGAEFGRCL
FT                   ASSSDDGTICMWREGVRAPGAAAAAAATAAAEAGSSEWERCAQLRDSTKPVSHLSFAPA
FT                   DHGLQLAAAGDDGAVRFYSPSDPLALTGWELCNESEALRPGARCVALAWRGRGVDEGSP
FT                   MEPQWNPDVHGSRGPHGGWTGDGITVPPTLGVALRWPDAVNAVRVLSYDEASMRWSNSA
FT                   TVYEGPAAVNALAWAPKTRAGDLHDVVAVALGADVGLFRVDTMGLGGDASLGDAGGVSS
FT                   LEATLSHPAVVRVCDWNAVGDTLATSAEDGRVRLWAANVATGAWEEQAQLVGE"
FT   CDS_pept        958439..965491
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635088"
FT                   /orf_name="MICPUN_58727"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="dipeptidyl-peptidase activity"
FT                   /function="ligase activity"
FT                   /protein_id="ACO63466.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008239"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199B29D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P2"
FT                   /transl_table=1
FT                   /translation="MTVDTVQHAAGEAAVAEVSQAFFDPARRIFDNLVICGYRRSRLGK
FT                   SLPSKETPDAVPEPPPTSEISRAPRRFLLTSAPPRSPRASPSPSAQILTHGLPARPDHE
FT                   ALDGRTCTLAAAILLLRRYTERHDFTARVYDNPPSGAAPTDPSSRFVATGCDCVDVGVS
FT                   FDDDATVANVLVQCKRAIAEVGTTLTTTPDLLIATLRPGRDPEPVAAALLAELEHSCGG
FT                   DGEKSSGSRFAFLFCERQGALAAVANAPARARHDIKRTAGHLNVLLAALGGPQTGPSLL
FT                   RAPAWSVPICSAEETRRLRQWNAASDRPGYLPNPRPCPTHPGHLDRSGSKSFPSPRATT
FT                   LPARIAEAAAASPNAIAVSTESKTGVVGADGADARGWTYRELTRVAATIASRLRRSIGR
FT                   ADIRGERVGVYLERGPYLVASLVAVHLTGAAYVPLDPLYPADRIGAMLTDARAAAVLTS
FT                   VSGGLANEIGAIVEAARRQSENSDVFEPPVVSLADLEEEVDANEESCDFGALAAVARPD
FT                   DLAYVIFTSGSTGRPKGVQVTHANFMNFIYSMEEITGADANVVLCAVTTVCFDIAGLEL
FT                   FLPLCVGGRTVLASRETAADPRALADLIAREDVNFMQATPTTWRTLIRSCGGGEAATGA
FT                   DPPGADPPGADPPLRRITALVGGEAVPAELAVDMINSTRVAFNVYGPTETTVWSTCAAI
FT                   SRSNPTSIGKPIANTSVYVAAVAVDDELNVRVEPAPVGVVGEICIGGAGVSRGYVGRDA
FT                   LTAERFPRDPFSDDPNARLYRTGDLGRLRPDTLELECLGRLDHQVKIRGYRVELGEIEA
FT                   ALEQLPTVEQAVVAVHDSAKAAGEEDARQLVAYVVEASSDDGSDDAAKADEDGRKKSHD
FT                   SDLTKDLAEAEAWGAVYDEAYAARDALDESDPSLNFSGYGNSYTPGRVHRPEVVREWVE
FT                   TICERIAGLRPRRALELGCGNGMILLRIAKLCERYVGTDLSANAIDYVRDVITSHPDFI
FT                   LPHCELDIAGAHEAARFTDKHLDTVVCNGVSMYFPSADYLTSVVENSLTAVRPGGHFFL
FT                   GDVRNFRLHRHFHASVQLFLADPGMTFHDYRINVATHVKHEKELLVDPVAFLAMVKRAL
FT                   SPSLCDRVVIDMRRGYHRTEFGMYRYDVVFRRPADATDAPKDGGARYDLEPWDSTVHSL
FT                   AEIEDMLVGDAPEYLAFTGVPDARLVHEEALLNELEDTADAHAHATAGALRAHLDKVAV
FT                   ALERAAVEPEDVYRLGERLGYRVNAMWTPDEPTRFDVVFAKASAPEPEPVAFASLRHRG
FT                   LDHLTVGGDCEDTAEMLRELTNKGARATASAEKALTDLVKRKGAAESEKPDAPVKTDEE
FT                   DAAENSVFSIVPAAKARVLRVALRSSLPAYMIPRAVVGVKPGGLPMTSNGKIDRNALPA
FT                   PATLRAKSSDIEVDAGIRSVDYVAPDGDAEELVSALFEEILFPEGSGQVGALDDFFDLG
FT                   GHSLLAMQFTGRLEAATGFRLQMRQLNDAPTPRAVASALRNIGYDSNGANRGSSIDRTD
FT                   IHSVDRRLSSSLPASAASSNALTVVDPVSLPHASAGTVRVDEIFFPTRDGTKLSARLWL
FT                   PDGVALDADELRAPAVIEILPYGYATGTIDTDEATYPYLAGNGIACIRVDSRGSGNSEG
FT                   VLDDEYSPQQQRDACDACEWAAAQPWCTGAVGMMGCSWGGFIALQVAALAGDTAGKGAA
FT                   REAPSLRAVCAVCATDERASDDMHWMGGSLLGENLAWGAWLLDSLAAPPVPVTSSVGTA
FT                   SPVRISSGNITPYTADSDGDENHSDNDQSSWESRWVSRLEELKPMHGEWASLHPESSRG
FT                   RSYWKEGSVGSGGRNMIAVPVLSVGCLHGGGYANSTPRLARALGPNRVKAVMGSWVHNY
FT                   PHLSKSGPAFGFLAEVLDFWREHLFVPGNPLPGSPRENRRDVPGVRVHVQRPPLDGGPV
FT                   TAPERAEGYWVAEHSQDHLDAAADEGAFLLAFTPEGTLEADPRSARRDELDIFSAPKVM
FT                   RDTPERPVGVASGRWFTFGDGDDLPGDQRPDDERSVCFDGAPVTVETAIIGAPRITVAC
FT                   RRVGEDATTHSGVVVARVCAVAPDGSSHRITYGVCNVSAMSSSSHGSVSNYQGDEDEST
FT                   FAVTVACDYCAFSIPVGWKLRVGLSQTYWPVIAPSPAGFEPLAVVGGACEIPALSDEHI
FT                   ADKWSYSVDTIPELEVLVAPLATRGLRGGEVRNDLIGAGASAKVIRRADSGARLVPLKD
FT                   SRLIVESQAVDVSARSGRSQRIERRRVIKGLATSGKVSPKSALDSMHAFGPASPTSRSS
FT                   TPGLVDAEIVVGAEMTVVDGAYKFDTKLEAFVTEENEDSDTENRRSVFARSWTEIAPAV
FT                   VTQE"
FT   CDS_pept        join(965815..965900,965965..966967)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635089"
FT                   /orf_name="MICPUN_97419"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase "
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63467.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000199B29E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P3"
FT                   /transl_table=1
FT                   /translation="MDASQEDLEERPLRIGINGFGRIGRLVCRAARNRGLTTVAINDPQ
FT                   LGAKYASFLLTHDTVMGRFEGEVSTSTERDDCFLIDGEPVHVTQRTDPGEVPWGASGCD
FT                   YVVESSGKFLTTALCREGHIKRGGAERVIMTAPSKDAETPMYVFGVNHESYALDQPSVV
FT                   SCASCTTNALAPLAKIIDDNFGLSEGLMTTVHALTISQPTVDSANPKDWRRGRSGMSNI
FT                   IPTSSGAASSLGRILPTLRGKLTGFALRVPVADVSLLDLTCVLERPTTIDEIKAAVKLA
FT                   AEEEFEGLVRYTDDPVVSSDFIGDPSSLIFDSAAAVATSPHLVKLLAWYDNEWGYSCRV
FT                   VDMMMHMWEADKMRQGLKNPVA"
FT   CDS_pept        complement(967208..968173)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635090"
FT                   /orf_name="MICPUN_50333"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63841.1"
FT                   /db_xref="UniParc:UPI000199B29F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P4"
FT                   /transl_table=1
FT                   /translation="MGSAAETNKDKAATIVSAIASQSAALEEPLEVPGGTPFGQVCDAA
FT                   AAVEMGATKIQMIFADGADVPEDAAGSALETFHMNVITFIAYCQSAMGTQGKTFDAGLR
FT                   DAAKVLCKSAGRLVATATESAEPSGSLRAVLGECWEAVKDIKKLPKDGRVAISKALMRV
FT                   ATFIKDTSTELSELGEGAQDEGGNPEDPDEDDLRFHDEDFTAEEMRVARACAEFASASF
FT                   EFVRKIVAPIVRGSASDVDALERALDSSKKFQVRLEDVGAGVYPPQDGGALIEDASKAM
FT                   EEGRTMGKEIAEAGGVEGAEEAVAELEGAFNKLRDALGEK"
FT   CDS_pept        join(968344..969306,969493..>969720)
FT                   /codon_start=1
FT                   /gene_family="HOG000200814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635091"
FT                   /orf_name="MICPUN_82271"
FT                   /product="Predicted protein"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO63468.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG627038"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="UniParc:UPI000199B2A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P5"
FT                   /transl_table=1
FT                   /translation="MFGPGRTARVAENRFGAKPSPTPGGERAPSGLSENKRGGAAANHD
FT                   GLLVNLEHCKYECLRKVTADNGFEEVGDDEQYWDLCWMDSSVSEGRVAKLYPFQRINHF
FT                   PGMLEICRKAPLSRNLRRMQTAHPREYSFSPQTWDYPSQLDLFRKYSRANPDAVYIVKP
FT                   SAGAMGRGIYLAAGESGIDKTHSGAVVVQRYMHDPFLLDGFKFDLRIYALVTCVDPLAV
FT                   YVYDEGIARFATTPYAAPNKSNLSQVTMHLTNYSLNKHSATFVSTDKEDEGTKRSISSL
FT                   FAQMKAMGHDTEKLWRDIREVVARTVLPIQPHLAHCYHSSPSRCFELLGFDIIIDEKLR
FT                   PWLIEVNHSPSFNMDSPLDARVKCGAIGDVLRALNLDGEERRAWIEAEKRAQKKRLY"
FT   CDS_pept        join(970944..971052,971388..972931)
FT                   /codon_start=1
FT                   /gene_family="HOG000198718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635092"
FT                   /gene_name="LF4"
FT                   /orf_name="MICPUN_96377"
FT                   /product="Long flagella protein LF4 "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO63469.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B2A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P6"
FT                   /transl_table=1
FT                   /translation="MGGAAMVRRSGDLGRYKHVLGVGAAATVTPNSPRIAQYRLVAKKG
FT                   EGTFSEVLKAQCIKNGKYVAIKCMKNHFDSLDQVNNLREIQALRRLSPHGNIIKLLEVL
FT                   YDQPTGRLALVFELMDMNIYELIRGRRHYLAEDRVKTYMYQLIKSMDHMHRNGIFHRDI
FT                   KPENILIMDDCLKLADFGSCRGIYSKQPYTEYISTRWYRAPECLLTDGYYNYKMDMWGV
FT                   GCVFFEIVSLFPLFPGTNELDQIQKIHNIIGTPSAELLGKMKQRSAHMDFNFPQKSGTG
FT                   IEKLIPHAPPECVDLINKLLAYNPDDRLSARQALRHPYFREIREMEKRQYALMNPKADG
FT                   TLSGSGGDDSRAGHHGSAATSSDARSDRTRRSRASASVASASVPSIAGKGIGDAGGGGG
FT                   YEPSGGHRRLQVAGSHRSHAAASSVHSGYHAGASSYHGGSDASSIISAGGISLGGVSAA
FT                   RSGGYGGGGAADLGVQGVGSRNVKPGAREPVKLGGGYGGVAGSSYGGSYKSKPAARGSV
FT                   RERMEPPSGVGGQKAPVSHRTDKYVSPYGQQRR"
FT   CDS_pept        973216..973617
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635093"
FT                   /orf_name="MICPUN_58732"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63470.1"
FT                   /db_xref="UniParc:UPI000199B2A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P7"
FT                   /transl_table=1
FT                   /translation="MVKKMVVTMLVSGTPSASSSAIAGSAERNSAESAVTEAASGALDA
FT                   TSTSSYSTRTSESIAEPLATVHAARLISTRAEAGGTLAARTLDPDRAITATPLATRGLA
FT                   APLTRTGTAIAPVTIAEDIFTSENNRCSS"
FT   CDS_pept        973726..974901
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635094"
FT                   /orf_name="MICPUN_100624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63471.1"
FT                   /db_xref="UniParc:UPI000199B2A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P8"
FT                   /transl_table=1
FT                   /translation="MSGKPKTPGTLRGMRRRKSGVARPTLTTPILKQVDDCTWARVDAV
FT                   ELEEEDPEEVKLPVFSSRALPPSPRTAPPSERPSSMNDATNTKWWTIRQPSPFVSARKT
FT                   PNPSPAPSRERDENEIPTSGTAVDDLASPRVNSRVRRPARSARTRCDTPSRSLVTADIL
FT                   CSEPALGASPRPCASRGLKRRRVSERVVDQETASVDSPAIRAVSPGEGILSLLRKGAAI
FT                   DAAAAERKRSLPPGFSVREVTSFDDAALQTLSTAFAAEDPRVGKLPRGGPTGGVRGRAH
FT                   VLDDAEGEAIGYTLTFENVAPPWDMERSLGLPPRLAHIFILRGWRRRGIGTAFFLWWRE
FT                   KFGATVRLFAVDTPSEAMNRVLAKGMCVQTATRSGHNASAVHFHSTAMERT"
FT   CDS_pept        975026..976288
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635095"
FT                   /orf_name="MICPUN_100625"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63472.1"
FT                   /db_xref="InterPro:IPR013882"
FT                   /db_xref="UniParc:UPI000199B2A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6P9"
FT                   /transl_table=1
FT                   /translation="MAPSELDPPGMSDDFYRASVVTLTTHIDDARNRIAASTTEHLNQL
FT                   RRKVEVDVEWMKKETEARFVQLECEAKEARELIATLRAELTNAEKKEAMAVAEARKARA
FT                   ELDELRDSVQSGKEPLRAELEMWKESSRKYRKKLEHSEQALARLKARAGAAGFVEATPP
FT                   HHHASAFRPHAKRVRMEETRNLAAEAPATSPPRQADPAAPESNADPSPPDVDPTLAQMP
FT                   APAVPDPGARWRRKGGGTAGGGTAGGRVAALAAEASLRRANSGDSQLWGATQVRGGDAR
FT                   GGDAYAAEDRRIFKLGVPPTDRRPGAVTIGGDENAAGGEGKFPARGEKEERVVKFVEVV
FT                   RKRSEREKLPAFTCEECDKFYAAAGLTGASRPNDGACQHCPPGTTDDWSRHRARWAPPP
FT                   APKGYWNLGFGTQQSTERQST"
FT   CDS_pept        complement(<976341..>976941)
FT                   /codon_start=1
FT                   /gene_family="HOG000240662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635096"
FT                   /orf_name="MICPUN_71597"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63842.1"
FT                   /db_xref="HOGENOM:HBG588380"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199B2A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q0"
FT                   /transl_table=1
FT                   /translation="KYRLVKVLAALDRGVAANDDDRTYVGDLVDQLEAAAKSTGGVPED
FT                   ADLEKALDGEWRLAYSSTFAGEQPGSQGFTGAPGQGAPGVTLGAVYQRLNAEAKTCDNV
FT                   VCLRSPIPGVSGVAALGHSYEVDGRSMTISFTGVTVESSPFGVGAFKLPSPLDALPREA
FT                   REALTNAGARSGSFETTFVDDDVRVSRGDRGECRVFV"
FT   CDS_pept        977507..978529
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635097"
FT                   /orf_name="MICPUN_58735"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63473.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B35B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q1"
FT                   /transl_table=1
FT                   /translation="MTRRRFQAGSPGAADPEPRPEEQSQRMGFGFNVGFGTTSNSRTMP
FT                   PVVRRADTTAFVSTPRGPLQSQHLVDQNSGSGASTPRSARDSHVAETYGECAVCFDPLC
FT                   AQRTAVLTQEHGRGMRKERTRSCAHFFHLACANELRVHHAKCPICRAPFNGVLPVPSPG
FT                   EDPDGWFAAVDVDGDGRLSPSEVLEALRAQIRCDWHAIERQLPKLWRRWDVNGDGYVEK
FT                   NELVSRGGLIEYVTKHFPKREHRERPPPPSIARAPNEWFEYWDEDGSGELEKEEVVRAL
FT                   VKTFGLGADMPSLRNIRQIVDAVWCVFDPDGSGAVDRREFLMRDGLADTIVASAGAWRT
FT                   "
FT   CDS_pept        complement(978639..979268)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635098"
FT                   /orf_name="MICPUN_108304"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63843.1"
FT                   /db_xref="UniParc:UPI000199B35C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q2"
FT                   /transl_table=1
FT                   /translation="MPARAPAEEGSLLPRGFPTVADLAECESAEEKAELCDKADLLVER
FT                   LEAKADSAEAFVDGPICAFFGFLKPNAIRNAEKARAAAEEAAAAAAALRRAAAGGPGGG
FT                   VIAGAVAALVAAGAAAVVLGGGGGGGEPLVKKSEPRASRTPTERVVKQPKERVAKASTG
FT                   QAFTLFSAPEPKAETGLYGLEASNMAEKVTKGEVDALSAYEALQRK"
FT   CDS_pept        983577..985415
FT                   /codon_start=1
FT                   /gene_family="HOG000071041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635099"
FT                   /gene_name="PWD1"
FT                   /orf_name="MICPUN_104820"
FT                   /product="Alpha phosphoglucan water dikinase "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="ACO63474.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG611655"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199B35D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q3"
FT                   /transl_table=1
FT                   /translation="MLAAASDATALSSGGGAGEEFGHIAHEAGELANNLPGGEQGALRV
FT                   RAVAERARRSAEDYCNLLSDLFDGRAAALGRSLGIDGHTVEVFTEGQIRASVVFQSAKL
FT                   ASHLLRAARTATGEAGWDCLVAGEVVGAKLVSVPRLDPSDPTIRALTADAPAVLLVQSA
FT                   DGDEEVSTCGPGVAGILLCHALPHLSHLALRARQAGVPLVAIEDPNLVNHASSLTSAPG
FT                   VRFVAQPSNISLDAAEGGYSPGTQGGGGGTSTPTPQRQAAALVADTSRAGWVTPLHELG
FT                   QMPWHAGVAVAGSKAMACSVLSALATDPNSGFAAPTGAVLPFGSMEQAAHALGHAERLN
FT                   FLVDALESVQTRPEEVASVCGELRDLVRQLRPSHEQLAALADPFAHDHGAKVMVRSTGN
FT                   AEDLAGLSAAGLYDSISNVAPGNPEVLGSAVAEVWASLYTPRAVASRAAAGVGQRGAHM
FT                   AVLVQQMLVPDVSFILMTRHPMTNDPNTAYAELALGHGETLASGSVRGTPWRMSMNRSN
FT                   PGESQVHTYSSFGTALVPDLDGDGTLKSVAVNCAGHWLSTDDGARGQLAARLVHAGGFV
FT                   ESTLGSVDGGQLLAQDIEGCLTPDGQLWVVQARPQP"
FT   CDS_pept        complement(985498..986532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635100"
FT                   /orf_name="MICPUN_58738"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63844.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199B35E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q4"
FT                   /transl_table=1
FT                   /translation="MPSSRIEFHMITIPTVGRGGQMSPFASRSGNPPRGLPTQHSVPSM
FT                   FATAAARRSTGAAARIWRSISTSTHRLTPDAGGEPARLRGVQEFLDFRRAHPEQCAVVV
FT                   GALDEWPMLGPDWGPERLRDEHGDVEVPLEVSTGGADYRDAYREDAPRSRSRTFQADHL
FT                   VRLGDFIDAFVLGGRDVPPGVNAYLAQHDLLARIPELSDACSPTPPHVGDGDDAQRERT
FT                   MRRCWLGPRGTQTPLHRDPYHNVLAQAWGTKRVVCFPPSDENKMYPFTANGFLRNTSTI
FT                   EDVDDADESKFPLFSKAGRVTTTLNPGECLFMPAGTWHEVRATSASLSVSYWWGRRGTG
FT                   PAGA"
FT   CDS_pept        join(986938..988632,988665..988736)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635101"
FT                   /orf_name="MICPUN_100629"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO63475.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B35F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q5"
FT                   /transl_table=1
FT                   /translation="MEYSRARERYEMNQWGNKDSKDVKIGVRTVIDEDDPALKLSDDAS
FT                   MNQALSRWNQVRNLLSSKASLTLLRSDSSIKNEAALYGGTIDSDSMKDPHGEPEPVGRW
FT                   WYVNPDGRFRSSWDIFQVAVLCYLACATPYRVAFDAPAYGPAFWWEFFVDLYFIADVFL
FT                   NFVTGYWEELETTSVLVSEPWPIAMNYLRTWFPIDAVACAPVDLVTRALEGTLRCSFEP
FT                   DGCSAAEKYDANVDANALKLFKLLRIFRLVKLLRLFRVSRLLHRYQNQLIYYHSFISVA
FT                   RVNGLVILIAHWMGCIYGMNYEQNLDDNSGNRWLQSIYWAVQSITSVGYGDMPADNEIT
FT                   MLIAIFTMLMGVVLCSWIMTNVLAAMNPDSSSKRFHERLQYVIAYLKNNQLPQGVAKRV
FT                   ITFYRWQNMNQFDEKSVLSDLPPSLRKDIFDNLYTDALVGVPIFKNMSNQFITEVCLRM
FT                   SPISFPQFHSVYGQGELGYDMYFITKGSVAVLLNEMPHNPSTDELQTMVDSCIELGRGS
FT                   FFGEPAVLGFASRLETIVCTRSCTMMTLNQDHMDELCQLSYEFKAELTGSEGGLHVVPA
FT                   GFRCRRGGDHSG"
FT   CDS_pept        988858..989040
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635102"
FT                   /orf_name="MICPUN_108306"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63476.1"
FT                   /db_xref="UniParc:UPI000199B360"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q6"
FT                   /transl_table=1
FT                   /translation="MASSGKMFDQLKSLHEIVARMEKKGGGGGGGPSGGGSSLEKRMDS
FT                   LEAKLDKLIELQLGK"
FT   CDS_pept        join(complement(990907..990960),complement(990594..990716),
FT                   complement(989268..990455))
FT                   /codon_start=1
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635103"
FT                   /gene_name="CDC20"
FT                   /orf_name="MICPUN_97422"
FT                   /product="Anaphase promoting complex protein "
FT                   /protein_id="ACO63845.1"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B361"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q7"
FT                   /transl_table=1
FT                   /translation="MLHRFGDENAPKTPGKARPDRFIPNRSALDLDIAHYNLVKENANA
FT                   NDLDLAAEVASPSKEEYKKQLASNFLSQDGGASSAKILAFKSKAPEPPAGMENSARGVY
FT                   TNNAGAGVKSKKTFRHVPSAPERILDAPELIDDYYLNLIDWGSTNQVAVALGCVVYLWN
FT                   ADSGDIQQLCQTDPNNGDDYVTSVQWGGDGKHIAVGTNDAEVQIWDVSRLKQVRTLRGH
FT                   NARVGALAWNGTQLATGSRDNTVMMHDVRIREHRTATLTSHSQEVCGLKWAPSGNQLAS
FT                   GGNDNLLHIWDQNSIGNGTHLHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN
FT                   TNTGALLNSIDTHSQVCSLQWNKHERELLSSHGYSQNQLCLWKYPTMTKMAELTGHSAR
FT                   VLHMAQSPDGTTVVSAAADETLRFWKCFSDSDAGKAKKLKDGASDSSVLRRFNFR"
FT   CDS_pept        991337..992365
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635104"
FT                   /orf_name="MICPUN_58741"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63477.1"
FT                   /db_xref="InterPro:IPR021920"
FT                   /db_xref="UniParc:UPI000199B362"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q8"
FT                   /transl_table=1
FT                   /translation="MTTIRAAPVARAISHGPSPVRAPETRAVLAPRASRARTAAKLGGG
FT                   CVAQPRGASLTASATRVARRKYPEREPDDDDDVSAESPSASSEAAEDPPTKPGFDADGK
FT                   KLKWMEILEESAEFDPEIKNLLDGADSNPDEVEKRIRERFEQRKERIYQEREGSTVPML
FT                   VKFREFKSQNLWIHLESHNAISDMEQPLLDEVFKAWFVLGKLGGFNSDNMQVQANFFEV
FT                   SNMEYDMDQANGDGDVPTAVFHAMGGPEYKGRWCRCWFDLGSADEMCVDVLINSLITFS
FT                   REYFGLKTLVIGGENVLEDWPVQESEFYVDDSREMEIEMGPFRPPPPGTDMGPMGGAGM
FT                   SR"
FT   CDS_pept        join(complement(994049..994304),complement(993699..993820),
FT                   complement(992494..993345))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635105"
FT                   /orf_name="MICPUN_105610"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63846.1"
FT                   /db_xref="HOGENOM:HBG561231"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="InterPro:IPR013951"
FT                   /db_xref="UniParc:UPI000199B363"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6Q9"
FT                   /transl_table=1
FT                   /translation="MSGKRQAASPPADEPDAKQAKGDDADAKAGADAENAGAEAGGDDP
FT                   METEENGRGDAPARRSLRTRNPVRKAATRNEGKAAKANATETKITQVTYKEGELLSDHL
FT                   KADGALVEVKIPAECTVNTNQQVRSRQLWGTDVYTSDSDVVAALMHTGFWLPGSTCPPQ
FT                   LLELVATARAVPPAEQYLSTSRNGIRSRSWGRVLTGFSYKVEACRAITVNNQTIELTGD
FT                   PERIKPCAPTFFPNVVESVVNTRASQANAERRQRLIQEVTIQYNLCNEPWLKYSVASVC
FT                   DRGFKRSEWTSARLRRETLYLETHTKRYELSYDGPVFDEEEENYDEVNAPEADVYRWGR
FT                   CATPRDLRQTAELGVPLPKEELVDVVTGVKWNEIGFDLNSVTIKGEEYKVVRLQWLPRI
FT                   EPGGELHEDE"
FT   CDS_pept        complement(994520..995188)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635106"
FT                   /orf_name="MICPUN_100633"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63847.1"
FT                   /db_xref="InterPro:IPR003659"
FT                   /db_xref="UniParc:UPI000199B364"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6R0"
FT                   /transl_table=1
FT                   /translation="MSNATVCDSTNGCEHWRGECQVQCGTLATAEACGVTAKCDWDEAY
FT                   HVCNSRRPPTCESSNTRSLCIATRFCQWDAIEAKCGDATWRCEDLKDEAHCARSTSPRC
FT                   VWSGNDENGGSCSDLRQCEAIALPQECPTHHGCAFSQSKNQCISLSALAGDKPVCRGSA
FT                   DCGVPFTFCNADYGVRGFCQNCLPIIGDGIDQCDNIARVPAPGAGECRSACFPPKKGGQ
FT                   "
FT   CDS_pept        join(995912..995966,996070..997304)
FT                   /codon_start=1
FT                   /gene_family="HOG000217038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635107"
FT                   /orf_name="MICPUN_113404"
FT                   /product="Band 7 stomatin family protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO63478.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG714701"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniParc:UPI000199B365"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6R1"
FT                   /transl_table=1
FT                   /translation="MRAATRGLFRAFAQARSLGPAAAAPRRNTGALALAEHDAILRALP
FT                   SIARSYNTSLRDLAVAPRPPNIGIKIVPEKGAVIVERFGKFHTVLNPGIHLLVPVVDQI
FT                   AYVWHLKEEAIHVANQTAVTKDNVAITIDGVLYLRVVDPVKASYGVENPIYAVSQLAQT
FT                   TMRSEIGKISLDKTFEERDHLNHRIVNTINEAATDWGLECLRYEIRDIVPPTGIKVAME
FT                   MQAEAERRKRATVLESEAEREAAVNRAEGQKQKTVLEAEAEAESTMLRARAAAESLAVV
FT                   GEQLINPGGADAARIRVAELYLREFGKIAKEGNTVLLPADAANPANMVAQAMAAAGVTA
FT                   QAIPGYEGGAAKVIAGGARTKAKATASKATIGGASSGDAAKARAAKIKEREIEELVESA
FT                   ANTYRANRTILSALTGERSKAEGRAILSSN"
FT   CDS_pept        complement(997368..998315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635108"
FT                   /orf_name="MICPUN_113405"
FT                   /product="Ferredoxin-dependent bilin reductase "
FT                   /EC_number="1.3.7.3"
FT                   /function="cobalt ion binding"
FT                   /function="phycoerythrobilin:ferredoxin oxidoreductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="phytochromobilin biosynthetic process "
FT                   /protein_id="ACO63848.1"
FT                   /db_xref="GO:0010024"
FT                   /db_xref="GO:0050618"
FT                   /db_xref="GO:0050897"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561233"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="UniParc:UPI000199B366"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6R2"
FT                   /transl_table=1
FT                   /translation="MATAAQHRVFAPRVSRASPARRRAHRVVAARAAAPAAPTGAWNLD
FT                   GCPDGIILSLARRLEAEWTRLPNVRDAPCAPELKSVDATAPDGDPATRIRIENLCLQTD
FT                   AFRKMHLEVAWGLGGLEVLHCVIYPWAEVAAPIFAADLVAFGGRVTLCIADASPCADDL
FT                   SLPRQYVDAARALRRSMLTSCPAVEPRPLPDWGVAILSPEACVCVGPPKEDFPAQTQTR
FT                   AFVKYLESLHGVHLLLATKIGGGYGGGTGARSRAQRRFCEKQLLNDKTKRVLERSMGAA
FT                   LTDRYMREVLFDVTANTPTGKDARSLGLPTKRFL"
FT   CDS_pept        join(complement(999629..999922),complement(998546..999493))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635109"
FT                   /orf_name="MICPUN_100636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63849.1"
FT                   /db_xref="UniParc:UPI000199B367"
FT                   /db_xref="UniProtKB/TrEMBL:C1E6R3"
FT                   /transl_table=1
FT                   /translation="MRLIVVIACIIVAATAVVAQEDPCVAELARCRDACGNREILVNDC
FT                   ASASGFLSKACSCGGALDAPAGEEGAIETTSETVYFDGGAVAMLGSEDAQETKAKKPCP
FT                   HHESMSMEPALMFNRRFGPGFASLFDELFDETEEAGGGWTTRGRPALLGRDASEPRGVT
FT                   VSFGPGLGVFGNARQRATFNAFQPQLVFRTVFYPEPRPLPSVVTLFDLEGSADSDLGSM
FT                   DPSAREESVMGALQRWRDVSEHGAAATWKVREEEEEEGGGVRAMEVNREAMSRAGRKTR
FT                   RGPEDEGGATRRLVLAFASVALIAAVLTLTSAALVCVASLATRALGRMFRGRGDSGLAV
FT                   DAVDVSEPLLLEYETTREVTAGALSTVYADAAPAAPTPRRASVEDETMEVMMPMPLERG
FT                   ERSTWRSEPGYSRL"
FT   CDS_pept        1001542..1002126
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635110"
FT                   /orf_name="MICPUN_108308"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63479.1"
FT                   /db_xref="InterPro:IPR001726"
FT                   /db_xref="UniParc:UPI000199B368"
FT                   /db_xref="UniProtKB/T