(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_4

ID   MICSR_4; SV 1; linear; genomic DNA; GRV; PLN; 1431126 BP.
XX
AC   CP001327_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 6, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001327.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1431126
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 6"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        complement(394..1152)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636236"
FT                   /orf_name="MICPUN_82436"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64325.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199B735"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9F8"
FT                   /transl_table=1
FT                   /translation="MVDGGVAELELDEVSLTRAVPAEVWRLSAMRKLSLPKNQLTCVPA
FT                   EIGQLTSLEMLNLNYNQLTSLPAEVGQLTALKELSLYGNQLTSVPAEIGQLASLTELNL
FT                   GGGKQLTSVPAEVGQLTSLERLWLHDNRLTSVPAEIGQLASLRELWLNYNQLTSVPAEI
FT                   GQLRSLRWLFLNDNRLTSVPADIGQLTSLEGLWLHANQLTSVPAEIGQLTSLEKLYLGD
FT                   NRLTSVPAAIRELRAAGCHAELDNGVTVDE"
FT   CDS_pept        complement(2153..2902)
FT                   /codon_start=1
FT                   /gene_family="HOG000100090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636237"
FT                   /orf_name="MICPUN_59000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64326.1"
FT                   /db_xref="HOGENOM:HBG559404"
FT                   /db_xref="UniParc:UPI000199B736"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9F9"
FT                   /transl_table=1
FT                   /translation="MTRDSNGGVGGRVQLPFDTYGLRRHNGLPLEEYYHSVENVPDLAA
FT                   RGVSQELYRRIFVNELAQVTGLEMPPRDEDAVKRQVCAAWLAAFVCFPVGLPYCCWITH
FT                   RERARVQAFDADLRAWQANATEQLRAIVPGAVVKTRMRVKGEYQIVGREQGEVKKSYVP
FT                   TSTERSIVIALTPEEGSLLQDEPHISGDADNIPPQCMCVFCACEGRPDGSCEGETLCCC
FT                   KFTVKPGAPEGLDYYEWKRDERCAVPV"
FT   CDS_pept        join(complement(6563..6636),complement(3285..6438))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636238"
FT                   /orf_name="MICPUN_59001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64327.1"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B737"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G0"
FT                   /transl_table=1
FT                   /translation="MSTLTVVTRPARPDDAVQLDGFVDGSHQGKVYGRFNLGQLIENAT
FT                   ATVVVIDPKHDDAVVGFLSVTRDIPLPFGVPKDRGLERMQWAKSEASAVGYPSDVAAWV
FT                   AGCGVKAGYEKVAVAPMLKAAFQLLPHLDAVLIAAPPEVEREPVGTSFVKMARTMKFAL
FT                   YAASRESVLPRLRVRLARVDDHDDLLPLVASAANDPYAAGGPLSRLPGGSEASTSDRAS
FT                   GGMGDEYALATLISRALDDPGKKCVLVAEAEEGKTGKMSFVGVMAVEAVDVEEAASLAG
FT                   KYDLAAYDNLMPAPDDDGPGDGNDEDNATKEPVAIRVTMLCVDGAYESQSADFLDHAFD
FT                   AFPEKDFCVLTLPPQAPELPLATLAMRRVAPTDPEADDALHACHRAGQLRGFTVRLAKD
FT                   DDYEEVWDLLEGMSDQEELCTAFADAAATSNTSQAAVVAICEGQVVGYATVTLGTEISS
FT                   LAQCFDLTKVVDVGAHGQSAFVELEDCVMNPIFAHKRRFVMCEAMRLSRATCVLYQLAP
FT                   GEEEPPPPDVVSLDFRLVAGRRSHTGFDAHFALYAFTNRISNSPRAAINSRIVVVGSNE
FT                   AALAVLDRLLTNNQCAFNNVTLVTNGGLAVGGVASRYNRASIAKLALENGGGNTSTGAA
FT                   GVALADAAVVGLDREGRCVYLDDDSMLMYEMLVLVPGRGDQTRHRLGLTLEDETPVERV
FT                   VDLMANLTKEDAQRLKAVIVYGDTMEAIGAARRLLTAGVPAAALRVVSPTEEGTLFAVA
FT                   EAAASKLRATESHTVAGQPAPEKGLTLTGASAVPGGGVHAVFSRAATGESVEMDADFLV
FT                   ACDRGDCDPALFKCLNDAEIVYDGHVVIDAAFRTNDPDVYATGDIAKFSRRYATAGGKL
FT                   QPLDRHDPKESGFLLADSLIDRVRGVRPRDAPPAFNAPKCESVILPGKCQFLFVARPAR
FT                   FERPSWDAPPGGRAIETRSDERGYARIDVDADGIVSAFYYCGDVKVDSQRMGCIVGLPV
FT                   SYLGEDLSSAACLLTHLDQDAFAAVFHEGFAQAHRSAVTLLSAPKDALAESFLGAQNDG
FT                   AMVQDIVIDFVRRHASDLPMLAIPSRA"
FT   CDS_pept        6823..9141
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636239"
FT                   /orf_name="MICPUN_100802"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63977.1"
FT                   /db_xref="HOGENOM:HBG607698"
FT                   /db_xref="UniParc:UPI000199B738"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G1"
FT                   /transl_table=1
FT                   /translation="MAVAGGASVDATASMGGLFASTTRSRSYRRRSPIPPEGHRCASIR
FT                   LSEKAHAVAFAFGRTASAWTRTPRGASLALDASEDDGILELLAAAEATRRGSSDPDSPD
FT                   GPRGLITVGGDGICLGLTASWSLTFDASSDGMGFRDEISLDTGETAESKVPPMLFQSGY
FT                   DPEADVAWETELGSGTCRATTFDGAHRSLLISWIRSGQWLNGQAARRRLLLKLIRGPRV
FT                   PLRALVEEHTMVPKLSMSASFAEPSEPGNKSGPSGRRGKDRGNKGGRKGGRNKFGDAVS
FT                   RASVREVKRAGAPPPIPSGDGALVAVACRGGSVGARVWLHRVNVGGDDGWVPHRCELAT
FT                   PEGVEAWVFGEWSRSDVGLLVPGVSHQTHPAGNSCVYRAKRTASILDGEKSSSKIFSQP
FT                   YEGYPTDDDRWPVPTYSLNDAGVTEAAAAVPAARGEGGHVLVAPRLNGQASPGWFVLDT
FT                   SCAGFAIEPSVADRLGMPAFGELSVVGVSAAALSGAMRRGTTISAGCVDVPAPVYMEQS
FT                   LAAALRTPPAPVGSDPSAGGGLVGVLGTDFLQHCVVELRAPRRVPGSPTAPSFDVFCFD
FT                   PAKYEPTDRVRAAWQRVEWIQGVPHVRVKLTVADDGLTPEPSLEQKLPRGGPQAGTGAG
FT                   PENPATDGSGWEGRLFRLSLGAGGAGAIVSARAAKEWKMVERTVGLQPGGVMSGPGEER
FT                   SRLAMVEPEVVTGRLRRVEFAGGRFETVRALTHTSGDPPDLALSPHADGALCADLFRGC
FT                   TLVLDFGRNRIAVLTQQVD"
FT   CDS_pept        10046..10921
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636240"
FT                   /orf_name="MICPUN_59003"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO63978.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199B739"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G2"
FT                   /transl_table=1
FT                   /translation="MALALSVSASAASAKVAAHRAHGLKASSKTSAVVFPAKRGRHVVR
FT                   ADAVGTERNGDADASVSISAAPSAVNGTLATAGAVPSKEAALARARDIMAADPAAATAL
FT                   SLVGQKVDMKVCFSLHYVTKPGEDLFIIGSDERLGNWDQNQGVAMTWTEGNVWKCEMDL
FT                   PAGGVFFYKYLVKLPGNGFKWQDGANNLLVLPEPWDVPEGGVFMADDDFGGVTREAQTQ
FT                   LAVKLISTEKEKVQLRVEANKAKEMTKAALQELLIAREELNKAQEKLAAYEGNVQTAFN
FT                   GQLNGGANQR"
FT   CDS_pept        join(complement(12087..12152),complement(11823..11966),
FT                   complement(11133..11636))
FT                   /codon_start=1
FT                   /gene_family="HOG000091079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636241"
FT                   /orf_name="MICPUN_59004"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO64328.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG314521"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199B73A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G3"
FT                   /transl_table=1
FT                   /translation="MDYGVPAALGVAPELMEEVSTGTTIMACVYDGGVVLGADSRTSTG
FT                   NYVANRASDKITQVMDNVWMCRSGSAADTQNVCAFVKNAVEEHGIMSGSDEPGMADVKL
FT                   VANVTMQIAYRNKDRLSAGMIIAGWDRRAGPQVFGIPLGGSLEKCDFTLGGSGSAYITG
FT                   FCDDTWKPGMSREEAEAWIRRAISIAISRDASSGGVIRLVTIHEKGAEKQMFEPAQHPL
FT                   AYDELPVIRREEVVA"
FT   CDS_pept        join(complement(12869..14134),complement(12335..12832))
FT                   /codon_start=1
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636242"
FT                   /orf_name="MICPUN_82879"
FT                   /product="Predicted protein"
FT                   /function="glycerol-3-phosphate dehydrogenase activity "
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="ACO64329.1"
FT                   /db_xref="GO:0004368"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG720894"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000199B73B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G4"
FT                   /transl_table=1
FT                   /translation="MPEPALPSEPWADASVSAPSRREQLRKLRGNEEFDVLIIGGGATG
FT                   AGAAVDAATRGLRTALIEGEDFGSGTSSRSTKLVHGGVRYLEKAVFQLSYGQLKLVFEA
FT                   LHERKNLLRNAPHLARPLPIATPCYHGWEVPYYWAGMKAYDLVAGASGLTMSGFRTAAE
FT                   SLALFPTLAAVRKEDGASLKGTIVYRDGQFDDARLNVALACTAAHAGAVAANYVKVTAL
FT                   VKDLRTGRVVGVKAKDVVDGGREFEVRAKVVLNCTGPFTDAVRKMSDGSRMDIMTPAGG
FT                   AHLTLPKHFAPDAEGLIVPKTKDGRVVFMLPWLGGVIAGTTDALAPVTLRPRASADEVD
FT                   FILDSIAPYLSVPATRADVTSVWSGIRPLAADPTQSGTENVSRDHLVVDEGDGMVTVTG
FT                   GKWTTYRLMAEHAVDAAIRAADKSMASRAGKCRTTDVAVVGAHGYSPDLHVRLLASKSS
FT                   KSGAKSSKPAAPELEDAAVMSHLAKSYGDRAPAIVELARSDPRRLARRIAGPNQPVIAA
FT                   EVLHAARSEYCQTTCDFVARRTRLAFLDVEAARVAVPEVNKLLAKELGWGSWRAARELK
FT                   DANALLDTFTC"
FT   CDS_pept        join(15025..15742,15854..17031,17203..18029,18156..19842)
FT                   /codon_start=1
FT                   /gene_family="HOG000100091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636243"
FT                   /gene_name="CAV4"
FT                   /orf_name="MICPUN_82714"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated calcium channel activity "
FT                   /cellular_component="voltage-gated calcium channel complex "
FT                   /protein_id="ACO63979.1"
FT                   /db_xref="GO:0005245"
FT                   /db_xref="GO:0005891"
FT                   /db_xref="HOGENOM:HBG557219"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B73C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G5"
FT                   /transl_table=1
FT                   /translation="MPKVDKDFDAPYYEPTVFFCLSKENPLRRGCIKFMEWVWFDRFIL
FT                   LTILANAIVLCMMEPKKIEGRGCGDFKATSTTGGNSVIEGSELVFTTIFTLEMLTKVVA
FT                   MGFLVNKGSYLRDGWNVMDFIVVVISLVSLLPGTGSNASALRVIRVLRPLRTLSVLPGM
FT                   RTLIGTIIRSVPMIGNVVLFCIFFFTIFGIFGLNIFMGILRNRCFTEVAGKTCADLTAS
FT                   IDGEYALMCRDAVSPTSGNNPNYGITHFDNIGYAWLAIFQCITLEGWTPIMYMTMDAST
FT                   GWSVVYFILLVFTGGFFLLNLALAVITEVYDEESTEARDAKDEEEDAEDAEEERKRLIK
FT                   KAARDKRHELGLYSDSEDDTDDDEDGSKRLRKEARLALQEEERRKAENATLAGRIRRFF
FT                   RKIIDSWWFNPLFVVLILINTLALAMEYDGMPKDYEDTLTTINLVLTIAFMVEMVFKVL
FT                   GLGPKKYVQDNFNIFDALVVFMSIVELAMANSSSLSALRSFRILRILKLVRSWKKLQNF
FT                   LYTIYLTLMSLGEFSFVVILTVFIFALLGMQMFGGKMCGLDDGEIPRHNFDTLLWALVT
FT                   VFQVLTGEDWNAVMYDGMKVGGSGTALYFVLLLIIGQFMVLNLFVAILLTNFGEHEWLK
FT                   LATKVKAKLEEEQRQKEEEAAELVRREDALREARKEAEELKKKDLEAKGYGQVREGSLI
FT                   CGFSCFNCAPQPGGAPKPLWKFEGRSLGLFSVNNYVRRWCFGVVDDKKFDTVIMFFIIL
FT                   SSLTMAFESPKVLESSTADTLDIIDWVFTIIFALEMVMKLIAYGAVGSDLRKKGLFCDD
FT                   GAYFRDPWNCMDGFIVGISIIAKALSSGGLEWVRALRTMRVLRPLRVISRVPELKVVVN
FT                   ALFRSLPGLGNVFLVSLLFWLIFGILGMQLFMGSFANCNDGSISTEGLCVSTYNTSEYR
FT                   LRSWRSQDMNFDNVFNAMQTLFEMSTTEGWTAVMYMGVDARSPDMAPKRDNNPPIAFFF
FT                   LAFMIVANFFILNLFIGIILDNFAQISEESGDGGSATMTKEQKLWVQRKTQLLGTKAKK
FT                   DYPTDPTRSAVYKFVEKEPFEYFIMFVILLNAVMMACEYYDQPDSWTNALEIMGYIFGA
FT                   IFIGEAALKLYAMNPYVYFADRWNCFDFFCVFITVLGWGLGGGGAASVLRVLRLARIFR
FT                   LIRKLKGLRMLFNTLLISVPGLINIGSLLFLLCFVFAILGMNLFGKVKFGENLNEHANF
FT                   RNFGQSLLLLLRMVTGEAWNSVMYDCMITPATSGCDDSSNCAIGECCGSQGAPAYFIAF
FT                   VVLGTFVTLNLLIAVVVDNFSNQKREEEGEDVTDDNIKEFEVAWRRLDPEVTGYIPLSE
FT                   VINLIKETPPPMGTYGTNITRMGMIRFMKNLNLQTGDSEYLHYQDALSAFTTRAMGIHV
FT                   NDLSEETKDEVKQSLSAKGKMSMQSLGSAEALREHVDGASDGRGVAVVNGRSRSSLKPG
FT                   LSIVKESL"
FT   CDS_pept        complement(19927..21612)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636244"
FT                   /orf_name="MICPUN_59007"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64330.1"
FT                   /db_xref="UniParc:UPI000199B7FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G6"
FT                   /transl_table=1
FT                   /translation="MGIPQVFVAVGGVCLFVARRRQGVGRRLSRDTRRDATKSSGNARD
FT                   APTRLGTVPRQARRRGGNEPIPVSSSEDIAPTASEASSTSGSAPTIDSEAVVSSRGADI
FT                   VVPGAEGNEERLANTASDATEITASTENAGDYDDIDDKDVEEGKVKARTSREGPAGGDA
FT                   NAGHEGDGNSVQVNNDTDEDRSSSFGGSASKTPIRPHASGGLGRVVTRSSSPPLSSSSR
FT                   KRRTAALAAVRAAARAASTASDGGAQSPASDATTDEDDEDEVNGPSSLDQKRVTFHPRV
FT                   TTIANDENAAPPASPATPAKQLRDVKDVRDAGCDAKTPAPTLAAVDPNRSQKSPSSTEV
FT                   KQPGAVAGNRFFCDSPLVCATPVVGTKRPVRGENGRYGLTRKAQIRIVKSPSFTDRSMA
FT                   PLTALSPPKDVVWEEMSAREQANWVGAGKVPNFSRFKTPGPKFPADRGKEEDEDVTVRV
FT                   SHEAMHAVGNMRYSAENAWSSPSDGGEGEEEDEGPYGPLVSTLSPNTMMDGASPATFAR
FT                   RYVEASVTRVEGMAADEMEHEAIARAYVDASEMRVGAMLRASGN"
FT   CDS_pept        21757..24318
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636245"
FT                   /orf_name="MICPUN_100807"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63980.1"
FT                   /db_xref="UniParc:UPI000199B7FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7G9"
FT                   /transl_table=1
FT                   /translation="MASTLSSEIWELREGLNVPPVPWIRDKPLPTVEDPRKAERDRKYA
FT                   ENEARIRELRQQRKVLRMKAERRVAREKEGLPSAGMTREQLIKHEAEVKLNDMAKVVDF
FT                   HVQKLEQMKARAEQRRSNPLFAGQNEKIEALRRRIEHENAMYELERTQRAEAAKKKQEE
FT                   EVRRQREKHDEIIAKREESERAKKEEEEKKRRETEEKKSATEERLERLEREAREERERR
FT                   EKLEREAREERERREKLELELRRVRENPPTPPPAPAQPATSIPITDDSFDEDPPGVANV
FT                   PRVTEPTADGTHVRPPKSPGTTSEASPRVDSQSHQPPKDASAEFSDSADFLDESNEERE
FT                   REKWNAELERRRRELEDERAAEKAKIASEVDAQVEARVRLMKGEADKTDAPADDARYED
FT                   DFESPTSPSPRPAVPVVLSSPNKAEVRGGPSGAGHVVPRGERLRVLDRLLERVYDLRFD
FT                   GEFYDAADPKRTGEDVIAGVFVRACDAVDDGSPLGETCAIACDAVTALVRSIPKGDGEP
FT                   APASFLDDSDDGAFMAQEGFPRHNDELSEPDALFAAQELRDRQTTDGYDAWTALLAHFY
FT                   QMAEAGAVDPRAAAEAMAEMLVPPDRSNTSRATRTRKTARLAQLIRALFACYDPFAPPP
FT                   PGHAPSWRRNATPRSVTRSTERRARAALKTEPGATSASGGGLFGTNLATSFIKPGGGKG
FT                   LGLTPNPNTASNVPPTTAYASQFGNGLDDSDELEAAMMATAPPPPRNTYRAPPPPPVEV
FT                   PASSPQAANTPTPKAATTPSPGRPPRSPKAQTHQAAAASDGGKSKRTTARTGPTGAAAK
FT                   VGSIVNRAFGVDDGDDSLNASGLLDQMEPEKSLNASDSFDF"
FT   CDS_pept        24669..26690
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636246"
FT                   /orf_name="MICPUN_59009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63981.1"
FT                   /db_xref="HOGENOM:HBG608038"
FT                   /db_xref="InterPro:IPR007042"
FT                   /db_xref="InterPro:IPR021933"
FT                   /db_xref="UniParc:UPI000199B7FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H0"
FT                   /transl_table=1
FT                   /translation="MEGPPLPPGPPPPGHFDDRGGPGGGGHKRGRSPPRGGPPFDRDDR
FT                   YDGRPPPRSPQRRRFNDGGRGPGRRFPGRRGGRRDDDEPLSFREFTIQHLPDHIAPAEA
FT                   ERAYQRYQETHAEKFRERNFHDVKNDPKLRELHDPRKLDGPFRTRAELAADAAKEFHER
FT                   LAAGTLEMPKPAEAPPTAPDPPKDDKDDDAGDAPADERRHHRPFPQRPFERRDARGRFP
FT                   VPPQAWNPTRLAHDLRNLVRLVKSLDEEKGVESAWTESADVKAVLDAPDPTPHLGREPA
FT                   RAAPPPKKSHTDDKVAPAEGADQGADMETDEPAPAQGEEIEGDGTGGVDQDALAEAVDV
FT                   RIAYLWRVHGVDYYARQELSVADYVSSPPAGRVDAESACLMRAAKPSDPTAWEDDKGDE
FT                   GKDGDANDEDDAGDKTDGDKTDGEKPDGEKPADAAPDSSGKHQRRRRTAAETWAFHTDR
FT                   WCVDRVTRGDPEEARLGRARADRDLNAWMDSCIVKHDENRYGCTLSAKLFVSPEYVLKH
FT                   IKNKQGAAVDAQLDKIYDRIYMENYLAAAKKEDLAAKRQKRQEREERLRDGAGGRGGRS
FT                   FDGGRGGRGGRGPRDRNQFQRPQISVMQAAPGMMLVPAEGAGPNGPYVQVPAPEAGGDA
FT                   PEGGQQQVVVVAEGKGGKRYQDIDAPKSNRVVLDYGDI"
FT   CDS_pept        complement(26743..27759)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636247"
FT                   /orf_name="MICPUN_59010"
FT                   /product="Predicted protein"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64331.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007273"
FT                   /db_xref="UniParc:UPI000199B7FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H1"
FT                   /transl_table=1
FT                   /translation="MSSSTSNEGSHLTVLVKEDEDEEDVNPFADPSLTAASVHDVVPKG
FT                   ASSGEIPRPRLEEKPRDPYAPPDNLSGLFGFGGGHVAASFSSHYRVEDETGMLGEGTID
FT                   DEALARKARELDKKEAELRVREDAYDEISATLEKRPNWPSCRPVLYHDIRAEVAEENRG
FT                   MVTAAYMTWMLASFGYCLNFLVITLNFTIGGSGIGDWFFACLFAAAGVPISFQTWYRVL
FT                   YNAGKRTRHNMFTSAQYIRFFVHFFFHFLMVVWMLASIPVVGTMCAGVITTMLIFSNAD
FT                   GAWDEFVGFLSFLNVLVWAAVGFSSLYVGGRAMTRFRTGGGPADVRRGVQFSGALIR"
FT   CDS_pept        complement(27884..29053)
FT                   /codon_start=1
FT                   /gene_family="HOG000241069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636248"
FT                   /orf_name="MICPUN_108359"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64332.1"
FT                   /db_xref="HOGENOM:HBG596425"
FT                   /db_xref="UniParc:UPI000199B7FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H2"
FT                   /transl_table=1
FT                   /translation="MNSLSIATTANAVRLAGKTAPPRQRSRVPVPGRFVGTSSSLRRSL
FT                   TLGAGARRRASLVVNAEGSSSVDVVSPDVESDAVPDVAPIGAAEGYVKLAKCLDAIKDL
FT                   PPSERAEAAENATGTVRSVLNGMKAAGETSRWDCYPELTRRNIFPNELNQMGVKNSSQI
FT                   GQPNNTNDFNFIVGVTMSTSFLALIVGATLPGDWGAFGSYLIGGISLAVLAVGSTAPGL
FT                   LQVAIDRFARISPEYRNRIARHEAAHFLVGYMLGVPVAGYSLGLGAAHTDFLEAKLERK
FT                   VYGKIAISEKTMLPLACVSMAGVAAEALAFEDVRGQEADLRDLQRILNKAEPKLSDQSQ
FT                   QQVTRWAVWQAASMLKRHEASFDALTRAMEEGASVADCLKVIEAAPKPQ"
FT   CDS_pept        29360..30094
FT                   /codon_start=1
FT                   /gene_family="HOG000100071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636249"
FT                   /orf_name="MICPUN_108360"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63982.1"
FT                   /db_xref="HOGENOM:HBG610917"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="UniParc:UPI000199B800"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H3"
FT                   /transl_table=1
FT                   /translation="MQVIASHRVIAPSRAALASKPVRSLRRASGSVARRSADRVILSTR
FT                   AMAEEGAADDDFESRLGALRGKRSKRSADDVAAKTAVKDAEPVKKATPSGQRRKGVADF
FT                   TTVGSVEEPAGANWGSETVVYEGPPSRGEIIANVAMSWTVVWLPLTISAIGRGLWVNYR
FT                   ITDKRVSVLSTSPLRTERIDVPLKEITDVIAIGRGVGLWGDMVITLKNGEKVELRSMPD
FT                   FKDIEKHIKSNMGTADPELAKL"
FT   CDS_pept        complement(30244..31527)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636250"
FT                   /orf_name="MICPUN_108361"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64333.1"
FT                   /db_xref="UniParc:UPI000199B801"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H4"
FT                   /transl_table=1
FT                   /translation="MRERKQVNYDERAFDRKLAEAIEERPTRHARFERRDYEGSHDIRT
FT                   RKPVNYDEDASNRELDEAIEEGTTEEGTNPRVRDPDASKDASEESAGAGGEEDDGLGTD
FT                   SSEDEETYWQRWERNRAASAQKALARQTGVRIESPAPSPIKLSGTKAAETHPVEIAASP
FT                   QSPASRLKMSRKAAVLSQSSESSDENDDDDDESDYEEELGIVVAGGGRRKRRRRHVSIS
FT                   ILTDRSDSPAWRRVLASSAKLDEEEDEDEEEIEEEEEEPTPEEEEEEESEERKREERRE
FT                   RDAEEERKRREKAAADKARLDKLAWEAEEEAPEEADKVFRLDPYSDITPKQLFCKVVRR
FT                   NILLAYPRLSAETANVLLSNLWSKTLNGDERRTFARLVAEAKEREMDRLGREKRNRGKE
FT                   TAAAFEADEEDEDEEDGTDDDDDYEGSD"
FT   CDS_pept        join(32641..32906,32947..33211)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636251"
FT                   /orf_name="MICPUN_59014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63983.1"
FT                   /db_xref="UniParc:UPI000199B802"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H5"
FT                   /transl_table=1
FT                   /translation="MIVALDGYHRLPRIRHVIADQSQVSSVFNLEYMSIELKQRLPKFL
FT                   FVLMKDIRRRHIADSRVCGIRFRVCGIPLPSIIFHLLHLPSSIFLWCSSSSSSAVRSIT
FT                   SGTFLVEGFSTTSSAPISTCSNFARSAFSVSALRLMNARQLAWMRSAAAFSTFFRSNLF
FT                   ASALPRNHARTLV"
FT   CDS_pept        join(complement(33414..34938),complement(33341..33375))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636252"
FT                   /orf_name="MICPUN_59015"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64334.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199B803"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H6"
FT                   /transl_table=1
FT                   /translation="MGKMGTMETIVLDSDSGDDEAGVRDSDDDDDFRVVPARPALPESL
FT                   KDVDGFGEDPESPSKNDGGSTKKEEDGEDAKNEDVENEDAKDEDAKDEDAKDEDAKNEP
FT                   HAEDFDSDEDEDDVPVEKIAARREARAAKLDPELLLREAAPEVVAPEIAALREHWQLAV
FT                   VLDFFSVFREEFLDRPFDAADLESALVDPCADPTLWGFIVSLQVELLNGCGFRVEHGEL
FT                   FRRRKRRHADKDQGLMIRDNSWAWVTNRVICEWWRTLTGKRSSEASKPPFAPPTRRRGV
FT                   EGEDKAPRNKSKPFNAFAKAERSTIKAEHPHIAKKEVDLRLAVRWRRLSDDERREYDPS
FT                   YDPESVDENEFTERWYADEMTPSQRLMTLWGLCELRLMIGLDHLGPHDVGYEAGWKEPP
FT                   GKFRPTPIGTDAEGNEYWLRTDTLYRSGEPTYRSTDSVDVPLPVEPPPYYNKDSGTWKD
FT                   QDEEDYTQLPCMQCGRMQYDEREIEHKFLLCDVCVNGGHARCMGVSVIPGGAHKGRKGG
FT                   GG"
FT   CDS_pept        36306..37208
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636253"
FT                   /orf_name="MICPUN_108362"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO63984.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199B804"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H7"
FT                   /transl_table=1
FT                   /translation="MLAANVATTPARLSARRGSVVGNRCASLTAARVPVLTRAPRSRAL
FT                   IVQSSNDWPAPALVQGPPGLDRQVAQHQGGGSLERERMEIMEKAAKLANINPNDPKSLE
FT                   AIGSKVQCRVQFRIGYQTQVGEDLFIVGSHKKMGEWNQHHALPMQWSDGGNWFTDLELP
FT                   AGGVVFYKYVVKQANGAYRWQEGANNLLVLPDEWDIPRDSMFVVDDNFSGLSRSSQNML
FT                   ASKVISYEKEIVQLRLETVKAKEMTKASLKELLLTREELEEANSKLDHYERNVATVIAS
FT                   MQHQQDEANSGARYGENAR"
FT   CDS_pept        37416..38153
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636254"
FT                   /orf_name="MICPUN_59017"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63985.1"
FT                   /db_xref="UniParc:UPI000199B805"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H8"
FT                   /transl_table=1
FT                   /translation="MPSRLKKGFFERAGERQERLIRRYEEHMAKAARCGDCGKLREAAP
FT                   DLWAFDDINDPDWYARELAEEEADRTRRREAGEEVSDDEDVVCPGCEAEKRGEKGVPHV
FT                   GDDFNVPPNKPEEKAANRFDFNKMEQNLRPELKEPLEQLMRDLQIIREQQQLIREDEEK
FT                   EIEEEQKDWPEDKRAAWRAELQEYRDKHMAIAFGDDTEGREPIVHPTTGETIHVADLDG
FT                   IGQFLKKMYSEEVPEPFRWPKYM"
FT   CDS_pept        join(complement(38886..38899),complement(38298..38697))
FT                   /codon_start=1
FT                   /gene_family="HOG000265590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636255"
FT                   /orf_name="MICPUN_59018"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64335.1"
FT                   /db_xref="HOGENOM:HBG561477"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="UniParc:UPI000199B806"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7H9"
FT                   /transl_table=1
FT                   /translation="MPTLRVHITCCNIKKLDTKFYNLEKPRCWVTVKLGEQTHTTQVGI
FT                   GLDPTWEEDVEFEVTNPEEQKVEGTFYIKCEKNGNEQQLGDMQTFALNKLLLNKQTFKG
FT                   LVVPGGKADMMFTALDFGDEQAEEEDDAFMDFL"
FT   CDS_pept        join(39294..39296,39720..39836,40031..40171)
FT                   /codon_start=1
FT                   /gene_family="HOG000224977" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636256"
FT                   /orf_name="MICPUN_108364"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO63986.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG392194"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000199B807"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I0"
FT                   /transl_table=1
FT                   /translation="MVLAQDIDLLHPPAALEARRHKLKRLVQSPNSFFMDVKCQGCFNI
FT                   TTVFSHSQTVVLCGSCSAVLCQPTGGKARLTEGCSFRRKGD"
FT   CDS_pept        join(complement(41496..41594),complement(40514..41416))
FT                   /codon_start=1
FT                   /gene_family="HOG000170162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636257"
FT                   /orf_name="MICPUN_90920"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64336.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG610285"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199B808"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I1"
FT                   /transl_table=1
FT                   /translation="MARQLTAWQQGMKAYFYVTIWMTISMGVILFNKYILAYSGFKYPI
FT                   ALTLWHMVFCTSVATIMVRVVGATKSLNMPKKEYVNRVIPIGALYAASLWLSNSAYLHL
FT                   SVSFIQMTKALMPGLVYVCGVAFGMEKLTRTTSFNMFIIAIGVAIAAYGEINFIYIGVV
FT                   EQLSALVFEALRLMLVQVLITRQGYAMNPIQSLYYVSPACAACLALPFIAVELPEILAD
FT                   VHLEIDYGMLLLNALTAFALNLAVFLLIGKTSALTMNIAGVIKDWMLIFASQHMFGNTV
FT                   TFLNYLGYVIAFLAVGMYNYNKLKAAKRKEAAAKAEAAAKGGGISAAENGSK"
FT   CDS_pept        join(<44151..44395,44762..>44954)
FT                   /codon_start=1
FT                   /gene_family="HOG000200820" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636258"
FT                   /orf_name="MICPUN_76780"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO63987.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B809"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I2"
FT                   /transl_table=1
FT                   /translation="DKTRRVKAAFDAFDADGSGELEVDELREVMAHLGLELTKGEFDHY
FT                   VAALMQDYDVDNSGSLDFWEFEKFYEQCLASDDLRAAVHAAFKKFDTDKSGSLEIPELY
FT                   NVLKEIGVDLDRDTFDEYADALMEDYDEDDSGTLDFREFHKF"
FT   CDS_pept        complement(46352..47749)
FT                   /codon_start=1
FT                   /gene_family="HOG000100072" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636259"
FT                   /orf_name="MICPUN_59022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64337.1"
FT                   /db_xref="HOGENOM:HBG561493"
FT                   /db_xref="UniParc:UPI000199B80A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I3"
FT                   /transl_table=1
FT                   /translation="MSALGAFAPAPTATLGARSRVSRRGALGTNNAKTIGIRQPAVRIP
FT                   GPRAQAVSTAVELLPPAIANPDSCSRANEFTVRKGAVPYKDEAVDCDIFVNDGAREAIR
FT                   ANGAERFVHLIEPNNPKLLKLLKIMEDGWDRIGVRAKNAGHHSLWPEAFEAGKALLEEA
FT                   FPEECDPAYGGEVLAGVAFVGDDMKDRAIDFMQRRPKTDFTMSKYNPLGRLHRDPDAID
FT                   YKQPGWMEAAMPGSGAPGDEDGYSYRYYNVWLARTPLDPSGQVWENPLCLLLPKDKGER
FT                   EWTYEIRTPEDNEGVTEETLGEKAGRIAKNPLSAAPIIMKAFSFKKQRKEDQFEFQDEN
FT                   YMKRGSPELVPDDTHVWVTHPFVCFDSFDMWHGAAKWSSDSAKSDVKAELCNGAKDVMR
FT                   ARRDASKGRVSMELRFRARCKPAGVRGGREGVPFSPLSSAYRGGAFKPDTVRPSNGAYD
FT                   LEKGTTK"
FT   CDS_pept        48025..48750
FT                   /codon_start=1
FT                   /gene_family="HOG000264357" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636260"
FT                   /orf_name="MICPUN_59023"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO63988.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG662214"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR013208"
FT                   /db_xref="UniParc:UPI000199B8D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I4"
FT                   /transl_table=1
FT                   /translation="MRAPPVSALPLLLLLVVALSARGVDAFSFSSLRVPTPRRRPVPNP
FT                   ACKTVNTVEGLDLRAYATHPWYVQEQQVVRYQPLDNFYCVRARYTVDDAGDEVEVLNSA
FT                   RRGGVDGDDTNARGTRLRAVLEDKDASTSKLLVGPAFLPRFTYGPYWIVAVSPDAPDPE
FT                   LGYEWAIVSGGAPTRLTDPENGLCSTGEDMNDSGLWLFTREPTVGADVVERMRATARDA
FT                   GFDTSVLKPVTQEGCEYPE"
FT   CDS_pept        join(complement(49700..49936),complement(49339..49563))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636261"
FT                   /orf_name="MICPUN_59024"
FT                   /product="Predicted protein"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64338.1"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniParc:UPI000199B8D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I5"
FT                   /transl_table=1
FT                   /translation="MAAITFTANVAKGRVAPAVRGRVRARGARGAIFATANEGTRAVAT
FT                   LPETGVKRVGAVVGSVAAATAAEPAFAAAHEVAEVAANGVLENLRLFIAIASIALILFQ
FT                   GPKGDGVVNSLNERRVFGSAAETKSAVDYVTAGLIGSFIALSAVLAATQ"
FT   CDS_pept        50134..52059
FT                   /codon_start=1
FT                   /gene_family="HOG000265449" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636262"
FT                   /orf_name="MICPUN_59025"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO63989.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG561510"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="UniParc:UPI000199B8D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I6"
FT                   /transl_table=1
FT                   /translation="MSDDDLDRFNDSDSEPERAAAEPTASRKAKGTGSNANNSSPAAAH
FT                   AGGGGKAAQRRAKKTAAKRARLERRRQERERFPRDRNDGSGSGEDDGSDLDDGTAAAPA
FT                   PKSSNAARVHHGVLNVEGVVVDGKLILLDAKSGAVYSATRRAPDGSHLRVGTWNPETRA
FT                   VTRLTKEEMEAQLNPPTPDGKRRKGRDGGDGGDEESAPGDLDGDDESAPGDGDGDGGDG
FT                   GDGTSLSARMEKPPDEVSHAFQVDADDHCETSPEAHAHILNFLNKTASALGKTPKTLVI
FT                   YDPYYCAGGTKRSFAALGFPNVINENKDFYAVCQRGEVPEHDVLVTNPPYSADHVERCI
FT                   TFAAKNLYEHGRPYFLLLPSYCVNKPYYTSALLTGGAAGKKARAAREEAEGGTKTKEED
FT                   GRDKKSGDEPRRDENEQQQEEEEEKTEEEEEEEEDGEGFKVHDGGKSRTKKIATRDGGS
FT                   RRQTLPFYVAPVKRYYYWTPKPLIAARKAQQGVELGGKTRRKKSHVGRLGERTSPFLSF
FT                   WYCGMGDDLQPEALRWHRKLPRAAVGGYTVARNPNDLPMHVLDEWDPRRRAAVERAKEA
FT                   GDDGAKPKRYAGFSGHNCGQNMDAKHKKKYKEFDNATGGNRRDNWSGGKLGDGGMFKRP
FT                   AKKRKY"
FT   CDS_pept        complement(52148..53005)
FT                   /codon_start=1
FT                   /gene_family="HOG000195569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636263"
FT                   /gene_name="PPASE"
FT                   /orf_name="MICPUN_104824"
FT                   /product="Pyrophosphatase chloroplast "
FT                   /function="inorganic diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="phosphate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64339.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006796"
FT                   /db_xref="HOGENOM:HBG434750"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniParc:UPI000199B8D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I7"
FT                   /transl_table=1
FT                   /translation="MVLSALVSMVAPAARLAPSRVAPQRVAQALRAPAFRPRVAFHAAR
FT                   AVSAKYASEKKGDYPSMDFRIFFSEDGKPVSPWHNVPLHNADGTVNFICEIPKETKAKM
FT                   EVATDEELTPIKQDTKKGKLRDYPYNINWNYGMLPQTWEDPGHEHPEMKVMGDNDPVDV
FT                   VEIGSAALEMGSVTPVKPVGVYAMIDDGELDWKVIAISAADPKAKDINDVEDVEKHFPG
FT                   ELEKIRVWFRDYKTPDGKPQNKFGLDDKCMNKEYTMGVIEETSKFYQDLLSGKTENKKG
FT                   LSLK"
FT   CDS_pept        53389..54360
FT                   /codon_start=1
FT                   /gene_family="HOG000232636" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636264"
FT                   /orf_name="MICPUN_108367"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63990.1"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniParc:UPI000199B8D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I8"
FT                   /transl_table=1
FT                   /translation="MSAVVVLNPVLRSLPARGAASAARGPRASAARATLRGVAVRAPVV
FT                   FGSRPGSRGALVVRGDAIDDAAALATAGPSDKTGPAASVVVPKLPRSDCARTVAKSEGF
FT                   DLSTTSFGSIGLGVGLPLLMSGFLGYFNVIPTGSISSLLLIYGFIISLIGFALQYAKLE
FT                   PLECVTYEDAAALRESQTTAILTQVRNDVTRYRYGDEQHLEEALAIIFRYNRPGGLRKN
FT                   QAPKLVGIAEQVIVDRYALVLKFESPKMELGEWTDRREKIQGFFGPGVTCGITEVGAGV
FT                   VEVELVSDGSDASGPGNGMEDMEVLPPLMPGLPPRYVKKGSA"
FT   CDS_pept        54839..55528
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636265"
FT                   /orf_name="MICPUN_100820"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63991.1"
FT                   /db_xref="UniParc:UPI000199B8D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7I9"
FT                   /transl_table=1
FT                   /translation="MPLDGRVALTHRVCAEHGARRALFVGDGDDAAWARDALTTGLDPN
FT                   ARFDGDGDGDGAVRVLANGDATRGNLLDAMRWLAAGARSGDSMLMHVASRVSPPPIGGK
FT                   DIRATLLDALPRGAWAVLVLDVGNEWWGAEGCAGVPGVPYVAELGFGDDARRCVLAVDP
FT                   TDAVGGHEVTSAAARLAGGLRAFGGDDGGVVGPPMDAIARGGGGGGERRGKRDASKDGD
FT                   PACCAVS"
FT   CDS_pept        join(complement(56627..>56932),complement(<55645..56338))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636266"
FT                   /orf_name="MICPUN_75659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64340.1"
FT                   /db_xref="HOGENOM:HBG601308"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199B8D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J0"
FT                   /transl_table=1
FT                   /translation="LDLSYCGLKSLPAEIGQLSDLSTLRLTGNMLFTLPSEIGFLTSLK
FT                   ILKLNDNRLRSLPEEVGFLASLILLDLSGNQLTSLNAELARLKSLGYLHVGNNQLSSLT
FT                   SLPAEIGQLTSLTELYLDNNKLTDLPAEIVQLERLNRLNLDNNKLTTLPPEIGQFRDLG
FT                   ELTLSHNQLTTLPAEIGQIYTLGLLNLDNNQLTSLPLENWPATYLEKLHLSGNKLTTLP
FT                   AKIGQFKDLWLLDLSRNQLTTLPAEIGQLTSLQVLRLLVNKLTSLPAEIGQLASLRKLY
FT                   LSWNELTSLPAEIGQLTSLEMLDLQYNQLTSVPDEIGQLTSLELLGLGENQL"
FT   CDS_pept        complement(58494..59858)
FT                   /codon_start=1
FT                   /gene_family="HOG000230004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636267"
FT                   /orf_name="MICPUN_108368"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64341.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199B8D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J1"
FT                   /transl_table=1
FT                   /translation="MADQKPGHCSTLIYTSGTTGDPKAVMISHDNVTWVTRANIAHHPD
FT                   FVNGPLRVVSYLPLSHIAAQIVDIHSPMAYLADHGLPSEVHFARPDALKGTIKDSLIKA
FT                   KPTVFFAVPRVWEKFAEALQAVGKKTTGLKKTISTWAKGQGKQIHAASQYKSKKSHPWM
FT                   GFLAKKILTKVKAAIGLDCARLCISGAAPISKQTLDYFGTLNIHIVEVYGMSENTGPQT
FT                   CGMNKKFIAGTCGPVIPGAEIKIDLAKGDKPGNGEVCFRGRHVMMGYMHNQAKTNETID
FT                   EDGWLRSGDVGMIDPDTDMLAITGRIKELIITAGGENIAPVPVEDKLKELLPGISNAMM
FT                   IGDKRKYNTVLITLRQVPDPNEDGAFTDALFGNSLEVSKAKTVTEAKADPKWKEYIEAG
FT                   IAGYNKTAVSNAQKLQKFYILDTDFSVPGGELTATQKLKRNVVVEKYAKEIESMY"
FT   CDS_pept        61670..62224
FT                   /codon_start=1
FT                   /gene_family="HOG000265589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636268"
FT                   /orf_name="MICPUN_108369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63992.1"
FT                   /db_xref="InterPro:IPR002395"
FT                   /db_xref="UniParc:UPI000199B8D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J2"
FT                   /transl_table=1
FT                   /translation="MATSFSGAAIKIADVPGNMCCVDIRGGVSAVAITLELNGAVAATY
FT                   VLRPNVTADAADDARVVMHDKPPVAPEDAPAHVHMHGGVPCTADHGEDGEHGHGHSHKH
FT                   GHSHDGGKTECHEDHGHSHKHGHSHDGGKTECHEDHGHGHGHGEKKEEHGHGHGHGHGH
FT                   GEKKEEHGHGHGHGHGHGHGH"
FT   CDS_pept        join(complement(64580..66301),complement(64004..64444),
FT                   complement(62333..63889))
FT                   /codon_start=1
FT                   /gene_family="HOG000043949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636269"
FT                   /orf_name="MICPUN_94381"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64342.1"
FT                   /db_xref="HOGENOM:HBG445142"
FT                   /db_xref="UniParc:UPI000199B8DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J3"
FT                   /transl_table=1
FT                   /translation="MCVSHEPIHPSKHPRDARPRPRPPGVPISVQTRKTRSPPLLPPPD
FT                   SLPTPHPSRPSPQRGIEHPGDIAEAASLSSIALPPLTYPLFDTLGDDIVATGKLSKLQL
FT                   EGVAYACQKHCELLPDGARAGFMIGDGAGVGKGRQISGIILDNYSRGRRRHLWISSSVD
FT                   LHRDAERDLRDLGCYLKVINGCQELDREGKRAFGLPKDFREGVLFLTYATLVSRNQRGS
FT                   RLEQILEWFGGEHADGCVLLDECHKAKNFDAGAETGSKVAACVIELQRRCPDARVVYCS
FT                   ATGISEIGNMAYMQRLGFWGEGTPFGDADSFIKAMKNRGVGFLEMLAMEMKASGKYVSR
FT                   GLSFRQAEFASVEATLTEKQTRVYNEAAAFMSSLRACLAQALTETRTSSNRGQAWKAYW
FT                   STHQRFFKLLCVSMKVPSVVEQCRRALREGKCAVIGLQTTGEAAEASLEMSPGMRVDAF
FT                   VSTTREMLLGFIRTHFPVYIEDVAAASDANGGHPDGQSLLNPGLNPGTPLGPLREHPDC
FT                   VEARRILLEQADRLDLPPNFLDELIDQLGGPRRVAEMTGRRGRIVRVSRNNFKKVEQVD
FT                   GVNLREKTAFQRGAKLVAIISDAASTGISLHARRDEPNQRRRVHVTIELPWSADKAIQQ
FT                   LGRTHRSNQSSGPIYLMTSTNLGGERRFAAAVARRLQSLGALTRGDRRAATGVDLSEGN
FT                   LDSPLGRRALKKMYDALVLDGTPLPPGAVSPGSGVVALHAELRALVCSLGVQVGLLAEG
FT                   LSEENVAALIETGGGTKDQGDVRRFLNRILGLSVRGQNLLFGYFTEVFEAEVKAAKAEG
FT                   KYSEGVSDLSGSNIHIAYTKTVLKDPMGSGAELRHSRVLIDRGVSFDKAKEILDAQRRL
FT                   PKDGFYRMRREMYGRTQVILALAKPGARNTFSIYRPNTGASFFEMDVEELDTKYRKYED
FT                   RDEELARHPWAQTYELTERGCMHGASCAVSRDGTGRECTAGSRQVRCCILSGAVVPAWG
FT                   ALEHTLERHEHRFNKSDRGMRAVKVIAEDGTKVVGIRYPEDLLPEVRERIVRDWFRNQE
FT                   RAEEKARVDRERKASAQLAAASGGAGGEGDAVLGGGGLLSPGASRVRVEAPTEVDPRCA
FT                   ARATREPKTMMHFFQKRDDDGGGERTQTRGDAPETRKRPAAAPASVPAGKPRVRGSSTQ
FT                   PTIAFATTGSQLASRPGGRVSNGGANTSKAQSTGPGPGVERQRCPICDLAFPGTWLNGD
FT                   VNAHIDECIANTVL"
FT   CDS_pept        join(complement(68185..68245),complement(67922..68008),
FT                   complement(66871..67553))
FT                   /codon_start=1
FT                   /gene_family="HOG000248767" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636270"
FT                   /orf_name="MICPUN_59033"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64343.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG545479"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR015498"
FT                   /db_xref="UniParc:UPI000199B8DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J4"
FT                   /transl_table=1
FT                   /translation="MPFSQRERMGIYSVKIHYLSEAMASVAFNMSARAAVGGAQLKLSA
FT                   QRKRVARAPLRVDALAAQVSKVSFDGASAGTATLDVKVAKPDVAKGLVHKYVVMVRQNA
FT                   RRGTASTLTKSEVRGGGRKPFKQKGTGNARAGSSRTPLKPGGGVVFGPKPKDWSIKMNK
FT                   KERRLAMATAIQSAAAASSMIVVDSLAGAAPKTKAMATALKSWGVAEGEKAYIITKDAP
FT                   EGVTLSTRNMARVVQTDIKHLNVYDVLNADKVVVEESALQYINDFYGESGAAWA"
FT   CDS_pept        68332..69216
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636271"
FT                   /orf_name="MICPUN_59034"
FT                   /product="Inhibitor of growth protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO63993.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG716496"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B8DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J5"
FT                   /transl_table=1
FT                   /translation="MPRAAHQSFGVVSTALNDTTGTTLDPLSPAVSAPFPPGFTPPPAS
FT                   LTDESLTVARLPRPSRAGFAAPLVSHLRRIRDLDAKSTAVVDGVKRKVEERLEATRSGE
FT                   GDPSCKRTRASGDASSSGASAPSANEREVRDACTDALALADEKVALAQAAYDLIDAHIT
FT                   RLDRDLRTFDQALLEREAAEAAAAGIKPSTPGGGTGGGGVKTENVGGAPSAPSAPPVDP
FT                   NEPRYCVCQRVSFGAMIACDNDNCDMEWFHYSCVGLSTEAKFKGNWYCPACTAERRRLK
FT                   KLEAKEAAAAAKK"
FT   CDS_pept        join(complement(71072..71155),complement(69455..70943),
FT                   complement(69305..69399))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636272"
FT                   /orf_name="MICPUN_59035"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64344.1"
FT                   /db_xref="UniParc:UPI000199B8DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J6"
FT                   /transl_table=1
FT                   /translation="MEAPLEKQGSMRVYNSHLMDSLLKDEDEAFDDRFNDAHRSPMALD
FT                   GSDDDDDDDDDDDEDPAFGSIRRARRVADSPHEPAVLTPTKAPTPKRRDGFGGIRGQSS
FT                   EDEDSSDDDDDDDDDSESGGPAEDSDSGSEGEIDPNGKPLTRHELREMIRKENDKRQYF
FT                   VSEEFKREVFRKKVEKEHAAHERFEKMLGSVMEGIDGGGLVADTNEKVYRREVAHDKKT
FT                   KAIHAEWEREIFAKISEQIKAQVDKIDARDLNTRLVNADETYRSTVNRKMSYHPKAGLF
FT                   LDTILGHDYDPFEHQPEWFKYHVDALRDPMKRDLHKSIKEDLAAGLITLEKARILAKLE
FT                   AKLRDTAAPASAIWSNGDYTMYGRYTDADGEELPPDAPIPGFFRQGQHLWNRHDVERNK
FT                   QDHFDFPVGNEHAEAEWRRTAAHRRAGVADHNAGGLRDMGKLLGLAGVVEHGPGADTGT
FT                   DRWLEKSRKKQWDASRGLPGHDRRNLNDVMQQKKGGGRGFDGTDAWLARKGKHCFQELP
FT                   IQKSNRKRSGTSGWTPSSRTRCGTGGTADIPTAISTAS"
FT   CDS_pept        71280..72629
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636273"
FT                   /orf_name="MICPUN_59036"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63994.1"
FT                   /db_xref="UniParc:UPI000199B8DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J7"
FT                   /transl_table=1
FT                   /translation="MEDGGPFSIAEWAAQATPAPKLEPKDDAPASKVELIDLTDDVDSP
FT                   RRDGSNATTEGGRVDDGATTDGLRRVAAAAPSTAGETSVDAALADLVKFAKLYAPRARV
FT                   PDPNSERFASARRAASRADKVRHPTPVSGDAWGAKLPVTNPADGVVVPGAFEGKAFAPG
FT                   QTPVVTAVFTAATKPRGVLGAYDVVAIEGASPRAGFEPGHETDGEDDVSTDRHRTAINP
FT                   LANGVDLRDSRCSHRQLCALAAESVSTRLMTHPTPASPTAFGGPLPERARAMIPLVRAM
FT                   LPGDATTDASILTARASDDHRRQAQVAARMEKRFGTGAFTKDARGRVTIRGGRGRGGRG
FT                   RGRGRLRMAPAADVAEGGGRDRKRRRETAAGGVGGGGEGDDAELIPNPVVDLTLSDGED
FT                   EDAEDDDGDGDELGDEDEDEDDFIDDEDDDEENEGDFDDGDDDDYSDVNF"
FT   CDS_pept        72742..73437
FT                   /codon_start=1
FT                   /gene_family="HOG000012751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636274"
FT                   /orf_name="MICPUN_59037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63995.1"
FT                   /db_xref="InterPro:IPR004877"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="UniParc:UPI000199B8DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J8"
FT                   /transl_table=1
FT                   /translation="MGDEPADALAALWPRSLADLAVVGACAFFGFTVPIALFDSTVLFT
FT                   YHPTCMSLGFGLLMTLGVGAGLKLRALGPGAERVRALWVHAATQTLALFLALGGFVAIY
FT                   RNKAIHDKPHFTTTHGKLGLLTIVLTVLSPTIGAVAFKRLGLLDAVPEQARPLVKAVHR
FT                   RLGLVTWCAGALATSLALPHPAVDQGSLTSAWQVSVFVMCAGVAFWHFTEPKGARGDGF
FT                   ARLDKDSQS"
FT   CDS_pept        join(complement(74433..74722),complement(73514..74333))
FT                   /codon_start=1
FT                   /gene_family="HOG000240556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636275"
FT                   /orf_name="MICPUN_59038"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO64345.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG286166"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199AD83"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7J9"
FT                   /transl_table=1
FT                   /translation="MQTRVSVPRAPAVISRVGAQHERILRQQAARTVKSASASPAASSI
FT                   TTKRGTVVCRASSSSPGPIRSLFNLEDIAKPFISAKDTLNEGIASFYDESSGLWEDVWG
FT                   EHMHHGYYPGGAPRDDHVQAQVDMIERSLEWAGLDATTAEDGVDRILDVGCGIGGSSRH
FT                   MARMWPGCVTRGITLSPVQAKRANELAAEQGLGDRSTFQVADALNQPFDDSSFDLVWSM
FT                   ESGEHMPDKGKFVNELARVCAPGGRILIVTWCHRILREGEKTLPDDELQLLDRICEGYY
FT                   LPRWCSVAEYARLCADEGLVDVRTADWSEQVSPFWRAVIRTALTWRGFVGLLRAGPATV
FT                   RGGLVMPLMHQGLRRGTIRFNLITATKPR"
FT   CDS_pept        join(74945..75112,75360..75452)
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636276"
FT                   /orf_name="MICPUN_59039"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63996.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199AD84"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K0"
FT                   /transl_table=1
FT                   /translation="MSDDAAPDTGAAKTPADFLKSIRGKPVVVKLNSGVDYRGILACLD
FT                   GYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTAKDK"
FT   CDS_pept        join(75695..75947,76061..79398)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636277"
FT                   /orf_name="MICPUN_59040"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO63997.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AD85"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K1"
FT                   /transl_table=1
FT                   /translation="MASPAASLDADAVAAYLLDRRHLLSAFELYQDLISPGGAASTKAG
FT                   ERDVVRDGDADARAKLEAFFGDQKRFALSDVRAHAGAVDVPTLRATVREQESRIKLAEY
FT                   ERRCAEEDLARLREERETRAVPATPRRSQNADGDTAVVFEQIHEAPRDASTPSYAARDG
FT                   FLNRAECVDLANVVPIPPHSAPDDDGTPTAPPAVLPDITPGERRCLNLMTHQYLARRGY
FT                   RAAALAMRQEATAGQDLDDWSPLGGEPARGEALRLMLRRAKALETLDPAAFEKMRRERD
FT                   ERVRELGDVKTAKETLESQLAAATRDVDAVRRELAKVRAEYEAAATESERWRAKFDEAA
FT                   ATVRHVERAAERARREAGDSPGGDSPGGSMAPTTKGKGSSALESAAQEEATIQALLESL
FT                   PRVSPHTLVQHRTELLPLYARAATRARLRSERTAALAQMLSCVKRPGSEQRRAVAETCA
FT                   SIGAAMGEERCVDELMTSIAKNCEEHKAETRRLLGVECLRACAGVSRRIAGMVLEELTR
FT                   IATGEASATVRVAVVRAVAATLDADAGESPPGESPPGESPPEETLETPGDPNRRDRCDP
FT                   PSSIVGPCPAVADDALMSAALDSSDEVSNAAIEWLAPALARWRRRLHGAGVTNSAVPKF
FT                   AAALEDALGEIVRGGEDARWRVGTLSRALEALAIDGGDSSPGESSPGDEFAWVARCAAA
FT                   TARSEEGCVAAVARAVRAHCERAGGSVTAVIILPAILAATALKRRRDESAGLAVALAAA
FT                   APCAGEGAYERVVRELLCADPSTNDDDDDDRDGDDDDRYDDRYDDDAFARTSYAFEFAS
FT                   LFDGRHLAARTVAALRALIESSDRFGAPDESSDQSDALIESSDQSGAATSMRTTDLSPR
FT                   IIGRAVASVGACASGLDADAVLSEVVPILSAVIDRATGANDDATAVNIIRREALRGLCA
FT                   CAESHADDDSVVDAAHDALNRCVNESFADGPGPGGATDRETVEAVAEMLGRAGMKGFGR
FT                   HRARAAATLARVASREAAAAAAAGAGARGGLGGGGGGGGDFADVGAALFASIRAVLSGG
FT                   DDGDDGSALFETLAPALRRMLDAGDAMLDASDRALAEAMLRDGDGGVASPPGASLPGAS
FT                   LPGASLPGASPATPPSTSGKKKKRSMFSYAYGGVRKHALGLPSRDPEKRAAAAGAAVRV
FT                   AGGSVTAVTGWTEAGGSPAVPTVSIEQLLG"
FT   CDS_pept        complement(79515..80210)
FT                   /codon_start=1
FT                   /gene_family="HOG000248814" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636614"
FT                   /orf_name="MICPUN_59041"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64346.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG746222"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniParc:UPI000199AD86"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K2"
FT                   /transl_table=1
FT                   /translation="MACRRATQLAMRRALVLGRSEATSNAARGLATRAETRARSTAMAS
FT                   SGDWAGSLGRGRTEAPAAGSVYARGALRRGFAADAEASEDKKDDAREPSPRMVRLADDI
FT                   CGLTLLEVHDLTEILKKRLGLAAMPMMGMPMGGVPMGGAAAAGGAAAAAPEEAAAEKTE
FT                   FDVKLASFDAASKIKVIKEVRAITELGLKEAKDLVEGAPAVLKKGIKKEEAEAIKEKLA
FT                   KVGGVVTVE"
FT   CDS_pept        80461..81798
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636615"
FT                   /orf_name="MICPUN_59042"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO63998.1"
FT                   /db_xref="UniParc:UPI000199AD87"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K3"
FT                   /transl_table=1
FT                   /translation="MPTKASAAPAPPGAPAPTPYEEHHHYRFRHPDVKNTVKARQRSFR
FT                   AIQVERDNTHIQRRLNELRREPASRFHAPDGELSLVPKSQRTYGPRAAPRRRPEWDDGG
FT                   GRSSSTSLRDGERRKNRQNPSSPAGGKTQTKERRARHWPPPRFPRGVYAENTEVMRQNA
FT                   SLQRRLVNQYRASRDSQLVREGKGRPVDGLALWAKRLAVYDPHPPNRARTTDARTGKCV
FT                   STGVPKTLTVARCSATGLLTYFGADGHRLREHPDCPGLYYCEKWFDEFAEMDATMQRAV
FT                   IDYAIECRSKRPKERSWQPARAPGESWVVNRHMKLSLILMRRMARADLFENASTLNASN
FT                   VSGDDRYEDDFEDEGDAPVRSAAGTTRAGTPLTMDEIRRRVETCRLRERIDDEERRRER
FT                   REIEKLGRDEAVAAAAAAPRREEIAAEGRAEAEAEADATDADATGV"
FT   CDS_pept        complement(81878..83560)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636616"
FT                   /orf_name="MICPUN_59043"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64347.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199AD88"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K4"
FT                   /transl_table=1
FT                   /translation="MPPLMLVNSAKRVVPDAHDGEVSSVCVDGDHCVTAGWDGQLRFWA
FT                   KYDALPTRSFQLVQRAQAHEDAVKTVATIADKWIISAGLNGLCRVWTRSGEAAMHPSQI
FT                   PEPTPNEKPGDEKPNGEDRAPPPPKHPLPLDDLGDDNAEEVGLEMEELRLARTERKRVL
FT                   AQYDGPWKCVGAFDGGAGGCVNAVVGLHAPEDAGCVAKPPAIALAVGSHLGSMTHAVRI
FT                   LDPTRNWATIQVLEHPEGVTRLLRKVGCELDGSDRLVTGCLDGRIRVYARDPAEPDPRP
FT                   PPVEPVEGEDEASGAGAGAGTGEGGDEGGEEQTSTPEPEPEPEPWFPPYRLEATLHAHP
FT                   TVVDIQWLGKHPAFPPPQPPAPPAPPPKEGGQAGEGDEDADEPVEPPGPPEFWPGCDSH
FT                   LWLVSVGTDGGVKLWERRRVPTKPWGLPHWGYEPPPEPPKGEAKEYAWCRTPGPDGEIR
FT                   NAPLAPRIRIANDESSKIESLAKARLTCVRVWREHVTVGLGDGRMCTWGRRVRDESGVE
FT                   GWVLERITPAPADNIRCGAVTGMYECGHNLLVTHADGQARVYA"
FT   CDS_pept        join(complement(84522..84596),complement(83807..84379))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636617"
FT                   /orf_name="MICPUN_59044"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64348.1"
FT                   /db_xref="UniParc:UPI000199AD89"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K5"
FT                   /transl_table=1
FT                   /translation="MSPATTRSTPAEPTAEVVVVVVEEPIESTAEAPADAEAPVAEPTV
FT                   AEAPAHNDAVAAAETPGDEGDERPGSGDVVVKRGDENTPPTNVDAADVAIAPAEPPADG
FT                   VTGAAADAAEADEADEAPTKVDSCVDSCVASCVAASAAEETPPLAVEPAPPVEPVDADE
FT                   AKNDAGEEEDAGVVAAKRKNGPDADNTAVEPASKAAKTAAAAADTAAEATAA"
FT   CDS_pept        join(85085..85238,85513..85847)
FT                   /codon_start=1
FT                   /gene_family="HOG000265597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636618"
FT                   /orf_name="MICPUN_54290"
FT                   /product="Ferredoxin thioredoxin reductase "
FT                   /function="ferredoxin reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO63999.1"
FT                   /db_xref="GO:0008937"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG438670"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="UniParc:UPI000199AD8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K6"
FT                   /transl_table=1
FT                   /translation="MSAWTVSAAAPVAGARHLAAKGRVAPTRVATSAARVAPAPTRGAT
FT                   LRVSAEASEKNLEVMRKFSEQYAKGSGTYFCMDKSVTAVVIQGLAEHKDTLGSPLCPCR
FT                   HYDDKEAEVASGFWNCPCVPMRERKECHCMLFLTEDNDFVGDEQTITMEEVVELSEGM"
FT   CDS_pept        join(complement(87690..87749),complement(86256..87329))
FT                   /codon_start=1
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636619"
FT                   /gene_name="ACTIN"
FT                   /orf_name="MICPUN_90942"
FT                   /product="Putative uncharacterized protein ACTIN "
FT                   /function="ATP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="ACO64349.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI000199AD8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K7"
FT                   /transl_table=1
FT                   /translation="MADEGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGV
FT                   MVGMGQKDAYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
FT                   VLLTEAPLNPKANREKMCQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDCGDGVSH
FT                   TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDIKEKLAYVA
FT                   LDFENEMQVANGSSSLEKSYELPDGQVITIADERFRCPEVLFNPAIIGMEAVGIHETTY
FT                   NSIMKCDVDIRKDLYSNIVLSGGTTMFPGVADRMSKEITALAPSSMKIKVVAPPERKYS
FT                   VWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF"
FT   CDS_pept        91194..92486
FT                   /codon_start=1
FT                   /gene_family="HOG000239525" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636620"
FT                   /gene_name="AMY4"
FT                   /orf_name="MICPUN_96388"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64000.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG318585"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199AD8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K8"
FT                   /transl_table=1
FT                   /translation="MGEGAEIMLQGFNWESCNSGVKWHNVIANEARSIRDAGFTAVWLP
FT                   PPTKSVSDQGYLPSDLYNLNSFYGSEGELRGCIRALKDVGVCPVADIVINHRCAEAQSS
FT                   DGRWNIFTGRMAWDQRAITTDNPEYGGQGNGGTGEDYGPAPNIDHTQDWVRNDIKEWLH
FT                   WMKNDIGFGGWRFDFVKGYAGHFTGEYVGDTMPYVSVGEHWVSCNYNHSHLEYNQDSHR
FT                   QSTYDWCNSTGGNTAAFDFTTKGILQEAVRNREYWRLSDSQGNPAGFCGSWPTHAVTFL
FT                   ENHDTGSTLQHWPFPTERLPEGYAYILTHPGTPTVFYDHWKDHALQEDIQRLIDIRRRV
FT                   GLKCNAAVQIQKAEDGCYAAHVGHPAVGVERGACKEIDMSKPSLCMKLGPADWSPNQGR
FT                   VGDTKWKVMASGDGWAVWENVRFLSAEQRSR"
FT   CDS_pept        join(complement(93867..93929),complement(92905..93537))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636621"
FT                   /gene_name="LHCP2.2"
FT                   /gene_synonym="LHCP2.1"
FT                   /gene_synonym="LHCP2.3"
FT                   /orf_name="MICPUN_96389"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64350.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199AD8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K9"
FT                   /transl_table=1
FT                   /translation="MACIASSFTGSVAALKATKIQAKSVSKVIKADIYPEFGTYPGGGE
FT                   SPIIPFGSEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADKF
FT                   PGAVAPLAPEGSGYPSFWAVLAIEVVLVGLAEAYRTGLSDPVFDELTVGDVSPGGRFDP
FT                   LGLAESGDLEELKIKELKHCRLSMFAWLGCIFQGLATQEGPIANWQAHVADPVHANVLT
FT                   NAASGFGFY"
FT   CDS_pept        join(94511..94573,94717..95349)
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636622"
FT                   /gene_name="LHCP2.2"
FT                   /gene_synonym="LHCP2.1"
FT                   /gene_synonym="LHCP2.3"
FT                   /orf_name="MICPUN_96389"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64001.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199AD8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K9"
FT                   /transl_table=1
FT                   /translation="MACIASSFTGSVAALKATKIQAKSVSKVIKADIYPEFGTYPGGGE
FT                   SPIIPFGSEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADKF
FT                   PGAVAPLAPEGSGYPSFWAVLAIEVVLVGLAEAYRTGLSDPVFDELTVGDVSPGGRFDP
FT                   LGLAESGDLEELKIKELKHCRLSMFAWLGCIFQGLATQEGPIANWQAHVADPVHANVLT
FT                   NAASGFGFY"
FT   CDS_pept        95724..97628
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636623"
FT                   /orf_name="MICPUN_59050"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64002.1"
FT                   /db_xref="UniParc:UPI000199AD8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L1"
FT                   /transl_table=1
FT                   /translation="MRASRDDERWTSVPLLDSDDGAAAARRHARGRTGRWVAAGAAVGA
FT                   IALVLVAALALTDPARRRGVATSDAAPKPATRANAAHAATLGRTSSSDANDDGRAGHLA
FT                   ARRRRSPRDAPLSAARVVPGVGSGVGENEMVTLVDLDDLDEETGEKSEAQRGWRKGDER
FT                   WLKPSTIEAHVHAADDELTNEFLDELPTRVPAHAIAEVKWAKFDETRDRVLPPADVGSY
FT                   AGEEIDWTVVREKKAAAAGAAAEGAKQNERIRLIVESERLAAEQARWSDSTYGSAAPSG
FT                   SFILAPICLAVVSSVVVIAVLLVRNRGPYGVDGKGGDDGGDMGGHVREDDRRVRGSEGE
FT                   SILGETDGGSKGSDRDVESGDVRLGGIIGEGGDANRRSMDGAESSSVADSHSFANYGAT
FT                   KNHHHHHHHHHHGGGRNSDAANLRGLMAGFGSRNTAMDRLIDDSRSDVAPSEAPSTVFE
FT                   INPPRWVARMFGAGGPRDSGNSAVGVEEAAVAAALERGNSSRGESVFSAADFSDAEAYA
FT                   YAMRLRSGTKSYPRGKPHSQPGHPHHANAPAADGTGRASAAGRAVATSAHASAFAAPPP
FT                   PHLQSRSAGGGGGGAAAAAAGGSGKPPRPFVGAAMAGAGRPVPPDRPPRIVKSTTRFL"
FT   CDS_pept        join(97836..98138,98187..99554)
FT                   /codon_start=1
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636624"
FT                   /orf_name="MICPUN_97483"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64003.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AD8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L2"
FT                   /transl_table=1
FT                   /translation="MSFRVFARRAIAATACAGVGAAAYPFVSAPFPRALQESSNASPRE
FT                   RLVVLGSGWGAVALLKNIDPTLYDVSVVSPRNFFLNTPLLPGVTVGTVEARSLIEPAAA
FT                   IAVDPVARTVRCKDESEVTAANPEFTLPYDKLVVAVGAPPNTFGTPGVREHAKFLKEVD
FT                   DAIDIRRKLADLFETASLPGVPEEEQRKMLSVLVVGGGPTGVEFAAELHDFLREDVPRL
FT                   YPALRDKISITVVQSADHILNTYDARISKYAEEKFKRDGIRILTNRRVTDVSQAHASVM
FT                   CKKTKKIEKIPFGVCVWSTGLGTAPLVRSIIAAAGQPPRRRAVSVDKYLQVRGLEPRGS
FT                   VLALGDCADVKSKAAAGGELLDKADELFKRADVDKNGTVDKDEFVNILKTLEESYPQIA
FT                   TLTKGAADGMLHDILSKFDEDGDGSLDRREFRRAMAEADSRLASHPATAQVANQQGEYL
FT                   ARELNAQGRARRAGVEDPAPTRPFEYVHLGSFATLGGEQAALDTSGSPLPGDFVSQGIG
FT                   TMVLWYGVYFSNCVSWRNKAMVVLDWTKKGVWGRDSSRV"
FT   CDS_pept        complement(<99713..>100096)
FT                   /codon_start=1
FT                   /gene_family="HOG000000067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636625"
FT                   /orf_name="MICPUN_72808"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64351.1"
FT                   /db_xref="HOGENOM:HBG656319"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniParc:UPI000199AD90"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L3"
FT                   /transl_table=1
FT                   /translation="WDVRVLYDGDCPLCVREVDFLRRKDAGRGKLDLVDIASARYDPSA
FT                   NRGIEFATAMSTIHGIEPNGDVITGVEVFERAYAAVGLGWVYAFAKVPALLAAANKAYD
FT                   FWAERRMEVTGRGSLTEVLELRRR"
FT   CDS_pept        complement(100389..101501)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636626"
FT                   /orf_name="MICPUN_54300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64352.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AE52"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L4"
FT                   /transl_table=1
FT                   /translation="MSAAAVSRVFTAPHVFIAHRATRRSPPRGPVRVHAAAGARHSGIV
FT                   GDDLVHGSSLTSTRDTPSHVPPASGAAAGGVPVAAGIAPEDLVHGSSLVATRYAPTKQP
FT                   SSSSSSTQGIAAQGSGKPVAYIAPTCPFAHKAWLALVEKEVDFEMRAVDLNDKQPDMIA
FT                   AYGVASPDAGSVAKVPILIHDGVAMIESALCATYVAEAFKSSGADLLPATPAEQYKVGL
FT                   WCETFAVGPPFFRALRATSQSDVDSALDDLRSVLRKCERCLEIAQTTTGRDKGQSDGPF
FT                   VLGAKYSMAEVLTSTMLPRLSVALGHYRGFRLHAAVEEMGLHRLARWMDASMDRPSMRQ
FT                   TLGEVGRVKGVDAGSAFIDHFAKFVSWKGE"
FT   CDS_pept        101975..103576
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636627"
FT                   /orf_name="MICPUN_104841"
FT                   /product="Cytosolic pyruvate kinase "
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO64004.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199AE53"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L5"
FT                   /transl_table=1
FT                   /translation="MNRLGALKSASGSHGSYVDLTKFEVQEKHVLENLSESNLQSLAAD
FT                   APANHKFKTRIVCTLGPVSRDVPKLEEMLRKGMNIARFNFSHGSHEYHQETLDNLRIAS
FT                   KNTGIRCGVLLDTKGPEIRTGMLDHGEPVFLEKDSEVKLTTDYATIGNKNLVAVSYPSL
FT                   ARDVAPGSQILCADGSITFTVLSCDVDNGTVQVRCENSAKLGERKNMNLPGVNVDLPTI
FT                   TEKDRDDIINWGVKNKVDFIAASFVRKGSDVEYIREVLGDAAKDIYIISKVENMEGLDN
FT                   FSDIVAKSDGVMVARGDLGMEIRMEQIFLAQKRMIKRCNEAGKFVITATQMLESMTGAP
FT                   RPTRAEATDVANAVLDGTDCVMLSGETAAGNYAVEAISVMADICQEAEAYVDNVATFKN
FT                   LMDHQTFPMGTVETVASSAVRSSHKVSASLIVCLAESGSTARLIAKYRPACRIVCLCIP
FT                   YRDGRAHDPESVARRLKANRGVITFVSKELLPTPGENLALCVELAKQAGLCQVGERVVG
FT                   VHDVDLSPVMKIMTVE"
FT   CDS_pept        complement(103703..106387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636628"
FT                   /orf_name="MICPUN_59055"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64353.1"
FT                   /db_xref="UniParc:UPI000199AE54"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L6"
FT                   /transl_table=1
FT                   /translation="MRSPPRSPGRLREEDAAAHAARVAEARAAYSRLSRAGGELNRELR
FT                   PAARKSAPATFANARGAPAEHEDALRGLDSLAVAAGRRAPPRKPPPSSPPGDISAGPHE
FT                   GWLGSVLARREEEEEDDDDDDDDDDVELTEEEVRAFREYRQTEELHARLGFALTDKALS
FT                   PMRGEAPERRKNPNPSSSSPNSTPGKKKKSSPAAEADRAARAARAVLADMAAANKSLMD
FT                   AAVASPDAFRLTHERTRRVMRDIGLAETDKAADEIIELTSASASIARQKKGGAEGGAEG
FT                   KGGGRDEGGEDEDEDGDPVWYDEDDPAWSMDVEAKLAAIAAAREEANVRRVRLERLMGD
FT                   AEARMGTRKPPGGTNVDEKIAALKKAAAAREREFEKLGIGGTRSGDGAARETAGETAGE
FT                   SRASFSRADADASIARLEKAVAEFKALGPLTPGPMTPQTKAEIEAEVTARLPKFPPGTP
FT                   PLPEFDYDPREVDELLTQLEAEEAERAAAKKKGEGEQKQQQHHHHQQEQQQQRSPISPR
FT                   SPSRGARPPLPPDVSAHRTALVLEALAEADLEVRDPEVEGSNPAWVDARDPATPNALKP
FT                   AEDDSIGKEHTRATDGATTDRTPLELERTDASPGDEAIDAKIAELRETMRGCAELIARH
FT                   ARDDPTKTKLVRDLAHVLNAASEKESRVETEQAKGGDETGEGDEPATSESLLESLPEWA
FT                   GQVPNAIRETRELIRDMEERVKATAARLHDSLTKPPRPFEISADGETGEGERDGQPALT
FT                   VEGMLKGLDRLNAERLDHRPFATALANAFDADSDAEDSPGLSPRWARNAHNAHNAVDDP
FT                   SPSEWDREAWERERAALRDRLRTELGLSDKFGEDEPPAPVPEMTWHKHAGSDGEEERFL
FT                   PEDETGKLKHVRDFQSLMDYAFD"
FT   CDS_pept        106508..107857
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636629"
FT                   /orf_name="MICPUN_108385"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64005.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199AE55"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L7"
FT                   /transl_table=1
FT                   /translation="MARLPSDGARAGDMDVELVDVSLAEAEVTDGAGVKRGGGGFARAR
FT                   MGDDAVSEDSDGEDEERGLLRGDAGDASTSAPHRSDPRPPPTGWRGYVARVPKGEAVML
FT                   AATFTFAFQNVVAKTVEKGVPPMQVVFVRSCISGCVTAFTTWRRAAECNAIVREADAET
FT                   TGGETRASASSGEDLRDSRFTIETLLGHRRFWRLCLLRGVAGSIAFSLAYVSLTYLTVG
FT                   DSVAIFFLNPIFSSLMAIPALGEKPSAVQAVAIGGGLVGTLLIVKPPALFHALGAPLND
FT                   DDRRRDRPMDPVGVAVTLFSAFFCAVAMVSIRAVRGRVSALALAVWFHGCSAALGFVSV
FT                   TSAWPLPPVWPTAHEWGLLILISLTSFVGQLSLNYGYSHLPTLTASALYYLMVAWSALL
FT                   GWAMMGERVDAYGALGAVAICVGGLAPGVHKARVERAARAKRAMNGADGG"
FT   CDS_pept        complement(107988..109601)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636630"
FT                   /orf_name="MICPUN_59057"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64354.1"
FT                   /db_xref="HOGENOM:HBG610791"
FT                   /db_xref="UniParc:UPI000199AE56"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L8"
FT                   /transl_table=1
FT                   /translation="MSGPAPASARRVAPAAPPRAFPSSRPRRAGPRAPRTRARVVPPNK
FT                   EWPPADVWEDFRKNVTGEWTGHAVALGPTGDIVPLPDEYVPSSFKEYGVGVNQWSTRAT
FT                   TAYDGDGGIDAVDSFSTTTRYLWPEAGCEFGKEDVAVTRGGDDRLMAGAQMGKMCVVDG
FT                   DYAHGPLVLPPCEHGSRVKFQFGFSQRTRPADETSSNGPIKLTLDKKDDMKGGDREPDP
FT                   KPARRIRVEVTVEAKPGEKRDWRLAKVELVSEARTDANGTVLGSNPRAPEHSPRLGEDD
FT                   IATGEWRAVQGATFLTCESLLDDEAFDLSFDDEPSRLSSQSSDDTSTSDGFDGQSSDDT
FT                   STSDDERMRVRVGSGKGRAGRGRVKKGKGGEKVGEEKGGGEDSRELVTPTVVKSAAELE
FT                   AERKERRRNRPPPQGLIVVPTWAVSAKGPFSSAYEYLVGGKSPLVLLPMRMWCLVESVG
FT                   RDELLVEVGVYAGPGGLDEDWHDLALTEGGGSEPRRVAARRYERGGRFASAFFVEESRM
FT                   TKAELEQEKGEGEGGNPLYF"
FT   CDS_pept        109768..111030
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636631"
FT                   /orf_name="MICPUN_108386"
FT                   /product="Predicted protein"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64006.1"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG561725"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniParc:UPI000199AE57"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7L9"
FT                   /transl_table=1
FT                   /translation="MTDDRGGALGPSLGAFHACYLVGSLDPARKGRSYVGFTVNPERRI
FT                   RQHNGVLAAGARYTRRLRPCEMVLLVHGFPSKVQALQFEWAWQKPALSRAVREAAARLK
FT                   VSDRSSSLVNKTRLVMAMLHVSPWNNLPLRVHFLNPEYAKLAKDKCDAPPEHVEVAVGD
FT                   MDALKRSVGGSFNDGKDLDDSDDDSDDDEDSRVVTIDGDSISEMPSISGAFASRRRCAA
FT                   CGGEGVRGAGARVACPRCDCVAHPRCMASHFFASCAQSSEKSGPGTPRRPTRTLIPRGG
FT                   PCPACGASLSWGAVVAAGRRTRTRPAPNRKEDNTAGTAGIINGTAGAKPPPPLPVDVDA
FT                   ACTRRAEARAAHAARVAAWADASLDASLDEDTAVNDDDDTAVDDSDVEEAYAAPLAERL
FT                   EAKWMRNGTGPRNVIKISVSP"
FT   CDS_pept        complement(<113041..>113652)
FT                   /codon_start=1
FT                   /gene_family="HOG000241207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636632"
FT                   /orf_name="MICPUN_72597"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO64355.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG630391"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199AE58"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M0"
FT                   /transl_table=1
FT                   /translation="YFLVHNIAKKHNVGTIARCATAFGVRSVVLIGAKSYNTFGCKGSS
FT                   NHVDFVHYPTLSDARVGLMERMGVTKILGVEICDGAVPIETHPFAQNTAFIAGNEGDGL
FT                   TKQQKAICDGFVYIRQHGVGTASLNVAVASALVMHHFALWAGYRERAREGEKYVVGERK
FT                   MRTSKRGVIGDDPDEVRRRRAAAREAAARDGDGDGDGDGDG"
FT   CDS_pept        join(114458..114631,114722..114957,115088..115221,
FT                   115287..115483,115583..116032,116090..116258,
FT                   116790..117067,117183..117496,117615..117701,
FT                   118278..118520,118606..118951,119093..119278)
FT                   /codon_start=1
FT                   /gene_family="HOG000259586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636633"
FT                   /gene_name="OGDH"
FT                   /orf_name="MICPUN_82522"
FT                   /product="Oxoglutarate dehydrogenase, E1 component "
FT                   /function="oxoglutarate dehydrogenase (succinyl-
FT                   transferring) activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO64007.1"
FT                   /db_xref="GO:0004591"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG289950"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniParc:UPI000199AE59"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M1"
FT                   /transl_table=1
FT                   /translation="MITAEDVELQSTRDTADVLRIYKVVRAIRNRGHFAARLDPLGRSL
FT                   GPLKEGYELMESTYLGLHDPSPEKRFFLGNECKSLDPDGRRQWWTVEELMTRLRAVYCG
FT                   TLSAEFNHLASVHKKDWLRRQLEGHVRDDGGVAQLTREDKRTVLRRLIKADALEGFLAR
FT                   NFPSAKRFGLEGAEALIPGLQSVVESAAAGGAEAVVVGMAHRGRLNVLNNVFGKPLGLI
FT                   ATEMRGESRSSFNVGDVRYHLGTRTTVTLKEQRRVEMSMAPNPSHLEAVNSVVAGMVRS
FT                   KQMRVDVPRGGRSRVSQRKVMGLLIHGDAAFCGLGVNAEVMQLQDLPDYTTGGTVHIVV
FT                   NNQIGFTTVPRRARSSPHPSDVAKGYGAPIFHVNGDDPEAVVRACRLAADFRAEWGQDV
FT                   VINLVCYRRLGHNEQDDPSITLPLLSERIKRQRKVSEIYADRLVADGVATRDEVNGMDD
FT                   VDDDIDALAKAEKDYGVRVGDSVRTAKALLSQLDDVARKARLEHMGLFPPDFIAHPHTR
FT                   KLLENRRKMVDGELGVDWGTAELLAFATLHCHVRLSGQDVERGTFNHRHSVLYCSRTSR
FT                   PVNPIDNMGLGDQDRFLVCNSPLSEHAVMGFEYGFSVDSGPAALVLWEAQFGDFANNAQ
FT                   GIVDQFVATGEAKWWGGLVLLLPHGYDGNGPDHSSARPERWLAAADRGRIDRADWERYM
FT                   RHRAKTHADSSCNFVLINPSTPANYFHALRRQANLPHVKPLVVLAPKYLLHHRPCASPL
FT                   RDFGPGSRFHAVIGDGDVGDNSVEPDAVTGARERPKASNVRRVVVCTGQVYYKLHQLRK
FT                   AKGADDVALVRLEQLSPFPHAALARRLARYPNAELVWCQEEPKNMGYWAFAQPRVNTAV
FT                   REILEKTNRRDEVRRVRYVGRPAAASPATGSPVIHAAETRALVHEALGLEHVGIHLAEP
FT                   RSSVPRY"
FT   CDS_pept        join(119516..119542,119689..119825,119924..120194)
FT                   /codon_start=1
FT                   /gene_family="HOG000029132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636634"
FT                   /orf_name="MICPUN_59062"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64008.1"
FT                   /db_xref="UniParc:UPI000199AE5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M2"
FT                   /transl_table=1
FT                   /translation="MSGPVKKIAGEAAKASGLLGNIAKVLPWKITGPASGAEWKEVPIG
FT                   ATEYRVTAPASQPSTVRVPHAEPERIYDVRYHTRDSRRKYEPVLHGDVYSTTVVTPENI
FT                   MQNMEDNVKGVFTPGVRHGIQDLNGYEEVSILEQTNGGYT"
FT   CDS_pept        complement(120341..121990)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636635"
FT                   /orf_name="MICPUN_59063"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64356.1"
FT                   /db_xref="UniParc:UPI000199AE5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M3"
FT                   /transl_table=1
FT                   /translation="MRRGRTPSLALVLAALALASVTAAASDADDARIHHSRERRRVARG
FT                   GGVHPATVGEGSAGLVDVPFDTKPIRGVRGGEFPTAVPGGRARFLGGLEVTFTSPASSD
FT                   ETPDAELDPLSYGGWSSATGNADGSVAWILTDNYARLMRVELRNEPSTGRLDAVTKISD
FT                   ATAFRFRSADADDGAPVERTPGTRIDTESIVRIPHAADGGDSPGGDASFGLNDFVVGVE
FT                   DAQVPGVRPNNLLRFADGVAGGYRNVPGAAEAFKGDDACGVNLGPEATVYLPSRYTFAG
FT                   SLPEGAYPGSVIVAMCEARNASGVVTGFILDAPSSASTGGGGLGLIGKVYLRGLGDALA
FT                   PGRFQCGASDATLTPDGSIVVVLFHCYDFVTGDHVASLRTVRADSLRVPGATVHVSPLL
FT                   DWDDGPIGNMEGVHAFESGNDGAIGVLMVSDNNLSPTINTQIVEFEVRGPLFAESVVAG
FT                   GASSSSSAVLGDLEGGLKGGDGATMPSPLRHPFRAALWVGARRRDVRFGASFAAFAVVT
FT                   ALVAIGLIVGRWRRAVNAAARVRSEMSPLLPR"
FT   CDS_pept        join(complement(123014..123091),complement(122232..122882))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636636"
FT                   /orf_name="MICPUN_108387"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64357.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR019577"
FT                   /db_xref="UniParc:UPI000199AE5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M4"
FT                   /transl_table=1
FT                   /translation="MFSLGLGRFLRGEARKNAKEKKETYELERLVKQKIGKQRLKEIKA
FT                   KFAIFDADNSGQINAAELATVLRAVGLNPTEHHVQELLEEYDADNSGALSFAEFARLYF
FT                   EELESVEEADKLFKNSFQFFDKDGNGEISLVEFREVLTQLGDPMDDDEVSLFFKLVDRN
FT                   NDGKLQYDEFLEMVLEGTSQGTPGKKKGRKLASIMANGLDAPGSPGRGARRDNTAAQAP
FT                   KRTSEDAGAVSPPGTVNAKR"
FT   CDS_pept        join(123430..123442,124141..124550)
FT                   /codon_start=1
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636637"
FT                   /orf_name="MICPUN_90970"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64009.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="UniParc:UPI000199AE5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M5"
FT                   /transl_table=1
FT                   /translation="MSKRGGGAASGTKYKMSIACPVGAVMNCADNTGAKNLYVISVKRW
FT                   GSRLNRLPGASTGSMVMATVKKGKPDLRKKVFPAIMVRQRKPFRRKDGLVLYFEDNAGV
FT                   IVNPKGEMKGSAITGPVAKECADLWPRIASAANSIV"
FT   CDS_pept        complement(126072..126503)
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636638"
FT                   /orf_name="MICPUN_108389"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /protein_id="ACO64358.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199AE5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M6"
FT                   /transl_table=1
FT                   /translation="MIRFLLLQNRQGKTRTAKYYVPMDDDEKHQLEFEVHRLVVNRDPK
FT                   FTNFAEFRNHKIIYRRYAGLFFSLCVDVNDNELALLEAIHLFVEVLDHYFSNVCELDLV
FT                   FNFHKVYQVIDEFILAGEIQETSKKQIMERLYELEKIKD"
FT   CDS_pept        complement(127110..128936)
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636639"
FT                   /orf_name="MICPUN_82586"
FT                   /product="Cytosolic pyruvate kinase "
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO64359.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199AF09"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M7"
FT                   /transl_table=1
FT                   /translation="MGKQEGPKHGHILDNGETRDRLAAHIARPCRWVPDRPAAGPIGVP
FT                   RAPKRHKTDFLASTEPPPPVASRPSTHPSNDRIPLCALFIRAGINGKHARVEGDDAVKN
FT                   RTNIVCTLGPVSRDVPKLEQLLRAGMRVARFNFSHGSHEYHQETLDNLRIASKNTGIMC
FT                   GVLLDTKGPEIRTGMLDHGEPVQLEMGSEVTLTTDYEVKGNKNLIAVSYASLAKDVAPG
FT                   SKILCADGSITFTVLSCDVDNGTVQVRCENGAKLGERKNMNLPGVNVDLPTITEKDRDD
FT                   IINWGVKNKVDFIAASFVRKGSDVEYIREVLGDAASKISIISKVENMEGLDNYDDIVRE
FT                   SDGVMVARGDLGMEIHLEQIFLAQKRMIKRCNEAGKPVITATQMLESMTGAPRPTRAEA
FT                   TDVANAVLDGTDCVMLSGETAAGSYPVEAVSIMADICRESEAYVDNYAVFKNLMDHQSL
FT                   PMNPLESLASSAVRSAHKVGAELIVCLAKSGRTAQLLAKYRPAATILAVCVEDPNDDSH
FT                   DAASVARRLLLSRGIRPVVAPVSWRASAEETAADADAGSKHHAVVNVTETKNLMQNAVD
FT                   YAKDHGMVNPGAMVVGVHRVVGDLILKIVECH"
FT   CDS_pept        129617..130504
FT                   /codon_start=1
FT                   /gene_family="HOG000265601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636640"
FT                   /orf_name="MICPUN_82373"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="dihydrodipicolinate reductase activity "
FT                   /biological_process="diaminopimelate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="chloroplast"
FT                   /protein_id="ACO64010.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008839"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0019877"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG318149"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR011770"
FT                   /db_xref="InterPro:IPR011859"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="UniParc:UPI000199AF0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M8"
FT                   /transl_table=1
FT                   /translation="MAAAVPIMVNDLTGKMGRAVADAVVARGADVCYLVPVAFSGEAKD
FT                   PVTIGDVAVEIKSIRDGDPGAVLDDLKAKHPGLVVVDYTLPAAVNANADLYVKHAQPFV
FT                   MGTTGGDRVKLLEDVATSGVPAVIAPQMGKQVVAFQAAMKLMATNFPGAFKGYTLTVTE
FT                   SHQSSKVDTSGTAKAIVESFNELGCGFDIKDAVLVRDVPTQIAPIPNGMGVPEEHILGH
FT                   AFHTYRLTSPDNTVAFEFQHNVCGRSIYAEGTVDACLFLSSKMGEGCASEDCEAGKTLF
FT                   DMIDVLREGGMVTN"
FT   CDS_pept        complement(130690..132168)
FT                   /codon_start=1
FT                   /gene_family="HOG000265602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636641"
FT                   /orf_name="MICPUN_59070"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64360.1"
FT                   /db_xref="HOGENOM:HBG561789"
FT                   /db_xref="UniParc:UPI000199AF0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7M9"
FT                   /transl_table=1
FT                   /translation="MTPRGVAPRTSVVGTEPRAARTCGEASTSYPRAASMRGRARHARG
FT                   ARGGTREISIPAISASGDAREEERADDDGTPDGTPDGTRRSLLASVALLLARSSPALAS
FT                   PSIPARPSPPALAASLPAQLVDALAPATEPGRVADALRLPMTLDGGTYVVRYAIGDTTC
FT                   RGVVDTGSPFLTMEGRCTDYWGCLKESDARPSGYGDTYEIYGLQEDGVTRWVLGDARFD
FT                   GEVVDVTVDETVGPPVGPPAGWSETSNNANTSMSGNKLATKQRFTFPEVLFGVTSEVTA
FT                   KEGSSGSPASYAPFVGLVKERAGDWIRPTFLGQTDVTSFSLDFTTDTLVLSRREQIPRE
FT                   LRAGTMSMVDLRPLGSPVFHYAVEVEELWINGSRHKTDVPIYVVFDSGTTGMLVDRDLF
FT                   YNSDLALGTFECHMKMRGEDGSRVQIGSSLRTCTSRCLFLTLPIDVPWDGVRRGEAHVI
FT                   FAGLAFMFNQGSLTVDADARRVRLGGGFKGAAFL"
FT   CDS_pept        132262..133665
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636642"
FT                   /orf_name="MICPUN_59071"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO64011.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniParc:UPI000199AF0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N0"
FT                   /transl_table=1
FT                   /translation="MSPSAVRHVFLTGQPGVGKTTLVLKAIDALKTSPRTIGGFITTER
FT                   RDGRGERCGFDVVTVGIDPPSSGTLATKAAAGSRPGKGVPAVGNYVVDVADFERVALDV
FT                   LGRDADGPGRQRPDVTVVDEVGKMELHCVDFLPAVRRAMEDESTTVFGTIPMPRYGRTV
FT                   PAVEAVRHDPRVAVVHVRRENRDAAAVAVAKALRDGHLDIDALVPFLQEGQAAKLGLAM
FT                   DGGDGDGVPTDGVPTDGDGDGDGDGDRRVLGREEPEGCPCLLGGAHAARFRPECFTPGD
FT                   LPDVEPRVLLLGETSSPKPAGGSALAMYEGRSMWRVMERFLLSASDEEKGSSVCDHATL
FT                   VKAAVRSGVAVWDVLAEVHETAARNGSRRTKRAKTAADGASNDVVGLLERVHTIESVCF
FT                   IGAKARVAFAKNFGGDKNDASITVENVGPAGGGVSREVSLIVLPSSSRANARVSMEQKA
FT                   RAWREALSR"
FT   CDS_pept        join(133777..133908,134000..135541)
FT                   /codon_start=1
FT                   /gene_family="HOG000198168" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636643"
FT                   /orf_name="MICPUN_59072"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64012.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG561791"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199AF0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N1"
FT                   /transl_table=1
FT                   /translation="MSTGGSSGSPRADAKMVEDAQRALVAFSGVPAAAVSGEAGAETEI
FT                   DLNDFMSLRRPQNIMSGISSGMQSVGKGVLGGAAALIAAPVVGARSEGLSGFAKGLGAG
FT                   LCAAVALPVAGAAVGITQIARGAYNTPEAIMEANAGKRWDSHRRVWVAEDLVQESLRLS
FT                   ECSDDDILEKARERAKARGEAPGLEGALGGGGGAAVNGGGVASTEYYDALEVAPSATPA
FT                   EIKRSYYLLARKLHPDKNPDDPEAHQKFQRIGEAYQVLSDESLRKKYDERGKDGLKDHA
FT                   FVDPSAFFAMLFGSDQMEGLVGRLQLATLAAAGADLTKDERRLLQERRVGRLAVKLAAM
FT                   LQGYVDAAGDEAKVKSFEGHIRAMADHLVAASYGDIMLHTIGFVYEKQSLEYQTDPVGG
FT                   MGTWADLGFRANYARMEQMGKRMQSQFNALGAGMRVISTMRAADTEAKAAQGGGGDESA
FT                   AEAAMAKRQKDVLNHVMEAIWNASALDIEATIRKVCDKVLHDFSVSKEVRGRRAKGLEI
FT                   MGQIFQAVKAPEGKGDRMRDVEEAMRKAFMGAEEDGAESD"
FT   CDS_pept        137528..137866
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636644"
FT                   /orf_name="MICPUN_108390"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64013.1"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="UniParc:UPI000199AF0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N2"
FT                   /transl_table=1
FT                   /translation="MGGMGGMGGGMPNVPPELLSAIMSDPELMAAMQKPKVMAALQECM
FT                   SNPAAIGKYASDPEFQYIIQKLQKVMPGGPMGGGGGGPGFGSGMPGGFGGFGGAAGGQG
FT                   GASVDEVD"
FT   CDS_pept        complement(<140945..141781)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636645"
FT                   /orf_name="MICPUN_82966"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64361.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AF0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N3"
FT                   /transl_table=1
FT                   /translation="MPPRDRTQGNGTGGTAKSVEHDYHIIELVGEGSFGKVYKARRKYT
FT                   GQIVAMKFIAKHGKTDKDIKSLRQEIEILRGLRHDNIIAMVDSFETKAEFCVVTEFAQG
FT                   ELFEILEDDKCLPEDEVRAIARQLVRALHYLHSNRIIHRDMKPQNILIGSRRVVKLCDF
FT                   GFARAMSSNTMVLTSIKGTPLYMAPELVQEQPYNHTVDLWSLGVILYELFVGQPPFYTN
FT                   SIYSLIQKIVRDAIVWPENMSPQFRSFLKGLLNKRPGERLAWPDLLDHPFVRDTAND"
FT   CDS_pept        142191..143759
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636646"
FT                   /orf_name="MICPUN_100850"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64014.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR003888"
FT                   /db_xref="InterPro:IPR003889"
FT                   /db_xref="UniParc:UPI000199AF10"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N4"
FT                   /transl_table=1
FT                   /translation="MAAARGTPGASLVTLVTASLRDARPGGGRGEEERGGEARGRADTC
FT                   ISERYASGPTSAGATTPSPAARAPARGAREVSASSSARGSAATREGGPARAGEPLARAG
FT                   GRRAPPPAPAPVVHSYFATLLGATTDPGDALEMLRDAPACLRRNRLVEMKKAAKAEATR
FT                   KRLHSLLEAGERLDAATFPGLASAFFPTHVPDSASSDDADERRRELRRLFPGGALYVDE
FT                   RPRVYPMSTDDDNLAPSLSSPQPSSRTSPDASPPSGEENGDETDAVAGESPGGESPGGG
FT                   VAGETSTAASGKKRTTPAASGKSVSKRRERPNESATAAAARYRQAAAAPTSPPRTLPFL
FT                   AGGIQVIRIGRVVPALSGRNSAQSSYVLPAGFTTRRRYTSATDPTKKVWYESTVEVRSS
FT                   ASDSQQPATNDCKKGTGKKDAGKEKEGFVVIVHEVGNPALTWRGTSPTHAWQQVIAAVN
FT                   VRAKTRKKAAVSGPQFLGLSLPEVAEEIAKLPGYAECIESMAARGGTNGGGGGGGGERS
FT                   PTNAR"
FT   CDS_pept        complement(<146882..>147481)
FT                   /codon_start=1
FT                   /gene_family="HOG000162368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636647"
FT                   /orf_name="MICPUN_72779"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64362.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI000199AF11"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N5"
FT                   /transl_table=1
FT                   /translation="SRTDKFYYLAKEQGFRSRASFKLVQLNRKYDFFSGARACMDLCAA
FT                   PGGWLQVAQKYMPMSSLIVGVDLAPIKPIRGCTTFVDDITTQSCRAQLRRVTPEGTKYD
FT                   IVMNDGAPNVGGNFAAESYTQAALTLDSLRLASEFLREGGWFVTKVFRSTEYHALLYSM
FT                   QQLFKKVESTKPVASRGTSAEIYVVCIGYLAPAKIDP"
FT   CDS_pept        join(148014..148082,148179..150317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636648"
FT                   /orf_name="MICPUN_59079"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64015.1"
FT                   /db_xref="UniParc:UPI000199AF12"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N6"
FT                   /transl_table=1
FT                   /translation="MSGARGRCACPNCQVTTAPSNGRMPERPIVCAPCVRRTLRDRRAE
FT                   LDEAHRAHATSRARLERAMTATAGRDRAEGPRAALATERARNATEDLRRARAENARIES
FT                   AIRDERDGLARAREALTTRAAALATAQGTARANRMRMFQSALPEETRLQTLRLKHAREQ
FT                   LAVERARAVQRLRLVFPIAAERVPVESNPGKDESNAKNQIANVANPVHPVGSRHRPRPP
FT                   TAVTVCGLRIPDPGDASPLNPREISAGLGMTLALVNLSAAVLGAPQLHRGEFRGSESFI
FT                   WTPGSFWEDEPEAAKPGSREARKLRLYLPEKYLPTGDAGGEEMRGGMPAGDARKEGGSD
FT                   DARGELDGSGSRHSPRGVGKSGRRSSPLSGALEGLNRGLDRVEAALQGVDGAGRVAAAV
FT                   GAVAGGIGTVAGGIGTGIGRVGAAVYETGERAATNVSKTALNLRPGVAGVSGVSGVSGA
FT                   NGSTSARPNDPNKPRINPIHPTVPIHPAEWSKQAEREAVAARARAELNAGIRLLHRSVG
FT                   AICADAKPSLGGESPGPEDWGPLATLALTLATAARGAKKGGGFPDATAWVQRRRLNASS
FT                   CDADGGTVSKTVSSGIAGRLGAWETRAESAFLAPAISRAAHSGLTGAQSLMSSVFGGRN
FT                   GFRNGRGASTSSGTIGEDDDGGDGASDDEGGREDGESSAMAESTWQLVDAPVGRTAVRD
FT                   GVAAVSSRGRAAVLPPPPSKPEDVERWTRAMDLGGGRRAGG"
FT   CDS_pept        152589..153980
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636649"
FT                   /orf_name="MICPUN_100853"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64016.1"
FT                   /db_xref="UniParc:UPI000199AF13"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N7"
FT                   /transl_table=1
FT                   /translation="MTGAVPGIIDDDWREPFHPRTARVLEMGGGHGSGGDANAIPVAVV
FT                   VADDDPPGDRADDVPVAAVASPAPSPKKAPPPNSGASPCPEVAELAHLRRLVAKGVPLT
FT                   VAQAGRARRLIAALVHGPHCSRLADASLNLAAPAKPVWPPPGGVGPTVPIRSRLRLAQE
FT                   LITALQYNHTDAVTYFTVDKARPTCRVMDTARDIIRHGLPIRCVEAVFLAMYLTAGWKE
FT                   VERIPLRMRSVVVDDEGVERSHAHIVLLIRERALDETGAVRDNLIDEASKGRVDETDRS
FT                   NGDETPSKGRSIRYGALGTSRRDELAYVPFGAPTLTTVLEHYRAGYAKWRHRLVGVKIG
FT                   LPVEHDTRASSPVCWRHVAVECGGDGWDAAMRTLEAHDARCCGGGVGTRRHYDKWRCDG
FT                   QMWTNDADKLLVRRRERDGGWSGRSGGGDAGGRRAAGGRFPVASSPVKSPGGQKRTSRS
FT                   ARAAA"
FT   CDS_pept        complement(154082..154438)
FT                   /codon_start=1
FT                   /gene_family="HOG000238646" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636650"
FT                   /gene_name="PSBW1"
FT                   /orf_name="MICPUN_82984"
FT                   /product="Photosystem II 13kD protein, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO64363.1"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="HOGENOM:HBG493836"
FT                   /db_xref="InterPro:IPR005610"
FT                   /db_xref="UniParc:UPI000199AF14"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N8"
FT                   /transl_table=1
FT                   /translation="MTVAADTSIQFVKGTNETSVPDVKLTRSKDGTNGTAFFWFSEPDV
FT                   FEATELEGEITGMFLIDQEGELSTVDVNAKFLNGKPQGIEATYVMKSTNEWNRFMRFME
FT                   RYAEDNGLGFAAKK"
FT   CDS_pept        complement(154823..156316)
FT                   /codon_start=1
FT                   /gene_family="HOG000265603" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636651"
FT                   /gene_name="VDE"
FT                   /orf_name="MICPUN_104842"
FT                   /product="Violaxanthin de-epoxidase "
FT                   /function="binding"
FT                   /function="violaxanthin de-epoxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="chloroplast"
FT                   /protein_id="ACO64364.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0046422"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG608043"
FT                   /db_xref="InterPro:IPR010788"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniParc:UPI000199AF15"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7N9"
FT                   /transl_table=1
FT                   /translation="MALTCAASAPVSVRRRPPRKISSSGATSATKATMAALSPFSMRAR
FT                   AFPHRRLSAAIVVRASSEEATSTSSSAPSERDEDEEERRELGRSSLGEKLRGGVAAFAA
FT                   AAALSLSLPNAAGAIDARVVETGKCLLSQCNVELAGCLADEKCAESLVCLQGCFGKPDE
FT                   ADCQIKCGDLYASKAVQTFNTCAVSNKNCVKQKQDTGEYPVPSLDAMAPDFDANVFGKE
FT                   GRWYIVAGLNKDFDVFDCQEHFFSAPDKDHMYVKINWRVARPNGQFYERSDVQTFYADD
FT                   KTSSIMHNNGNEYLHYQDDWYVPGYKDGEYVFVYYKGTNDAWDGYGGAVVYSTSPTLRP
FT                   EYVPELTKIAEKVGVKFSDFVVTDNSCKPQAPLKVTAVRDLDTLGDDVVAIEREVVKDE
FT                   KALFSFVGKEGRLFAREVGKDSRLIAREVGKDARLLEKEIEKDLGLVSFGPRFTALKTN
FT                   DASDLPKVELTGKAKAEQAKAERLVNKVEANIGRAQDGQ"
FT   CDS_pept        157001..158650
FT                   /codon_start=1
FT                   /gene_family="HOG000198169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636652"
FT                   /gene_name="ZEP1"
FT                   /orf_name="MICPUN_82567"
FT                   /product="Zeaxanthin epoxidase"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64017.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000199AF16"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P0"
FT                   /transl_table=1
FT                   /translation="MSAATSTAAGPVARQLGRGNALRAKTKSASVRAPVRARAARAEIL
FT                   QFAPAVGEDGIRGVFKKQPPRDDLPTVLVAGGGIAGLITALSLQRRGMKVKVFEKVKEY
FT                   KLFGGPIQLQCNAQGALDSIAPDVLEQVWEKSTITGDRINGLLDGVLGDWFYRFDTRQP
FT                   CYNNGLPLTLVIARYDLLDILRNAVGEENIMMQTVVEKYENAGDKVIATLTDGTTYEGD
FT                   VLVGADGIRSKMRAQMRDEDPENPPLAYAGYAVYTAICDYSAPHRTAVHTDVERTGYQV
FT                   FLGPKQYFVSSDVGAGQQQYYAFLDVPPGGDDEFAKCERWPNYRAMLMDRFAGWCPAVL
FT                   ERLECTKPEDVERRDVYDVLPDPRWVDGRVALLGDSAHAVQPNLGQGGGQAIESAYALA
FT                   DELAKCEGKKGVQKALVMYTMRRFLRTGSIHGLSRFSSLMNTVYRKYLGDEPYGFYPEP
FT                   VKQFWNNVAKLKIPHPGSVAGQIAIMGTMPGLLEYVGGGFNRFGLPAWLGGASHGNGLD
FT                   REPRSQVPGVSAPKRDLKAEDFEMKGIPGLAK"
FT   CDS_pept        complement(158817..159725)
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636653"
FT                   /orf_name="MICPUN_59085"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO64365.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000199AFCB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P1"
FT                   /transl_table=1
FT                   /translation="MGSFPEGGLAALNQDDLPAMRRACLKVATDAAKLGAAVMLDKLGA
FT                   DVVKTKANARDLLTEVDPEVQRIIESSVADAFPTHGFLGEESVPGGWEAGSAAIARLLD
FT                   TGPDWLWIVDPIDGTTNFVHGMPLSAISIGVAYKGELQVGVIMDPFAGEIFSACLGGGA
FT                   HCNFAPMRVGEERSGEEAVVVTGYGATAESADAMLKGMKALTDLPVRSVRMLGSAAIML
FT                   AWVAAGRLTAYFECDLNAWDTAAGALLVREAGGRMTDLVTGDEYGLKTRAIVASNGATH
FT                   DELRKCLVDGGVRALADYFKE"
FT   CDS_pept        join(complement(161201..161592),complement(160702..161089))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636654"
FT                   /orf_name="MICPUN_54313"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64366.1"
FT                   /db_xref="UniParc:UPI000199AFCC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P2"
FT                   /transl_table=1
FT                   /translation="MLKSKNPHPNAWFGRAFALYSYRGSAGKSRSYNTRRALSAHCCTL
FT                   SPKSAENETHFFSTVVTRPSNSVVTKANALSASTPFATNSTPRRGVPSAILAMASSCDT
FT                   TTSNWPSTPGLGNLPPTTGFPGSSRLTSTTHVLHHRLATYALAPFTATAYAPSNRVSTR
FT                   VPTNSGTMVGGSNPMKSFDNRAGRTTTERELDISDTTYAVSSTTATARAPHSLRIKNHV
FT                   NLIAHDAKIKMQRITCPNSARGWRPWSSWRGATRRAG"
FT   CDS_pept        join(complement(163085..163245),complement(161866..162757))
FT                   /codon_start=1
FT                   /gene_family="HOG000265605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636655"
FT                   /orf_name="MICPUN_54316"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64367.1"
FT                   /db_xref="HOGENOM:HBG561798"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199AFCD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P3"
FT                   /transl_table=1
FT                   /translation="MAEVAAPSVEDWPVGDDFLLREAVEAGAALASIARGILPFSRAYS
FT                   CQEVTDRWRALLYDPNVARPAARRMARHILDAQPTVSPASTAEDFRSAWTRSAAAERAS
FT                   LRGVDGPADAGAGPATPAGGSPSASAGGKRPRRSPSGGSGGDDLADRGTAGTAGARGDE
FT                   TPPAETDADETTPPPSFADAEAAVLAMDPRPARDQVDPVARKRSRTQLASALRKIRKLE
FT                   ASAQAATARAATAKNSLGVLQGHRATFQITRRETVLGRSTEDQKVDVDLAEEGNASKVS
FT                   RQHAFIKLRWNGEFVLRNVGKRHVWINNVAVESGRRASLAPHSLIEVGGLRLMFLPNPT
FT                   LVRASEPEPF"
FT   CDS_pept        join(complement(164977..165636),complement(164620..164802),
FT                   complement(163480..164568))
FT                   /codon_start=1
FT                   /gene_family="HOG000208576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636656"
FT                   /orf_name="MICPUN_82627"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64368.1"
FT                   /db_xref="HOGENOM:HBG597089"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI000199AFCE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P4"
FT                   /transl_table=1
FT                   /translation="MHLRRTVTQDAADAVALTAPKFKPVTGGGDSPGGDSPGAGRWEAD
FT                   KTALEDARDAVAPVINAPPPRAPVGLPAKLKERWNALYDPASIAALNKRFKREKNPKGG
FT                   KGESKVPAKDAKDEEAKARRARAIAALPTAPFKSRLQRELFALMDGYRDVVYTARKPPG
FT                   SARKEPLGPDGSGGGGDDVMDAYLLHVVNHVMRTRTRITKNNESLLKRSKAKEIEMDDD
FT                   LPRDQGFVRPTVLILVPMRNVAGRVVRRLLQMCPAAQGRADAVNKLDRFAEDFGDGDSD
FT                   RRRGGGQWIPEDHKRLFRGNTDDHFRLGIKVTKASVRLYVDFFGSDVLVCSPLGLVTKL
FT                   QESGKSAADFLASIELLVVDNADVLMMQNWQHVLTLFSSCNQLPKDQHGVDIMRVHETH
FT                   LNGLARNLRQTIVLSSFPCAEINALVRNECANLAGRVRWKESFPGVLGWAARAVRNAGG
FT                   LRQQFERLPDAASIADSDDVRFKHFTRRVLPRLRENPAPGALIFIRDYLDFVRVRNLLT
FT                   AEDVSFAVTSEYTDQRDAARARSIFADGRKRVLLVTERAHFYFRRRIRGVREVHFYSLP
FT                   DHAGFYAEMLGFLGDGDGRSAASTANAPSATAVFSRLDALTLERVCGSARAKKMLAPDA
FT                   NSTFIFTA"
FT   CDS_pept        join(166656..167104,167213..168143)
FT                   /codon_start=1
FT                   /gene_family="HOG000223062" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636657"
FT                   /gene_name="ASP2"
FT                   /orf_name="MICPUN_59090"
FT                   /product="Aspartate aminotransferase "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO64018.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199AFCF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P5"
FT                   /transl_table=1
FT                   /translation="MPVVGLLATRACAIGAAASIARRGALVRAARAPLIHHRQARAGCL
FT                   STRAEVDQTLNPRVAALRPSKTMALTDKAREMKESGLPVIGLAAGEPDFDTPAEIVRAG
FT                   CDAIKNGHTRYSPNTGTAALREAVCAKLKEENGLEYSPSEIVLSNGAKQSVAQGVIATC
FT                   GPGDEVIVPAPYWVSYPEMCRLAGAEPVVVTTTADEGFLLTADKLRATLTDDSRLLILC
FT                   SPSNPSGAVYTKEALEAIADVVRSHPRLLVLADEIYEHIIYEPAKHFSFAAIPGMRERT
FT                   LTVNGFSKAFAMTGWRLGYLAAPQHFATATAKIQGQTTSGPSSISQEAAMAALGLGKFG
FT                   GAPVATMKAAFQKRRDYVFDRLSKIEGVKLASPQGAFYVFPDVSGLVGDGCVAEGFGPI
FT                   ADADALCEYLLEKAQVALVPGSAFGNPECLRISYAASDETLREALDRIEKALAPEVYVR
FT                   G"
FT   CDS_pept        168691..173022
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636658"
FT                   /orf_name="MICPUN_59091"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64019.1"
FT                   /db_xref="UniParc:UPI000199AFD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P6"
FT                   /transl_table=1
FT                   /translation="MRDDPDPGGNLAWARAIAKADALVALSHEVRASAEKRARFKQAAG
FT                   AYADPRSRASRTTHERERAAEGVAKEMGVEVPVAEHEKTPAEPVEATASSPLPRSTAKH
FT                   TAKTGTPLGTSASFKSDGSDASVGDSATAGTAGGGTAGGGAPQSSRKQSAILKPQKQNS
FT                   GDVLDMWDEKGNIRVAKALADTPNPSDVDPSSKEVSITPDQYRLLYLISRLQSVSFEAP
FT                   RKMGSIELTRNEISSGGGGSPSRTSSEDSLDRLQSLAAREREEREGGGGEEGKSELRAH
FT                   TNVRKPGGVFGNSGGRVAPEPDHNIARSSSHGSSAGRTVTIRDEPPSDSSRVPAATPGG
FT                   ENENEGSKEPHRQLSTTSLWKKAVVSVVNTLKLRHTLSRSFQHVPSTMRELQDKASTRW
FT                   VHRTPLLVYIYEGILLEIFETYDFYPGSEMSGVCKGVLNMNVSTEAVDDLSDLQEMGLV
FT                   LRLKLGTKDHFTTTSYQVMPAGVAALKSMPQRDKNDMDRFLVHGVRVETPQMLRATHYD
FT                   PHDYAWWGTADNDDDEYLREIFGDKPEFTPFEISFDAVTGEFNLLDTEGNERVSTVTEF
FT                   EDVSYVCSPYLPSCVRPKEGRHSTNREFSDFSSLAHLAAEGTHTMRDADIRHHVFLNNI
FT                   TLLSSQYLVNGPNEVNSLNEKLSLHASREEMRKGQAGLVSAQVDHSPASTVFDVAMSGM
FT                   CAIFPMDYVRSTMANFESKVYLPEDPGVVQLENFGIHLHSNGEVIFGVKVESVMSNVRD
FT                   NIPIDLIARIVFDLHEDSASTLSSISSSHQRLLMASLRGTRYVNEVRNENQGSSRRRNR
FT                   LDIGASGHKKRPVELTGSAALDNVIDNLTAVGSKVSGVAASIASVPRQVRDQVMSGLVH
FT                   NKKASSGEAARGDARGRPRPLRRAVTPSQLARSSMSPVIRGNNPALTRQKSAVYDSDDD
FT                   GSSVFDSSDEDDELMRLQQLVVAASEQHAFTASKYAFNMFTAFFCDSITPGVSAAELMD
FT                   GEDYENDIMQIIGRITSGADLPGGGIVLSGEKGLIVSGPAGRKFEQLIVVHCSVMARRI
FT                   FVSEFFHRLFEMESEIDAIQVAISAHIGKPSQLSDIRRRVMEACKQASLLDSLLTQCQS
FT                   SSSDLPDISQKTMEKGKSDPAYDVLLETLNTQDYREELVLRLKDLESLLHCARLGLDSL
FT                   RENTDVISEMQMFKLQESLQSNTRNLESLFRSNESASSSLQIMQLVIGGSLGFAILDRM
FT                   TGEWSALDTPWGQTFWKYFVDPAGVWFVVSMTVFVVIVVGLHITMKFMIKQASADMCLR
FT                   YSLHVRVNLHALRQYLKRRVLFSEEAETDVEGNNVYKVSWDENKKAYGGSALRVGISVD
FT                   QGHARLCTVTLQYNRREGSLSVPDVQDKFLRELVDARVIVDESELGDLIRPEAHTLEER
FT                   VRMAADEQRSRDRARKLRKRGEDRQAVRIIERRAIKSERSY"
FT   CDS_pept        join(complement(173429..174350),complement(173169..173314))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636659"
FT                   /orf_name="MICPUN_54318"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64369.1"
FT                   /db_xref="UniParc:UPI000199AFD1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P7"
FT                   /transl_table=1
FT                   /translation="MARWTPGPFDGVDSGNAAGGSPGTPPHDDEPPPPPLAPEDARKLE
FT                   LAAAIFGESGLEVDLDALGRGKEAATAARVLTDSEFDDSSEEDSDYEPGEESESESDMS
FT                   SDVSSDASSDASDASEDDEASDRFNPSPATMAHPGTPPAMSYASGPSMGHPMHPMMMPM
FT                   APPMLAPMAGSVAGGSPGVPGGRSPAGSNATGGSPMNDTSSALQQQQQQQQMAMMYQQF
FT                   QQFQQYQAFSQMMQQQQAMMLGWAGQQQAQAPPQGTVFGGVRASFNGSVSEGGSFGTFG
FT                   SGAPSASVDGGVAADEAANRRRVSKREAKDAKRAARAARRAAEGAEMSRLVKERALREL
FT                   RAQLQQPAQAAALTA"
FT   CDS_pept        join(complement(178206..180704),complement(175836..178142))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636660"
FT                   /orf_name="MICPUN_59093"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64370.1"
FT                   /db_xref="UniParc:UPI000199AFD2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P8"
FT                   /transl_table=1
FT                   /translation="MGAVRRALGSLLAVSARRASGSVSWDAAPRIGTRLASLRTVDARW
FT                   YRHLGAITAPSVPGGGGPSGYAPPAAWTSRRATRMHATSWASASDHWRGLSTVAGDDAP
FT                   DDSDADDADDDDDEAAEAAFAAVDDDDIAAYDDDDDDDDDEVASTSVASNPTHVRPRRE
FT                   IHGSVTDRDVARCPLDQLRDLVEEYHDVFDGGAAALALKKMATNGMFLVDSTDRDRRVV
FT                   THAEDEEEHSGEHSDDGPSSAGRKSAPGGMFAPSRGVRAGINTNTRVHPSVDLLLSAVT
FT                   RTACTMGPREATRCMYALMVMNVARGRPASDALVTALDARLGECAPEMHGKHAAVALFS
FT                   SAKLRREMRDAEVARTREDAEVGGSNPGGGGGWTFTKNQFITSAARGAQTSMRASDAAL
FT                   VDAVARTAGDDMSADDLAKAMRGVAIWIDTLGRKVGRLTRAVDAINVGLVRRLVDEAEV
FT                   GGSDPDGIDDVWDASDPQEGRAKLTPHAAMSILSSHRVLARHGAGRANRELVAALTTSL
FT                   DVVLDAIADGDDKIGAGLFLTAVNALAKARKAAGLDERIPAELKAKIDTCVEHFCEKKD
FT                   VEAWFPGSAILALAALAQTQTSSAVPWKVTGSLAGALERCLERFEKRFTRGDAVATIFA
FT                   YDAAMTRLDPNLVRAPPVVDRMRVTLDETLTRMPPARAARLLDKQCKTAMDAFGKEAKR
FT                   TTSPAHLVMSPAHLASAFRSACVGAGELDGSQLASLARAAAWFYGAHGDGARGDDATPS
FT                   PRSSPLTPPTDEMIAGLDEAAGALARSGTLPAGTAAVLLRCFCELRGVGWKKGDPTNGG
FT                   VFKVSNHALRDLLSAAEDGIPEFESVAMDGFTRAVRMLDGFNGDAVVGERVKSRVEARM
FT                   AELLRTRRLFTDSPKSKEAYYFGRGGVLDHLTQWHKTFANAPGPTHTELMDQFRTQLSD
FT                   SVSHMTREHAAEVLKLLAPLEDSKKPMNWKLMSKSSIGPLLKKALLEQHETKYPWGKWA
FT                   KYEGRDLVDLTRSVANLVRNMEENHERLHPGHVAAKHPKQSKERFMTPITPSMVKSLTW
FT                   NIIRECKRRHRTDTPLEPGAYVEMLQSLATVGNWGRGRFFIESVAAPQSVVSRLAAKIS
FT                   HPESVAALTYGEVITAGRCLVALDETVTRLGGVFDKIDGVFDTSSMRKLAGALRRRTLA
FT                   EDTFTTPARVFAETARISFFLDKEGPAGHPSGGDDAGDETDWTRWCERCARCVTTAADD
FT                   DGGAAAAQFLRMLSHACAKSPDRLAPRVPSDVISSVSDAAAGLGLNETLENTDSELNNE
FT                   TVENGGKIGNPERVLLIAGALARFAASGANVPAAKLAESAAAAERVLIEGWAENRTFRN
FT                   QKRSGGNAFSAGALATFATLRALPTSGYRLGEEARGALSEALLADAPRWVARFAHFDHL
FT                   ATLALGPENGSETLETDDDAASPVASPTFPELAAVCDALRASSLSGQRLLDAAEGKSGT
FT                   GARKLGSGPREDARRAANAAEACVRLVEAGLEGWRRGGDECGVWRNVAESVVGGEDGAA
FT                   FVKSLRSASEGLTRGSTFGSFETSSSSSSSSSSSIDAGLTETDAEVKRRLDLAVGRLEA
FT                   AREELSVGTKGPVGGFFSSLFG"
FT   CDS_pept        180866..181525
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636661"
FT                   /orf_name="MICPUN_59094"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64020.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199AFD3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7P9"
FT                   /transl_table=1
FT                   /translation="MPAIWRPNVSGPLPDVDVEVGVTEDASSKGTKRKRAPYTKGPCEH
FT                   GVKYRSKCKVCSACPHGRERRYCKECGGSSICEHGRVRSICKECGGSQICEHGRERCRC
FT                   KECGGRGICEHGRQRYSCKECGGGSICEHGRQRSKCKECGGSQICAHGRVRSQCKECGG
FT                   GGICEHGRIRSRCKECGGGSICEHGRQRSRCKECGGGSFCEHGRLRYRCKECRAAN"
FT   CDS_pept        join(complement(183378..184676),complement(183179..183278),
FT                   complement(181731..182956))
FT                   /codon_start=1
FT                   /gene_family="HOG000020613" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636662"
FT                   /orf_name="MICPUN_83126"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron-sulfur cluster binding"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /biological_process="coenzyme biosynthetic process "
FT                   /protein_id="ACO64371.1"
FT                   /db_xref="GO:0009108"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG335564"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="UniParc:UPI000199B08B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q0"
FT                   /transl_table=1
FT                   /translation="MASVSLSCSATSLRAATVAREGHARRADRGQRYRGRVFSARPGAS
FT                   HRGEASTSTSSDDLDDLISAVASGARDLTRSEIDRLTSELNLTSLCDAACAVRAAGPDP
FT                   GIVTFSPKVFVPLTFACRDRCGYCTFAKDPEAGSKIYMSLEQVIEVAERGRVAGATECL
FT                   FTLGDRPEALYPAAKHELNEMGFESTVDYLAHCASAVLARTGLLPHCNAGVLTRTELAK
FT                   LREVSVSQGLMLESTSDRLVDEPGAAHFNCESKRPATRIRTLDLAGELDVPFTSGILVG
FT                   IGETREERLDALFAIRESDRKWRGHVQEVIVQNFRAKENTGMRDWPEPSLDELAWTAAC
FT                   ARLIFGPVTQIQVPPNLTPEPDDAAGGGPVGDREGWRRLLRCGVSDWGGVSPGVTPDHV
FT                   SPEAPWPHLSELARVTAEEGYSLVPRLAAQARYVTEGLERWIDARLAPYVRVLADSEGF
FT                   ARASGWCPASLAALEHSQLCEVDGGAKSDFDSHSQTQMDIDEAAVATLLRARGADFDAV
FT                   CAAADEARAAQCGDVVTYVVNRNINYSNVCTLSCAFCAFSKGPAAEELRGKPYLLAMEE
FT                   ITRRTAEAWARGATEVCMQGGIHPDFTGDDYLAILAAAKAGAPGIHVHAFSPLEVSHGA
FT                   QTLGLTHREFLKKLKDAGLGSLPGTAAEVLDDPVRAQLCPDKLDTDSWLELVATAHDAG
FT                   VPTTSTMMFGHVDTDGPDAWARHLLRLRNAHVASVSRNGRGFTEYVPLPFVHFEAPAYR
FT                   SGYARRGPTLRECVLAHAVGRLTLGAAGLTNVQASWVKMGPEMAGELLRAGCNDLGGVL
FT                   MNESITRAAGARHGQEMSAATMEGIVAGVGGGRVARVRTTAYGDAPAGRREAAMRAGPL
FT                   LEV"
FT   CDS_pept        185590..186627
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636663"
FT                   /gene_name="CAO2"
FT                   /orf_name="MICPUN_104843"
FT                   /product="Chlorophyll a oxygenase "
FT                   /function="chlorophyllide a oxygenase [overall] activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64021.1"
FT                   /db_xref="GO:0010277"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561803"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="UniParc:UPI000199B08C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q1"
FT                   /transl_table=1
FT                   /translation="MGRRFADERSLDNPGELKGIRNFWYPVHFWSKLTKGDASPDFPLF
FT                   GEEWTLVRTDAAGVAAARASIAFPGCDEMASIGDGGWVCRSVADPAMHLPIGVKDGLVM
FT                   VWPGSCKPDAALPGTFKPPEGYTTHAELIIEDVPVEHGLLMENLLDLAHAPFTHTGTFA
FT                   KGWGVPNFVEFVTARLRKPGDGWHDMANGLNLSALGGQSGSWNPYPIDMKFVVPCMVDS
FT                   HIGMSQAGAAGGGAQFEEGVQCAECANHLHQLHVCVPSTPGRTRLLYRMSLDFAGWAKW
FT                   VPGIELVWTEMANQVLGEDLRLVTGQQDRMQRGGRVWAHPVAYDKLGLVYRRWRNFSVG
FT                   DSCEL"
FT   CDS_pept        join(186756..188040,188113..188390)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636664"
FT                   /gene_name="FTO"
FT                   /orf_name="MICPUN_112682"
FT                   /product="FATSO protein"
FT                   /protein_id="ACO64022.1"
FT                   /db_xref="HOGENOM:HBG561804"
FT                   /db_xref="UniParc:UPI000162B433"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q2"
FT                   /transl_table=1
FT                   /translation="MGKKHKPRPDDRARVVDASDVGGKVKKKKANGATMKASRRKGGGA
FT                   SANGDGRPYDPSRTLSKPAPPPPAYTPRVPTGAYITPEHDEYDACVARSYVGFVVDPPD
FT                   ILPDELHADVAAAFKTMAKRGLFTRDVLAAGKTVSPTFVSRTLVGERGMTYHYQKLRIF
FT                   ALPWSDEDTPEGSPLRVVRRLNDAMKRRSRALLTRHRDARVPGDVTGSCEFNVTLINLM
FT                   EPERKESVALKDEGQFGMGKASVSWHSDSSLQDTSTVAVYHQTSGGIDGDDTSWHVALK
FT                   CLDGVTPALRVPLRSHSAYYIMRDFNLHHHHAVLNGDTRRFSSTHRVAVTAKDTFDYVR
FT                   GRCERALAVLPSLKWRAGRWPKGTKPPRDASSTQLSDAVRVLGETHREVEFQWIRMFWL
FT                   QGTRHAAQHDGYWTRRIEELTQAWDVMELGLRFAMDACARAADGKAKAEPRAFEMLRYL
FT                   LETIAELREEHDARTQSGAYAQVPDDCKPVDLPGFDDSSPLPRNLRPVLNTLERHRRRA
FT                   LDR"
FT   CDS_pept        join(complement(190162..190729),complement(189844..189969),
FT                   complement(188611..189674))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636665"
FT                   /orf_name="MICPUN_59098"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO64372.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="UniParc:UPI000199B08D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q3"
FT                   /transl_table=1
FT                   /translation="MTAVVAETDQGKAAKEPPAKPGKEETGNGTTGKPPSEVMWAWEQG
FT                   LPRPEQLPGTNSQLLTPSLANAFGIQMMNGYRYPLPPPSQESGERANGESRAAQGSYHD
FT                   PMGAAQMQASMPPPYANFHHSMPPPGSANAQAAAAAAMASAAISNPYGFPGMYQAPFGA
FT                   QRPGGHYDPYGRSLGQGGDRGMGHSQGHLDPNVSFEHMMAYQAGMEHSRSFEAFKRSRE
FT                   EPGMSMGLEGSEDDHAHALKRPRLVWTPPLHKRFVDAVSHLGIKNAVPKTIMQLMNVEG
FT                   LTRENVASHLQKYRLYLKRLQGCSESTMENSPSREGGGSGGGSGEGSGGDTGPGARHGG
FT                   GSGGDGSGNEYKREGSGSEGNDGPGSGQGSGGGAANGGTGSGAHDGGGSGGSDGGSGKG
FT                   NPAAQSEKGSGAGNASGGSGNGSGNGSDGGGQTQTLKASNKDGPQSQKTEPGAPAAPAA
FT                   TAQVNKGSTPQGNSGAAPTQAELKPGVDEKLKLKHTRQGSGSGGEGGASGGEGNGSDDG
FT                   EERPNSMERASSGDGSNDGANEVDEPGRKGKLGNSARDAPATSKPPPATSKPPTTEDKK
FT                   TKRTGKSTK"
FT   CDS_pept        190822..191595
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636666"
FT                   /orf_name="MICPUN_59099"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64023.1"
FT                   /db_xref="UniParc:UPI000199B08E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q4"
FT                   /transl_table=1
FT                   /translation="MRRRVRRLEGRKKRRKSDKKIPRFEDIFAKKAANPWFAVLGLEFP
FT                   RDATQAVTKSDSVSDLGISSLETCGEKIWGCASDASDASDGLSRAPGLDWHSNRKSKCR
FT                   GVVILGTNNARYAHSRRILTHARHRLTNMTTAAIARRAFAAGLLSPATFRPALAASDHR
FT                   TRAMGVVTDHNLGKNLDDAIHKAERAREDIWFREHDLDALRDLYKKARKQARHWKMEGE
FT                   SVKTDAAELSELKELVNGKLDQATMERLIDWKHHQ"
FT   CDS_pept        join(complement(192609..192689),complement(191670..192506))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636667"
FT                   /orf_name="MICPUN_59100"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64373.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199B08F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q5"
FT                   /transl_table=1
FT                   /translation="MSAPAPGLGSSVELATNELGELGIEVEASHCSGRVWPAAIVLGRY
FT                   LESERCARLRARDAAILELGAGTGWLALKMSSRFASWTATETTEGGALDRLERNLAKFA
FT                   GGGTRGRHPIARALDWNDAEGFVDSEGGGWDLVCGSDLVYSEAGAAALARCLDALLGDG
FT                   DGDEKSAPGDGDGDGDVRSAAGRRRPMIAIAQTCGRWGGHGFDEALYRALANRRLRASA
FT                   AFGETLEDDDTTLRQHVVVFSIERSPGASDIECVDIERDRRSHPLLRAARIRERNEAAQ
FT                   LAALTEDERRELDAARLFDELSST"
FT   CDS_pept        192811..194112
FT                   /codon_start=1
FT                   /gene_family="HOG000182591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636668"
FT                   /orf_name="MICPUN_59101"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64024.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG567470"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000199B090"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q6"
FT                   /transl_table=1
FT                   /translation="MSATSAAFVAPVARISSRSTRRHRVHAPIARAVAPSSSSSSSSVH
FT                   PVRGDALPTFPGGWLGPDLAADPGSWTHRLTDDEVAELDAALASAEAAGLDVIDLTPDT
FT                   FPLPTLKTRLDATRRELVHGRGLCLFRGVPVHRYTPWQRCAVFYAMGAHMGWTCPQNAR
FT                   GHVLGHVKDLGADPNDPTTRIYTTCAAQPFHTDSADIVGLMCLENSTTGGESMVVSSVA
FT                   VWNELARTAPQLARTLLEPFPVDRKGEVPPGKRPTYDMPVFHRHGARASDVDGSAVTVC
FT                   VGAGEAGDSEGGREGGCELLSGIYDRNFIDAAQARFTEDDGVPRLTPTQIAALDALDAT
FT                   CDDPSVRLDMRLEPGDVQWLHNHTTFHARREYGDGEGKGPSKRHLLRLWITPPDARALP
FT                   GAFAERFGDLRVGAGRGGIRVEGQTPFCALEPGA"
FT   CDS_pept        join(complement(194779..>194844),c
FT                   omplement(194419..194616))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636669"
FT                   /orf_name="MICPUN_82663"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64374.1"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniParc:UPI000199B091"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q7"
FT                   /transl_table=1
FT                   /translation="RQQKWSKGKAKEKANNQVLFEQSTYDKLLAEVPKYKMISISILTD
FT                   RLRITCSLARKAIAILIAKGLIKPVTLHSKQQIYTRATNDTE"
FT   CDS_pept        join(195614..195908,196392..198622)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636670"
FT                   /orf_name="MICPUN_100867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64025.1"
FT                   /db_xref="InterPro:IPR003612"
FT                   /db_xref="UniParc:UPI000199B092"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q8"
FT                   /transl_table=1
FT                   /translation="MTLSLADAASATYDPAKCTDKDVVAPLGLACQTALADSSVMASCC
FT                   AALTTWNAAGCNCPAHEGETLLDLDEYALFKPALAGLNAGCGIDAADDDADAMSALAFA
FT                   LAASPVAAYGVIHRYDHVDDETHEKHVRAMYRLDDLLSEYNRLHNHPDPDHHRRHREPE
FT                   YVRAYKEKHLHAAQHARRVEALRHAHGDGDPTHVACDDPLFVQSHMLDCLRHPTWEHPH
FT                   GGCCEGLRMWNDAGCNCDGVRSVLTHDATFEHYARVAAKFEAQCDVTPRTNCENQLREV
FT                   RRYGVIHHDGFDASSGHFHLALPERDAVGIRTRASILPELPGNRRSLKSAWESTAGKQT
FT                   IDCALMQSAMLALLPCLGQVPASVSDECCKGLNSWNDAGCYCDGVQTVMEDPETPKAYV
FT                   ELAAVLNPACGVEKVTDLNHRVCAPPPPAPPPTPPPPNPPPRPPASSTLAFATTVAQET
FT                   WGAFYRSFSPYEWDAPTDEDYCKWMADVLVCDYIKNADDCEWKDSDAGGSREVLTPCEW
FT                   YEGKCELRDYLQIGARELRNAFRNVLAASQSAHDACAAGCADEENEGDEEKCVDTPHGC
FT                   LPSVDAAMAAADAASSEITTTAVQRMVYRQYMHGVVGCNVLGKGGAETVGVDECAGRDG
FT                   CAWDSSSGGGNGRCEPTRAWREATSLEVCTPPTPPAPPPAPPPPPVSGYEYEATRGDGF
FT                   EKEFSPWMVWSFMVVSSAISLSWMCGCILVYKRHPECPKPESSDDESGTDSDENNSSDG
FT                   ELTHSEITVETSELIENGRDASDDKPVLRGRRGGGRRGEVAREVVIPPWPKYAPIPYAR
FT                   RKSTPKKHRKPGSMEQWERMQAQKPRRYK"
FT   CDS_pept        198845..199549
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636671"
FT                   /orf_name="MICPUN_59105"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64026.1"
FT                   /db_xref="UniParc:UPI000199B093"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Q9"
FT                   /transl_table=1
FT                   /translation="MKRSNPSARGRRRGDLAFYFWIIAHIALAFLLVASVGALDRPPRG
FT                   RRDGRTSAESGDAQSLAVGAATTRGYRRRALASNATDPHPTPPPPPPPSPAANASSPAR
FT                   AELVNADGGTTSRSRETSGSDRAAVGGDASTGVEGGTGADQEGAAYVVDEDARALARDD
FT                   DDRSVGYGARELVPFAVGVAALSFVILMCFDTLVALTLLLCLGAVVAACVMVLNNSEDD
FT                   TRWRDDEFNGPM"
FT   CDS_pept        complement(199638..201149)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636672"
FT                   /orf_name="MICPUN_59106"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64375.1"
FT                   /db_xref="UniParc:UPI000199B094"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R0"
FT                   /transl_table=1
FT                   /translation="MRRHVGGRFTPPRRASSGSYPDSRAGARRAPTSSSDDAGAAVKAS
FT                   VGGPSDLDGEDGEERTPADASERDDDARASLRDVDIGAREEPGERVRVLDDERVDADSE
FT                   TDAHEDAHEDRDDHATSGDRQCSGDDDDEEEERTEEESASDGGDSLADHSSADASLNAL
FT                   DPDNLRVLQSYGLRPQMSYESSENETGSDDNLLDDDDGHVAAGSAPSAPLPPTWRAAIS
FT                   ASLRLSREFSGLANDSSESSSSEEEEEDDGDVTFPWSAGSSLDDTLNASTRAAAHEMLR
FT                   AADVSHEVASLFAARVPRGVATSWEDARRGIDLDAVCAERFGGGDESVDPTPSTRAFEP
FT                   PCDRSFGFSDDAACIAEAAAASTAFCPRKPRARAARAFADVSFVADLLEELPGVDPSDA
FT                   RIACVLAAVTVEHAEELQRGEGGHGRRRGRANRATAGSFPRVLAPAAGRGLGAMARREL
FT                   AGGGGGGRGGGMGGRAGGTGGRAGGATSDETRESRGGRRNVGRSR"
FT   CDS_pept        201420..202979
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636673"
FT                   /orf_name="MICPUN_105685"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64027.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG561419"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000199B095"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R1"
FT                   /transl_table=1
FT                   /translation="MVRNGRGTTAAVVAAAGGLGLSLAALSLGAVPLLASLGDRASNKR
FT                   KRGSPLSPSRWYASQDRDGRVGDAVADVLARVADGGVEPMLRCEVWPLLLGLRDANDTA
FT                   VEQEQARRRRRERYRQLRRRCEELHEMLSGRSGAAMGASGDEPPADLGTFTETLPVIRA
FT                   DVPRTPFRTGAFQSHWEADRLAESASEDDLTNHSSTHRSTEPPAPTGGGGDANGELPRL
FT                   EPVKSVPATHQPTWRTAQADRLTNVLQSYALLDPAVGYCQGMNEIAAHFLDAIPDESEA
FT                   FWCFEKFLRGYRCHFVMGGHVGSPGGGGSGGATPGSTSKASGRDANDKRRGNKRGYPRV
FT                   APRRSANVRDRLHELGDVLRRCDPPLWKHVQLLGAQECMFAFRQIVVLMARELPPAETL
FT                   YLWEALMARGDHVVTEEDEGEGEGEGEGEGEGEGEEGDGNDANDEGEFGAGDGRLFVHV
FT                   VAAAFIQARNIAFGCHEFDQLLHASHHAVANKTLAAAPLLATATRLMAKGYRAPGMAFP
FT                   TK"
FT   CDS_pept        complement(203148..204374)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636674"
FT                   /orf_name="MICPUN_59108"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64376.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199B096"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R2"
FT                   /transl_table=1
FT                   /translation="MATPHRYPAPASTAARPAHRGAPSSRRRRAPTPAPRLAAPVSPSG
FT                   ITLREGAPHPPRAVVHEHLDWSCVRSSHAREESGLWLPGWRGETERGASTSGRAGVGTD
FT                   RSAGEPKARVGESRLHTGEPAKAGRRGMLAGAAALTALPIADPKPARAFIDLPSRLHNR
FT                   YFLVRHGESTLDVRGMFLSNPSYKYDTTYGLTKRGINQMHEAARVISDEYDAAPSWLYT
FT                   SNFQRSFQSALILREDLGLLFSQLRTEFSGLLDPRKMGALDFDSQSKWDAVWAGDEKDS
FT                   GNTPPPVPASLQPSASVESPRDLYRRALEAFTRLEATYFGEDVILVSHADTLSLFTAAM
FT                   MGTDLRTHHGDWGMELGQVRCVDLSGDDGRALGANFKPTDLRGEYAVGDKATNYPFMPE
FT                   GYGTDVSGV"
FT   CDS_pept        complement(205379..206551)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636675"
FT                   /orf_name="MICPUN_59109"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64377.1"
FT                   /db_xref="HOGENOM:HBG690661"
FT                   /db_xref="UniParc:UPI000199B145"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R3"
FT                   /transl_table=1
FT                   /translation="MARALGLARLVASSRRGSLAAAASYATSAPPPPPPAHGRRASGSS
FT                   DDASTIPPLACEWIEPPGDQSTTDAPVALVLHGLMGSGRNWRTFARALSKRLAAGGTPW
FT                   RFALVDQLWHGRTFGDRTHREWRNPSAQTAAANGACAVDLAASAVGDFAAHVRAVNPHC
FT                   RVAAVIGHSLGGKIALRHLARLGDANALPPHPTQWWSLDSVPSAVAHPDDDPHGVQRVI
FT                   DAVRNHLPRTFAAREDLGTALAAMPGGVTFPRDLVDWLGTNLAPADPTAGATSPLTWQF
FT                   DPDGAAALYDAYKRDDGALRVALDPPMGRGGRYNGSSVVHEVHVVRAERSERWPKDTVA
FT                   ALVARAKQRGSRLRYHALRDAGHWLHVDNPGGLRDVLAPEMARLHASLTR"
FT   CDS_pept        join(complement(208159..208311),complement(206739..208052))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636676"
FT                   /orf_name="MICPUN_59110"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO64378.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI000199B146"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R4"
FT                   /transl_table=1
FT                   /translation="MHHSQEATDTALDWCIELISQSNVLEVGAKYAILDALKDKISSGE
FT                   FSPTTRIRMYVESISRLTASEESGPFMRLRPENVNEVFQSLVKMGDVAHALGDDSIPMP
FT                   TITLTAQTYAETMLTHLRPPYRDVENFAESVDNYDLDDEDFQTASPWLDVEALENIRVD
FT                   LKKQAARVTDDRCDGILRRWNTAKDTLVELAKYCGEVLEAMGPSFLERVAADFRSGRYA
FT                   PPSHDGVLIPEDAIPEDARAKRRERELLEAGRVLREAFDKKPNSSSPSDLKNKRKAPAD
FT                   DVEAAAVRRNVTAFEKLRAANAAVADPLKEALRASDAAGAQGQGGRRTEEAAWNALAAE
FT                   YEAGTGSDQPSDESPAAKAAKARAANRDAADDGKKVVIRPHHRGATARTVDWDSRGDGG
FT                   AVSDVSTPPTTRKAGAPGVIGARTTRVGTSGRKAYTRWTTAQEEELRRLVGVHGVGSWA
FT                   TILEAGRDMFGADRTSVNLKDKWRVLTKAR"
FT   CDS_pept        join(208957..209096,209355..210558)
FT                   /codon_start=1
FT                   /gene_family="HOG000260368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636677"
FT                   /orf_name="MICPUN_82419"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64028.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG507255"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="UniParc:UPI000199B147"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R5"
FT                   /transl_table=1
FT                   /translation="MEDSLAELAELAQSAGLEVVATLTQRMKHPHSGTYVGKGKLRELR
FT                   RLRDPTVDTVIFDTELTPRQNRNIEQYLDGKVRVCDRTMLILDIFSQRARTAEGQLQVE
FT                   MAQLEYQLPRLSRMWTHLDRTAGGGGAGGQVKGMGEKQIEIDKRLLRDRIQFLKKKLDK
FT                   VKTHRMLYRDRRKETPVPVVSLVGYTNAGKSSLLNALTAADVYAEDQLFATLDPTTRRF
FT                   PLPNGKDVLVTDTVGFIQNLPTELVAAFRATLEEIVDSTMLVHVVDISSPLAGAQVAAV
FT                   DTVLKELGASDIPRVTVWNKSDASIASGKDPEALAEEARSRGAVVTSATTGFGIDSLVH
FT                   ALQDTLVRVALVRVEIDVPYDVGGVIGEVRKAGVVESETYWQGGTRVVAHVPSATARRL
FT                   AHLAVTDSSPRLEDLEAAAEEGEPQWSREDEEAFLAMMLEEEEEEASA"
FT   CDS_pept        complement(210610..211773)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636678"
FT                   /orf_name="MICPUN_59112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64379.1"
FT                   /db_xref="HOGENOM:HBG561422"
FT                   /db_xref="UniParc:UPI000199B148"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R6"
FT                   /transl_table=1
FT                   /translation="MEEGEGKRPRVASTPSLHPDRLTIVLTTSPIKTHPSTRLIEEVFE
FT                   SIAVLAGLGDSRKIIVADGVKVREHDKFRSGICTPEAMSNYRHYLSRLEALTKTEGSPL
FT                   RGAELLVLDERHGFAHALRRGLMRVATPFVLVAQHDRSFVRPVEVSHVLDVMETANEHT
FT                   VCTDSGRVNYVGFPTTTTLSHKTYVASKYGLAVEPVTRDVPDPKVDGSKPGRSGTDDHL
FT                   RTNDERPSTLKLLPLVQFYDSMHVASTRWYLSRVFGRSRYVNLPRGGFIEDTLGQHMLR
FT                   TIREECVGPRASDADAVARAHAAFGTFVYQDDSMETKCGHIDGHDVLTAKGSCRKYGFG
FT                   YSHTSEERWREIEGGAGHAHWGEGTYETVTGYRDDPGSVALGADVNV"
FT   CDS_pept        212453..213259
FT                   /codon_start=1
FT                   /gene_family="HOG000241715" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636679"
FT                   /orf_name="MICPUN_97494"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64029.1"
FT                   /db_xref="HOGENOM:HBG316630"
FT                   /db_xref="UniParc:UPI000199B149"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R7"
FT                   /transl_table=1
FT                   /translation="MGGFTRILHSGKPDDLMDEIPTVVVDPLPKGIKDHGYVVLHRPYA
FT                   FKQWLDTYAADIEEEYVLMTEPDHLYLRGMPLFATPNRAAAFPFFYIDPKKPEFTPIVQ
FT                   KYNEVKAPIDAFAPIGNSPVMISVESLSRVVPKWHDLAVAMKQDPVADKAFGWVIEMWA
FT                   YSIASAQVGVTYELHPEMMLQPPWDDSFRVKGKEAYIIHYTYGQDFAKSGEATPGKIGE
FT                   WHFDKRDFTGFPPKEKIPMPPRDAHEVIQKMMTIINEGITELPHWP"
FT   CDS_pept        complement(213342..214634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636680"
FT                   /orf_name="MICPUN_59114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64380.1"
FT                   /db_xref="UniParc:UPI000199B14A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R8"
FT                   /transl_table=1
FT                   /translation="MVSKDALVKDVGALIERLQSLAQVVKDRSDACKQDLAASSPERTT
FT                   SAADSEGALPSSTEKKLRMVSRALNGRLKDTMDALTQLKRIADDALVLSPEDDASADRL
FT                   RALGAELALARENASDAGLLSEKIPDVPGRAGPDAADVHDADGKRTRARTGEDPDPIDP
FT                   DLERVLVANAVDVKSIRDVVARLRDNERDVDARAALAREVRSLTSPRAKESNESTPAGI
FT                   EPAAASDGSSSPTRGSSYSEDNFAYGSTPFATFWRVVQECPALRGAMSRMAKVQQENYG
FT                   IFMNQRGFQVWGSSSGWLVFYAALGCKVSGVGYELLRCHVDFANGVVMSMLNALSKPPV
FT                   FIHGDVLEQADCDVMQFPPVVWLTSQCWDQSLKSAVAEKLTAQCEAGALVVDYGEGVGL
FT                   GDRGGAWERVGTTTAPVSWNPAQTFHVYRRV"
FT   CDS_pept        214827..216254
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636681"
FT                   /orf_name="MICPUN_100874"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64030.1"
FT                   /db_xref="UniParc:UPI000199B14B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7R9"
FT                   /transl_table=1
FT                   /translation="MSTALAHSRAYIAPASPGLSARATSRRRVRARVAFTPMAKGQKGV
FT                   RKVVQSGAGALSFNPGSVLSKMMNVTKNKINWKILDDAADKLDGELASQPILGLVRAEV
FT                   TIRGIDALEREGRGYKEYILLRSLGLKAWFTHATSRAGVHDPLTRCAVGKRLADPDGEF
FT                   NIYRRVLAHAPAAAAGDWTKFADGLAGDAKAAAAALTDDERKTAKNRYDTSVDATAFAA
FT                   IDDGVKAAAAVCARAQRGDDAVATAVPLPWVDPGACPVVDAKSPAGDSPAGDSPGGDSP
FT                   GGDSPDGDGEDSVESMFGKKAKKRNKARSAGTGSVAKSVGGAPPSLDAMLSQLAKKQQE
FT                   PTFPEVDAWITKSGQATASEAVATALALCLEAPADSVVVAPSALFASAVSFDTGSLGSG
FT                   RRIVSPNAAASGKTEWGDRAMFVTFEPAAGGGGGDGGMLAKGVAAAAGAGCGVCVVVVA
FT                   LGSGEAAVDAVRTRAKI"
FT   CDS_pept        complement(216305..216946)
FT                   /codon_start=1
FT                   /gene_family="HOG000100073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636682"
FT                   /orf_name="MICPUN_59116"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64381.1"
FT                   /db_xref="HOGENOM:HBG561425"
FT                   /db_xref="UniParc:UPI000199B14C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S0"
FT                   /transl_table=1
FT                   /translation="MQLRSGKRKIDAYQPTFDPNLDIATVVFSHVQCVGTRLRLAQVSK
FT                   LWRDASKLAAGYPRRFDFSDAEAKHLKMEDLRKYSFLIDNDVALSLPREQVFELLESFR
FT                   EKLGVPLWSPQEYLLHFAAFIGSVRMLKWARENDMLWPPTSIDYAWPAAYRGHLPALQW
FT                   LHENGCPMDERACLYAAENKQWHCLRYLVDNKCPGWERFSVPKTYAHRLR"
FT   CDS_pept        <217525..>218091
FT                   /codon_start=1
FT                   /gene_family="HOG000012701" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636683"
FT                   /orf_name="MICPUN_71821"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64031.1"
FT                   /db_xref="HOGENOM:HBG714721"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniParc:UPI000199B14D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S1"
FT                   /transl_table=1
FT                   /translation="DFGWTHKAKWIDHMVVAGAKDAPPVTDVNDDLARETHFYEQALGS
FT                   ANEAIRRLKELGVPVKRPHDYYAEMVKSDEHMKRVRAELIFEQTAQETREERRKAREQK
FT                   RYGKQVQAEKLKERTLKKKESIKNLDKWRKQRKQNNYAEEGAKAPEGFEDGFRSKDSPK
FT                   GRKRSTQETRQKREFKNEKFGFGGRK"
FT   CDS_pept        complement(219091..221727)
FT                   /codon_start=1
FT                   /gene_family="HOG000100074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636684"
FT                   /orf_name="MICPUN_59118"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64382.1"
FT                   /db_xref="HOGENOM:HBG561426"
FT                   /db_xref="UniParc:UPI000199B14E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S2"
FT                   /transl_table=1
FT                   /translation="MFLGRRRSNGHAAGAGSEDDDFDGGPDSVFSALSTMQADHIKSAV
FT                   AEVRQSGGKVIKNTNSALSNWDQVSYGLENRIAANGAFPLMLLAFVTSFVLGLFGVLWY
FT                   RLSSDTAELVFGQDSVADGVFMAVQLITSASFNDIPDENGLRLLYFVQIFFGLVVFAIL
FT                   VGFITDAVSQFMNSLASGRTKVAAHGHTLILGWNEATLRAVVQCSFLRRQYQMLNEGKF
FT                   FGVLFYFPALVPAFRRLGLLERPSTSLAVSDIVIMDNSISKEEMHIRLAQVLAERGILP
FT                   WRTKLGRNIICRVGNPTNVNDLIRVGAHRAAAILVMMTEHDTKEEDESGGRIFNGATLR
FT                   TTLALRQCLFTNPYDEKKGVTVFPGLRIVLQMLHPSEYVDAACFVHPDGKDVVIPMDLS
FT                   LFLNALMFKCAAQPGLSSILMSILDFEGSAIRRRKASNLRSGPNNAYGACVGQTFGMLR
FT                   REFSRAIFIGIIRPSMPKEFIKRRGFGLCPDPHIVIEPDDLLIFIGPKSNPVHSHEMLD
FT                   TFNGYIKEAERIRAANPEIEKGHMTSWETSSKIKSNVLVCGWREIWNDHPERLHARINE
FT                   VVRMRLAGSTITFVNGVAQELFKHHMLEHGLIHEETIKEGGNTVSIFGYARGHKHEGVR
FT                   LRHITGDAASASILSPVIMKNTIHTAIVLGTQTTVRLGAHHRDTRILNILLLLRKLWSI
FT                   KREGVPMHIVGENNEDMTARLALAPKRIGKIRTEPDFVNSQAVSARALVQTLAYPLIQP
FT                   AISDLFQESKNSAEIVTVAAQEYVPLDTPLLYGVVRAMVLQTRGERSICIGILWRAGHS
FT                   ELLVPHDQNVTLMKGDRLVLLRRMLSSDIQNRVEAATTFARMWKDRAMRRAAQKWAIPN
FT                   GDSESES"
FT   CDS_pept        222214..223698
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636685"
FT                   /orf_name="MICPUN_54325"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64032.1"
FT                   /db_xref="UniParc:UPI000199B14F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S3"
FT                   /transl_table=1
FT                   /translation="MSLILVRQEYGGRERPYVMRTNTSGGGHLLHYFCTIIVLLGFSVT
FT                   FAALAGMRAYLASQDTRTPLVREYNRAVDAWVKTGREAFTTRTDGFAWAVDKAPFGALA
FT                   RRNGTCGDGRTVPGSLAAPEPGQVALGTEDDGIDIARYELTSVLYGVKRAYIAAHDAAN
FT                   APGLEQVSVEIGRGRAKSNDVDSYTAFSTSFAPYECDVLSVPRSASSGHAGGGGDARNT
FT                   RNGGTWSPGHGAHGTTEVRCDECSRDDEAGAVTAVTAGCDARCLPGAADRDIVATRRWV
FT                   RRVVLVRSQVEDGKVAGIMRKPSAATCSLFHGETRTTTHESVWDARLACAHDRAPLTDV
FT                   DLELEVRARDDPHVLAGELTGCTFHFGRDADENAVAAAFFTLGAFVTLGLATYCVKKRK
FT                   GFERYDSRLTQFSGWNAWRTPVTAMDFASRDSRSRRGRANESAENAGEQSCDDETDHEG
FT                   AEDVDVDVDVDVHVDVEADGDGADAAASREAADERV"
FT   CDS_pept        complement(<223928..>224353)
FT                   /codon_start=1
FT                   /gene_family="HOG000029296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636686"
FT                   /orf_name="MICPUN_73396"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64383.1"
FT                   /db_xref="HOGENOM:HBG638995"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniParc:UPI000199B150"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S4"
FT                   /transl_table=1
FT                   /translation="PRASSAGDASPSVDYFATDKRPVILFDGVCNLCNGGVNFALDMDP
FT                   PGKLRFAALQSTAGRALLRRAGRDPDDISSIVLVEEDAAFVKSDAVLRIATYFSANPLF
FT                   PFAGTLGPVVPTFIRDAFYDAIADNRYDLLGMKDECRL"
FT   CDS_pept        join(224723..225157,225227..226252)
FT                   /codon_start=1
FT                   /gene_family="HOG000237857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636687"
FT                   /orf_name="MICPUN_97495"
FT                   /product="Predicted protein"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64033.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG587389"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000199B151"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S5"
FT                   /transl_table=1
FT                   /translation="MMRAPGAGRAARVAVVGGGAAGLAAARELRAEGHTPVVFERGDDV
FT                   GGVWVYDPRVEVDDVTGTDPNRARVHGSMYASLRTNLPRECMGYESFPFTRTFAGDDRR
FT                   FCGHAEVRAYLAAYADHHDIAKDVRLRREVLSAEPIDISSRRWGPRWRVTTREVTVGDD
FT                   DGGVVSVETFDAVVVCNGHYSEPRTPRYPNAENWPGVQMHSHNYRTPDDTFEGKKVVVL
FT                   GAMASGEDLSREIATVACHVVLAARGFVPGAPKDDFPVESYPKNATLKPGIVELIPERS
FT                   GVKFEDGSVEEDVDVILYATGYQYAFPFLANAAVDNSAISAVDNCVSPLYKHVFPPALA
FT                   PSLSFIGLPWKVVPFPQFETQARWIAKALSGAAPLPPRREMRLDADAFEESLGAKGIAR
FT                   RHAHRMGDAQFAYNDELRALCGHPPLGAWRAEMYAATGARKRSQPASYRDGPIPWSDED
FT                   ARFAARAEATAAGFETDPARDEVQAGAA"
FT   CDS_pept        join(complement(226412..227084),complement(226312..226355))
FT                   /codon_start=1
FT                   /gene_family="HOG000100073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636688"
FT                   /orf_name="MICPUN_59122"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64384.1"
FT                   /db_xref="HOGENOM:HBG561425"
FT                   /db_xref="UniParc:UPI000199B152"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S6"
FT                   /transl_table=1
FT                   /translation="MRVSATRALCGEATVAPLGTDEVWREKKLGRANRATTSSHSRPRN
FT                   ATMQLRSGKRKLDAYQPTFDPNLDIATVVFSHVQCVGTRLRLATASKLWRDASKLAAGY
FT                   PRRFDFSDPEAKRLKTEDWRKYSFLIDNDEALSLPREQVFELLESIMREVLRVSWNTPL
FT                   ENLLHFAAMIGSVRMLKWAQENDMHWPPSSINYAWLPAYHGHLPALQWLHKNGCPMDER
FT                   ACLPRVGVTHSHIRYL"
FT   CDS_pept        229433..229939
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636689"
FT                   /orf_name="MICPUN_82955"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64034.1"
FT                   /db_xref="HOGENOM:HBG561428"
FT                   /db_xref="UniParc:UPI000199B153"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S7"
FT                   /transl_table=1
FT                   /translation="MRRGRRRLLAEGNVAELQPGGEWEGRPGELALARFNYYKCGKCGE
FT                   PYFGGLRECGGEPGGGGGDANGDAELMCGGCSATVSGLSGACAKHGRDELQFKCRFCCS
FT                   PAVFFCFGSTHFCERCHVTRPDWKPQPPPKTCTRATCPLGVDHPPHGQEFCLGCALCRA
FT                   TDTGY"
FT   CDS_pept        complement(230040..233123)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636690"
FT                   /orf_name="MICPUN_59124"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64385.1"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI000199B1FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S8"
FT                   /transl_table=1
FT                   /translation="MAEIPPGEAALPAASKITIDDESDDTESDTTPAEIKAKIERDVDE
FT                   LFKTKTVEEMEEIEKKLRGDLETMDAEIARTIGGSWKDFMENSKDVDLITSNLQEIADG
FT                   FAVVRDTLAELPEIIRKNNEAMEALRAPQEPEEFTPEMATFAAGSRLKYLVDTPEKVWG
FT                   ALDEREYAGAAMRYAASRDCVAACVETSEPPHLTRDEAHKKFPALRQQPAALDSLRGQI
FT                   ARAARKALESPKAPRETLASALAASIIVEGMNAERSLVLYLQTRRAWCRATLRRCGGDG
FT                   AGVDRVAGALARVLAEPARAIASARACFLGGESPTGESPTGESPPPPLVYARLDEGWDE
FT                   TDVANVLFAGVVDPRREVEAWRRVVESAKPARLSRARIAALCEEWLAGVASDVLVATTE
FT                   KGFMGGIRTVDDLVSVESVARAKLAEKRSSADDVAACVDLLGREVDAWATLAEEPTSHR
FT                   ARTLLSATLRHGGLRTAVDAALQAVAPPAPRTSALSPPAEAAAMWGGDWSGGDSPGSDW
FT                   SGEQPPSKSPRSALDGPDRGVNASRDVAPANVAAARALAGKFAAALAAARGDALAIGTP
FT                   GGRLKLKPTFSISNPQRDAPRLATLEAFVRGECHAGAMATADFLWKRLEAYEKDAAAGD
FT                   DVAAERCLLVAQTAQFARLAPEELGALMGPARDWNADAVALAKQRRRAAKSSAKSNRFQ
FT                   LFGSTNQNASDKNNAAEDPRLAESLAALARVAHRGFRAWAERFARTVGVELSRALPQDE
FT                   RLGSQEVPRDWEEESGGDGGEVSLRLPALPSPYALGCLHAASSEALRCGGHLMSHDGIA
FT                   ALVRATAKECGGAYADFVQSATSTSDRLSERGVLQALFDLRFVMEVLLGPGCMGGGRGK
FT                   AGGKVVGDANDEGDALVAAQRAERTLAARLDPIDWATYESFLWRNERRAYSRCATLLGL
FT                   LTQSHRAPAGAEKVLPATSSDAKATTPPPRFTYLPVSLPAARGKGGGKGDGNVGAVDWS
FT                   LAGFDRFGEPDETRGAGDEGGLLGKIGQGLGGWVRGVV"
FT   CDS_pept        233428..236910
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636691"
FT                   /orf_name="MICPUN_59125"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64035.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199B1FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7S9"
FT                   /transl_table=1
FT                   /translation="MGGKKKKPGKKSSKKSGNAAETGSQKSRSEMGDSDDSENEGGVEP
FT                   QSTESGPVETVPEAAATNDEAAEVAAAVAASAAADPAPAKPPDPAPAPPAPEKPPFEGT
FT                   EEEIAAAKKIQALQRGRQARGEFAKLKAAKAAKPEDALNTSTESDDAAAKDLRASQDAA
FT                   MLELLRKERVELTAALADARVTIKLAEDKANAAQAELEAKTQEMDAKIAQADAKATEER
FT                   ERAERLEHQVEAFDKSAASAVGSATNERKAKVEAELERDNAIKDMEKEKAKAAQAVAEA
FT                   AKKIADAEAKTAEERGLYDATMKRAHDAEERVRESKEALLAMRAGLIRMATVMGDSREI
FT                   RDFMRAMRAAEDSEEGSNEGIPGEPGADHQRSVNESSVAASADAARLVASNDDRGADEL
FT                   VDECIDKLHHFLSVNADEKKELRAQVQAQQRFSKDSVGGLGMGGIGRSAALSPTSPRAS
FT                   NAWKQPWERSEALSPGASALSPMAKDIAMMDMSELRTELERSRRYTTRLQTRFDKLNVE
FT                   VTHQANMTLKAIEERDEAVAMLLAKAKSEEGAREDSENRARQLRAEIAQLKTDLDKRDR
FT                   RFKQLTPLDAVVTEEFTKMRKEVDAARRADPNAGPSAHDDAVTASAVTALCSRLEKATA
FT                   LEKECDDLRKINAFLRRQGGSLDSSGGSGGISAAVESVMKESEDVIAALNRDGVKAEEV
FT                   PLTGSNTEKWRQVAMAFSGSVGKGSPPASPGALSGVLPPPPAEGNGGDDAPMSAAEVAR
FT                   SMDSLRSSILKPHGPSEPLGSAPGSVSASYSTTSRMTYDSPGGAYSKTITRPDTGSAIK
FT                   VRSVHQLRQTHTGGTFAPPRELFRGSPYSARNSPKPRDVGPKPWDAPSAVLPASERVNP
FT                   GPEWFQDARHAWDSYTDALSQVEAQRELEKEKREYAKYESLLKSGYNAAEPMRLPAHLR
FT                   VKDALASEAEVDRAVKRFVKTLSEHGASVSLRRNGPCKYMLSRTLTSAAQRGGRPGPSG
FT                   PAPASKIVMLRMISNRLVVHRGTNLPPLDLLDAVVGYVQPYKPPGPVRKVADGLGREKK
FT                   WLESWTGKAGVKSPPAAASPKPVDFSQMTRERYPEDETVPPVPQSPAKSPTPQAAGLPG
FT                   TPPGTLPKSPATPASNTPTGPRPFLRVDKEPTPEKKPVPEKKPTPEKKPAPAV"
FT   CDS_pept        join(complement(237890..237937),complement(237473..237559),
FT                   complement(237042..237275))
FT                   /codon_start=1
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636692"
FT                   /orf_name="MICPUN_90989"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="ACO64386.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG755218"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI000199B1FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T0"
FT                   /transl_table=1
FT                   /translation="MAAIMNISASARVAPKVQLRSASSKALKAKPAFVAKASFRVNAAA
FT                   SDDTLTKVRTIISEQLGTDLDAVAADAKFVDLGADSLDTVEIMMALEEQFEITLDEEGA
FT                   EKIATVQEAADMIQEQMA"
FT   CDS_pept        238518..239342
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636693"
FT                   /orf_name="MICPUN_59127"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64036.1"
FT                   /db_xref="UniParc:UPI000199B200"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T1"
FT                   /transl_table=1
FT                   /translation="MDSERLARVKRKLEALNYDGDLDPKSAPLAEKLVDDLLNATNSYK
FT                   SLKLRLTKQSKAQDNWEAKLMTLKQENAALLEENSQLRLQLIHNDELCDEKLRRAFAES
FT                   CKLQRSVTELKFWKEQAIQRNVQFERLHDEIRGRLKSGNYQVVSTEQDAQARMELTAML
FT                   DTANIENHWNVNVLISGADDRAAALQERLAHADHELKRMHEEVAAAKAAVASREGEVIR
FT                   LHSLLDKATDVDHLALKIESETKDALIVALSQQVEELNARIVKTESGREEHE"
FT   CDS_pept        complement(239441..241399)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636694"
FT                   /orf_name="MICPUN_59128"
FT                   /product="Umuc-like DNA repair protein "
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO64387.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI000199B201"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T2"
FT                   /transl_table=1
FT                   /translation="MEGAASAEKRSVEDFRVRVHGGPHPLRAGSEGGATTFGRDDDAGW
FT                   APRPPDDANASRRIVAHFDVDAFYSQVEELRDPRLRGRPMAVTQKFLIVTANYAARSAG
FT                   LKKLMSTTKAKALCPEVALVSGEDLTPYRACAKKVRAALERFGTCEKLGLDECWVDLTA
FT                   EVDRRIAAGGPASDPPLVGHRHSSEHVVESDNAHRPMDIRAVDPERTNASDGVHHPVPP
FT                   RCEDGADPDANPDVSDPARERRLRVGAAIAAEARDAVRSATGLRMSAGIAHNKMLAKLV
FT                   SGLHKPDDQTTLPAGVAAKLVSPLPVRALPGVGHGAERTLVHRGVRTAADLRRVTRSEV
FT                   CEWLGPRVGRKVHDAAWGVDREEVAPKPAPNFVTCEDSFRSCTTWSSVDAVLAVIAPDL
FT                   LARMDEEYEDEVERTVGAGALIPAGRAARTLTVKWRDVGPGGKGTGWSRSSASTTMPTL
FT                   ANDRSIDAKRRADALREAATRVLRSELTRGFDLRALNVGAGNFEPKAVTLNKRPGVEAG
FT                   CVSGSSGIDVGTGRAAPHGSAFAAMNARRDYDRGGGRMSKTEERALSERERGLGGGVFG
FT                   GGLNGGGGGESSDVFAEPLRDQDEDEEDGDSFYADLADVQRSSAMPSIGRVQSLVPRKR
FT                   GAEQASLLSFFKGPSKR"
FT   CDS_pept        join(complement(244987..245211),complement(241488..244871))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636695"
FT                   /orf_name="MICPUN_59129"
FT                   /product="Ero1-like protein /fumarate reductase "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein thiol-disulfide exchange "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="ACO64388.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006467"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561434"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199B202"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T3"
FT                   /transl_table=1
FT                   /translation="MCVASEVTAVTARAQTAKEWQVRGEVGDAACNVEEVETANEQQLH
FT                   EILAELTNTTYFRLFPVDLSRKCKFWNKQKETDEDKHEPSCSAPAEEDPSNPFGGGSSN
FT                   AFAPAEQAPTACSLDLASKDPGSMKWAPATTPVDRRITEQEHVAIAANDDGANDCADAD
FT                   LPEFWMDMCGYDAPPPGSEDHGALEYVNLQLNPERWTGYNGSHVWSAIYEENCLKQSGS
FT                   VDDMCYEERVLYRLLSGMHASVNIHIALKAKTPKKGVVGREDWSADPARFAAHYGQHPE
FT                   RLRNLHFSFVVLLRALRKAAPTLGVMDLSLGQDKAEDARTGALMRRLLDTHILSSCSGV
FT                   FGAFDESMLFRGGAGVNGEASSPVAELKSQFKGVFHNISEVMDCISCQKCKLHGKLQLL
FT                   GLGTALKVLLLPEHLHATALSRSEVVALVNTVAKFSHAILAAPELAAAHSDASTRAATA
FT                   AAPVPDLSSAGIMTASSDWTPATTRSLMDAAISAVAALASDGAIGAADEDALVDAAVAA
FT                   DPRVLILARHYGVGDPSKFAQHALRAVRSGPFVGYSSYTAVASSSVKSSQVDVVVVGGG
FT                   LAGLTAALTALDRGGRVTLVEKEGYVGGNSQWASSGINGVDLTNATNPDTVETFESDCW
FT                   RSSLGGGAGAATGATLGCDAVGQSRSKSNDDASKSDNSTPNKNDSCSALGGPSPESVEH
FT                   IPTLAAGSVETLTWLRDRVGVDLSRVGQLGGHSHARTHRPASGMAGSTLVLALQKQCET
FT                   YAKSGALTWRKKTRVDEITMDPATGAVSGVRWTTKDGTVGFDSAKSVVLATGGFANDRE
FT                   GPDSLLRKHAPDSTRFATTNTKGTTGDGHKLAFGVGAQGVDMANVQIHPTGFVDPNDPK
FT                   ASTKTLAAEILRGAGGLLLTRDGRRFADELGTRDYVSGRMLAEAKAEAAAGGLEVGEDV
FT                   SLDFALVLNDAGAREADKHVPLYTQKGLLREFDTVEDLAAWLDDELRAKDMRGHHAADT
FT                   VATVRATLAAYDAVAKSGGPDPETNKTFFHNAPFLVPSGKFYAGRVTPVVHYTMGGVRV
FT                   DNLGRVVREGGDGSVIPGLYAAGELIGGVHGRNRLGGNALTECAVFGRIVGGDVPVASS
FT                   SFVDAGGGAAPTAAAPARTARRDVTREELSRHKSEESCWVAVYGEVYDFTDFLDEHPAG
FT                   AEAILKYGGTDGTAIFDSVHSRDMLDDFDAVGPLVD"
FT   CDS_pept        245882..247126
FT                   /codon_start=1
FT                   /gene_family="HOG000230773" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636696"
FT                   /orf_name="MICPUN_104847"
FT                   /product="Cysteine endopeptidase"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64037.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG746690"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="UniParc:UPI000199B203"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T4"
FT                   /transl_table=1
FT                   /translation="MTRRVILFLAALMLLLVALPGATAARIVPSETLQLKQLRHAAAAK
FT                   INQLKAALGEKATKEVGSLSDLFHEWTQKHGKTYDSEEEKELRLKIFADNHEFVQKHNA
FT                   EYENGEHTHFVGLNHLADLTKDEFKKMLGYNAALRASRAPVDASTWEYADVTPPEEIDW
FT                   VASGAVTPVKNQKQCGSCWAFSTTGAVEGVNAIKTGKLISLSEEELISCSTNGNMGCNG
FT                   GLMDNGFEWIVNNRGIDTEDGWEYVAKEEKCGFFRRHHRAVAIDGFKDVPSNDEDSLMK
FT                   AVSQQPVSVAIEADHQSFQLYAGGVYSAKDCGTELDHGVLLVGYGVDPKSTKHKHFWKI
FT                   KNSWGPAWGEDGYIRIAKGGSGVEGQCGVAMQPSYPTKLGTTPLGEPTLFEKGEELLDK
FT                   GMDFLQKLAESNGGD"
FT   CDS_pept        complement(247685..248068)
FT                   /codon_start=1
FT                   /gene_family="HOG000223544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636697"
FT                   /gene_name="LSM"
FT                   /orf_name="MICPUN_100884"
FT                   /product="Like-sm protein"
FT                   /protein_id="ACO64389.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199B204"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T5"
FT                   /transl_table=1
FT                   /translation="MSGGAVDAWQVSAVASLVEELDKKILVVLRDGSKIIGFLRSFDQF
FT                   ANIVLENACERIIVGTSFSDIPLGLYIVRGENVVLMGDIDETIETEGLTEVSNEEIKRE
FT                   REAEKAADKFKGEMLKRMDFLED"
FT   CDS_pept        248878..250239
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636698"
FT                   /orf_name="MICPUN_54332"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64038.1"
FT                   /db_xref="UniParc:UPI000199B205"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T6"
FT                   /transl_table=1
FT                   /translation="MLLAACVGSEVRPAPTAMPPAADMFRGMSLEDAPHKPQSEPEPEP
FT                   EPEPEPVYEEEVEFSSFTSPAPASAEEIMFDGMEMAEPAREEASEDFADFASATPEPEV
FT                   NPEPVADPEPQPEPMVDPEPDSEPEPEPDVENQELEDGFDDPFAAPIENMRMSVSHDDI
FT                   PSVVPVATADEDAEVEESAAERITAEEEDADKWAAFGDAPTREPEMEVEPEPVVEEDIF
FT                   GEFESTPPLPVVSEPANTKYDGFTDFATAPPPIESPAASMTPAGSLDDLFGPMDNKPMS
FT                   MSTEDIPSIVAVEAPTETEVDDDDDDDDGGDGGGGDDDDDDDGFGDFDAAPSPAPSPQL
FT                   ADLSDAPTGEEHARPVAAPEPSIDDLFGAPIEDKPLDMDMFRAPGVVTPSAPTSVDDAF
FT                   GAFESTPVALETDGADDGSPAFADDAFGIFEQSTAPTPPTQATKDPFAEFASLI"
FT   CDS_pept        complement(<252842..255292)
FT                   /codon_start=1
FT                   /gene_family="HOG000068177" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636699"
FT                   /orf_name="MICPUN_83049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64390.1"
FT                   /db_xref="HOGENOM:HBG402910"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B206"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T7"
FT                   /transl_table=1
FT                   /translation="MYHSFGFESVKRNNLAYLADDVIIFTVGNMTQILNLETQEQTYLH
FT                   GIDGRGVGMVMVHPTREYFAVGEKGTNPNVYMYEYPSLRLVRVLSGGTEEVYSCGRFSP
FT                   DGSKLATVGNYPDFMITIWDWDKESIVLRSKAFSQEVYDVSFSPTFPGYIYTSGTGHIR
FT                   FWKMASTFTGLKLQGDIGRFGNVDLSDISGYAELPDGKVISGTETGTLLIWDGGLIRAV
FT                   LVRPDGEGGAFKPCHEGMIEVVRFDNATKTISTTGADGHMRWWDYATVRDAEPEDDRIE
FT                   VLIEPVKEAAIGDGAGGLCSVKSIITTEPDHWLVQDANGGIVRVAIGEGGELGESRQLT
FT                   SFHGGCINGMDISAVSDHAVTAGSDGTVRLWAYAERREVYRSKFCAGATFVQMAPAYVD
FT                   GSQRTVIAGFDDGVVRILLRCSDGFKIVDCFKPHNKRVTVAKFSPDGSVLATGSADGTV
FT                   FFLAAKYPKSPPKTPKLPGVTLAPIGFAKAPGGVSALQWHENMKEPKLLVGCETGHAFE
FT                   MKAPNWKPGQPDSVDSTITFEFEATATHYTFNRPRPTAMSIVESKYPPVGDERDAADAA
FT                   EKAAIIEQKRVMALEAEQLQKELDEAERIAVYPVKHIGYVPFSGGNFELALGGEAAGKI
FT                   WECQFGAKDPMRGTKTRQSALTVTRASVSGKLSVQAFEDGTVRVAPSRGKSYWVGAVHD
FT                   GIYGSVTGAAVTRDDSFLLSTSSDGSFFVQKIGAGLLTERVPATDAEEVTSVAEDPTPA
FT                   VEDITDPTKYSFEEEKIKLAEDIARAAAEEAKLGVRGYINKLRDEFQALLAENEARPPH
FT                   ERLPR"
FT   CDS_pept        257575..258156
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636700"
FT                   /gene_name="RSP12"
FT                   /orf_name="MICPUN_96416"
FT                   /product="Radial spoke protein 12, cyclophilin-like protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64039.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199B2B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T8"
FT                   /transl_table=1
FT                   /translation="MREYVAKSGREYVTMEVSIGGEVEGKLLIELFTDHAPKTCANFKE
FT                   LVKGGHDEIPDGEGYKGCLIHQVHVGGWFQTGDVVNKDGTGPQCCIYGESFGDECFRVK
FT                   HDRPGILAMACAKRNKNGCQFYVTQCVLDSLDGKRVGFGRVIDGMRLMKMIDRVETDAY
FT                   QRPRQPIKIESCAMWTPTPEEEEAKENDEP"
FT   CDS_pept        complement(258194..259294)
FT                   /codon_start=1
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636701"
FT                   /orf_name="MICPUN_82889"
FT                   /product="Predicted protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64391.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI000199B2B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7T9"
FT                   /transl_table=1
FT                   /translation="MAAPDFLIKKLESSERTHKELTFRLADPDVASDAKEFQKLSKALG
FT                   ELTGVVDMYARYKECQAEEADAREMVKDAAGDAEMEAMAREEIAALKGEMDELEEKMTI
FT                   ALLPKDPLDDKNIMLEIRAGTGGDEAGIWAGDLWRMYQRYAQSKGWSATILSSNAADFG
FT                   GYKEIVVEINGDSVYSELKWEAGVHRVQRVPATESQGRVQTSTATVAVMPEVDEVEVKI
FT                   DDKDIEISSARSGGAGGQNVNKVETAIDLLHKPTGIRVFCTEERTQLKNRIRAFQILRA
FT                   KLFEIQLEEQQKEIAGRRKAQVGSGARSEKIRTYNWKDSRVSDHRLGQNFPLDNFIGGD
FT                   IGPAIGGCQAMEQQEKLEELNAEMTV"
FT   CDS_pept        join(259685..259762,259891..260787)
FT                   /codon_start=1
FT                   /gene_family="HOG000276737" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636702"
FT                   /orf_name="MICPUN_59138"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64040.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199B2B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U0"
FT                   /transl_table=1
FT                   /translation="MGAADNEEVPVVSTELYHKDFDAFVKALGAAYEKYGFVILQNHGV
FT                   SDDLISRALDGSKKFFALGEEEKKKYHLAGLGGARGYTGFGVETAKGSTKYDLKEFWHL
FT                   GRDLPPGHRYEDKMPPNVDVEEGEFTAVTKEIFAALDALGGRVLEALAVHLGQPREYFG
FT                   DKVNEGNSILRVIHYPPLARDGEDGAVALANAGHVRAAAHEDINLITLLLGADEGGLQI
FT                   LRRDGTWLDVNPPPGCVTCNIGDMLQRLSNRRLPSTTHRVVNPGADRAHLPRYSMPFFL
FT                   HPNPDFVIDTLATCVSDKYPNQFPTPITSDDYLQERLREIKLK"
FT   CDS_pept        complement(260981..261772)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636703"
FT                   /orf_name="MICPUN_59139"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64392.1"
FT                   /db_xref="UniParc:UPI000199B2B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U1"
FT                   /transl_table=1
FT                   /translation="MAENGAVAEPVEEQQIDRIDEVMQRPSLLDVVQERVVTVKGDAAC
FT                   KIPGVIPARIVMLCENREKVTGRDEAQAFWTEILTAAGSGDADARCAVLAYPEATVVAV
FT                   EGTTSTVGEVAKELESAHERVAADKGQYTSIRVVSTTEDMAKFVLPGPGVYASFVNSPT
FT                   AEAYEELEPERVFKATSAVNVAVLGLGMKLRGMSSGERELALKDISAVAPELPTLKQLM
FT                   GLLKQPEGAPTLTEFLEVYDSPLDVDLDGENVWPMPSTLNF"
FT   CDS_pept        complement(262054..262722)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636704"
FT                   /orf_name="MICPUN_59140"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64393.1"
FT                   /db_xref="UniParc:UPI000199B2B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U2"
FT                   /transl_table=1
FT                   /translation="MSSIRYVAVTAFVIALVASSAAASTSRRENTASAKTSEETFAGQR
FT                   ALEELSHTPDTRERDGKPDSDTSEGRWFGWFGWGHKYPYYYSYSYPHYNYYSNYWCGTP
FT                   YYGGGSHGGYNGGYNSYYKSASGEIKDEMKSRQVLPRDQLAKQAMQRQTIAAKRVPASA
FT                   CSEWLGVTLNEISEAPNEVAVVNDGCCFPSGCALAPSAGCFAQDGQSCCVPDSERKETC
FT                   "
FT   CDS_pept        262913..263626
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636705"
FT                   /orf_name="MICPUN_100888"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64041.1"
FT                   /db_xref="HOGENOM:HBG607600"
FT                   /db_xref="UniParc:UPI000199B2B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U3"
FT                   /transl_table=1
FT                   /translation="MAAISDSDDDIPPYSDLSSVSSDSSDRIRGNVFQKALYRVDRARG
FT                   KTEDFLNDIHESYSFDLDPEYRLKLQKRFDGWGVGAKFDFKSGDCRVKVKSAPRRGGED
FT                   GFRFWRWFKKVEVQPEDGDVEVFTKKLQFGYLSLQGIGGYKSATNGFNARWKIETTFWE
FT                   SSPAMMALRRSEVALDPDERIKMALRWDLDVKPPKAEGGIGDGNDGGYDLDLGTYHVAI
FT                   PRLELKVDLTSKDRL"
FT   CDS_pept        complement(263668..265059)
FT                   /codon_start=1
FT                   /gene_family="HOG000046975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636706"
FT                   /orf_name="MICPUN_54333"
FT                   /product="Predicted protein"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /protein_id="ACO64394.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="UniParc:UPI000199B2B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U4"
FT                   /transl_table=1
FT                   /translation="MAQISQESLDKGVICSSAGNHAQGVALAARQLGCDAVICMPVTTP
FT                   GIKVEAVRRLGATVALEGENYDACQAYAKRRAEEEGRTFVPPFDDPLVVAGQGTVGMEV
FT                   VRQLPSVEYVFVPVGGGGLIAGIAAYIKSIRPDVKVIGVEPEGANAMLQSLFHGKICRL
FT                   NKVDGFADGVAVRQVGDVCFDLCQQLVDGVMTVKTDEICAAIKDVFEETRSILEPAGAV
FT                   AVAGAKLYGQVHGIEGNVVAITSGANMNFDRLRVVSQLADGGLKQEATLLSIIPERNGS
FT                   FKHFVELVGTDVNFTEFKYRVTESADAVVLYSVSVDDEKDLEACIKNLRENGINTENLT
FT                   EDEATQLHLRHMVGGSTGVSNERCYKVEIPERAGALDTFLNAVSPKFQITMTHYRSDGT
FT                   AQGKVLFGIKVPDTERPALEQALNSTEMQWEDMTDTMAFKLLYGCERSGACEINFGADE
FT                   KLTPP"
FT   CDS_pept        join(complement(266637..266690),complement(265716..266540))
FT                   /codon_start=1
FT                   /gene_family="HOG000242993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636707"
FT                   /gene_name="RAD51D"
FT                   /orf_name="MICPUN_96417"
FT                   /product="Rad51 DNA recombinase 4 "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="ACO64395.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG561438"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199B2B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U5"
FT                   /transl_table=1
FT                   /translation="MELSAERLEQLYLEVAPQILDGPAIEQQLSKLNFLPTGCDGIDDL
FT                   LEGGLRQGQVTELTGEAGSGKTQLCLSAAASAAALGHRVVYLDTGGGFSAKRIKEFHRG
FT                   FVTADADSAEVEQHLSLTLDLITVLNVHDILTLFKVLEELALGLSGDPGVPGDGGLEGN
FT                   QDVVDIGRDMGLLVVDSLSSLLSPVITRLHHQGYTMMASTASLLRSLAPAHNCAVLYTN
FT                   HTVSAGGNDRGGASIKPALGTRWTSTPHRRVCLGKGHGNDAQGCTAEVIYGPGTGSSCA
FT                   FKVVGDGIRTL"
FT   CDS_pept        266979..267875
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636708"
FT                   /orf_name="MICPUN_108396"
FT                   /product="Predicted protein"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64042.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="UniParc:UPI000199B2BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U6"
FT                   /transl_table=1
FT                   /translation="MARGMSPSLHRPSQPAAPRKFRCGAHAWSMPRGSLRRDDREARFG
FT                   SGLSTVVAGRINFRRNVSASAKPKGGKKESDDDAIDDGELDVDEDFDDAELAEIEESGE
FT                   NEIETDEAFFTGGTEWGQMGLDVLREVLNEDEFDGELEIFSYKVSAERKRIYISIDAVN
FT                   DKFGSPTLDQLGAVSRTYNTVLEEKGFPDDVALEVASPGAERQLRLPLELERFRDLTMK
FT                   VTYAARAEEDGAEGTRTKVLDVEDIDEDGSPTFKLADVEENRPQAKKGQGMNKKQRDWR
FT                   LKLDVGDISKANLYVGF"
FT   CDS_pept        complement(267959..268897)
FT                   /codon_start=1
FT                   /gene_family="HOG000006978" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636709"
FT                   /orf_name="MICPUN_59145"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO64396.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B2BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U7"
FT                   /transl_table=1
FT                   /translation="MGRGEKENADVAKATKPVGKSATSFIAGSTAGLVSSGLLQPLEVV
FT                   KTRMQAHRLKAGFSINKSAWATAGCVVRDEGIRGLWAGVSASCIRTACGAGLYFLLLER
FT                   VTRELNTKFPASKDASQTLQGARTFAIGAASRSLAAAMLCPLTVVKTRMEYASISGTSY
FT                   TGVANALYTIGAKEGVKGLFSGLGSTLLRDAPFSGLNLMMYTHMRTVMGEVAAAQGRET
FT                   TSMDTFFAGAVAGGAATFLTHPPDVLRTRVQLGRPSASFVKIVTEEGVRALWVGSFPRI
FT                   LRRTLQQAMTWSLYEHVAKLLGGTSLSPKAD"
FT   CDS_pept        join(269031..269927,270010..270093)
FT                   /codon_start=1
FT                   /gene_family="HOG000231279" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636710"
FT                   /orf_name="MICPUN_83025"
FT                   /product="Predicted protein"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64043.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG621298"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011943"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B2BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U8"
FT                   /transl_table=1
FT                   /translation="MAEEGKITVAVKWQGKQFSISVPEDADVACLKRCIEAETNVQPKR
FT                   QKLLNVKSGPKPADDDVLLSSVKLPKVVMMMGSTEQSINTVAQAAEAAPEVLDDFDVGV
FT                   NEEIDCRDREENKEKLRRRIESYHVDGLNPPREGKKLLVLDIDYTLFDHRSTAEVPEEL
FT                   MRPYLHEFLTQAYQEYDIVIWSATGMKWIEVKMRELGVLGSPNFKIMQLVDHGAMITVQ
FT                   TEKYGMFDCKPLGWLWAKYPQYTERNTIMFDDLKRNFVMNPQNGLRIRPFKKAHLNRGT
FT                   DRELVGLTKYLLAIAKLEDAQFMELKHSKWEKYIGEDYGKPNAKE"
FT   CDS_pept        complement(<270168..>270965)
FT                   /codon_start=1
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636711"
FT                   /orf_name="MICPUN_76127"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64397.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B2BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7U9"
FT                   /transl_table=1
FT                   /translation="VAGAIAGTLVSIVLHPVDTIKVTIQADRKVREPIAMVVSRIIRQR
FT                   GVFGLYSGLSTSLASSAPISAIYTASYELVKGRLLPGLPEEKRWIAHCIAGGCASVATS
FT                   FVYTPSECIKQRCQVTGATSAFAAAKSVVRADGVLGLYKGWSAVLCRNIPQSAIKFFVF
FT                   EQLMRAAGGALASGGGSSGTLPALAIGGVAGSTAAMFTTPFDTIKTRMQTAGVVNQGGS
FT                   TMRGLLPTMRDIVVNEGVGGLYRGVIPRLLIYVTQGAVFFSSYE"
FT   CDS_pept        271482..271733
FT                   /codon_start=1
FT                   /gene_family="HOG000264455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636712"
FT                   /orf_name="MICPUN_59148"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64044.1"
FT                   /db_xref="HOGENOM:HBG561440"
FT                   /db_xref="UniParc:UPI000199B2BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V0"
FT                   /transl_table=1
FT                   /translation="MGTTKDPKLWINTKKLGKKIIPCNDEMLALLACFKKCDFVGTESK
FT                   CAAERKKLDACLMFQAKQPKKKNTINFHLQRLARAARR"
FT   CDS_pept        complement(<271926..>272976)
FT                   /codon_start=1
FT                   /gene_family="HOG000275238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636713"
FT                   /orf_name="MICPUN_68819"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64398.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG284241"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199B2BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V1"
FT                   /transl_table=1
FT                   /translation="SPEESLECVLVGTDVACVLSEDEGDRLDGAKETRDDDSTSSILAA
FT                   LGGVALVSPFFLWGTSMVAMKEVLPATSPLFVASVRLVPAGAVLVAWAASKGRPMPSGA
FT                   MAWLAIAIFALVDGTAFQGCLAEGLQRTSAGLGSVIIDSQPLTVAVLAAIIYGESLAPA
FT                   GVFGLFLGVVGLLMLELPKEALAQIGGGDLGGALAAVTAGVDDGGGIWDSGEWWMLLAA
FT                   QSMAVGTVMVRWVCKYVDPVMATGWHMALGGVPLLAYSIATEPGVYENLDKLTAGDVGG
FT                   LMYTSLLGSALAYGAFFYFASKGSLTKLSSLTFLTPMFAALFGYLLLGETLDEVQLAGA
FT                   AVTIVGIYLV"
FT   CDS_pept        join(273737..273835,274023..274877)
FT                   /codon_start=1
FT                   /gene_family="HOG000168011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636714"
FT                   /orf_name="MICPUN_97504"
FT                   /product="Dehydratase"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO64045.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG381459"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B2C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V2"
FT                   /transl_table=1
FT                   /translation="MVTGGTGLVGSAIKEVIDAEGNSEEKWVYLSSKDGNLCDPAAVAA
FT                   IFDKYQPTHVIHLAAKVGGLFANMKHKVQFWRDNVNMNDNIFQECHKRGVQKLVSCLST
FT                   CIFPDKTTFPIDETMIHDGPPHFSNEGYAYAKRMVDVQNRMYKSQYGCNFTAVIPTNIF
FT                   GKHDNFHLEDSHVIPGLIHRGFNCKKEGKSFDIWGSGKPLRQFIFSIDLAKLMIWTLRS
FT                   YDEADPIILSVGEEDEVPISDVAYAVAKSLDANIGGTPLEVTFDTSKADGQFKKTANNH
FT                   KLRKYLPDFKFTPFEEAMDITVKWFLENYETGGVRK"
FT   CDS_pept        join(complement(275271..275444),complement(274945..275166))
FT                   /codon_start=1
FT                   /gene_family="HOG000079014" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636715"
FT                   /orf_name="MICPUN_59151"
FT                   /product="BolA like protein"
FT                   /protein_id="ACO64399.1"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniParc:UPI000199B2C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V3"
FT                   /transl_table=1
FT                   /translation="MGSLSQSSHSQLAASGRLHEADVSRCVAHRFTTSAKAWMANGGEA
FT                   SGPGPLIEQMKAKIRVGLDAQFVDVVDMSGDARHVGIQVVANAFEGKNPVNRQRMVYKC
FT                   IWEEMQTDRVHAVQRCETKTPAEAEAK"
FT   CDS_pept        <276167..>276863
FT                   /codon_start=1
FT                   /gene_family="HOG000174759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636716"
FT                   /orf_name="MICPUN_70339"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64046.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG738163"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199B2C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V4"
FT                   /transl_table=1
FT                   /translation="NAGATKELEIDTEKDRDGRAIREKVLKTAAERADGFEDDKKYRGL
FT                   NSYVDYRAGFRKEHSIASEKGSGAHGPMRASSNVRMTFIMDYKPDICKDYKETGYCGFG
FT                   DSCKFLHDRGDYKQGWQLDKEWEEKEKQRKAALAKLEQMERNMGEDGVCVPLEDDEDDE
FT                   EDGIPPACPICEKTWDAIRDPVVTKCKHYFCEHCALRHNAKEKACFVCHRPTGGTFNTA
FT                   KEIVKRVKEM"
FT   CDS_pept        complement(276991..277860)
FT                   /codon_start=1
FT                   /gene_family="HOG000233050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636717"
FT                   /orf_name="MICPUN_108397"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64400.1"
FT                   /db_xref="HOGENOM:HBG748003"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000199B2C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V5"
FT                   /transl_table=1
FT                   /translation="MECAYRRRGNSGKPVVLIHGFGVSSFQYREQLSALSKNNKVYALD
FT                   LVGFGKSDQPDLEYCMEFWRDQVVDFVDNVVGEPAVLVGNSIGSLTAIHAAAKKPECTT
FT                   GIVLLNCAGGMNNKVKRMPGDFDGFGWQYKAVIPIFNVVLAIIDFVLKTPVAKPLFDNV
FT                   RNEESVRNALKGVYKDSSRVDDALVQSICTAAEREGAFGAFVRILTGPPGPRPEELMPN
FT                   VKCPMLILWGDNDTITPPDFPLGQYFMKLPDNRPNTTLKVFEGEGHCLQDDNPGAVNPV
FT                   IKEWVAAL"
FT   CDS_pept        278386..280800
FT                   /codon_start=1
FT                   /gene_family="HOG000232522" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636718"
FT                   /gene_name="SELD"
FT                   /orf_name="MICPUN_112686"
FT                   /product="Selenide, water dikinase "
FT                   /EC_number="2.7.9.3"
FT                   /function="ATP binding"
FT                   /function="oxidoreductase activity"
FT                   /function="selenide, water dikinase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64047.1"
FT                   /db_xref="GO:0004756"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG634476"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017584"
FT                   /db_xref="UniParc:UPI000199B371"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V6"
FT                   /transl_table=1
FT                   /translation="MGKMNDSGPVVKDLVLIGGGHSHVYVLKMLGMNKLPGVRVTLVAK
FT                   EVNTPYSGMLPGHIAGHYTWDECHVDLRPLCTFAGHRLIHDEAVSIDLENKRVILKDRP
FT                   SISYDALSIDIGITPAKAVQGASDYTTPVKPIYGFGERWEALLDRVLSTTAQTRVAVVG
FT                   GGAGGVELALAMQHRLQVELEKAGQSADRASFKLITRGKLMPTHASSIRKTFLHIFHDR
FT                   GIEVIEEDGVESVLKGEVVLSSGRKVPADECIWCTQAAPQSWPGEAGLETDNGFIKVSA
FT                   TLESTSHSGVFAAGDVASVVGHPRPKAGVFAVRQGPPLHDNLRRYLLGEKLVDFSPQKV
FT                   FLGLISTGSKHAVASYGSVSFGGASSTGAMLWKWKDHIDRKWMKMYQEMPVMASPEPDV
FT                   SEVALAAGPATIAALQAVPMRCGGCGAKVGASVLSRVMARLNIPTRPEVEVGLDQPDDA
FT                   AVITVPPGMVAVHTVDFFRSFVDDPYIFGQIAVVHALGDCWAMGAEPHAVLAIAQVPYG
FT                   LESQVEDELWQMMSGATAVLEEVGCALAGGHSCEGAELALGFSVHGVAKREKLMKKGGM
FT                   KPGQVLIVTKPIGTGTLFAADMRAKAEGRWVTKALDSMRKPSAVAAQLLVEHGAKACTD
FT                   VTGFGLLGHLVEMCKGANLAAVLDLDEIPVLDGAEECLKMGITSSLQPANVRLSRAVAN
FT                   QDGIANNPRYPLIYDPQTAGGMLAAVPKENAEACIEALRQAGYPSTCGIGEIIEHLPAV
FT                   ATAPEQVVFVQDAQNQFSASGESKERVRPIDLNNCETGTCEIPISKKQKAK"
FT   CDS_pept        complement(<280977..281345)
FT                   /codon_start=1
FT                   /gene_family="HOG000200821" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636719"
FT                   /orf_name="MICPUN_74145"
FT                   /product="Predicted protein"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO64401.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG753323"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199B372"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V7"
FT                   /transl_table=1
FT                   /translation="MIHVLYAEDSVPTQFIIKRLVNRIDDIELVCVNDGKAALDYCKNA
FT                   KDGNKRPDIILMDCQMPVMDGLQATREIRKLDDPILSRVPIVAVSSGIKSMNEKDCMDA
FT                   GMDDYVAKPLNQQALTNIL"
FT   CDS_pept        complement(<281967..282761)
FT                   /codon_start=1
FT                   /gene_family="HOG000007846" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636720"
FT                   /orf_name="MICPUN_82799"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64402.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI000199B373"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V8"
FT                   /transl_table=1
FT                   /translation="MGEQEYKQFNQYIIVKDLGRGVHAKVMLGLNAADNLLYAIKATSI
FT                   AAVAETAVRKEIAVLKKLKHPNVLKLFEVIDDAKTNELLLVLEFASAGPIFTRYNMVPV
FT                   KENRLLSYTRDIIQGLDYLHHVAGIAHMDLKPENLLKSGDGTVKIADFGVSFIGKANTK
FT                   NSNKRIVGTPAFIAPEMLGEDGYDPFAADIWSLGVCIFHMATARLPFTGRTIFQIIAMA
FT                   KRQGLQFPEKPDLSAELRDLLTIVLKTEPEERASLEDVMTHAW"
FT   CDS_pept        complement(<283950..>285173)
FT                   /codon_start=1
FT                   /gene_family="HOG000286883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636721"
FT                   /orf_name="MICPUN_68869"
FT                   /product="Major facilitator superfamily "
FT                   /protein_id="ACO64403.1"
FT                   /db_xref="HOGENOM:HBG303485"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B374"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7V9"
FT                   /transl_table=1
FT                   /translation="ELKALWPFIIISITYLLFTVTDGAVRMLVLLHAYNKGFTAMEVAV
FT                   MFTLYELMGAVTNLAAGVAGAKWGIRATLISGLLLQIVGLGMLYGWSDDWSKDEAIVYV
FT                   TIAQAMCGIAKDLTKLGGKTVTKLVTPEEKQERLFKLVSALTGYKNSLKGVGYFMGAAL
FT                   LDWSYFAAISVNIGFIIVALPFAIFGLTTQLGRVASKNITLEAVFKQSDNINYLSLARL
FT                   FLFGSRDLWFEVPLPFYLRSAEGLGWPRAAVGALLAGYIIMYGQCQSYSPQLVLVPLKQ
FT                   SPPNKWVCILWNAVLAICPIFMGAMALTSVYDEPGDSNTGKVVTLMIGVFSFAIIFAVN
FT                   SAVHSYLVVKYAEGNKVAMNVGFYYMANAFGRLTGTIISGALYSYVGSNVNDGLAACFL
FT                   ASLVFVVIS"
FT   CDS_pept        285459..286661
FT                   /codon_start=1
FT                   /gene_family="HOG000007253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636722"
FT                   /orf_name="MICPUN_83138"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64048.1"
FT                   /db_xref="HOGENOM:HBG561443"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="UniParc:UPI000199B375"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W0"
FT                   /transl_table=1
FT                   /translation="MRVWSRVLVVCFLGLCLVVGEVASLAPARPARGGVGVAPRRVKLA
FT                   PLGSSGDGAQLPKYRVDLDQPPGVRWNDVMKDKRAAAHKTITSLFALLPEEVHTEVDKL
FT                   VLHVEERLPVWAREEMQGIAAALNVTFGDILLVNFFFEITPFCTSVIARSSSTGHLYHA
FT                   RNLDFGFGMPSFSENLRDLAMDVEFTKGGEPAFIVTTFAGYVGAATGMRSGVFSVTVNE
FT                   REMTGPLPIPNLLKGVLNLINAILTSDAYPVTWATREALEDDASTFNSVVKMFSERSLA
FT                   TQIYLIIGGASEGDGVVLTRDHNSLLDAWKMDAASGEWFLVQTNYDHWLPMPIWDNRRK
FT                   PAEKALSKVGADAILPSSIYSNVLSLDPILNQLTVYSTIMSCAEGKYESFLRKCEGCSP
FT                   I"
FT   CDS_pept        complement(286774..288588)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636723"
FT                   /orf_name="MICPUN_108398"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64404.1"
FT                   /db_xref="HOGENOM:HBG561444"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199B376"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W1"
FT                   /transl_table=1
FT                   /translation="MVNYKDVVFMFGGHGQRLQPPPPGQPRIAHEIYDTQSKYEATNPL
FT                   YYDDLWAYNVTEREWEQLKPFCTTCQNQSEVDGTAERDVFGPRGRHSPSLANYDDSVYL
FT                   FGGYAFGGVTNFVGIYPTGTATDYPSLNSKYYLNDMWKYNITVNEWEELFPHPRYPIRP
FT                   SPRFGHSAAISIKGDQVVMLVFGGYTWDDEIGDLWYYNISGDTWIKVEGEGEYPSRRYR
FT                   STMVPIGHTSQLRTGSTQQAGRALVFGGHGCLKGASYVEATKSKVVSNMDRINNIDRQW
FT                   DTQYDATGDGKITVRGIDVNEYGDPILSTNPDLWIQTPNDYGEKYCYEELDDLWQYFPT
FT                   SCPKDCSRRGVCEYNFCVCDDGFTGIDCSNVSCPDDSCFFDYLGHRQVCEQCNNRGTCN
FT                   GYTGQCDCQFPASGESCREYDCLNDCNGNGICDHARNNSLGYGVCECFTKDGRPAYEGL
FT                   DCSIPVCPWNPANEKNLTCYDRGICVNGTCVCHPGYGDSFVHRELSAPDGGLFGIRIPT
FT                   DWDGTPIPGCGYDEEKDAYSEAFRGPKPADPITGRPALPECEPIWVADCGDVFFTFAGA
FT                   PTLYGMPLIIALSLAWLANEILDINTRP"
FT   CDS_pept        290845..292137
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636724"
FT                   /orf_name="MICPUN_54343"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64049.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="UniParc:UPI000199B377"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W2"
FT                   /transl_table=1
FT                   /translation="MADVDNDEALDEETEVMSLATGVAMIAAAYCRGTELHGAGGLPKW
FT                   SSNEASAAGRSLLGLMFDNDANGGADESRGFGDAIRDCLARCLGEAAAYLAFSLAIEPE
FT                   PRWGGLAGSRDDRESRPLAPDLPPHLPKQLAKPTTESAFVASVRLRWLIESSGYPSLGR
FT                   AVKSENQDASAMISRIVPCVLRAMDHTSSAVRREGCAALVALISATNRTELRWHGAALL
FT                   DAASSTLSGSTAEVFGAAAAAHTRAAVAVCADDPRDPGLMSALEAMIQAASSRNHEVAV
FT                   AKAWVLEFPTLLSALKLGAAAHLGRLFPPLLEWLHARDDATAIGAASCLELLCMMTWPR
FT                   VPNHAASIWSDIARAYTEADARGGGQTTQLFRTTLERLAAIVQLASGEKFEEVWRAACI
FT                   EPIPAQLAPLISFLENLPGRDGVSNEWHVQA"
FT   CDS_pept        complement(292196..>292996)
FT                   /codon_start=1
FT                   /gene_family="HOG000030431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636725"
FT                   /orf_name="MICPUN_82680"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64405.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG595730"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI000199B378"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W3"
FT                   /transl_table=1
FT                   /translation="LKLELGTERFETSTVIFLGDLCDRGPETSGVFNFLSSLKDKHPRQ
FT                   DVRHLAGNHDFAFATFLGLIPITDGAVEEGEFKPRRAEYPLWEDSSSKQAHLGMHLQGR
FT                   RWGAFSREGFNDGINAFDSHTTFTSYSAAPGDREDLLKKVPVEHKKILESLEFVVEVED
FT                   AEEHGKKLVAVHAGLETDCPFDVQMTALRQRRVNQAWVEALQGRANVMNLPEDTPEDVI
FT                   IASGHHGILEMRDRRIIIDGCGGHRENRLAAVILPERKVVRSSS"
FT   CDS_pept        294425..295402
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636726"
FT                   /orf_name="MICPUN_82855"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="ACO64050.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG561446"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000199B379"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W4"
FT                   /transl_table=1
FT                   /translation="MLLVLHVIHAPHLLLIAIIATVLIAAPSLAWSATTFAILGVAYSP
FT                   TFIGAPGSTGMRTWTAFQLWATRVVEDAARRWHGECRVVRDGSWRKSKREERRYIFGYH
FT                   PHGMYPAAACWFHLTPQFASLFPSVPPPVTLGASVIFRVPILRDVAMWAGARNVSRNVF
FT                   LKSLREQGAVVLCPGGQAELVEHVGGDGDDVVTLCTRHRGFIRIAIEENAHLVPVFVFG
FT                   ESQATRNIIKWKAAQRWTYKRLGFPMPFLPGGFKGFLPIPAPLPLSFVVGEPIKVPEPG
FT                   PGGTALEEDVLRTCDEYYQRIRDLFERYKVSSGFPHLRLVFKDD"
FT   CDS_pept        complement(297402..297590)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636727"
FT                   /orf_name="MICPUN_108400"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64406.1"
FT                   /db_xref="UniParc:UPI000199B37A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W5"
FT                   /transl_table=1
FT                   /translation="MLSSETNQSLRRKSCGKADDEGHESLRYAAVISSLVSCFGILMAN
FT                   LFKYSRRNTPQSLPLPC"
FT   CDS_pept        complement(298474..299994)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636728"
FT                   /orf_name="MICPUN_100898"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64407.1"
FT                   /db_xref="UniParc:UPI000199B37B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W6"
FT                   /transl_table=1
FT                   /translation="MTSVEEDAAIGVALGDATSAGEILALRDELSEKELELLEMQQSFA
FT                   ELVAKHDEVKAQLKKASRFKEDSANILQSAVKFKEEAQITAKNATERADKLQADLKSTR
FT                   EAAASAKKMATHFKEKCEAEHERAAAAESAAAALRVELETFRKSSTAKIAELNEKLESR
FT                   SKESEEVITKKDHELRLRESAEAEARLSAELAKVKETAEDVESKLRAELSRTRDDLALA
FT                   LAKGKVTRESVGDSSGQLLATVQRMTREQLEAAREEVSRAYEVAKSREKEAQDAREKVE
FT                   SLQQSHAVLKATMDQLRERVDDTKRHAETRTEAAARHKATSRNLRKQLAEVHAALADAQ
FT                   AELRLSRRGETRDTRDSGTSASSNLIGAAEEATSVLSAALKQCFEPGSNSQLVNQWMDV
FT                   GVRKDERGASVLLAVAHRAAGALVTATSRASDAEYAAEHAMHSLEDTQLELNAVQAERD
FT                   AARAAASASDERANRSNEELRDVLNRLRDSDKKTQKLDELIRRLASRS"
FT   CDS_pept        301112..301552
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636729"
FT                   /orf_name="MICPUN_54346"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64051.1"
FT                   /db_xref="UniParc:UPI000199B37C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W7"
FT                   /transl_table=1
FT                   /translation="MGSHRSSLGCKRPREETSSMEETPRPPVGYPSHESRGGARAQCDD
FT                   DAHNSPPRHTPGVTPGESKHSQLPPRRIAICFPKKVSCASRPPVLLTNVQAKSGCTLSS
FT                   LPIERDPARTDRTTAPVTYFRRIQYHAQQILRYLSHRFRGAR"
FT   CDS_pept        join(301967..303079,303745..305439)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636730"
FT                   /orf_name="MICPUN_100899"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64052.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B37D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W8"
FT                   /transl_table=1
FT                   /translation="MSDGHSGLPGTVEEVAAEVPKTQRLFPIFAKGRKTVHLVRHGQST
FT                   YNEAISGPGSWNEPNIFDAPLTKLGRSQATALGSFLAKLPKDAVWVTSPLTRAMETCVY
FT                   GYKASLQVKAAQRRKAASMREAAIGLASHQKTGSGLPPSGRRRSRLSNGGLPSGVGTSR
FT                   ASDENGYLDGDPMLGTTPAPNRIDEIDEPGSRDAGAVSGGKYPAAVANGYGEERTPAPV
FT                   REPLRTVGSDLGELAPDANGASPCDSDLDQAEMMAWGDKVFVSHHLSEKLSTSGDIGRC
FT                   KGVLMNEFPLLAGGLSRLPGDVWWYNQHHRPNDAERQQFLSHEPTQKFKDRVERFRSWL
FT                   TSRDEKVFVVFGHSTFFKQLTGGHRSLKNCEGDSAATLLAKLQARNRVEVDAFRAVFEA
FT                   HAGAQRQARVLQERVATLNRRCAELSEGKEKAEADLKTANEAAAKGTAVKDQSARISEL
FT                   QTELAASYKQHAESSQQVIAAKEQQAKAEDELVTAQNALAIAERERDEARERGSELEAA
FT                   LEEFRAAAETATSEAEARLLARNEAVAKAEAMETENASLVERLMQMKMAEAEKMNEIND
FT                   LYDDLQRQKKSAEMRAIASDLSAASAESMSSLAAAVGGANAFGSVYFPARKRLAIRANV
FT                   GGTHRVAFTPGGDVLATAGDDRTVALFDAGSGNPTGPERLTAATGALLDVDFSGGDSGG
FT                   AGSDVLMVLGAGTDRALRLWDATTGRTRHTLTGHAEKVVSAKFCPWNYARAVSCSHDRT
FT                   IKVWDLERGFCKASIMCASNCNSVTYGESAAVVISGHYDGAARIWDLRQKPGGACDPVE
FT                   VRGHSQHVTAVTMMPTNRGQFITSSRDNTLKLVDLRSGRAEVVRTLKASGYRSGTQWAN
FT                   PCVAPDGRHVVAGGADGGVFVWNLIDGGLKVTLRGHDVAVATCAWSQSGLVTADKNGVA
FT                   IVWSG"
FT   CDS_pept        complement(305545..306741)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636731"
FT                   /orf_name="MICPUN_59166"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64408.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI000199B37E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7W9"
FT                   /transl_table=1
FT                   /translation="MSASTCVLVEMGEEDPIISVAQLMAGLIGDADGKVVKECESLLEA
FT                   GKFTEVVAKIMAHGGKLFADAPEKDLEAAVLIIGGLAQRLSPADAAKCVDQLVAAALAG
FT                   TDRGSLRAAILFQLYNMTTDIKARFPILKKILGYVREAKLAELVAPISHHVEDNYKSWN
FT                   LDAAETRAVLSDVFTMLAETSGNSDPNSTEAKRILDLQLLFLATFSAGEKLDAKGEEVA
FT                   KAVVTSFVKATDMTFRCDLLGSPAVQALEGTKSSGALKLLTTMLTGNGVAEFAAFAKSN
FT                   GAVFKDLGLDEAECLGKMKLLALCALAEKSAEGEFTYAQVAEALQCGEGEVESWIVRAI
FT                   GARLVEAKMDQVRGVAVVTRVNHRVFGDDQWKELKSKLASWRENLDAVANMTAPQIEA"
FT   CDS_pept        307081..308142
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636732"
FT                   /orf_name="MICPUN_82977"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64053.1"
FT                   /db_xref="HOGENOM:HBG607597"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B37F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X0"
FT                   /transl_table=1
FT                   /translation="MAAAVAVEVAAPVHFENEDSSDDDNFADELEAQLFEAEARRDAIG
FT                   VKRERDEKGLDEEEPSTKRVVRDAGRAEQHDGREGLTTLPLELSLQILRWLSPEDLTSC
FT                   ATTCRALRLAASEDSLWRRCFCSRFGHPKRPGVRSWRALYFQEDARELRLTTSSAPPDL
FT                   RHLYAQMQSAKRAQPPATLTDDALLTLTDAENVMRWRAQRGLSDGSDPASAHTCSIANG
FT                   CSYRRFGADIFVCERTGRAHVCDDSCRERVVDMDGMSEMCSISGRSFDRFLGDGAEGMG
FT                   AGHVEGGAGEVGFTGERGWLGRAFEAGYGASSEKELYAALWGGDGSAGMRANRGVDSDD
FT                   EVGSDESSDYDSE"
FT   CDS_pept        complement(308199..310856)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636733"
FT                   /gene_name="OFD1"
FT                   /orf_name="MICPUN_59168"
FT                   /product="Basal body protein [OFD1], oral-facial-digital
FT                   syndrome 1 protein-like protein"
FT                   /protein_id="ACO64409.1"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniParc:UPI000199B424"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X1"
FT                   /transl_table=1
FT                   /translation="MALDATALSDRQFRRKVFEELQNAGTIDGLKGTLRSRLVGVLQRR
FT                   DPSVFLGSGPGPGQQSLWQRAANSLYVEYLQHQNYGYALSVFQPECGLTNQQVMTRDEL
FT                   ARVLCLGPTSSVVQYMPKPNEQGREQPLLLGILQALADAGGAGARREITTQTGDYGGNT
FT                   SLALRLAQIDEMHERAVESERVAPLRDAEERMASFQRECEERMRHEMEEQVRRVRDHEV
FT                   GQARLEEAAKHRRQLAEAREELERVHAERLRKLRAREESQLERVRAAESALERAAYDHR
FT                   QRLAAEHEKLREAKEEAHREETERAMNRAREEEDLKRRESEIKSKESSWSMRYAELSAE
FT                   AEERALARRRETETEAERRLEMIKTEMMALEDERAKLELDRAQHAVEIATIAQARRDAM
FT                   ELKKKHGQQSTATEILAQQLDDLNEQLDLARRALAKRGIALPVPKGLGGGIKMGLTYGD
FT                   SLSLTEEDSVAYAQVVAAMEVAKSEADVARKELAEIRSDFNKLKKEHALMRHEKHAAVR
FT                   QAEDLKVKYEFANKRTEEAVRTAQEAWVTINEQKGAWKSLLDEEKDRRVAAEAACAAYR
FT                   TAMMAPGASAADLGLDSMHALLPPNLQNLPEPGDETSASTITKLRLQKFEMQQEKQRQT
FT                   IAEYERQMMFEKQRQQYKETMDKAEVEAKKMEEEAALEAKYARAKLEAQEKHRAEQAAQ
FT                   ASTEIETEYSDDDFEIDEEKFIPSDPIARGLRWGIGRLTEEEKAKLKPLTEEERAKLKR
FT                   IIEEEKAELEDELPSSLQIESKAEEEPKAEEEPKADAEVEPAMAPKSPAATPKSPPKSP
FT                   AKSPAASPRQSRGSSQGKKSSPGVSGSAEIEELIEEEEEFVPDELDEVPDELDVSIPYD
FT                   SGSKDNSRSGDSVF"
FT   CDS_pept        311421..312146
FT                   /codon_start=1
FT                   /gene_family="HOG000229528" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636734"
FT                   /orf_name="MICPUN_83167"
FT                   /product="Predicted protein"
FT                   /function="uracil DNA N-glycosylase activity"
FT                   /biological_process="base-excision repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64054.1"
FT                   /db_xref="GO:0004844"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG605450"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniParc:UPI000199B425"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X2"
FT                   /transl_table=1
FT                   /translation="MEVAAEAAAKGEPPNLDDLLVEETWRGALDGEFGKEYWSSLKKFL
FT                   AKEYGSGAKVFPAPGNIFRAFNTCPMERVKVVILGQDPYHDDGQAMGLSFSVPKGWKVP
FT                   SSLINIYKELGTDLGCKKPTHGDLDKWSTQGVLMLNASLTVRAHQANSHSKKGWESFTD
FT                   AAIRTLAKQRKGLVFLLWGKNAQEKERLIAKDAGHLILKSPHPSGLSAHRGFYGCKHFS
FT                   QANNFIEKNGGVPIDWQIV"
FT   CDS_pept        join(complement(313271..313789),complement(312264..312968))
FT                   /codon_start=1
FT                   /gene_family="HOG000158382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636735"
FT                   /orf_name="MICPUN_83030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64410.1"
FT                   /db_xref="HOGENOM:HBG316871"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199B426"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X3"
FT                   /transl_table=1
FT                   /translation="MEARLSEIALVADQKARTAQYRDVLTECLAGGGNVEGLKAMVTHM
FT                   MSDDVPLVISRQILQALCQEVVTTLPSEKQKETASFALEKMNPRVMSFDEQVSMLREGL
FT                   AKLYEKDAEWSRAAEVLAGIDLESGTRVLSDEYKLQKCVQIAMLYLEDDDAVNAETYIK
FT                   KASFLLSACKQDDTLEYQFKTCYARILDAKGKFTEAALRYYDLSQTKIGLVMGAGKQVG
FT                   EADLAAALTSAITCAILAAAGPQRSRVLTTLYKDERCARLPVFSLLEKVYLERILQTDE
FT                   VQVFSANLKPHQLGGEGEDGMSILSRAVIEHNLLSASKLYNNIAVTELGQLLGVDPQLA
FT                   EETAAKMIGEERMEGKIDQVDGLIYFQDPKNTSLAIMQFDDQILDVCNQVNALIDMMER
FT                   KGILPEDA"
FT   CDS_pept        complement(313894..315174)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636736"
FT                   /orf_name="MICPUN_100904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64411.1"
FT                   /db_xref="UniParc:UPI000199B427"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X4"
FT                   /transl_table=1
FT                   /translation="MAFTRPEWVSHTVSVEDMTAGKNQWRNIQDIVRVTFKEFHDVLRA
FT                   QGDAIKSLERAIDSKADRGELGRGLSRSQLPEVEAALRQLKHISSDIGHQLDLRATKAD
FT                   VHAAFKAQEELMSRELARKADAEEVERKVNEMDALLAECVERAGVSREGFAIAPRSMSF
FT                   KPGTERPRLGEGGERSMEELWEEISRKADADDVDAALRSKADASSVNKALERLEISQLG
FT                   LATKEEVAVKSDMKDVCALVDVKVGIDDVNHALAEVSRELELKASAEDLEAHLKSQALI
FT                   NRGLVGESSLGRWIWKSGQVNKGNGVPWNVQSVNTDPDNFRWERDRSYIVTVAPGLYEV
FT                   NFGFFVRKKPAIQLLVNGEPVLAAVNSASYVLHHSSGRLTSVGRHPSGNITGLTLIDFL
FT                   ALPAKAKIAITYNGEPGGEGFLTLKKL"
FT   CDS_pept        join(315461..322487,322631..322638)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636737"
FT                   /orf_name="MICPUN_100905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64055.1"
FT                   /db_xref="UniParc:UPI000199B428"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X5"
FT                   /transl_table=1
FT                   /translation="MSFPSESGRGLGSLHASTSRRNPGGDGGLDLDVGEATIDLTPQEQ
FT                   MQFIHNLTKANANMKMKVFYAEKRIEELTVATGLDEDQLKGLDNMVKNNIEQSVKIEEL
FT                   QTEVNERNEIIGTCNKHIASLEREVEELRRSGELTAAERESQTQAAAIEAATAAATVAE
FT                   VLKELQDLQLDHSSLMERAANAEAELSSTREKVRALEADLATQRAESRASLQRSMVAVA
FT                   SQQAAEEEIVLLRNRLNAAIYKADEAAADREVALAREAAVREELGAREAIAAGSLEAKV
FT                   QAMMDAEVRRRDEHARALDAARAEVLAAREETAAAERATETARAGRRQAAVDVERLEAQ
FT                   CAREVQAANESREKAMRDVRSAMEENERKLQESARNAEDAVARAQAHAKEEIELLKKRF
FT                   DVDLAQARQRAERTADETVRKALERSDEKLALAVQAKEAASAVNKALKEELLEARSSQA
FT                   EAEMALATANATCAALEQEVMAAHTASPVDGESLAKHIADLTEKANYAALLRDEAVTEL
FT                   ERVTEALVKERGRAAELDVEYERCVVAAEALRAEEHRMGMEHMTRLEALQQAEEKLDAD
FT                   IREFEANRAEQQRRLDEQRARLDDVVRRTEMLESTIKPLPTGAEGQEGPDLVEMRERLN
FT                   AAATALSISKEHADAASKTRDEAVADMNKLREQLANTKAALESARADADKASIARAKRE
FT                   AGEEVLRLRNSAAAVETASLKERISALEAEVETLQGDLKEARESAGKAVVLRPVIREDA
FT                   PDLVTAPSKSSPPTAPENASVKDRARWFQEKAIEKTPGSKSVVSETESTAFFTPQRGFD
FT                   DEEHAEQLAALRRTVHDLEAQLADATAEVKDRDRRLKSAEADLGDTTAAVTELGARVAK
FT                   REQELVAKHKQQVSELEQARVAAEKLVEATQNKANSRIEELIEQLSLKEAEVEAMAQQQ
FT                   RQLKEQFTTPQKAANPLFTGQSITTSEKIAPAMVAFQSPPVATPASLQTDVMLEKGILE
FT                   AQLSEAKDTIRKLKIESQLAKDAMTEARFRAELAKSSPEISRVASDDNIARNDAEWRAK
FT                   LSEVKSKAAAMEVRLREQLDEALENLVVQEREAETNLRKQLTAARQKTAAQVAEAEEEF
FT                   ETRMAQANKKIKRLENELRETKAELEASGPGLRAAAPSPVQAEPKPAEEISNELETELR
FT                   HSLNKAEARIFELTSEVEVAEERSRKANELLIVENSQLELDLIEAREELSSLDEEWKLK
FT                   LATANAKAKAVESRLQSRLAEAEDNGKDLVEAEWKEKFAAFKTKATADEAILQEQLDEA
FT                   KDTILSMEQNFERRFKTQLSAAKQKAAIEQAELAAKLDEAENKLAAIDVEWRAKMSEAK
FT                   TTAAATEAGLRAQLAEIEENSLAAESVAGASEAENKLRAELVMARQKAAVEIVDLKASL
FT                   VAAQEEIVALKFAEQNHRAALERTEQRMHTVVDEALQRASESEEMMKAQMQTALDKSSA
FT                   AKIDLQLQLKKAVMKAESDEAEHASQLEDLASRHAAKEADFKTRLRATEDRFHAQLQLA
FT                   EDQLQATQNEWRAKLSEAKSKAAAAEALLRSQLAAKEENSMADVIARAEESEAQLRAQL
FT                   LDVKQQASSERSRLVTQMAEVEEKVGAIEAQCRLQVSDAKAKAAEAETKLAKHIEEAQD
FT                   ARAEISTLKDDLVKAAVLEAKLRAQIDDEQKQNRDLNAKLTHAQTSSSSSEGEMKAKLL
FT                   AAKMVEAELRDSLSTAQSRVNQLVLQVDTADSRARSTSAVAADELEVMTRRAMEAEDSA
FT                   AAASANVESLHLELMELKKTHGDEINELHRRLQEAIDIGAEAETKVEEPGSPTPAVSKM
FT                   DSDVLAQLLEASMSREADLRAKLEDSAAAKEEIASSTEARELRAQLDSVRDMVASLQLG
FT                   VQARDKATTEAMTPDGKGISRSSPAKTPELAASRATVNSLTSLLETASIREGELRAQLH
FT                   SANQRVQDLEREKHEQDLVAQTQLETIQQQLQQLQPQRDQTLDEEAAAQVSTMAVVTGP
FT                   ARAPRAYNPMWGGFPGYVHPMLSAPAPAEGTAVGALAAALEAAGEREGELKVKLAESQA
FT                   SAAAAAIKLADAIAIARAEVEDSVKERVMALETEVRNLSAELEEKANAAQTFKASLNDL
FT                   QDKNAILEQERMSAKARVRELEARMLIDAANAEAKLKIVLGDVEAAKAETETVRGEAKH
FT                   KIEANWDQANRSVAMAQEDAKKDRDAIVEKETELIAARELIAALEQREAEVLERVAALE
FT                   LQLSSAQTQLKSTETQLKSTETQLKESQDRESIATQADEVLREDLNKAEARVTALLQEL
FT                   EATRAAAMESSRAAKSASARAESMAVALASAKSGSSSDMKLATAEARVTALEVELRC"
FT   CDS_pept        complement(323326..>324615)
FT                   /codon_start=1
FT                   /gene_family="HOG000033463" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636738"
FT                   /orf_name="MICPUN_106946"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylamine-glycine ligase activity "
FT                   /biological_process="purine base biosynthetic process "
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /protein_id="ACO64412.1"
FT                   /db_xref="GO:0004637"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="HOGENOM:HBG404060"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniParc:UPI000199B429"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X6"
FT                   /transl_table=1
FT                   /translation="VNVLVIGSGGREHALCWRLKQSPTCGELFCTPGNAGIIVEDGVQV
FT                   VDVKESDHAAVIKFCKDNNVGLVVVGPEAPLVDGIADALIAADIPCFGPTKDAARLEGS
FT                   KGFLKDLLKKYNIPTAKYERFTDPEAAKKYIQKEGAPIVVKTDGLAAGKGVIVAMDVQT
FT                   ALDAVDDMMVNSAFGSAGAEIVVEDFLDGEEASFFAVVGGGKAIPLVGAQDHKRVGEGD
FT                   TGLNTGGMGAYSPAPVLTPAIEAKVMNDIIQPTVDGMAAEGCPFTGVIFAGLMIKGDDV
FT                   KLLEHNVRFGDPECQCLMARMRSDLVDLLLKAAKGELDKVGELQWSEDMAINVVVAADG
FT                   YPGSYAKGEMIGGLDAANAMDGVKVFHAGTAMKDGKVTSAGGRVLGVTATGKNITEAAK
FT                   KSYAAVDVIEWPGGFVRRDIGHRAIARENK"
FT   CDS_pept        complement(325158..326150)
FT                   /codon_start=1
FT                   /gene_family="HOG000239410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636739"
FT                   /orf_name="MICPUN_108405"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="ACO64413.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG561456"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000199B42A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X7"
FT                   /transl_table=1
FT                   /translation="MKGSKGKRGRGGIDSMWNILLITTWLCTAHIALALLAASLYFLPH
FT                   PLAVGTLASLIALVLLPVRRPFPRWGIAIARAITYAAMDYFPMSLEWEDQPSFVEASVK
FT                   GVPSIIGCEPHGVLPLSIISFADYCYYGPETPSIVKETRALATSTIFYIPLLRQLWSWL
FT                   GIDPISRAHMRAQLERGRSVLMIPGGVAECLRMTPKCETVYLRKRFGFVKMAIQTGAQL
FT                   VPAYSFGQTRTYSYWKLGPPLCSDATTARLAKIIGLAPMTFWGRWGSPMPRQEKIHTVV
FT                   GKAIPVEKRADPTNEDVAAKLEEFIGAVKDLFERHRGENGYGDVELVVL"
FT   CDS_pept        join(326302..326400,326490..326885)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636740"
FT                   /orf_name="MICPUN_108406"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64056.1"
FT                   /db_xref="UniParc:UPI000199B42B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X8"
FT                   /transl_table=1
FT                   /translation="MTMSYVRFPYEELGPPAKTPIKPVNLRTADEWKADAMMSNLYPSV
FT                   VDNISVFTPTRTERVRAEKTKQAEGCDTGLAPVYFRPPASEPAVGDYGPLWYEDRGREG
FT                   RKIIGAGAKAKGSSRDGGGGGGPDDVRPAGLESNEILGAKNRTRTGLKLKKDCWGNVIP
FT                   Q"
FT   CDS_pept        complement(326963..329173)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636741"
FT                   /orf_name="MICPUN_100908"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64414.1"
FT                   /db_xref="UniParc:UPI000199B42C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7X9"
FT                   /transl_table=1
FT                   /translation="MASDEAVGSPRRGKPPPRPSSRTSPSSADDDVPVERTEDEKAAAW
FT                   DAIASRVMAAAGSAYEGTCTPVTRDAEVEQLRRRLQEYRDENDSLGEAVRAMKAALDAA
FT                   NEDAANAETTRNERDEAKEELAKTKALLAKADATLRNLKDRVAEMEQLCLDQQDDVIAS
FT                   NQAMEAAEEKLAEAEGAAQASSEDAKAAQAMATELRDRVALLEADADIKASQQGIIEGL
FT                   EVALAEARQAAASASADRETFQSKWRAEWEAAKDEHAAELRGGRARMAMLEADLAELRE
FT                   TLRTERREWCGRRRELETRLCEALAQARRFREDQKGAAESLRIMVEHESTLRTAARHQT
FT                   EVVARLRGDAATSAVRCENVASHCAELLKERDAATRRAEDAENAARRAREEAGEAWGNP
FT                   AAALSRAVAGDLEGGSDAGRVPALLAAAVRGSHRGPDSFEPTAGPEGLNRRAETGDPDG
FT                   PARMSPSTPSPGEASPSTPSPGEASRTPPPAKWIHSIGDDVAEELIHALAREVAGSRGR
FT                   EEGLRKELVEAREARNDARKALVNEVHRVHELERLRVNDLRELHAAEQNARSAMVTAWS
FT                   LRDRLATAAAHVERFEVDADAAKRGAELVETREDGWWPVARGHKGPERTVETIDDEPRP
FT                   AERALDMLASGAEAATGEEHALGTFIDPALVEEALEELAVEAAMSSPHGSSPLLSDARP
FT                   RTPDRGEADDVEEVPRRWTPPRKSGPASELTTEPSASIFAPF"
FT   CDS_pept        join(329330..329349,329498..329546,329717..329926)
FT                   /codon_start=1
FT                   /gene_family="HOG000210394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636742"
FT                   /orf_name="MICPUN_59177"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64057.1"
FT                   /db_xref="HOGENOM:HBG561460"
FT                   /db_xref="InterPro:IPR019342"
FT                   /db_xref="UniParc:UPI000199B42D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y0"
FT                   /transl_table=1
FT                   /translation="MASGFGAKGNEGRCTPLWQNFSRCMSTADSPSECTNLREDYFECL
FT                   HHRKEIRRSNSVMEQRAKVINEKAAVLKEKIWKEVFDTSWATVEKAK"
FT   CDS_pept        complement(<330931..331311)
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636743"
FT                   /orf_name="MICPUN_82546"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO64415.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199B42E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y1"
FT                   /transl_table=1
FT                   /translation="MLSGVTAAAPAAPKTWGSVRHVVGGAVELRSLLEEAKAAGALTVV
FT                   DWSMTTCGPCQRIKPIYEQMARTRPTALFVGVDTHASPLNAALAREAAVSAFPTFHFYV
FT                   DMQRKADLVGADTARLAMMVQQH"
FT   CDS_pept        join(332600..332724,332855..332942,333055..333222,
FT                   333324..333665)
FT                   /codon_start=1
FT                   /gene_family="HOG000105162" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636744"
FT                   /orf_name="MICPUN_91006"
FT                   /product="Transcription elongation-nucleosome displacement
FT                   protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="ACO64058.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG499930"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012294"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="UniParc:UPI000199B4E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y2"
FT                   /transl_table=1
FT                   /translation="MGDDEPMTDPNAKAVTVAGPSDAGDGAVDLSVHPSGIVPQLQNIV
FT                   ATVNLDCKLDLKTIAFHARNVEYNPKRFAAAIMRIRAPKTTALIFSSGKMVCTGAKTEA
FT                   LAREAARKYAKVISKLGFPAQFKDFKIQNMVGSCDVKFPIRLEGLAWSHGHFAQYEPEL
FT                   FPGLIYRMQMPKIVLLIFVSGKIVLTGGKNRDDIYKAFENIYPVLTEFRKLPNPNDEDV
FT                   LAQLAAPSAAGAAALPAP"
FT   CDS_pept        complement(334232..336379)
FT                   /codon_start=1
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636745"
FT                   /orf_name="MICPUN_94458"
FT                   /product="Solute:Sodium symporter family "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64416.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI000199B4E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y3"
FT                   /transl_table=1
FT                   /translation="MASYCAYDSPTPEYYTDAATCTRQDSFFGGKAVLPEGAGYGIVIG
FT                   FGVFFSLATGIIMKLNQRYGGLNLSSEFFNTAGRNVKTGLTASVIVSQWTWAATLLQSS
FT                   NVAYQYGVSGPFWYASGATIQVLLFGMLAIQVKRYAPNAHTICEIIDARWGPSVQKVFI
FT                   FFCFMTNIIVSSMLVLGGAATVNALTGMSTTAAGFLIPLGVIAYTMTGGLKATFLASYI
FT                   HTAIIFSILITFIYIVYAGDDSKGLGSPDNVYKLLNSLTAQTKEVCADRISKKQNCGYV
FT                   PKNEEGSYLTMLSEGGMIFGIINIVGNFGTVFVDQSYWQSAIAAKPSSSTKGYLLGGLV
FT                   WFTIPFALATSMGLATVALDLPVTSTEAGMGLVPPAVASHLLGKGGAAAITIMLFMAIV
FT                   STGSAEQIAVSSLISYDVYRKYINVHATGEDILRVSRYGVVFFGVFMGLLSLILDEIGL
FT                   SLGFVYLMMGIFIGSAVMPISFVLTWDKANGAGAVAGAFTGLILGLITWIATASGLEGK
FT                   VTVDTLGMNYPMLAGNVVAICSSGIVHATMSFMNPQNFDFSTLNERIQLIDDTLPKFEE
FT                   DEESNPKQLEESLKWIQKWGWGFTFIMIIVWPCLSLLAGCGTPTGCGVFNKGYFNLWVA
FT                   IALTWGTVATAVIIILPVYESWAEISTTLQGMFTNDDVHMRMDIIDSKLDSLLKAGNLG
FT                   ESGNKLSKTDAYRAKLLAGKL"
FT   CDS_pept        339083..339658
FT                   /codon_start=1
FT                   /gene_family="HOG000100076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636746"
FT                   /gene_name="PSBY"
FT                   /orf_name="MICPUN_112658"
FT                   /product="Photosystem II PsbY protein "
FT                   /protein_id="ACO64059.1"
FT                   /db_xref="HOGENOM:HBG412409"
FT                   /db_xref="UniParc:UPI000199B4EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y4"
FT                   /transl_table=1
FT                   /translation="MQLADLDARIAIFGAFVPVLGWVGYNILGPGLKQLEKMQQDAAKK
FT                   KGVAAGVGGLSAAALMGMPEAADAATEAMQLADLDARIAIFGAFVPVLGWVGYNILGPG
FT                   LKQLEKMQQDAAKKKGVAAGVGLSAAALMGMPEAADAATEAMQLADLDARIAIFGAFVP
FT                   VLGWVGYNILGPGLKQLEKMQQDAAKKK"
FT   CDS_pept        join(complement(342474..342567),c
FT                   omplement(<340474..342365))
FT                   /codon_start=1
FT                   /gene_family="HOG000231885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636747"
FT                   /orf_name="MICPUN_83194"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO64417.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG591772"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B4EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y5"
FT                   /transl_table=1
FT                   /translation="MGRTDDSPRQSIALGAHKTKSKEFYDIVRHIGECKNKSDEDAIMR
FT                   REVMMLRTVLTGPKLEKAKLKEYLIRLMYVEMLGHDAAFGYIHAVKATNESEVSLKRVG
FT                   YLATSAFLDENHELIILIVNTVQQDLKSDNYLVVCAALTTICRLVNEETIPAVLPQVTE
FT                   LLNHPQMHVRKKAVMALHKFHLKSPSSVSHLHGKFRQMLCDKDPSVMSAALCALHDLTI
FT                   SDPGPQKNLVPSFVSILKQVVEHRLPKSYDYHRVPAPFIQIRLLKILAALGAADQKAAT
FT                   EMYSVLNAVLKKGDNHSSIGNAIVYECVRTAASIYPSPVLLEHCAGVVSRFVKSSNNNL
FT                   KYAGLDALSCIVNINPNYATEHQMAVVDCLTDPDESLRKKTLDLLYRMTKSNNVEVIVE
FT                   KMMDFLRDATDHHLREETATRIGELAERYAPSTQWFITTMNVLFEVGGDVVKQSTAHNL
FT                   MALIAEGSGEDANDATLRRSAVAAYLGLISKPRIPRVLFEVILWVVGEYGTLSGQSPQA
FT                   LMDTLCTAVEAQPEGDAVQAQAMTACAKLAAAGGGQLSEKATKLVNRNLNSRSIDRQQR
FT                   AYEITALLRENPALVAAALPQDASCEDLEVNPALPALDAYVNKALAEGASAYLQPSERS
FT                   TGLREAGGGGLSHEVAGSLRFDAYDAP"
FT   CDS_pept        342704..343855
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636748"
FT                   /orf_name="MICPUN_100914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64060.1"
FT                   /db_xref="UniParc:UPI000199B4EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y6"
FT                   /transl_table=1
FT                   /translation="MDTGLLSSLVPFVLWIGGTFCWWGLRGRLWYRSTRHLWPCFLVAS
FT                   PFGGLNVPKLPPHDKQWCCFRASPGSRKYKAVRVAPCFPENPCAVCGKACGLTDRELDR
FT                   QRHPCGLGCGCRCACIGCKYTNAGECERVLCEDTVPEDVVGNTVASVAAGGLSAIATAL
FT                   TNVSRSVEQLTRQQVERQQRRQQQAPVPAEMRRGYAPQPPQPQYQAPATQWDAQRQVYE
FT                   QHRWEQQQQQQQQQQQQQQQQQPNYPQPNYAPPAPPPPPPPVQTGNPFAPPGAAEPASP
FT                   SAPPTALLYPSVPGGPEPQAHAAPPPTETGAPSREEQAKLAAAKAATEAKVAAGKAAKA
FT                   AKATGAKMATMLGKGMQAVGKRMEEAAKDGASKAKDRNPQNRQ"
FT   CDS_pept        join(complement(344890..345024),complement(344126..344314))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636749"
FT                   /orf_name="MICPUN_94459"
FT                   /product="Predicted protein"
FT                   /function="electron transporter, transferring electrons
FT                   within cytochrome b6/f complex of photosystem II activity "
FT                   /biological_process="cytochrome complex assembly "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytochrome b6f complex"
FT                   /protein_id="ACO64418.1"
FT                   /db_xref="GO:0009512"
FT                   /db_xref="GO:0017004"
FT                   /db_xref="GO:0045158"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005497"
FT                   /db_xref="UniParc:UPI000199B4ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y7"
FT                   /transl_table=1
FT                   /translation="MAALTQTCKIALPARVAKRSARTARRTAVVAKAAAPVDAVRVQQK
FT                   AVAGVLAAGAVYEAMSAPAAQAAMELVQVAEGEPLIVNVAWGALMATFSFSLSLVVWGR
FT                   SGL"
FT   CDS_pept        join(345545..345678,345793..348118)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636750"
FT                   /orf_name="MICPUN_100915"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64061.1"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="UniParc:UPI000199B4EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y8"
FT                   /transl_table=1
FT                   /translation="MSDPTWDTSKENFQPLKRGRDAKMLDQVTGMANGERATKIKEERS
FT                   AFWNAIATYDGDDPLEVWVRFIKWTEQMFTSGGRETEVLPLLERCTRELQEVPRYRDDV
FT                   RYLRIWVKYADCCKEPHDIFKFLQANDVGQRHTLFYEAYAAFLEIRGAFKQAGEVYDRG
FT                   ILMRAEPTQRLKEKLAQFQHRMMKRKQRKMEEGGALEEEGEGETRRFGEVGAAARGGSA
FT                   NAENPGGAVRSGGGGAAGVVGSRARGLGGTGGVGGGRTPKRSNENDGGLEIYCDEEDGV
FT                   APSAAPAPWKNLGKYTETRKENTRGATQWTGQGLGNKRSRPGQASAVTPAPDLDIYEDE
FT                   DLAQAEAEAAANAGLMSKSTSKPPPTNALRRRLDAANPNLASNPMLHHGKGAPEPEPIA
FT                   GERPKTFYGGYNPADTVNNFGEEVCYEERRAARWEVANGPVAAQKPAPGLIIGRETKEE
FT                   DMELDATVAVPTTIGGVPAEVTATTVQVMQNPKLDVAEVQTAAPPESVPQHSFGSCGAP
FT                   PSDVGSGVQGRALERPTDEAQGVPPAGAAQPVAAAVPAGLRWTATEGGTYGMNEPTMTL
FT                   TTKEAWGDIMSMFSGGLEAERATNPAEMGDAAATAALAPIKEANTPAQKADETESFAIY
FT                   EDTCLLSKEAVAAVAAPKQQSPIADLEIREDTVVLPPIAATPRPAAFGANAAKTPAMHG
FT                   RTPLAAMPMRTPLAPTTATRQPLATKTGAAAMPPSAPVAGKAAADENEFAVYEDPTEQI
FT                   PSGAHSQAVSMQPPAAPANTPMPSDDGGFDVYQDTMHIDPAMMAEAMRQGEGSQASGSA
FT                   GSAQHTR"
FT   CDS_pept        348791..349771
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636751"
FT                   /orf_name="MICPUN_108412"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64062.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG561465"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B4EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Y9"
FT                   /transl_table=1
FT                   /translation="MGLAGSGANAKVYEAEYAEVASVSDEDDEGFGGLAIKVQSARLAR
FT                   WEWMVCKRLAGRIDPLHAAGVVQPSALHLVGGTDVVKGSDAEIGVLIMPFGDHGTLQDV
FT                   LNSYLRVGKQMDELIVMYYAIELLRVVESLHLAGVVHADIKPDNLLVRNGGDNWCDWAV
FT                   NRPGSWKLKGLSLIDFGLAIDLGMYDWQTVFVGDCGTEGFRCSEMIEGKPWTWQADMHQ
FT                   IAATVHALLFGKYMQVHKVLTDFDGFKYRPRESLKRWWRTELWEIFFEVLLNFPTLDFK
FT                   SPPPLGDLRRMFEEHIMEERLGAQLRVGLMKQTVSMFQQLREGKT"
FT   CDS_pept        complement(349853..352057)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636752"
FT                   /orf_name="MICPUN_59187"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO64419.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000199B4F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z0"
FT                   /transl_table=1
FT                   /translation="MTQSKVKLQERGSEMGMLSGTNGLRKGMAKEANLAEIILEQAARP
FT                   KINYDKCKVIVTIGGPLTETVDQLAEMLEAGMTVARFDFTSGSRTLEQHLQTLENLRAA
FT                   QKRTRCLCAIYCALGGNIFAVSRNDPEKEFNFTKGQTVKLLHGKPVCDDSDVLHLDSSI
FT                   GELDFAETFSPGDVVFVHPFLRAGELTAELEVTSISEREIVCVCRNDVEVPSTVKRLAV
FT                   NFSGAKNAPPFNACDEVIVNNFAVPANVDFISVGAVRDGGMLGLLKQHARNSGLPSVRI
FT                   IAQIDNLHALRDLPGILRQADVVLLARGELGAVVASEKMFAVQKHVLKMCEKVGRPCIV
FT                   TRLMDSMIFAPRPTRAEATDVANIVLDGADGLLLGLETLDGNFPLACLETVLSIAREAD
FT                   SVYDYEARYRRQMVQMNVKLAKATDSLPWGVAPLVKDDPDLAKIKPNARRNSLTIRLEQ
FT                   FEVDVNLKKEALAAAAVQTAYQIEAKLIVVFSHTGETTRLVAKYHPQCPVLSLSIPTVH
FT                   GGTVQWRVEGDVEARQQLVYRGVVPALSGGSGPTLDDETAPVVHQFGATRTDVEALTKA
FT                   QELGLIMPGDLAVFCQLIAGLSTVKVVEFAGMRKPKSRTFSPEISRSSSPGVPRMASDD
FT                   SLDTKDAMKEIQARFGRIGTTGNFEELKQTDEANKSKPGLVQRNGGRGAAKPPRSSNSS
FT                   ASLPRVDSGVSTDSPDSTHHEGRTGVARPKKTKSAHFIPF"
FT   CDS_pept        352334..353632
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636753"
FT                   /orf_name="MICPUN_59188"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64063.1"
FT                   /db_xref="HOGENOM:HBG561467"
FT                   /db_xref="UniParc:UPI000199B4F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z1"
FT                   /transl_table=1
FT                   /translation="MATSTEGVMPSLIASGDSSPRPRERFGTGVDDMWRKESALHAEAR
FT                   KTSRSPLDPFVDACLQLTASFRVYFKFLVTMESLFLSIISVASVLLFSLYEVKGQRLAV
FT                   NVSWAFISFAIVMPLTNSLNEAFRRREEALSLISDVKAYLLSYYQGHRDWDWGENGRKR
FT                   LPANHVSHVRFIIASLVTDMRDLLTSPPTARQIHFHTAKGRTQRRKMRAIQHEISARCC
FT                   EHFDRVSLAVEELKYGGMPGNESARLRQYVTFTMRAWEKLKMIKRYRTPIATRAFARVY
FT                   IFLHPIFWGPYYAYLVEQMLNEDAALGDAMISGSTAHKAMANVYACVLSVLTSLAMQGL
FT                   FNVRYRMEDPFLCEVGAGEKYAGLDQIDVGREFAELMRCLCSEFKDADQNEAGGGPSRR
FT                   VWPVPSECAIAHLEVGSALDVQTIIHHTREERV"
FT   CDS_pept        join(complement(353900..354708),complement(353775..353784))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636754"
FT                   /orf_name="MICPUN_59189"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64420.1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniParc:UPI000199B4F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z2"
FT                   /transl_table=1
FT                   /translation="MSQMSRSALLLRLASRSAAAPRAPLHGYAPRGQQPWTRLGTQHAQ
FT                   DAASSALRGGAAGMTTSAAGFAASAAGANAGASPGAGARSLLGYALLVSPSAVCAFLCK
FT                   WQLDRYEWKRGELDAREAALSAPDLTMRDIAAMVDAGVEPDEYARVLVEGELETGRTIK
FT                   IRPRVRSVHGTPVPGSVVLTACKPRRGKGRTIIVNRGWAPEHWVEPKGGTCLKTSGVVR
FT                   RSETPGAFTPANDPAAGAWHWIDRAAVCAAMSLPPDTQMVQLVHDGGRTT"
FT   CDS_pept        354893..355708
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636755"
FT                   /orf_name="MICPUN_82773"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64064.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B4F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z3"
FT                   /transl_table=1
FT                   /translation="MKDLSVGELFGVEGKTVLVTGGARGIGLMIAAGFVANGARVYIAS
FT                   RSKDACEAAAKKLTAEGPGTCVALSEDLSTEAGCVNLAKMFRAREDRLHVLVNNSGTSW
FT                   GAPLEKHSEKGWDKVYALNVKGIFFLTRELLPALDAGSTTTDPARVINIGSIAGERPQV
FT                   FPTYSYDASKAAVHHITRKLADELADRRQKGGHAITVNAIAPGYVPSAMSDGLAMYKES
FT                   EEIAKSGIPLRRKGAPQDMAGAALFLSSNAGAWITGTTVRVDGGFLAKL"
FT   CDS_pept        complement(355756..357108)
FT                   /codon_start=1
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636756"
FT                   /orf_name="MICPUN_83132"
FT                   /product="Dead-box ATP-dependent RNA helicase "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64421.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B4F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z4"
FT                   /transl_table=1
FT                   /translation="MAVVLNETEKKKAKEAFLGIGVCEELAEAAADLGWKAPSEIQAQS
FT                   IPQALQGKDVIGLAQTGSGKTGAFALPILQELLDKPQAFFALVLSPTRELAIQIAEQFE
FT                   ALGAGIGVKTAVLVGGIDMMAQSIQLGKRPHVVVGTPGRVVDHLTNTKGFTLKQLQVLC
FT                   LDEADRLLNLDFEQEIDQILKVVPRDRRTQLFSATMTSKVAKLQRACLRNPVKVEVSAK
FT                   YSTVDSLKQNYLFIPAKHKDCYVNYLFNELSSSTMMVFTRTCDQTRKLALVARNLGFGA
FT                   IPIHGQMSQPKRIGALNKFKAGERNILVATDVASRGLDIPAVDVVINYDVPQNSKDYVH
FT                   RVGRTARAGRSGLAITMVTQYDVELYQKIERLIQKKLDAYDAPEEAVLLMNERVNEAQR
FT                   IAQQQMREADAKGGGKKRNRDGDGEEDSQLLTIMGKGGRGGKKGGRGGGRR"
FT   CDS_pept        357395..>358152
FT                   /codon_start=1
FT                   /gene_family="HOG000030261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636757"
FT                   /orf_name="MICPUN_83150"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64065.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG173295"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="UniParc:UPI000199B4F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z5"
FT                   /transl_table=1
FT                   /translation="MASTVHYKFKSQKDYDSIEFDGMFISVGDLKRQIVDKRGLGRDQA
FT                   MELQLTNAQTNEDYEDDAVLVWKNTSVIAKRVPRDQLAAVGSEVGSTTVKKTVYVPPPQ
FT                   IPTGTEFRKPPPRRNMTYIAPGAAGADGAPADTSADPSIAALVSGAASAWETEKAAASA
FT                   MGRGAGRGGGRGAPGGGRGMGGRGRGMDTSGPPPPGYVCFRCSVPGHWIHQCPTNGDQN
FT                   LDVVRMKTAYGIPQNRLEHTEDGVLVAPTG"
FT   CDS_pept        complement(359623..360498)
FT                   /codon_start=1
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636758"
FT                   /gene_name="NIT"
FT                   /orf_name="MICPUN_96425"
FT                   /product="Hydrolase, carbon-nitrogen family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO64422.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG742418"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI000199B5B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z6"
FT                   /transl_table=1
FT                   /translation="MEPPPKRAGVSKAAVGQMRATNDLEANFETCSTLASAAASQGCSI
FT                   LFLPECFAYIGIAGNDALAVMEPLDGPLMARYRQLAKDTGVWLSLGGFPETGPDADHRY
FT                   NTHVLVDSDGDVRASYRKIHLFDVDIPNGPVLMESKTASPGDAIVAADSPIGRLGMTVC
FT                   YDLRFPELYSRLRHEMGAQIMLVPSAFTKPTGEAHWEVLLRARAIETQSYVIAAAQAGV
FT                   HSEKRESYGHAIIIDPWGKVLAKLEDPDNGIGIATADIDLGYLEDVRERIPVDKHRRKL
FT                   ETFEATVEKE"
FT   CDS_pept        join(361139..363128,363245..363252)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637049"
FT                   /orf_name="MICPUN_59194"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64066.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniParc:UPI000199B5B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z7"
FT                   /transl_table=1
FT                   /translation="MSTSTYVMTKMGLMKKKSSVDPKYCRPQGLYSSHNLNLKKLKKLI
FT                   IAGKLAPCYPGQEGAEVAAEAGSDKGTSRVSVAKGTYAAQGYGDIVLDECPICFLNYPY
FT                   LNVSRCCRACICTECFLQVKAPAEGQSVQCPFCKSHGYSVEFRGQKTEAERTAQQKEEA
FT                   EVAAAVARNREHLLAEEREREKRLLERRRSMGTEGPSTPGTPAQGGENTNDNVDDVHVP
FT                   EGWEEEYAAMTPQRPDPEARRGRWVNSPPTRDELRRARHEYRGRISSRQQAAREAAVNE
FT                   RELLRQLADQRQRRTRSGLRRQRDHANAMDPAYLRRIQDFVPAHLLDNAPDEALMAAGD
FT                   LDIEDVMVMEALYLSLQEQEQGEQRERAQRRLADGEDTEVAAAIAQVEAAERERQDEED
FT                   ALPTAEDIEGGNFDYDEEGEDEEEEEEEEEEEEDADDVERDRASADAAVEAITALRTSS
FT                   TASRHSTDQYLEDIRRLRVAGYDEDIDDDDDDEEERDEHEHEHEVDDDDYVSPENLLAS
FT                   PPRTSEDGVYAFGISPADVLSATADATERTADALERSAEDMDRAHDAQEASLQRILRTL
FT                   TANADAIASLSRSRAREAAAREAREEVEAFVSEELEAEFEEEEPAPTLSPGDSERSLGS
FT                   QFNPGSQFNPVQTIRRHSFTTDDIAETVPG"
FT   CDS_pept        complement(363442..365016)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637050"
FT                   /orf_name="MICPUN_59195"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64423.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199B5B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z8"
FT                   /transl_table=1
FT                   /translation="MSQASAPSIDDWRCPVCLEMLCKPVVGACGHVFCFWCEHKSMDVF
FT                   DKSSCPTCRMPFSNLPAVCEALHFHLGRTYPKEYARRLRECHEEEKKTGNFSPNPTPVF
FT                   LFDFSKVNELLSRGLQNRGSEKRLFDFLEAQEPMTEPDMNGIFECTPGMEDVETHVLWE
FT                   PVVLNCGHAVCKSCASSTLTFGPGSTSLCPCGDCRMRVVGDKMPAVCKLMQRVIEASPI
FT                   AERVRREAALREEAAWVNAETELAEEEEEEEDHDGEEEEDHDGEEEEDHDGEEEGEEAN
FT                   PLPGAVPEGGEADVDVDDLRPNPETFVHVAVGCDACGVYPIKGRRFKCIDCPERMGFDL
FT                   CGACHGLVEARFVERGPRLGAIEGRFNQQHRPGHRMREVHPVPNFFHILQQRHPDLNPR
FT                   QIMNFIEEQILAQQEGGDGDPITNAADNIVAEILDNLEPNVDGAVAAEEGTAGGNIMEA
FT                   GLEGGPVEDVVRADAEAEELLTRQLFGDEDEEEEEEEEEGDVEVEYLSEEDEELAADAR
FT                   RRGLDAS"
FT   CDS_pept        365727..366956
FT                   /codon_start=1
FT                   /gene_family="HOG000194265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637051"
FT                   /orf_name="MICPUN_108413"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64067.1"
FT                   /db_xref="HOGENOM:HBG749871"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199B5B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7Z9"
FT                   /transl_table=1
FT                   /translation="MVKEAITYIDRAPNLAVKTELIETLNTVTSGKIFVEVEKARLTRA
FT                   LAKIKEEAGKIDEAASIMQEVAVETYGALSKHEKLFFIEEQVRLCLDKGDYIRAQILSR
FT                   KINAKSFDEIVKAEKKAAIEAAKKAGEDVSQMDLDKDMTEEERAKEEKKKNASVEHAEG
FT                   YFEATDPTIPPVPELKLRYYHLMIRFYSHSNEYLEICRCYQNIMECEGVKEDPSKWTPV
FT                   MKKVVWYVALAANEPMQQSLLHQISKDAKLADLPLHKQLMKQFTTKEIIHWDTLAAAFG
FT                   SEMAAEADIFGGDDGEKRKKDLRQRVIEHNLLVIGAYYSRVTLQRLGELLCLPADETEK
FT                   HLSDLVTSKKVSAKIDRPGGVVDFKTKAQGADWLLNQWVGKIDKLLNTLDKANHLIHKE
FT                   AMAHKVSLEA"
FT   CDS_pept        complement(368532..369431)
FT                   /codon_start=1
FT                   /gene_family="HOG000265606" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637052"
FT                   /orf_name="MICPUN_59197"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64424.1"
FT                   /db_xref="HOGENOM:HBG561472"
FT                   /db_xref="InterPro:IPR019265"
FT                   /db_xref="UniParc:UPI000199B5BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E800"
FT                   /transl_table=1
FT                   /translation="MVLGARVRALAVDALGYAKGVPALALDDRAFREFIVWLEDTKIRA
FT                   MPMDARGPLRAVDAPAAAWNSAFASLVAETGCELDVDDAAQTPRVFDHLLEQAVALDYR
FT                   DNADDFGAVVKDLKLASIGAAPPPPKRQKTSAGGVQGAGEREDDAPRPRMRGLTDPSLV
FT                   SALDELAAVLRVEIPAGSGVEASADACVAAVERFIAPFWSKVEEAERNAGDGKEGRGDE
FT                   RWNLSPSDFPSGVALGFDEDGDGGCSAAATAAVNVLRALHVNDLRVLQSAVDALLVQMQ
FT                   EYTSDPKTDSRLGRVGSG"
FT   CDS_pept        369590..375283
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637053"
FT                   /orf_name="MICPUN_59198"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO64068.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B5BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E801"
FT                   /transl_table=1
FT                   /translation="MTDAVAWPMFPRPRVASRGPPAAGAPSSDASPAKNEATRNDPPKD
FT                   EQGRNDPCGGDRPLAAGARKTAGTDPLASHPLTSTSADVHAGRGGVDTSHRDGEYAKFR
FT                   AVLRKNFTLKTRGSQLWCTILEVLVPVAFIALMCLPRLFISDESVEMTLHRPAPIQSIT
FT                   WSGRVPGGPTGDGPYRLLWSPDTNADAERVAESAAIDLLCGGGFMTQVALASSVELDQD
FT                   AIAEHGILDVPEVLAGCRNNPGACAGFVKRRGGVDSLGPDSAVANPLTLAWLCTDSCLA
FT                   RRECYRPVIDEFLVGFPTETAAMAHAMTLAERGRSVAAIVSLPNDLSRDSRRVEYKIRV
FT                   NATDVPTGDLGARWSSEKFQRWVVGEDTRWRTYWTYANVQKSFDQALMSLTAGDESPAP
FT                   RGVQLLASVKGYPFPAYSTNLGSTFASVFFGLVYVFTFCITVVVVVKGVTVEKELRIRE
FT                   GMKIFGLSDLAYWSSWFVTSYTSLLLVSLLVSIVGIYPFRYTDWTLTFAFLALWTCQLV
FT                   AFCFCLTTFFSSAKVAAIASALVYVVTWVPGVSAVAADNMGSDSWIASCVMMPATCVYM
FT                   WGWVVSILENAQKGARWDTVSLNLLDGGEISASEGTGTFSGALVLGVTACNAVAYAILA
FT                   WYLDQVIPGPFGRTRPWWFVFDPSYWLEKKSSAPAVGDSGPHDSASLPDGVEPVDLDKN
FT                   DAVPMIIVEGLVKTFGSNRAVDGLHFAAHRGQITALLGHNGAGKTTTISVLTGMINQDG
FT                   GAATIDGMSVETDMQSIRKDLGVCPQFDVLWPTLTAREHLELFARFRGVPESEITREVN
FT                   DKIAAVGLESKAECEAGVLSGGQRRKLSVAVAFVGNPSVVILDEPTSGMDPRSRRYTWE
FT                   VIRGFRRRMGTTILLTTHFMDEADILSDRVAIMYDGKMACVGSPLYLKTRFGSGYRLTV
FT                   VLGDSAESPAAVDSVVLNRIKGATQTSTAGSTASYAVPASQRASLPDVLNRLESRRDVV
FT                   ACGVSCSTMEDVFLNVAELEKNLGSPIPSTAPASEPDAVRVEMDEPSAPDSRVHGWALY
FT                   RRQFHAMLWKRAIHARRDRLGIVTMYVVPILFVVLGIAVSKISNEAFEDPPPAVMDRSY
FT                   LGDLPTAFSAATTLDVQRVTGHLSPSEVLPVPRTGGTWRCWNPSPVVDVCRPDAFDPII
FT                   PGCPNCTAPDDLQNTIDGFLLSNIPDQATCANPEHTDNASCAALLVDSAARFAVPGRTR
FT                   EVNYTVMVSSTAYHALPASLASFHDAVFKALHHDAPDATLVSINHPMPTSSEQKLEQAM
FT                   LMHLVVSLCALLGLACLSASASAFLVWERTSASKHLQMVSGLNRGVFWAGAYVWDLIAF
FT                   GPPLAIFLVIFAASEEEAYTGESFAVVAAALGLFALSAPPLAYLLHWPFENNMACLAGQ
FT                   MGAYFFFGVAQIICAVVLGGLAEAGVDAAETAWEVLQWAFRWLPHYCVARVLFNLAGNH
FT                   ADVRLGLVDAKPKGPWHPEVSGRDLGAMAVCAAAYALLNLAIEYEVFTAAWWRRRLGTT
FT                   RFSTPYGGGGGDRFDDGTNDEDEDEDAGVRAERVAACSDAPPGSLRALVVRNLRKRYPR
FT                   RRRQIGGFVDAVRGVSIAVPSGECFGLLGVNGAGKTTTFKMLSGQFPPTSGDASVTPRG
FT                   LDATSTPTSFNILTNLARVRQHVGYCPQFDALQGTMTAVDHLLLYASLRGFAPARAVST
FT                   ARDLIDRLGIQKYATLPASGYSGGTKRKLSVAISLVGDPAVVLLDEPSTGMDPTSRRQL
FT                   WGVLQSTCRGRAVVLTSHSMEECEALCHRAGIMVAGKLRCLGPIQRLKSEHGAGYSLDL
FT                   RVGGDGAIDAVRKLIERRVPDATLKEECATRLRYGLPSSAVASVFALLEDKSNDGLVQD
FT                   YQLGQTTLEEVFLRFAEGGEEDE"
FT   CDS_pept        complement(375522..376082)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637054"
FT                   /orf_name="MICPUN_59199"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ACO64425.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG522494"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199B5BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E802"
FT                   /transl_table=1
FT                   /translation="MADDLAGYLAGLVLECEDVRGKDKLKELKVDVGGDEPLTIVTNAS
FT                   NVEAGKRVVVATIGSELKDGAKVKKAMVGGVTSEGMLCDGPMLGWTGGGAGAAALLPES
FT                   FKPGEAPPKSRPRLDGGGAGGDAPAAPAAKSTGPGVDSLFEKKLTKEEKKALQEKKKAE
FT                   RAAKKAAKGGQDAAEETKSDDAE"
FT   CDS_pept        join(complement(376859..377068),complement(376167..376730))
FT                   /codon_start=1
FT                   /gene_family="HOG000265130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637055"
FT                   /orf_name="MICPUN_100922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64426.1"
FT                   /db_xref="HOGENOM:HBG561474"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199B5BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E803"
FT                   /transl_table=1
FT                   /translation="MRPDSSRTRAKTPAFALLVCSIALLVRGGNGQTPAPDASGGSYVD
FT                   VSSNATSEVEGRFGTQPSQRSGQSLTRVDSDTAVLFGGLSPTGTLNDVWEYKVAQKKWT
FT                   RLHEGGVGPLDTDPYSTVPSPRTGHAAVVLRGDLFIFGGYDPDRGDTNDVWKFTRATGV
FT                   WSHVTLAAGADVPASRSGHAAFAPDPSAGVFTVFGGNMRNDVWEFDVDASKWTVVMTEF
FT                   AGSSGAAVKGVGALLVAVGAATAATLVSGEWWRNF"
FT   CDS_pept        join(377890..377946,378084..379529)
FT                   /codon_start=1
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637056"
FT                   /orf_name="MICPUN_94461"
FT                   /product="Predicted protein"
FT                   /function="NADP or NADPH binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="ACO64069.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG286913"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B5BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E804"
FT                   /transl_table=1
FT                   /translation="MAEADKSQVGLCGLAVMGQNLALNVAEKGFKISVYNRSGDKTDNA
FT                   VARAQKEGLGDNLVGFKDMGEFVQSLAKPRCVIILVKAGAPVDATIEGLAQHMEPGDII
FT                   IDGGNEWYENTERRAKALEEKGLLYMGMGVSGGEEGARNGPSMMPGGAKAAFDVIEPII
FT                   TKVCAQTDSGPCTTYVGPGGSGNFVKMVHNGIEYGDMQLISEAYDVLKTVGGLNNSELA
FT                   AAFNEWNAAELDSFLIEISALILAKEDDQKPGEGFLVDKILDKTGMKGTGKWTVQQAAE
FT                   LSVAIPTVASSLDARFISGVKDERVAAQATYMSAGLEPADAEVAALTPEEKQQLVDDVR
FT                   AALYASKICSYAQGMNLIRAKSNEQGWNLDLGEMARIWKGGCIIRARFLDRIKKAYDRD
FT                   ADLPSLLVDGEFAKELVERNDAWRRVVTSAINAGVATPSMSSSLAYFDSYRRGRLPANL
FT                   VQAQRDFFGSHTYERVDMDGWHHTVWSDMNSADSITTSGYSA"
FT   CDS_pept        join(complement(380898..380934),complement(379684..380807))
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637057"
FT                   /orf_name="MICPUN_59202"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64427.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B5BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E805"
FT                   /transl_table=1
FT                   /translation="MASKNLEDYEKLGRIGEGTYGVVYRARDKQTGEVVALKKVRMDKE
FT                   RDGMPVTALREVRILQSSRHKNIVNLLRVVNGKKPNAIFLVFEYCEHDLARLLETMRVP
FT                   FTEAESKCLCLQLLQAVEYLHRRWVFHRDLKLSNLLLNNRGELKLCDFGLARFYQPGND
FT                   GSYTPKVVTLWYRAPELLFGCARYTAAVDNWAVGCILAELLKHEPLFPGKQEQQTLDMM
FT                   YKLLGTPNEKIWPGFDKLPKFGSYRMSPNQPYNYLQTEFNRLSTAGVDLLNRLLTYDPR
FT                   RRCTAAQALEHGYFQEHPRPKRVEEMPTFPSLHDVLAPVSGGGDVSGRLDVSGRLTGHV
FT                   DGAPAAGGVGGGSSTWDRPDAPLPRGGLKRKRPGGFGQPDRYGSVF"
FT   CDS_pept        join(complement(382601..382700),complement(381166..382478))
FT                   /codon_start=1
FT                   /gene_family="HOG000012507" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637058"
FT                   /orf_name="MICPUN_100924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64428.1"
FT                   /db_xref="HOGENOM:HBG561475"
FT                   /db_xref="InterPro:IPR006802"
FT                   /db_xref="UniParc:UPI000199B5C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E806"
FT                   /transl_table=1
FT                   /translation="MASEDPKLQEAIAFLQKTNLNGESVYEQLAKVVGKVLDEKPEDAV
FT                   DLLETSVIAKKTAFKPADPPLMAADPKNVATAVALKELYCAPKREIDPETGEPIEPAED
FT                   LLNEFESEDIVGDATMYQAVGLGLSLSEMYGVMLAVKRLGEDPKRNCGSVRFFGKVLGT
FT                   NGDYYVFETSIKEHEPEDPPPETPAGEIPPEPAGEGSNEYTYFVCSYLGGAFVRLPDVT
FT                   PKAVVAARKIKKYFTGDLEAPVWSYPSFPGNEAMYLRAQIGRIASATVVCPAGYLVAHQ
FT                   EGEDGPKTLVIPGSEGYEEVEPKYEEKEDLQEMREPANWSHRYRYLKKQGRVETYEPPE
FT                   DADPEAAPVDPPEPDVDPELLSTLDGDTESECVDWGSCVMEEIDGSAQKQPAWTSCTSS
FT                   NVVGVKNQTVAIKSMVWPGAFAVYQPGPKFSNCYVGYGIKNAPYVPAPPPAVMTEAEEI
FT                   PKESDALPPKAE"
FT   CDS_pept        join(383060..383105,383325..384619)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637059"
FT                   /orf_name="MICPUN_59205"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64070.1"
FT                   /db_xref="UniParc:UPI000199B678"
FT                   /db_xref="UniProtKB/TrEMBL:C1E807"
FT                   /transl_table=1
FT                   /translation="MAHVFVLGAAVGTIVVHIKKKAGGGGNDADLSSEERAKREADAAA
FT                   RVAGIEALLRDQAQKLEETKAAAELANKKAEMADLEGELLKQKLDAVITEKNSVERMLE
FT                   DMAKKKDAAELAVQREASEKAKYVDENNALLNKVTVLNDARVADKHQYAVQVRKYRDEL
FT                   VAYTEKTPTEFLAEILALVSDMDNDVDIELVDAEVAAARLGNRTRVAKEEELKICSEWT
FT                   HNPALAMANPQKLARLAGRVRVLDAPPPATASTSNAGGAAKVVNASGVSVSTTPEMAAK
FT                   RRTALGALDQNATAAYSGSAMNKLQEQLDAIEFRLDKAAGKAAAMGASLLDTHFVDITP
FT                   SASPLTSPKMLSAKKMSRSENDDGLVFQGGVGAKSAGGRTSGLSSRGAGFQAKASVNIG
FT                   GFFGGRSSSAASAMTPTKQLKGMDVFDDFEPAPMGPRPSRAMAVLGK"
FT   CDS_pept        join(complement(391204..391383),complement(387906..388010),
FT                   complement(384803..387598))
FT                   /codon_start=1
FT                   /gene_family="HOG000192862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637060"
FT                   /orf_name="MICPUN_91017"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="nucleosome binding"
FT                   /biological_process="ATP-dependent chromatin remodeling "
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="chromatin remodeling complex "
FT                   /protein_id="ACO64429.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016585"
FT                   /db_xref="GO:0031491"
FT                   /db_xref="GO:0043044"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000199B679"
FT                   /db_xref="UniProtKB/TrEMBL:C1E808"
FT                   /transl_table=1
FT                   /translation="MSAEEAATTTREAEEAEEPVAPGGTEETPAVEDTTANDAEASPAT
FT                   ADASEDPSGAEGAAAIALAKAEKARLRQLKKQQREEIEKVRLQQNAAIAKDNSGGKWKY
FT                   LMQQTEVFSHFLAGTKAHNAKKGGRRSKQAEDAEDHELVEAAEEYHAVRLTVQPECIKF
FT                   GKMREYQLAGLNWMIRLFDHGINGILADEMGLGKTLQTISLLGYLSEYRGITGPHMVVV
FT                   PKSTLGNWMNEFKRWCPMIRPFKFHGNQEARAAQKAQYLDKNNAFDVCVTSYEMVIKEK
FT                   NALKKFHWRYIIIDEAHRIKNENSRLSKVMRMFACNNRLLITGTPLQNNLHELWALLNF
FT                   LLPEVFGDAGQFEEWFGTGTEGDNTEVVQQLHKVLRPFLLRRLKAEVEKNLPPKKEMIL
FT                   KVGMSEMQKEYYKRALQKDIQVVNSGGDRSRLLNMVMQLRKCCNHPYLFQGAEPGPPFF
FT                   TDEHLVENSGKMVLLDKLLKKLKEKGSRVLIFSQMTRLLDILEDYLLFRRYKYCRIDGN
FT                   TDGDTREDMIDSYNAPGSEKFVFLLSTRAGGLGINLTTADTVVIYDSDWNPQMDLQAMD
FT                   RAHRIGQTKEVSVFRFCTDGSVEEKVIEKAYKKLALDALVIQQGRLQENQKNVNKEELL
FT                   SMVRFGADKIFDGTTNSTITDEDIDTIIAKGEDETKLLNEKMAGFTDKALKFSMDADAS
FT                   LYEFEDKEAADSKEAFEGLDVKAVIAQGWIDPPKRERKKNYNESDYYRDVMNQGPRKPA
FT                   ASGPRILKLQNMSDFQFYEVPRITELYNKEVARKQYEWHREKQLEALQNNAVPQDLPPE
FT                   EPTAPKPLTDAERDEYEQKLNGGFKDWNRRDFQAFCRAAEKYGRADAEGMASEIEGKTL
FT                   EEVKEYNAVFWQRYTEIADYKRILGNIERGEAKLQRQNEMLKNVKRKLEMYKNPWRDLK
FT                   LVYGSSSKVKSYTEEEDRFLLCSIPEVGFGNWEELKAQIRQHWLFRFDWFIKSRTPKEL
FT                   QRRIETLINLVEKEFEEVDKKRPAGGGGAPAAKKPKA"
FT   CDS_pept        388417..389982
FT                   /codon_start=1
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637061"
FT                   /orf_name="MICPUN_59207"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64071.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI000199B67A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E809"
FT                   /transl_table=1
FT                   /translation="MPTNYVNFKGAADFRMRLICATLGSRALRCVPAAPRRHRPFVARQ
FT                   SRTSDEKAPRRRRRRHLTVARSLPATPRRIDDIRVNDQNPGVRDYEASLLRLLDKLTNG
FT                   MKVEINETGTTLKYKPGIVTGGRRISHDCGTARAIGYFLEVVIPICLFAKKPVDLTLTG
FT                   ITNDETDVSVDTIRTVTLPMIKRQFGVDDGLALTIVKRGVAPGGGGEINIKLPIAKELK
FT                   NVDWTDEGMVKRVRGVAFTLRVSPQTGNRLVDASRGVLNDFLPDVYIFTDHHPGDAKNG
FT                   QRNKTSPGFGLSLVAETTTGCLLSVDCASTSGSAAKEAGHSIFQVDENSGSSSDEDSDD
FT                   YSQESGSDDSDQEEEDDEGSDEDEEMEEEDDDEEKDEEEMDSDEDDPAAAEEAERERRR
FT                   EEKEKRREHRVEFKARMERAKGGVMVPEDLGKTITEALVAEIARGGVCDSTHQPLVLLL
FT                   MAIGPDMLTKARLGPLTPRAIQTLRIIRAVLGVTFNLEEQPQTGTVMCMTVGAGIKNIA
FT                   RRAT"
FT   CDS_pept        391495..392490
FT                   /codon_start=1
FT                   /gene_family="HOG000265108" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637062"
FT                   /orf_name="MICPUN_59209"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64072.1"
FT                   /db_xref="HOGENOM:HBG561478"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI000199B67B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E810"
FT                   /transl_table=1
FT                   /translation="MSAIGTQLAPVVAPVVGAPTRRSRPRGMRVVAMGGRMDGTAGSLF
FT                   GGGKKKADGANLPPSGYRSRTDIPKMLNNTPHPREVRKWFYDDCRESVVAAVTGANPKT
FT                   RVKAFIEFPELNVNGDVYRIGTLLELVREVAMALAADGKRVRVCVQGSMGQGVFQGLPL
FT                   SLSGVARILDMMDWGDADEFIARGSIGGDVPRPDDAYFILISPQNIVGYSVLPYLQEME
FT                   KAAGDRPIIMINPKLGDIQSAGNVMSIRGRGERREYVEKTWEEVYHFRLLYKKPFFFPI
FT                   YGALRYGTGGMWELYKKFGKMEQEEWKLLRTYDDGEPGAAEITKRILAKD"
FT   CDS_pept        join(complement(393105..393241),complement(392611..393014),
FT                   complement(392545..392567))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637063"
FT                   /orf_name="MICPUN_59210"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64430.1"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI000199B67C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E811"
FT                   /transl_table=1
FT                   /translation="MGTFTVTIDNKKKFGGNMRAFGVNAAAGKMRAFGDAAPRQTSALN
FT                   RLSGGVIKRGIGSRLGDSAGKWKHDLFDSPGSNDLRSRLDGGRGSGGRFGAGGGRGGAG
FT                   GRGDDLRSRIVREVHGGRGGRGGRGGRGGRGGMRIDHMGDRGGRGSVVEFLRGIGLARY
FT                   TATFQEEEIDMDALTHLRRRSWLR"
FT   CDS_pept        393533..394297
FT                   /codon_start=1
FT                   /gene_family="HOG000058041" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637064"
FT                   /orf_name="MICPUN_96426"
FT                   /product="Hydroxyacylglutathione hydrolase "
FT                   /function="hydroxyacylglutathione hydrolase activity "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64073.1"
FT                   /db_xref="GO:0004416"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG753931"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="UniParc:UPI000199B67D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E812"
FT                   /transl_table=1
FT                   /translation="MEVYQFPCLQDNYSFLLHDPSTGATAVVDTPEVAPIEAALKEKGW
FT                   KLTHILNTHHHWDHTGGNAELKARHGCVVIGPSGERKGEIPGADRAVREGDEVAVGNVV
FT                   ARVLDTPGHTAGHVVYHFPTEKKVFVGDTMFAMGCGRLFEGTADQMWSSIQKITAMPPD
FT                   TEVFCAHEYTLSNAKFAVSVEPDNEALQARLREVEVKRAKGVPTVPTTVALELATNPFC
FT                   RPDSVLLRRTLGLEGADDVAVFAETRRRKDNF"
FT   CDS_pept        394477..395274
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637065"
FT                   /orf_name="MICPUN_59212"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64074.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199B67E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E813"
FT                   /transl_table=1
FT                   /translation="MESSPESPCGAPGAMTFDFHGLVDLPLECQRAIIDRLHWREVLAL
FT                   ESTCSHLRDLVASDEHAWRVRCEMRFTPEELAVAVDDATTWRERFMRSVKRGMKAVSNA
FT                   RPLLDLADNTVVHFRRFEEAQRRLSGITFQDVREFIAAERSSPTLLVLAGMVECMAREP
FT                   KVEPAEVVGMLKDAGCEASGKSVRLTQWLLGRLEGVGYRLRDEVVVHEGSLERLAVDNP
FT                   RLFEVMLRGIQYEVRDMEVRAIGPEKKPWWAMLGTGMHISQAA"
FT   CDS_pept        complement(395397..396506)
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637066"
FT                   /orf_name="MICPUN_83166"
FT                   /product="Predicted protein"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /protein_id="ACO64431.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI000199B67F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E814"
FT                   /transl_table=1
FT                   /translation="MSTILNDLSAVPDGALDAVLLKSVEMPEGTPTVRGYDFEGPLDLQ
FT                   KMLDCMMTSGYQATQFGRCVDEVNRMLKWRLSDEPIDDTTDEEERDPAYRASLRCKIFL
FT                   GFTSNLISSGVREQLRYLVKNKMIDVLVTTAGGVEEDFIKCLAPTYLGDFALKGAELRK
FT                   QGLNRIGNLLVPNDNYCKFEDWIMPILDAMKKEQDETGVVWTPSKVIHRLGLEINNEES
FT                   VYYWAAKMNIPVYCPALTDGSIGDMLYFHSFKSPGLVVDLVQDVRAMNDEARTVGRPKK
FT                   TGMIILGGGVPKHHINNANLMRNGADFSVSINTAQEFDGSDSGAKPDEAVSWGKIRPEA
FT                   TPVKVHADASIMFPLLVAQTFKQNFEPKP"
FT   CDS_pept        <404193..>405369
FT                   /codon_start=1
FT                   /gene_family="HOG000079418" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637067"
FT                   /orf_name="MICPUN_75688"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="ACO64075.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI000199B680"
FT                   /db_xref="UniProtKB/TrEMBL:C1E815"
FT                   /transl_table=1
FT                   /translation="RLTPCQVMVPGQVALTPNLPPPTMRNAANKHLVPSVAEWSAFNQD
FT                   VATIESIEDEVSVLASLQKPKKLTIVGSDGHKYAFLCKPKDDLRKDLRMMEFTTMLNRL
FT                   LARDPSSRKRRLYLRTFAVLPLTEDCGIIEWVPNTTGLRHVIQALYVQDGIYTKQTLGD
FT                   VKRMHESLKATPTTWMSEILKKFPPVFHRWFLNRWKDRPAAWHGARTAFAHTAAVWSMV
FT                   GHVVGLGDRHGENILLDQESGDCVHVDFSCLFDKGLELETPEMVPFRLTQNIVDGLGAG
FT                   GYEGTFMRVCEITLGVLRSHREALMSVLETFVHDPLLEWTKGSKARGRGEADTSPERAR
FT                   DQLEKIRSRLEGVVVGVGAAPSLPLSCQGQARRLIEEAVSRSNLGRMYVWWM"
FT   CDS_pept        join(complement(406102..406172),complement(405517..406000))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637068"
FT                   /orf_name="MICPUN_59215"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64432.1"
FT                   /db_xref="UniParc:UPI000199B681"
FT                   /db_xref="UniProtKB/TrEMBL:C1E816"
FT                   /transl_table=1
FT                   /translation="MASIAASPAGLFARRAAFNGLAVRPRAVARAVPAVRFAPVAALKK
FT                   DDEWETQKAGPAFNLALAAMVAGSVFVTDVVSPEYAEAARSSGRMGGSSFRSAPRAAPR
FT                   GGMGGQSRQAPPMVGGMGYGYGMPMIMPMPMFSPFGFGFGFGGLSFIFNILIFLWVANF
FT                   FLSFVSSLTAGNDKRNDDDRF"
FT   CDS_pept        join(complement(407572..407781),complement(406568..407401))
FT                   /codon_start=1
FT                   /gene_family="HOG000265136" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637069"
FT                   /orf_name="MICPUN_59216"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO64433.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199B682"
FT                   /db_xref="UniProtKB/TrEMBL:C1E817"
FT                   /transl_table=1
FT                   /translation="MASTFVGAPTALRAQVAPRRGSRSTRALTRADAAAQASLAVTPAT
FT                   VGSRSGSASVKGTVRKQNEDRFASYTNPNAKDGSPYAIYSVFDGHGGFAVSEWLKQNLA
FT                   GLIVEEWPKADFCLEALSQACLRADYDLIQPPPGFFGAFGERGVGGAKCGSTAVIATLF
FT                   EQGGKPTLATANVGDARILLVRDGKAVQLSVDHVPDDEAERKRIDRGNPNLRKSLVTFT
FT                   EGSWRVGGVLALSRAFGDAFLKESGRFEGLGERNADYGSGFGLNAEPDCYIEQLTPTDS
FT                   WVMLSSDGLFANDERGGGGGFENQEIADFLLAAPADASPESLAKELCSMAVSKGSTDDI
FT                   TVTLMRL"
FT   CDS_pept        join(complement(409049..409121),complement(408231..408631))
FT                   /codon_start=1
FT                   /gene_family="HOG000248742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637070"
FT                   /gene_name="RPL18.1"
FT                   /orf_name="MICPUN_59217"
FT                   /product="Ribosomal protein L18"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64434.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG602198"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniParc:UPI000199B683"
FT                   /db_xref="UniProtKB/TrEMBL:C1E818"
FT                   /transl_table=1
FT                   /translation="MLAFSLSARAAVATRVATPATQRRATPSTQVVAKVTPKEARRQKR
FT                   HTKIRSKVSGTADRPRISVYRSNQHTYVQVIDDENQTTLCAVGTMSPKIKEIVGTEEWK
FT                   TKTVDAAREVGKAVGAMCVEKGIKTAVFDRGGFVYHGRVKAVAEAAREAGVEF"
FT   CDS_pept        join(409543..410109,410746..411405,411577..>411720)
FT                   /codon_start=1
FT                   /gene_family="HOG000289958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637071"
FT                   /orf_name="MICPUN_82381"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="cobalamin biosynthetic process "
FT                   /protein_id="ACO64076.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009236"
FT                   /db_xref="HOGENOM:HBG634910"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="UniParc:UPI000199B684"
FT                   /db_xref="UniProtKB/TrEMBL:C1E819"
FT                   /transl_table=1
FT                   /translation="MGGCKVIVVGGMQAGVGKSTVTVGLMAALRQRGLRVQGFKVGPDL
FT                   LDPLLHEAATGKPSYNLDGWMLTKEHNLSVARSLAGDADVAVVEGGDGLYDGTFGDEDG
FT                   STGQLAKWLGAPVVLVLDCDGLPARSAAALLKGHLAFDEELPIAGVILNKTKDAAHEKH
FT                   IRDSIEGAGIGAPIFGALRRDDSGLGDRNKFPVIPESPKRATSGSHAGSPLRANTPKKE
FT                   HSFGRNLVGGVVARLGRGVGTGASHLIPRPLFSNTVRVGIARDAAFCHYYRENLALLRE
FT                   CGADLVPFSPVAGDSLPQGCRGILFGGGYPELYAQELTGNRSLRMAITAFAAGGGVIYG
FT                   ECGGLMFLSQALIPEGGAQPRPMCGLAPFSTRVAAAPASSYAEVTIRPGCPLFPAGCRA
FT                   RGRVHRNSEIGPSANHWEAVGRVEGYAWRNVLMSYARLHWGGTPEMARHFVDVCKGVP"
FT   CDS_pept        <412810..>413343
FT                   /codon_start=1
FT                   /gene_family="HOG000106336" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637072"
FT                   /orf_name="MICPUN_76178"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="iron ion transmembrane transporter activity "
FT                   /biological_process="high-affinity iron ion transport "
FT                   /protein_id="ACO64077.1"
FT                   /db_xref="GO:0005381"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006827"
FT                   /db_xref="HOGENOM:HBG708630"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniParc:UPI000199B685"
FT                   /db_xref="UniProtKB/TrEMBL:C1E820"
FT                   /transl_table=1
FT                   /translation="NTGVLAMDPQRLSEVLDVIVQVGTATGEEDAAIALVGSLRARLRA
FT                   VTAAVAPAKRRPKVLSLEGLRPLAVGGHWLPEMKHLAGGVDELQEPGAPAAGLRWEQVL
FT                   GYAPEVLILAPCVSPTPEDTLDELDRLASQPGFWALPAVRSREVYVVHHVLFSRAGPRL
FT                   VNGVELLAKILHPEL"
FT   CDS_pept        complement(413603..415516)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637073"
FT                   /orf_name="MICPUN_59219"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64435.1"
FT                   /db_xref="UniParc:UPI000199B686"
FT                   /db_xref="UniProtKB/TrEMBL:C1E821"
FT                   /transl_table=1
FT                   /translation="MSSLPHDPRLTKLSRWCVPDPWDTFVAAACSYFCFGGPFVVAGCA
FT                   LLPFLFVLPIVIAWWVVAEGAWLVHRRYLRHRHEQFTPAPDNPARRKQMERMLLMKDDV
FT                   IPDFREFLREWFRGADPRLIRRENVKEFVRYGFYGGVDGPLGQAEEEIEWWIGEVEHTW
FT                   GIAFEPGRTNGLKFMAHMREPLKVFHQPLAYYAYSHCAEALAGLVLRFWGFTWHKCGDT
FT                   GVTYWLRLGPKPLPRTPSRTPSPGMTPSNSYEAFLNDTANGIDGSDDSLHDSGPDPDQG
FT                   GSVDKGRRGVPCAVCGGVDNRTPKYQGGWIKRTIFRRGGGGWGDNRKCFAGCAPRRARL
FT                   SDGTKLMTRENDATTPTWAPAPAPAPTPLVFLHGLGIGLPPYLWTVAHALRARPDRPVA
FT                   LVCLPEISMRAVTRVPSPDDLVDAVENLCRRHALQRPCLLGHSFGSFLVARACQRSKVA
FT                   AVVMIDPVSSCLMLPAVVSRVMYQLDDRWRELIGRESAGMEAVDPEAKRALGLARGRSG
FT                   GIFDRRVSIRDKAELVTRYLFTLARDWFVVKELSATVALCRQFWWFQVCAFAEDLPEKT
FT                   LMVLQSYDAILDAEKIARHALHREAAEVLWVEGFSHGEILGPQGFEARKQLLEFIQNLD
FT                   GN"
FT   CDS_pept        415790..417499
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637074"
FT                   /orf_name="MICPUN_59220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64078.1"
FT                   /db_xref="HOGENOM:HBG611281"
FT                   /db_xref="UniParc:UPI000199B73D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E822"
FT                   /transl_table=1
FT                   /translation="MLAVGGRVWCRSGDRDTRSPRRADASRKASKARARKRAESPVRRA
FT                   ATVVTSDVAETRADASTDDAFSLGCPHFDTCSGCSTSTNLDDFPELRRAREYFARSHDA
FT                   AFDCATGDVRGWRTRARLAARMVPDEDAAGGEKLALGLFARGSHDLVEIPGCVVQHPRL
FT                   NDAAALIASACERAGIRAYDETTGEGELRYVQLTAVGADGRADLDTDAAVQVALVWNSP
FT                   APTTAAGPMTAPRAIALALKLWNSNSADGPGDIEPPNGVRVHSVWIDWNDAPGNKITGP
FT                   HWTHLKGERFVWARHGAADVCFTPGSFVQANSRAFDAALERIRSFVFRGAAVSELYAGA
FT                   GPIGLSIAATMGEDGDDEGSVRCVEIVGAAAETFERSKSKLPEGVGRRVSMAISRAEDA
FT                   CRDAVRDADVVIVDPPRMGLDPRTLTALTGGEAPAAEAGGTAAATAMADGQPEAAVVTE
FT                   KKPMTRAAKRRARKKKRAKAANAPVADAKAPEEPKPSQPTVKFPAPPSRLSRLIYLSCG
FT                   FAAFQRDCDALVKSGEWRLTHAEGFNFFPGSDHVETLAVFDREETGAAFWEG"
FT   CDS_pept        join(complement(421005..421181),complement(417677..420616))
FT                   /codon_start=1
FT                   /gene_family="HOG000265133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637075"
FT                   /gene_name="TIC110"
FT                   /orf_name="MICPUN_100937"
FT                   /product="Chloroplast envelope anion channel-forming Tic110
FT                   family"
FT                   /protein_id="ACO64436.1"
FT                   /db_xref="HOGENOM:HBG561483"
FT                   /db_xref="UniParc:UPI000199B73E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E823"
FT                   /transl_table=1
FT                   /translation="MATQAVSAVAGIAPQQAAPAQSAKASGFASGGVRVPRVAGLAKGS
FT                   ARVKHVTRASATPQFEKDMDQLEAQQSALGQARLGAYGVVVGGALAVGAAAGTATGSNA
FT                   AKAVLTAGLGAGAAVAVATADKKRVSAAPKALWNGMLNRDPATITKADVDAIGAKFGMK
FT                   DMSKDCPEAVTELYDAYLQSIVPMGDDPVQGWEPEALRNFRQQLGLEDADAANAHIEVG
FT                   RRLFRKRIELGDKDADLESRREFQKLVFISTRTFGEKQAKFLLPWNRIFRVSDAQVTLA
FT                   MKESASNLFKNHVNESGAINTLEAGALAAARAYQQELNLKDADCAEVVQKLAQDYVVSK
FT                   VEAASELAQVRSVNSDFTEANKLLTEVLDYNKKMGAGGDALPGLQVVTLAGSSFEDKSG
FT                   EANTLFRNFVTQGTEAGEFSAELKSSAGALKVLFGMGNKEAEEIVLDVTTKRYRELLRD
FT                   AVKSGELDKAESPAKVLQSICEKLQFPPEVAADVNKENYRTKMEQVMEKKKLTDEDVEA
FT                   LGRVRRLLCVPKDVVDECTMDICGAVYKSAVLSALSVGTESFTPELRDRCKRAKDAVRL
FT                   TDDMALKILKNEVVKAFMAYIRVARTKQNKIEQSKEIRKMVYFNSTVVTPMVSDVTKAA
FT                   AEDAAKELAELLKEAQAAAKQEEEDEKKEAEAKAESEEKKEEGEEAKDGEEKKDVEAKA
FT                   DGEEGEDKKAEEDKKEAEEIAAKVEQPAYQKEINLKDEVDSVTAQGIYQDYLMFCMQGD
FT                   TVNAPMGVQITIERDQSEFTRLSQLGDILGLNQFEVGSVHKGLADKAYRAQAEQILGDG
FT                   RGLTADRAEKLKEIQQGLSLPDADAQKIIKGITSKKMLQDMQAQIAMGTLTIADIRKMK
FT                   EEGVDIENNISMDKRMSMFRKNAEKRLTDGSGSSDLSALTETLPEDLSITKEKAQSELL
FT                   KIANEKKRSTMVQAVAELRQKKVGDVIKSAKNLVACHGVAPESKLEWAVQEELKDIFSV
FT                   FVMEGAGAEEQDKLQAALGLDDAVCAELKEVVGAGKFQLKADVADEALF"
FT   CDS_pept        421694..422842
FT                   /codon_start=1
FT                   /gene_family="HOG000036278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637076"
FT                   /orf_name="MICPUN_108421"
FT                   /product="Type II secretory pathway family "
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /protein_id="ACO64079.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000199B73F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E824"
FT                   /transl_table=1
FT                   /translation="MFAVTSTPACVRATQGTALAGGKRCGRIFNSLSTPVVRRERRGAS
FT                   LRVNAEFSIGKLTSVLAKKTKGDLDRVFKGTSKTREKLSYMDEVLALWNLDGLEDTLEE
FT                   LEDTLLSVDFGPTTAMNILDVVRERCEKGEIKTGAEVKAALKRAIVDILVRANDGKEGT
FT                   APLKLNEGDGPSVIMVVGVNGGGKTTTVGKLSHRFAKESGAKVMLVPGDTFRAAAAEQL
FT                   ATWAERSAGVMATYKDGMKPGALCYQAVDEAIKMGDIDIVLADTSGRLHTNCDLMDELA
FT                   GIKKSIGKRMEGSPHEVALVLDGTTGLNMLNQAREFNKMVDVTGIILTKLDGTSKGGAV
FT                   VSVVDELGVPVKFVGVGEAIDDLQTFDPVSFVDALFPDDPAE"
FT   CDS_pept        join(complement(426606..426995),complement(424474..426189))
FT                   /codon_start=1
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637077"
FT                   /orf_name="MICPUN_104852"
FT                   /product="Transketolase chloroplast "
FT                   /function="transketolase activity"
FT                   /protein_id="ACO64437.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI000199B740"
FT                   /db_xref="UniProtKB/TrEMBL:C1E825"
FT                   /transl_table=1
FT                   /translation="MAALNTSFAGQRLNKAAARKVSAKVTTRAVKPVTRAQAVAAPADV
FT                   SSETVMDCVNTIRFLAIDAINKSNSGHPGLPMGCAPMGYVIYREAMTHNPKNYQWFNRD
FT                   RFVLSAGHGCMLQYSLMHLTGYPSVSNDDLKNFRQWDSVTPGHPENFITNGIEVTTGPL
FT                   GMGICNAVGLAMAEKHLAGRFNKPDCEIVDHYTYAIMGDGCNMEGMSGEGASLAAHWGL
FT                   GKLIAFYDDNSISIDGHTDISFTEDVCARYEAYGWHVQHVQDGNTDLDAIRDAINKAKA
FT                   DPRPSLIKVTTLIGYGSPNKSNSHDVHGAPLGADETKATRENLGWKYEPFEVPEDVSKY
FT                   MDCSEKGAAAEAAWNKKFAEYKEKYPEDYAELNSIITGELPAGWADALPEFTPEDAGVA
FT                   TRIHSQTMLNALGSAIPGFIGGSADLAPSNMTLMKQFGDFQKDTPAERNVRYGVREHGM
FT                   GAIANGIALHSPGFKSYCATFFIFSDYMRSAMRIAALSGAPTLFVMTHDSIGVGEDGPT
FT                   HQPIEHLASFRAMPGMLMMRPADGNETAGAYQIGVEQTDRPTTFALSRQVVPNLAGTSR
FT                   EGVRKGAYVVAGPAAGEDCDCIIIGTGTELELAVNAAKELGAKARAVSMPCWELFEEQS
FT                   DEYKASILPKGVPTVSIEAGSTFGWSKYADISIGRDDFGASAPAGILYKEFGITTEAAV
FT                   KAAKSLM"
FT   CDS_pept        complement(427431..431468)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637078"
FT                   /orf_name="MICPUN_59225"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ACO64438.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG611632"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B741"
FT                   /db_xref="UniProtKB/TrEMBL:C1E826"
FT                   /transl_table=1
FT                   /translation="MSGADGRSSPAGPSGAAGGDQGNGQPKHNFKVISGFTKSQIDQLR
FT                   QQITIFKKIKKGEYDFDFPGYVPRSATPQLRAHDQPDQSQWTHQHHQQMQQQRQGAGRG
FT                   GAGRGRQRESGPRPDAVPARPPPPDVCSLPSWYKRPRGPIYDLAAGYGGMEEDTSAAVK
FT                   YGYKPVPYECDVRAMVEDEANRQLETRRKRRLAEVQAQLAAIEDDSTPHAYQQRRRLRV
FT                   EEKKLRLVELQDSVRAKVVAEQRELMELGDRAYKKLIKEAEKAKELAAKRDVKRAKEER
FT                   EAYFKSLTVYRRKISEASSEAKELVVTRNRQVMKAHERMSRDWMRRQRDALVASQAAAK
FT                   AKGGGDGTADADYLRRVEALKANDMEAYRELLAEAQGREGAVSADDKYASLQEFLEKTE
FT                   GYLQQLGGKIAALKLTQQRSEAAAAAAAEAEAAGLTEEEVIAAAEAAADQAAEQGSRDL
FT                   MDAANAHDGADGKQKYYALAHSESEKIIRQPRMLTAGTLRDYQIVSLQWMISLYNNRLN
FT                   GILADEMGLGKTVQVCALIAYLWESKQNYGPHLIIVPNAVIVNWKSEIKLWLKNMSAVY
FT                   YVGHREERQKLFNQQVMQLKFNVLVTTYEFIMRDRAKLSKVNWQYIVIDEAQRLKDREG
FT                   RLARDLDRFRCNRRLLLTGTPLQNDLSELWSLLNLLLPQVFDNAKVFQQWFGDDGKKSA
FT                   AGAGGEGEDWMEKEKKIIVISRLHQILEPFMLRRLVQDVERKLPPKITIAVHCPFSAYQ
FT                   AAVYDWVNKTGTLRVHPTMSKIGLAARQNFKGYLALQNRCMELRKVCNHPALNYPTDKG
FT                   GEWRTGEDLVRTCGKLWMLDRMLIKLRAAGHRVLLFSTMTKLLDLLETYLKWRMTTPAG
FT                   EGLEWCRIDGSTALDLREEAITAFNAPGSKKFIFLLSIRAAGRGLNLQTADTVVVYDPD
FT                   PNPKNEEQAVARSHRIGQRREVRVLHMEAVMDEIGAADDDGGIGGSGHGGAGKGGHGAV
FT                   CSPDDTTWGTGGTRKFTESIESVVRNVVQQQKIEMADEVINAGRFDQQTSHAERRETLE
FT                   KLMQEQATAGARSCASMSLRTLNEKLARTPQEVELFNEMDLRADLWPGTLTVADETPGW
FT                   IRYKKADRDEAVSSQATRTKPGLAGEREEAEKARAIELASGVQLGRGARNRGGFVPGSY
FT                   AAANAALSGKDARAVQLRAMKKAAEDKDKDRDEDRDDAKDKDNDKAKEEDKAAAPAAAA
FT                   AAAVAAEDEATEVVLEDDVESEVTETENEALVEAGEEVGMDPAELSEEDEEYHKGEDEE
FT                   LAGIDEIGAHIDEDDDMPPSPKFDHPPPADDDGPVPMDTDEQAPPAAAKKLTFKFSMKA
FT                   KE"
FT   CDS_pept        432468..433208
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637079"
FT                   /orf_name="MICPUN_105701"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64080.1"
FT                   /db_xref="UniParc:UPI000199B742"
FT                   /db_xref="UniProtKB/TrEMBL:C1E827"
FT                   /transl_table=1
FT                   /translation="MPAVTLNTRTDLTTSKAKLGTFELTTTTTVEGWKIKATAEPSVPE
FT                   LTKSGLSDFSAEIPAMNAEASKDGITVFLDNLQLIPKKQFVPRLKIAKSVDVADQSYDV
FT                   KAELIPKGNTSAAKDNSPSNSHVVKLGVTAPAISGFTPKLDYSTGNNTATVEVSGKVDK
FT                   ATVTLKADIDIEGKKSKGASAKVAYPLPEGVKATVEVKDDKSAKVELAKDQFTLEVPIA
FT                   DLTAPSLSADNLTLKVKYSMDFDM"
FT   CDS_pept        complement(433580..>434260)
FT                   /codon_start=1
FT                   /gene_family="HOG000231116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637080"
FT                   /orf_name="MICPUN_82734"
FT                   /product="Predicted protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="ACO64439.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG482410"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B743"
FT                   /db_xref="UniProtKB/TrEMBL:C1E828"
FT                   /transl_table=1
FT                   /translation="PSEDVIDLLRTATGVCFDVDSTVCTDEGIDELAAFLGKGEEVAEM
FT                   TNKAMGGGVGFREALEMRLSVMQPTRQSVETYLANNEPKISPGVPELFDALRANGKTVY
FT                   LVSGGFRQMIAPVAARLGVPPENIFANNILFNEDGSYKSFDPEEFTSKAGGKAEAVKHI
FT                   KAKFGHGTMAMVGDGATDLESRAPGGADVFVGYGGVQQRAAVMDGADWFVTDFDKFTEV
FT                   VDSK"
FT   CDS_pept        join(complement(436591..436735),complement(435457..436343))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637081"
FT                   /orf_name="MICPUN_94478"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64440.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B744"
FT                   /db_xref="UniProtKB/TrEMBL:C1E829"
FT                   /transl_table=1
FT                   /translation="MSSAMATQQFTANVLRTGARNARKAPRAASRMTVRAAQTDLTLPI
FT                   DLRGKKAFVAGVADDQGFGWAISKCLAQAGCEVILGTWVPALNIFETSLRRGKFDESRK
FT                   LSDGSLMEFAKVYPMDAVFDTYDDVPEEIRTNKRYAGNEKWTVAECAEQVEKDFGKIDI
FT                   LVHSLANGPEVAKPLLETSRNGYLAALSASSYSKVSMLQRFGPIMNKGGAAISLTYLAS
FT                   EKIIPGYGGGMSSAKAALESDTQVLAYEAGRKWGIRVNTISAGPLGSRAAKAIGFIDDM
FT                   INYSLTNAPLAEKPLTAMEIGQTAAFLCSPLASGITGSCIYVDNGLHAMGLATDAKSLE
FT                   RSD"
FT   CDS_pept        437023..437409
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637082"
FT                   /orf_name="MICPUN_59229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64081.1"
FT                   /db_xref="UniParc:UPI000199B745"
FT                   /db_xref="UniProtKB/TrEMBL:C1E830"
FT                   /transl_table=1
FT                   /translation="MSVLAFAAPTVSPALSRGAGPRAKSRTASVRRAMAANNKAPVVIA
FT                   EKTRPAAKVAAAVNAAMTVALVALPAFAEEAATATSSGEISPFAGVVDVTVLGVVGLLA
FT                   VQGNKKAEAAKAGGKGAKGGKKKK"
FT   CDS_pept        437774..440527
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637083"
FT                   /orf_name="MICPUN_59230"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="ACO64082.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG316558"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012178"
FT                   /db_xref="InterPro:IPR013725"
FT                   /db_xref="UniParc:UPI000199B746"
FT                   /db_xref="UniProtKB/TrEMBL:C1E831"
FT                   /transl_table=1
FT                   /translation="MPADIRSFFGGGPKKPAGDAAAKPKEEKLEEPAATVLPKKAKAEE
FT                   PKPDVDMVDLTDDAPAPKTTAKRKTVVDDVREPRSVPQTSRSTSNVFVVYFSPIAPTHV
FT                   MFLRRQPSRALHHTQDDDFVPDKSPPSAKKAKKTPSKKTPTKKTPAKKEPVKELPKPPG
FT                   YPKEESELKFSVIQGDQAWGYNDTRAEPPNKGVKIAPRGPNDCLEGVTVVVSGVLDSLE
FT                   REEAEDYVKRHGGKVTSTVSGKTTYLLVGMDCGKSKYNKAKQHGTTLIDEDGLFAMVAA
FT                   CGEKPAVEEIKPEPAPAPAAAKSPVPTPKPSPKPSAAAPTAPPPAPVKKAKGEDETPLW
FT                   VNKYKPNQPAQLIGNGAKIAELRKFLTTWEDVHLKGPEVKGKDKPMKSVLISGAPGVGK
FT                   SSAATIIAKQLGFEVVEVNASDTRGASGKDVKEGVGGKASNAIREMVTNRAVNFFTGKP
FT                   KKMCLIMDEVDGMSGGDRGGVQELIACIKISKIPIICICNDKYNQKLKSLQNYTMDLPF
FT                   VKPTKVQILKRMLKIAQDEGITMSEAAMEALIETCSNDIRQIINQLQMRRLTKQTFEFD
FT                   DVKSLAKKDLDMGPFTAMDKLTNRDAGLLTVTERLNLVFQDSDLIPLFVQENYLQYRPF
FT                   AARNDAERLQIVANAATCISHGDIMNRSVRMKQNWGLMPYANMVSSVMPASMVRGGRET
FT                   FHEYERNFNRFPGWLGKNSSAGKMKRLLHEVHSHAMTSNAFKADSAGMRCDYLPLIKDL
FT                   TSRPMWEPPQGKGKEGIEDVMEIMNSYCLTRQDWESIYDLCKFPKGVGPEFVDVLKPIA
FT                   TATKTAFTRACNAGSRTVHSGILVEDFKKKRGGKKAAANEDDGMDEGEDEGEGGGSEEE
FT                   DNPFDNAPKGPKLSAKRLAAIGFVAKDDGKKKKAPTKKKAAASKKK"
FT   CDS_pept        440931..442052
FT                   /codon_start=1
FT                   /gene_family="HOG000087629" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637084"
FT                   /orf_name="MICPUN_82948"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64083.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI000199B747"
FT                   /db_xref="UniProtKB/TrEMBL:C1E832"
FT                   /transl_table=1
FT                   /translation="MALKTGIVGLPNVGKSTLFNALVENSTAEAANYPFCTIEPNSGIV
FT                   PVPDERLQALAAISGTSKDNIVPTTVEFVDIAGLVKGAADGAGLGNKFLANIRECDAIV
FT                   HVVRCFDDDDVIHVDGKVDPLSDISVINFELALADMAQIEKRLERLNKGRAKSNADKEA
FT                   EAGERDALAKIKVLLEEGKPARLADLNEDEWALVKDLYLLTAKPTIYAANVNEDDLADK
FT                   GGSNPHVAVVREHAQEEGAEVTIISAQVESELIKLDPEERDEFLADLGADEGGLQSLIR
FT                   AAYKQLKLQTYFTTGEKETRAWTIKEGFTAPQAAGVIHTDFEKGFIKAETVGYDDFIVN
FT                   NGFSGAKEKGVWRLEGKDYVVKEGDVLVFKFNV"
FT   CDS_pept        complement(442115..446635)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637085"
FT                   /orf_name="MICPUN_59232"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64441.1"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="UniParc:UPI000199B80B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E833"
FT                   /transl_table=1
FT                   /translation="MSEEKCAVSELSAWPLLLAKWAERVRGGGVHRSCRGMVTRGWRDD
FT                   DTGAGAGREAGRRRPRGRDRGGGGPGRFHRGSFALLVCILACRVASAGASPKLSALSFV
FT                   GDVATLTPAFDPDTLSYNASVTTDRTSVQLAYAVASPDSASSVEVTTAVTQPSGRRRRN
FT                   LLSSTTSALAISPGHNDVTLTVRRISDNAATAYAVRVTAYSLAAHVSLSGLSLVVGSTP
FT                   VALPGPGFQANTLTYDVTVDYRTSAVSITPTAAYAAKCTMTVNGVAHTSGQAVLNVATP
FT                   TFADVGPNVITVTLTAEDGLTVGTYVVNVNRVPPPPPPSPPSSPSPPPTPPPPSPPSPP
FT                   PAAPPPSPPSPPPSPSPPPLPSPPPVPSPPAAPPPPSPPSPPPPPPSPPPLGPPFRWVT
FT                   TPWTKCTAPCGGGTQTRSVICAGGPGGGPVEYVECGGAEVAPASFRECNWNACPVYRWD
FT                   FGEWSDCNATCGGVGFRQRLVQCKSKDPTSTVRVVGVGDNYTVGGRVVPDALCRANTSA
FT                   VVPASMENCNFRPCTYHHWDAGPWEKCSATCGGGRRWRNITCAVRDDMWEEMTAHNADP
FT                   LANPNIQGSNATGGGAANAGEGAARGTEKTVTNVSTCYAYQDFIGDPPAEYGVCHTQAC
FT                   VDGPRWLVGEWENEGACDKKCDGGRLRRSVRCVEGAVGAEVDADVSKCPSPAPEGEVPC
FT                   NTHKCDFCERETCSYRGKCSEGACDCGPTRIGLFCDVSRVCGFDQLGTLDGRCCAGTID
FT                   AVGMCCPTHLPDAPAVIDGDGNCCYSGKVDACGECDGAARTVDVRGECCPGKLDAGGFC
FT                   CASGVFDACGVCEGDGTTCPVWLEVKAWFPQSIIDNGTESFNAHAREWFKIALNTSESV
FT                   IAGTAESGAVMGATVMYTPPPPPPKPSPPVSSNGRRKLLQTMSPYGVAVTIPMRFPFEA
FT                   GVDPSWTALAMLDQLALRSGKPVETKGNMSDVLWATRASRVMGLARAGACGNGVCEVGE
FT                   TCSSVIDELHDPDAESEAHAAVVRAANQYASLTASVKAAATAVYAGSSLVGPYVSDAAN
FT                   KCCPRDCPHVLKSCPSPEGTTSPCGGRGRCLPATGQCDCFKGMGWTGLACGECAEGYYY
FT                   KFGTCQAKLPIAAPPPPRSPLGFIQAPPPMVEKDRNNWTGLALAVAGAGVAATLLCMGS
FT                   SAISAVSAFVGGRLGRKKPEERDSDRVAHLRGGKRAGKGGFDDDWVFAMKTPSPPQGRK
FT                   TLTRRPPSPGGGSLLGGGFTSGFTSLDDAAYYDESDERFNAGRRFGSPAGHGRGRRDRA
FT                   MSSRAYASPEVLTRRDANRGPPPSPPRLPSEGRRYPDDPPPPPEERFRLEGKTVALSRA
FT                   VMPEGAQEPARLPTANLGLTVKRYVPPEDPSGAEVAVNIDTRGLPPVEGSRRHAAPKVV
FT                   TTEVLTLGEPGVDFNVGRWPRGGGMEHVRAQREREELARLADERDRARRERYQRQLQWE
FT                   AEERERRGEHQRMMERERRLGGPHYSGSDTYSEYSPSVADPADRW"
FT   CDS_pept        join(446815..448230,448341..448395,448527..448924,
FT                   449224..449679)
FT                   /codon_start=1
FT                   /gene_family="HOG000100077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637086"
FT                   /orf_name="MICPUN_59233"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="gene silencing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64084.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016458"
FT                   /db_xref="HOGENOM:HBG561487"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniParc:UPI000199B80C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E834"
FT                   /transl_table=1
FT                   /translation="MGRSLAKKGGSAKKKGGHADWMDDEIDDANRLRSKDKIGFDASDS
FT                   EEEDPDADLDTEAVMDIGGDSDDDSDADSDEEEEDAEEEEEDDDDDDDEGDDDDDDDDD
FT                   LGSDDDEDEAALIRAMKAQQKKLASKGVKRGGQDDSSSDEEEEEEDDGLRIKGRKKADF
FT                   YGDEEVDHEGMSDEDERRDEEREARRLQQARAAGMSAADFGLSDDEDDSEDDESDSEPE
FT                   EEATLGAKAAKLSAKGKKAEKESLKKVKKNVASLGAAVESLGCEELEAAEGADAETGDS
FT                   PEVVALTKELTKNLDEVRNTIEPLCKFVREGNMVTKEGISYLDTKHLLMLSYCINIAFY
FT                   LLLKAEGRPVKDHPVVLRLVEIRTYIEKLRPIDKKLKYQIDKLLKMAKEGVTGEEEDAD
FT                   GAGEDPLQFRPNPDALVSKVDEDAEEGADGGVYRPPKMMPTAMEEFEEGGKSSKQKRAE
FT                   KEARRRAQRSSLIKATGRETTWRTQIVPDLGQELILFATTQELAQELGEAPEELGGDEG
FT                   DMQSAFAKREFARMEARAKIEEDLFTRVPLSKVERRRQKATTRSVNSLSQVGDFGDDVA
FT                   DLVEVAEELENKKRTRLVDSVTQLGAKPKKAKATSGDADLPMRDSLGDRRDKYERGVNR
FT                   KMAAKAREEEEAADREAARERRRVDEDEEYAGAATLRDRKRAAKEEKYRRQAGIIAPLE
FT                   EEIGDFDKRHVGKKIMENRGLTPHRSKDHKNPRKRLRDKFAKAQIRRKGQVRSMREDGG
FT                   GYAGEATGIKTSVSKSRRFGK"
FT   CDS_pept        complement(449774..451048)
FT                   /codon_start=1
FT                   /gene_family="HOG000210093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637087"
FT                   /orf_name="MICPUN_108424"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64442.1"
FT                   /db_xref="HOGENOM:HBG523811"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI000199B80D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E835"
FT                   /transl_table=1
FT                   /translation="MASAEELVKKVEAGAEIEDSKPLEAVATYRDVIFGVGGSDGDSVK
FT                   AKESAIDKLSKLYAKLKDAPALRTLLTELRPLFATVPKAKTAKIVRNIIDILAGVPGFD
FT                   DLQVELCKEQVAWARAEKRTFLRHRVELRLSGLYLDMKSFQDALKLIGQLAFEVKKLDD
FT                   KLLLVDIHLLESKIHYALRNMPKAKAALTAARTNANAIYVPPSLQCVIDLQSGILHAEE
FT                   KDYKTAYSYFFEAFEQLNNLDDEAKAVMALKYMLMCKVMCNQAEDVASLISSKGGLKHQ
FT                   GETLDAMKAVAEAYTKRSLKDLQSTLRSYEKQLGDDPIIAAHLGALQDSLMEQNLLRVI
FT                   EPFSTVEIAHVANLIELPLSDVEMKLSQMILDGKFEGILDQGAGCLIVYDDSAANTMYK
FT                   ATLETISNMDRVVDSLMVKSSKIVA"
FT   CDS_pept        join(451438..451488,451575..451734,451820..452061)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637088"
FT                   /orf_name="MICPUN_59235"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64085.1"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="UniParc:UPI000199B80E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E836"
FT                   /transl_table=1
FT                   /translation="MSEEPPVDPPAEAPPAEEPAPAEEPAPAEEPAPAEEPAPAEEPAP
FT                   AEEPAPAEEPAPAEEPAPAEEPAPAEPAPEPEVAPEPEPEAAPAPVPDVVASPAKGAGK
FT                   PVRQYLDDTVVPVLRKGLRELVKQRPEDPFEFLADFIKSNKPKASD"
FT   CDS_pept        complement(452361..455930)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637089"
FT                   /orf_name="MICPUN_59236"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64443.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="UniParc:UPI000199B80F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E837"
FT                   /transl_table=1
FT                   /translation="MPWACCFRRTSKRTSKRERQHGCRSDVGHAEAAKKINVFGFLSHH
FT                   VFGFLSHHLTDTSVSSRSSVTESWSSPSSHAHRIEKYHDHRPRATTRMSPLRRSMRRIR
FT                   PRAATSTRMLVFMSSVLAAVFVDASTGPADHTGVKSSHEITRATNVTPGDDTRHPASLQ
FT                   LTVHAFGASLDLDLERNDELFSREYRVLAWNPASNAHQLVGNHPGTDHCHYHGRVRNAN
FT                   PGVRSHVVLSTCHGLSGIVKIGDETITLKPAERDAEHRDDDQLDADVVATIDVNADGSV
FT                   GPIPVGEDLSESAPSDSRRALLGGGGGADAFKYTAGPQTIVMRVMVVNDNDRCKFFTAG
FT                   ASMTSAEQTNMEVHTRHLMNMAAWMYKTISDEVSIRIVLAGQVNWCAGNAFSMKEVQLG
FT                   DRSGTYDDKVKYYQSFGARIIDKSDLDAKVPAWIYSNQASLPPFDVAHIFSPNAFAREE
FT                   GALSALAGGFASQGTPCYGFGVDGDIGRFGSSDQFAVHVIAHELGHNFGLNHDIGPGCH
FT                   ESDIFHIMTGDGSDSTDGKISVRVWSKCSVDAMLKLVQDSKLDCLKGPGHQSTTGRCGN
FT                   GIIDPGEGCDCGALDCSSVDACCDGTTCQLATGATCAPTEIGAGGDKSVEAPRSCCDAA
FT                   TCAPAAAGTVCRAAIDATCDAPEVCDGTTSSCPADAPAVALGTPCAGINGDRGSCWGKF
FT                   GQRGPFRCSNRDLSCTSLTDSILHGNGWSNPPRGGAHAADGTCSLGDYWQRNGFPYDTA
FT                   AKKFTAAHCDGGGTGNMVCFSGTNCSAGWYSLQRSYALAGFPCGDIGPDGIYESVCDGG
FT                   AGHNRHGHLATDFQDGVMYDGSNQPQWYPSKCVPTSSLLKPPPPPPPSPPTALPPSPPP
FT                   FPPPAPFATTTLFVDVTNFDYANAKDRWDWIWHIEASLAGALPQSYKERHQADRDSSSW
FT                   WTRATFSLKARMTIPGVATVDGVSDAVFKRAVAADLGVDVDTVVIVNKTVSSRRRRARA
FT                   LLASGGVTVNYELSKYATVANTRSDPSGGSINGNMTRELYVRNRVLASEAFLTVNAAFG
FT                   ASPDVSNPPANPVTATCELFIMAGSVEEAAAVLATAKDPSFPGKVNTLMRNWWPSETAS
FT                   VTKVSATPEVYHPPPEDGMSDATIALYSCVAVVACGLAAGAAYRWGGALRRKVAPLGAM
FT                   TSSVTSKKSSTAKVAPAPPKAPK"
FT   CDS_pept        complement(456041..457165)
FT                   /codon_start=1
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637090"
FT                   /orf_name="MICPUN_59237"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO64444.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199B810"
FT                   /db_xref="UniProtKB/TrEMBL:C1E838"
FT                   /transl_table=1
FT                   /translation="MAVSFEVPTIDISAFDGDDPVASAAVVDAVRTACENVGFFLLADR
FT                   GGVPEDLVRDALAASRGFFELPLDEKMRVASLKKGYIPVDGCDNAVRPTSLHEKFSCSR
FT                   VDLATVDRSDPYYDPSASPQAELYFGEDNRWPGAPDGFRDAWERYYVAMESLTRRLLRI
FT                   FARALRAKGGDDFFADKCRRHVSNLVALRYPPLDRSKGAAIEERVRAHTDPTDVTILAF
FT                   ERGPEGLQVLPDGADDWLDVPDAPATLLVNLGDMLRFWTNDAWRSTRHRVMARPRGARA
FT                   GVPSGVPSGVPSGVPSGVDDDGGDRLSLVFFHAPDYDAMIDCEDVGGAVVSAERPRRYP
FT                   AFRSGERSHFAQLVRNERGLPDRQTLREDNSRGD"
FT   CDS_pept        join(complement(459378..459407),complement(457254..459251))
FT                   /codon_start=1
FT                   /gene_family="HOG000164071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637091"
FT                   /orf_name="MICPUN_83165"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /protein_id="ACO64445.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG628350"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR012973"
FT                   /db_xref="UniParc:UPI000199B811"
FT                   /db_xref="UniProtKB/TrEMBL:C1E839"
FT                   /transl_table=1
FT                   /translation="MQYNFKKITTVPTAKDFIDVVLSRTQRQTPTVVHRGYAITRIRQF
FT                   YMRKVKYTQTSWNEKLSKILEDFPRVDDIHPFYSDLLNVLYDKDHYKLALGQLNTAKNI
FT                   IDKIAKDYVKLLKYGDSLYRCKQLKRAALGRMCTIMKKHAASLAYLEQVRQHMSRLPSI
FT                   DPNTRTILVCGYPNVGKSSFMNKVTRADVEVQPYAFTTKSIYVGHTDYKYLRWQVLDTP
FT                   GILDRPLEERNTIEMQSITAMAHLRAVVLYIVDASEQCGYTIKQQADLFHSIKPLFANK
FT                   PLVIAVNKVDVRKLEDLKPEDAALIAGMRAAVRGPAALTLGEEEELPCMSTLSEEGVME
FT                   VKRVCCDKLLAARVEQKLASRRAGEVLNRLHVAQPKPRDNISRPAVIPHSVAINKAKKA
FT                   SGELKIVTEKMLQEENGGAGVYNADLRKNYLLDNDDWKYDIMPEIYNGKNVADFIDPEI
FT                   DERLAELEREEEELEAKFQEDKAAAEMEMEPDLDDEEKELLGQVRARRAKLVSEHRRKK
FT                   SVANNVPTMRRDRTSDPERRLTTTRMKESLGAMGIDTTLAVARARSASAVREGRKRSRS
FT                   LAGNGGDEDVDAMDADGEEKPRVHSSKSRSVSVARRTSKSKGAGLRDESEKMRAQKLAD
FT                   KAQRKMNKRAKTGEADRVIITKMPKHLFSGKRGNGKTDRR"
FT   CDS_pept        complement(459661..460761)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637092"
FT                   /orf_name="MICPUN_108425"
FT                   /product="Predicted protein"
FT                   /function="rhamnose transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64446.1"
FT                   /db_xref="GO:0015153"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR010476"
FT                   /db_xref="UniParc:UPI000199B812"
FT                   /db_xref="UniProtKB/TrEMBL:C1E840"
FT                   /transl_table=1
FT                   /translation="MAAVGAISAVAAGLLNGSWNLPTKPDAPRLVNAALYWEWEQIWLV
FT                   ANILIVIFNTFLVLGVVGAGTLGDVYRGASSGELGSICAFSLLWGFGGVGYGQAIKRVG
FT                   MALGTSIVMAQIVCIGTVLPLAFSAADMTTQEIVGSVVGVLLACAGFAMSSRAGLLRDA
FT                   GDEAGGRARGSRASTTTTAAVDVEDPVKGASRSTFVESMAWCVAGGVLSSMLQFSFVFG
FT                   GGLVDDAEERGVAKEASAMPVWMLCFLFNSVGHVFYASWLLKANDTWRKFRSTPARDWA
FT                   HGGVMCALIAVAFTAHIHLYGFSASSSGAVFAWPLVMSSTVFTAQVWSLVLGEWTDASL
FT                   EARVANWASLGLLVAAVAVVALTATL"
FT   CDS_pept        complement(<461382..462824)
FT                   /codon_start=1
FT                   /gene_family="HOG000175283" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637093"
FT                   /orf_name="MICPUN_82395"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64447.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG327539"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="UniParc:UPI000199B813"
FT                   /db_xref="UniProtKB/TrEMBL:C1E841"
FT                   /transl_table=1
FT                   /translation="MDMREPGAWYPLARAMRREVHLHVGPTNSGKTYSAIQQLKAADSG
FT                   VYCSPLRLLAWEVAEGLNNRDGVPCNMITGQEKKPVDGARHVACTVEMADIRRMVDVAV
FT                   VDEAHLMGDPERGYAFTRAILGIPAKELHLCGDPAMVPLVQKVIEEVGDKLTVHRYTRL
FT                   QPLKVLDTPLRSIKNVKSGDCLVAFSRKAVHQLKRDVVRQAGLRACVIYGSLPPEARAR
FT                   QAELFNDRATTGYDVLIASDAIGMGLNLSIRRVVFTTMRKFDGEQMRLLEPPEVKQIAG
FT                   RAGRFGQGFGEGGTTTMVAEQLPILRHAVAAPVVDLTRCSVAPTLEHVECYLEAVPGAT
FT                   LVEALTALCRDASLPPHYFMATCDGMLAAAKLVERLPLSVEDHWMFAVAPANVEDGGEG
FT                   AKALWTFADAFARRGRVGVRIIKRPPARAPETQGELNVLEQAHAAYDLYLWLSMRHPAA
FT                   FPEMELAQALRQTCAAAIELGLQ"
FT   CDS_pept        463482..464711
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637094"
FT                   /gene_name="PORC"
FT                   /orf_name="MICPUN_96428"
FT                   /product="Light-dependent protochlorophyllide oxido-
FT                   reductase"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64086.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B814"
FT                   /db_xref="UniProtKB/TrEMBL:C1E842"
FT                   /transl_table=1
FT                   /translation="MARALLQTAIPATGARCPARSARVSRVVRAAARRSSDSSDAALGR
FT                   RDAVVGAGALLMLTTRVAPATAEDEAPDAAPEAPAVPKYGKPRVVITGSNSGIGFDAAK
FT                   KLAKSGDWCVVLACRTVAKAEQAKASMRSEFPSIDPNDVQCYACDLGDMASIRRFAKDV
FT                   TAEGPVDALCLNAGLEYSGDPTVYRTKDGFEETIGVNHLGHFLLANLLLPALESSEKLA
FT                   HPRIVVTASEVHDPASAGGSVGKGATLGDLAGLERDGKNFEMVSGEPYDADKAYKDSKL
FT                   CNMLFSYELERRLQASGSKVTVNAFGPGLITRTGLFRHQQPLFVKAFDLITNTFNVAES
FT                   VDGGGNTLLYMLTDESLEGVGGAYYSNTISPGSSPTGHAFIVQESSEESKDATEARNLW
FT                   RLSEKLVGLA"
FT   CDS_pept        complement(464924..467554)
FT                   /codon_start=1
FT                   /gene_family="HOG000204108" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637095"
FT                   /orf_name="MICPUN_82956"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="ACO64448.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG357195"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000199B8E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E843"
FT                   /transl_table=1
FT                   /translation="MADITAVLSATTSPDAATREAAEAQLKQAQEQNLGAFLQSLANEV
FT                   ATEAKPLDSRRLAGLILKNALDARDETVKADKQEKWVTMDANIRNTVKGCVWNQLGSPV
FT                   QEIRHTCAQVIAKIAGAEMPKALWPSLVTDLQNNMATGDPGKRQSTLEALGYICEEIEH
FT                   EHLQEADVNAMLTAIVQGMRKEEESNEIRLAATNALVNAMYFAEGNFEREQERNYIMQV
FT                   TCEATVCADVRVRQAAFEVLVGAAENYYEKLQPYMTAIFDLTVKATKGDEESVALQAIE
FT                   FWSAIADEEVCRQDDIADAGEGNHQIVYHRFVEQALPHLVPMLLETLTKQDEDELDEGD
FT                   DVWNLAMAGGTCLGLVATCVQDAVVDHVMPFITGNIGSQEWRLREAATFAFGSILEGPD
FT                   PDKLAPVAAQALPFLLNALNDPKTHVRDTTAWTIGRVFEFVGEAQSPVVNPGNLDNILK
FT                   ILVEKLQDKPLVAGKVCYALLRLATSCANDDDEQNPMRVALAPYFQGIVQSLLQTSERP
FT                   DAEQSLRMECYESLNEIIRASTQQNAPITQQLVPMVLQKLETTLAALSQPGLGPEAQEK
FT                   IGEVQGLLCGTLQTIVQKLSGEDATKMMIIQFGDQIMQMLLRVLGARSATVHEEAMLCV
FT                   GALAYATGDQFEKYMQALYPFIEVGLKNHEEYEVCNVTVGVVGDLCRALDAKILPFCDG
FT                   IVYQLLQDLQSTALHRSVKPPILSCFGDIALAIGPAFEKYVGYVVPMLQSAQQLSLQTP
FT                   KDDEEMIEYNNMLRNGIFEAYAGLLQGFKDDKSKVEQLKSHAVYVLQFIAEVAKDGDRD
FT                   EAVTRAMVGVMGDMADTMDGVGELFKQNMFWVELIRECEDQYQDQQLRDTAQWAKGKIT
FT                   MRVGM"
FT   CDS_pept        join(467746..467844,467906..468634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637096"
FT                   /orf_name="MICPUN_59243"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64087.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniParc:UPI000199B8E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E844"
FT                   /transl_table=1
FT                   /translation="MSTCRWLWRPVGGSRRRGKADRGKETKSGGCTVALLRSVGTRDDF
FT                   WAPPLFRGAGMECLRPALKKRKRYSPDDPEGVVGGFTTPVTPAGAPSDAGDSVPGITPK
FT                   SVTFKRGSKCQRIVGSADPKIDRTPIEIPCHCDGCGKYILTARHNCDACEDYDLCAPCY
FT                   ASLVDGTLEHEHDASCFEVKDWTEEEEEAALEEASRSTAAHATPASDGTGGARPDDRGD
FT                   GDGVETPGGGGRDGVGAVLFQTPTSQAPAIGDGGAQLAKGGEGVADANASSSR"
FT   CDS_pept        join(469464..470267,470547..>471533)
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637097"
FT                   /orf_name="MICPUN_82674"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64088.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B8E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E845"
FT                   /transl_table=1
FT                   /translation="MRPHASVTPEQAAAGAAALARRIASDPALAEIQRKRAALPVDEFK
FT                   GQILDAVARNQVVLVAGATGCGKTTQVPQYLIDDAWGNGRGATIMCTQPRRISAVTVSE
FT                   RVANERGENIGAGSVGYQIRLETKASADCALMFCTNGVLLRRLTSPGADKMLESLSHIV
FT                   IDELHERDLFADFLTIVLRGVLARHRHLRLVLMSATVREDLFSDYFGGCPVIRVPGYTH
FT                   PVADYHLEDILSLVGYGGGGGGGVHDFVYAATADPDSPEGQAVQAATLDAAEDEIRRLS
FT                   AMENASAQMSQYQIQADPDEVDLQLAQELIHWILTHRAGEMQTAHGGPAGAVLVFLPGW
FT                   NEISQLRDNMAADPRFSDGTTLVLPLHSMVPPQDQKRVFQRPPRGVRKVVLATNIAETA
FT                   VTIDDVVFVVDSGRLKEKSYDAHTGVSTLQAAWISRASAQQRRGRAGRVRPGECYRLYS
FT                   TARMSSFADFQLPEMQRSPLEELCLQVRMLAEASSLGGERGGGAAAVGMGQGSTAEFLL
FT                   QAVEPPIPQAISQAVALLQDIGAMKDDEGLTRLGRHLGEMPVHPRVGKMLLYATLLGVL
FT                   DPVLTVACASAYRSPFVVSVD"
FT   CDS_pept        <474783..>475516
FT                   /codon_start=1
FT                   /gene_family="HOG000240892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637098"
FT                   /orf_name="MICPUN_69885"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO64089.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG715901"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B8E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E846"
FT                   /transl_table=1
FT                   /translation="NTSVYVTGLPDDAEVDEVKEVFSKCGVIKLDADTAAPRIKLYRHK
FT                   ETGELKGDGLVTYLKEPSVQLACTILDGAPFRHTMGTNMTVTPAKFEMKGDFVAKKRSG
FT                   GKKRKAAVIAKQEAELGWGGFDDTKDRKKTTVIIKHMFTLDEMFSDPNFRVELEEDVEA
FT                   ECGKFGAVDKVKVFTTNPEGVVSVRFKDGGDAQKCVTAMKGRWFGGRQLEASLWDGFTN
FT                   FAKAGLESTEEDEAKRLKAFGD"
FT   CDS_pept        complement(475596..476591)
FT                   /codon_start=1
FT                   /gene_family="HOG000220466" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637099"
FT                   /orf_name="MICPUN_59246"
FT                   /product="Predicted protein"
FT                   /function="diaminopimelate epimerase activity"
FT                   /biological_process="lysine biosynthetic process via
FT                   diaminopimelate"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64449.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008837"
FT                   /db_xref="GO:0009089"
FT                   /db_xref="HOGENOM:HBG399442"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniParc:UPI000199B8E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E847"
FT                   /transl_table=1
FT                   /translation="MSASASALVAPSAVRGLASHRVVRRAGARRRCVAVAAAADAVKFY
FT                   KYQGLGNDFVLVDNRDSSEIKLSSERCAQLCDRNFGIGADGVIFAMPPGLVQKDEDYSM
FT                   RMYNSDGTEPEMCGNGIRCLANFVAKMDGADPKAYKVGTLAGLIQPEVRADGQVSVDMG
FT                   EPTLDPPKVPCTFEATQDGAAVRAKMEVDGETWLVTAVSMGNPHCVTFGKEGECDEEGI
FT                   KVDSFALSHYGPMFEKHPAFPAKTNTEFTEVVNRNYVKMHVWERGAGATLACGTGACAT
FT                   VVAAVLEGRTERKCTVELPGGPLEIEWRESDNRVIMTGPAELVFDGVVAV"
FT   CDS_pept        complement(476967..477923)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637100"
FT                   /orf_name="MICPUN_59247"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64450.1"
FT                   /db_xref="UniParc:UPI000199B8E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E848"
FT                   /transl_table=1
FT                   /translation="MRALDDAERLLVSGSFERAKIEAAAARQVAGSTSERVAAECVWIQ
FT                   AEYKLGGLTRHDLDAARMAAGFGEEFHRASALLWSRLRLANPADPAEAEAAAEKALQRI
FT                   FERTLVDRRGGRRDGEGDDDADILPGAAWLYAVHLTFQRRRRSRDARTWLTARVNEGTL
FT                   TADAWRRLDAEIDDEDDTAVKRTADDEDEDDTAVPEGEARVKSQGSPRTKPRSPGGSGT
FT                   RETGRETTGTNAGATRAGDDGQSLAMDSDGYDSVDAFGVVAAVRWCARYIGVGDEGANG
FT                   IGPAAAGAAVVTAGVVAFAMASEATRGWRRRRGGGRR"
FT   CDS_pept        complement(478058..479605)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637101"
FT                   /orf_name="MICPUN_100957"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64451.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199B8E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E849"
FT                   /transl_table=1
FT                   /translation="MEAGEEEAGYGAFLRAMPTAHTYLGEVRDLPGNSDIRYELARSGG
FT                   PLRCNLPLLPLSHQVLFPGDTLPLMIPSDDPLTQRLVHRAMAAPPPLKGLFCALTFVPE
FT                   MYDVASEDPRGVVGTVMEIRQVSVEDDAREDSALSVVARGILRLRIVDLDWIHYLARHP
FT                   VGLRPVAVRSATSVDVECDVIPEETFPRRPALPATAFGKNSPALPLTPHSASVYEAFDA
FT                   VRLAERVRRTPFVALTVKDVASLPKDPESLSYAVASRLPLDACERWRLLATETTTERTR
FT                   LLLRLLSEKEACDLSLTCRRCGVAVANMSDIVVVSDGGATGSYVNPGGIVHDMVTVEPR
FT                   HAGRTLRLHGDPSAEHSWFPGYRWTIATCGTCGVHMGWRFTPEREGSRVGSSGGDGDQL
FT                   GAQLESFEPRSATGAFDDGDAGAPARTEWPGGRIVGTGEFYGILRSATVAAEDGVGQSR
FT                   LRVPPTWPEGVDVVVDESQSDTSEGEDDDVGDDVDGSDGGDGGDGGDEATREDPCVD"
FT   CDS_pept        479787..481019
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637102"
FT                   /orf_name="MICPUN_59249"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64090.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199B8E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E850"
FT                   /transl_table=1
FT                   /translation="MATMVAIEARAPTPRVFCIPRRAEPARSRPTNSGVFPRGKRKGAL
FT                   VVHAQQYSGNMYHQPVGNREPPYDPNKPARPAELNNNAIATKATEASAIMRAHEEAQRI
FT                   THAAPGASDEERERATHERNVQAATTMGENAHALRERYSGDAEPEYVADVREARQRHID
FT                   LEARAVQERDYVTASKSAAILRRLVEIETELLVQETKEMESSLSQQYAEAALAKRKKDA
FT                   LLQELNDINIGNVTDDRYGDLTVKSNVTPKPKQKQATQSEGDQESDPDPRDPAPMQPMV
FT                   PVRFGINVKTAFGEGVVVCGDIPELGAWDANAAPKMEYQKKDATWSTTVHIPQGSVFKF
FT                   KFVVEGGLSEKEKEQGKQRAHHWQEGNDRKIQLPIEGDALSLDVVCDWDGNEAKERMWL
FT                   CTPVPSVAPNV"
FT   CDS_pept        complement(481142..483835)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637103"
FT                   /orf_name="MICPUN_100958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64452.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B8E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E851"
FT                   /transl_table=1
FT                   /translation="MALEVSRVLAGAHDDPILCVAYNAVRREVWTGCQGGKIRCWEEKT
FT                   GEMVQEVSGAHKGWVTAMEYVRRHDYLVTCGVDGTMVCRTEKGKELQRVDARGALFCLA
FT                   YGARRDLLVAGGRGAISVFRLVTINTIERNKDPGDRRVHPVRLVCTVPDVHADVIRGVA
FT                   CDANGRIFTGSYDRSVCVFDGEQFERMRMRDADEPAASVPPRDPPRYRRWANAHDAAVS
FT                   VVATDPANAWVLTGSYDGSCKVWTHEGAQLMNFSNFPGVDKVTGLCYSPATGTYWASGG
FT                   KDRGRVNVLDPRSPLNVTEFVRGVCGFGDFAVTALHASPNDGDRVFGVVADGVPTRHDV
FT                   VLWRFESDATFRVLRAHEDWVEALVRVPHRGDAPEEVYSVGSEGTVLRWRASGDVSTDV
FT                   WTKEESIDGGDIARGGMACACFSADLGALVTGCEDGTIRIWEPSVSPDDADGREPEPGS
FT                   EDGDEFDGDEPKEKESRLEDYLDGEEPWLRKVMPGHQGRVAAVAELWDHTLASAGADRT
FT                   IRFWDLQTRREAHCVPDAHENAVHSLERCALREEIATAAQGEDRVKIWRASGPYDPDED
FT                   EGARLAGQLTGHAEAVTAVKWCEWRELWVTASNDRTFRLWCPRALETTRCLKFRGDSIT
FT                   AMALDASNGKVLAAMTDRKVRVFDLARMEGRKDKHGNWIDDGVKGDEELDGGEGDQIAE
FT                   GEKKATEAEEDAPVAPEGKEQSKVEEPPAPRVPNFAGAHVDDDAEADHIFCGHVDLIRA
FT                   IVCAPGKGQYMTAGCDGDVRVWLAPNNPNRTSSTVPTLFEPGSEGVDESSIDRGVGEFE
FT                   RKNPLVVPRSIRAPDPAAKMIARQLEERERMDAEETERVARVEEERREREMSTRVGRML
FT                   CGLQDELMGRGGEAEPAKEKVRAGGR"
FT   CDS_pept        complement(<485019..486800)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637104"
FT                   /orf_name="MICPUN_100959"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64453.1"
FT                   /db_xref="UniParc:UPI000199B8E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E852"
FT                   /transl_table=1
FT                   /translation="MARGLGIANTVFAATGRASGGGKKTAKVGPQPSSSPGNNRRGAGQ
FT                   GASSGGRGGGSRPRGKPARLPPPPPVDPGVAPAGMRRRVSVKTSTKGESPFADLRGGGA
FT                   LLSPAARKDPARAEEERRRLWERLGASATGSGNAPAGFAHLLDPGAKAMTQGSGRGEEG
FT                   TRARGSSRAVLRVGYTAHREKFARALRLELEEEMARAKERLETWPVDRIRQEGYALFGL
FT                   RAMHEGTLQKDAVVRVLVPRHQVAGSNAAPDVPAGSNAATAPPTPSSVDRTRRTLAMGA
FT                   ELPFHRFAQGDMVTLVEGDEWDGNGKGGVQGVVVERAMHFLKVAVDEDDEAALLDARKL
FT                   RMDLSANTITHDRALAALVAFSEPGGMPGLAAAPGGKRLSSTAYAPLQRALIGIPDGNG
FT                   TLEAIACVPPPWGGKDALAKTLSPALKRTDHAKLNPSQAAAVKRAFGRTLSVWQGPPGT
FT                   GKTRTLMSFIEGAVELARAQGVTGGSKKTGPIVLACAASNVAVDNILDGLVRERDTDDA
FT                   QGLKGQRAKEGLKVVRLGSPAKVQPWLESHTLGALAAKTPIGKKAASLREQARGDYSPR
FT                   GAAARRQAAGMERVASEQ"
FT   CDS_pept        487202..487789
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637105"
FT                   /orf_name="MICPUN_108427"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64091.1"
FT                   /db_xref="InterPro:IPR022196"
FT                   /db_xref="UniParc:UPI000199B8EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E853"
FT                   /transl_table=1
FT                   /translation="MHFNRRSLALLACAILALQPVSAMEGMSGMASGSSTTTWSCSAKC
FT                   DGSVAADKICGGKNVSTASTLGLGTCAETKKAIFDVPKYATSAHMVPCDPGYCKMCTAA
FT                   GEKTMMGSTVTCYNNSVTMYANKTDANDHALARGCKGSHEMMSKFMPGETHASCESGKN
FT                   YFDAVASGAASGGAAAALFASVVVAGVGGFLV"
FT   CDS_pept        488620..489210
FT                   /codon_start=1
FT                   /gene_family="HOG000105368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637106"
FT                   /orf_name="MICPUN_91031"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64092.1"
FT                   /db_xref="HOGENOM:HBG657460"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI000199B8EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E854"
FT                   /transl_table=1
FT                   /translation="MLFAIVFCETGLVVTPFLPGDSLLFACGALGAQGIMNAPLVLGLL
FT                   FLAAVMGDTVNYGIGNFIGGKVIQKYPKIFKKQYIDKTKGFYEKYGGKTVVLARFFPII
FT                   RTFAPFVAGVANMNYTKFFTFNVVGAAVWVGLFIFLGYFFGTIPAVQENFAATIVAIIL
FT                   LSCLPVVFELIQAKKEAKEEAAKAAGEGGAAAS"
FT   CDS_pept        complement(489294..490805)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637107"
FT                   /orf_name="MICPUN_59254"
FT                   /product="Bile Acid:Na+ symporter family "
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64454.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG607708"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="UniParc:UPI000199B8EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E855"
FT                   /transl_table=1
FT                   /translation="MANPAIAATGNIILFVLILGLASQVDWGEFKQRFSKPYGIGIGLL
FT                   CQFIVLPLAGLASVRAFFPNNPVYGIPLLVTVCSPGGSYSNWWCSLFNSDLPLSMAMTT
FT                   ASSLLAVGTLPVNIMIYLALAYPNRGDDGVKVAYGGLFLSLAMVVCGIGLGLLASIKRP
FT                   EWRENLGKLGNAAGVTLVLLGVFFSSNSSRPIWARSLEFYVGVGVPCVVGLLVALAFAY
FT                   ACGLPKPHCLSVTIETAYQNTAIPLAVILSTFSNDDKAMCDTIGMRAEAVEGEGGGAAD
FT                   CDVIGVAAGVPTFYQVVQVVSLGILCLAGWKAGWTYAPPHHTLWRILSDNYQPIAGDDE
FT                   PDDPDVRLAHGGSTGSFVHRDIRARRRHTRSLSLGSGENFDFDSINFAELGAIGEERTA
FT                   DNPLGGVGDAGGRGGGRARRGRGGRGPGHARTRSDGGFFFDAALPPSRSPKKGEVNSLL
FT                   RVNSLGDIVEDDSPRREKSDEVTGEGDECGDDETVDVEAVDLEKK"
FT   CDS_pept        join(491235..491272,491473..492409)
FT                   /codon_start=1
FT                   /gene_family="HOG000091643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637108"
FT                   /orf_name="MICPUN_94482"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64093.1"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AD91"
FT                   /db_xref="UniProtKB/TrEMBL:C1E856"
FT                   /transl_table=1
FT                   /translation="MAETLSLRGVLKGHEGWVTSLATPLDNNSDMLLSSSRDKTVILWT
FT                   LTREEGNYGYAQKALRGHSHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGSTTRRFVG
FT                   HSKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQEQEGHTEWVSCVRFSPVTS
FT                   NPIIVSGGWDKLVKVWNLTNCKLRTNLVGHTGYINTVTVSPDGSLCASGGKDGVAMLWD
FT                   LAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQSCVKIWDLESKSIVDELHPEFPPVGK
FT                   KSIPPFCTSLQWSSDGATLFTGYTDCQIRVWTVSRAIGGAGAF"
FT   CDS_pept        complement(492495..494369)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637109"
FT                   /orf_name="MICPUN_100962"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64455.1"
FT                   /db_xref="UniParc:UPI000199AD92"
FT                   /db_xref="UniProtKB/TrEMBL:C1E857"
FT                   /transl_table=1
FT                   /translation="MDRTPGGSRTRGGQPPSNDATPNNKFKDFFRNADERLRDTGRMVG
FT                   TRLGEGIERIRLRQGSPGESTPSPTGRGRRKPRASPGAWSRFGRKDARVAEQDLAARHE
FT                   GATRDRTELFAQMRTTAKYVRETEAKEQAENELRSRLEREGWSNGYDANDDDDDDDRLT
FT                   PGKRIRNLFTRRRRQSEKEEDASDKDELEEVSPHFMAMCEAADALAPIRRKIENNLLPQ
FT                   YESFVASLSTAAVAAAAPDAQPAAQTNVETHLATLLLVEQELQGALKLLKQSHMRAMGL
FT                   RVTLGDPAEECLKRNVVNAHMIARQHLTGKFKRARDSVSAMLKGNAAAKVVAQQRMLIA
FT                   SAAAYDELERFYKRLVRLGNEAAAHQAVSDAGREGERVRAAFLAAAKTTKNALRAAFEE
FT                   STNVKKGTYGIESEVDGFKPGSWAYEGTMEETWRAHCKGVDGELAKYKRAVGSPTVRAA
FT                   LCLLPREDVDGADVDGDERSVDAADVGNAAVELVRDQLRNAVDAIEDAARACALMTASS
FT                   SGGSTPSTPSGGRAGEDERTTPGHGRGNLFGRTAAALVPVKNAVAELFRALHALAATAR
FT                   RVDVGDGGAEVGTPTSESKRSPLAKVKTWWKERISPGFSHSGSPSPNR"
FT   CDS_pept        join(complement(496583..496783),complement(494619..496454))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637110"
FT                   /orf_name="MICPUN_59257"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64456.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AD93"
FT                   /db_xref="UniProtKB/TrEMBL:C1E858"
FT                   /transl_table=1
FT                   /translation="MNKYEVIGVVGEGAYGTVLRCRNKETGEAVAVKKFKENDDDPAVR
FT                   KTTLREVKVLRTLQQENIVSLKEAFRRKGKLYLVFEYVPRNLLEVLEERPGGLDPDLVR
FT                   RYTWQLVKAVAWCHRHDIVHRDIKPENLLVGSDDTASDALKLCDFGFARQLKRHKANEP
FT                   LTDYVATRWYRAPELLLGSNSYGLEVDQWAVGCIMGELTDGQPLFPGESDVDQLHIVRE
FT                   AMGAIDEKTQGRDDRVSRTRLPPSTSPRRDRGMEHLRRRYSPKLDDNALRFMRGTLAMD
FT                   PRERLSWQNMLTHAYFEGMDGWTARPPLHENPAEKAPNAKAPNVAPNSKSSSSETATSH
FT                   PTERKHPSPTTSPVTLKERRERRMKENAEARRMAMETTAAAAAQSELEAAAREAKASRE
FT                   RRERERAARETAAKARASVAESPYSTSAAARRRREKFGVGAGASGASIRHSSLRADETM
FT                   TGTGTGTGTGTGTGTTVEYVAGTRRYGSFGAKPGGVAELRSRYASRVLGAAAVSSARLA
FT                   ETDALARGRRSMQRPHSLAADVFVDEDDAAVRGCDRGVGDRASFARLASFADPSKPARR
FT                   LQSLVGARASPALAPPTPSMALNGRAIGVPKATRPARGGGGFWGGFGSADAPRSLAAGG
FT                   GGGARASAGPTPHLDRLGAGPGGGFEERGRRVAVGGGLGAGWR"
FT   CDS_pept        join(497314..497485,497775..497920,498123..498255,
FT                   498343..498809)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637111"
FT                   /orf_name="MICPUN_83180"
FT                   /product="Cold-shock protein with RNA binding domain "
FT                   /function="DNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO64094.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AD94"
FT                   /db_xref="UniProtKB/TrEMBL:C1E859"
FT                   /transl_table=1
FT                   /translation="MADEVATAEETPGAEEVSNPDAPAAESKEESNEPNDDAKTGVKYK
FT                   GVVNWFNVAKGFGFVTRDDGVGDVFVHQSDIYAEGFRSLRDQEPVEFELEPMGDGRYKA
FT                   VKVTGPDGAFVRGALPRNSYRQRGPYTMARGGMRGPGGMTMMGNGMGIPGYPGGPGGPP
FT                   MGGMGPGGPMGMMGGMGGMMGSPPNGLAMGNGDGGGLPAPLPQPLGGGFGNPPGANGGP
FT                   IGGKRVVVLNLPWQTTWQALKEFFAGVGAITRAEIASDEDGRSRGYGTVRFSSEEEAAR
FT                   AIATLNGAEFEGRIITVRMDKYQQ"
FT   CDS_pept        join(complement(500942..501220),complement(500714..500795),
FT                   complement(499112..500598))
FT                   /codon_start=1
FT                   /gene_family="HOG000227327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637112"
FT                   /orf_name="MICPUN_104854"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64457.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG678063"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199AD95"
FT                   /db_xref="UniProtKB/TrEMBL:C1E860"
FT                   /transl_table=1
FT                   /translation="MAEQVIVVGGGLAGLSAAHTVLEHGGRVLLLDKCPFLGGNSTKAT
FT                   SGINGALTRTQAKAGIDDSADKFEADIIRGAAGVGHTSAPAHTIPLAKVLAQGSGSSVD
FT                   WLIEKFGLDLSLLSQLGGHSYKRTHRGKERFPGFTITYALMEALEKVMEDTNGDLAKIV
FT                   TKAEAKRLLTDETGGVVGVEYSKDGSLHKALGPVIIATGGFGADYKQDSLLTRFRPELQ
FT                   RLPTTNGEHCTGDGIKMAMAIGAGTIDMTSVQVHPTGIVHPGEPDAKVKFLAAEALRGV
FT                   GGLLLNADGERFCDELGRRDYVSGEMNKNKGPFRLVLNGKASKEIEWHCKHYCGRGIMK
FT                   RFSSGAEVAKEIGVNPSKLAKTFADYNRVAQTKQCPYGKKFFHNLPMDMNDNVWHVAIV
FT                   MPVVHYTMGGLQINTESQVTNERGHPIAGLYAAGEVAGGIHGRNRLGGNSLLDCVVFGR
FT                   VAGDTASRDLLQTAIKALRTGVRPGQDVALNRVANLNGHINPGAHVEQHASLGVGGGGG
FT                   VSAPSQSFNAGGGGGGGGVSAGALTEAEVAKHNTEGDCWVIISGKVYDVTKFLPDHPGG
FT                   KKAIMLFAGKDATEEFDMLHPPNVLKKYLPPEACLGPLA"
FT   CDS_pept        join(<501944..502060,502115..503122,503765..504550)
FT                   /codon_start=1
FT                   /gene_family="HOG000265442" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637113"
FT                   /orf_name="MICPUN_82380"
FT                   /product="Predicted protein"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64095.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG633203"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI000199AD96"
FT                   /db_xref="UniProtKB/TrEMBL:C1E861"
FT                   /transl_table=1
FT                   /translation="CCTQCGKILDDNVFSTDPTFSKTAGGATQVDGNFVPESGVDSHEK
FT                   TINKGKYEISQVADRLGIRPREDIANAAHRLYKLAVQRNFTRGRRTQQVAAACLYIICR
FT                   QESRPYMLIDFSDVVQTNVYVLGAVFLQLCRLLRLEQHPLISKPIDPSLFIHRFADRLT
FT                   LGRKMHAVANTALRLVASMKRDWMQTGRRPSGVCGAALWVAALLHGYERSKRDVVAVVH
FT                   VGEATLRKRVTEFENTPSAMLSVEEFDIRAKDYEKEQAALAESGALLGAPGGITALTCI
FT                   HKDHDGSTHFAHGMCRQCYLEYARVSGGARGGEDPPAFQAAEARRDREAQRALPAPQAT
FT                   LALPAPAAKKGKKMSAKEAREAMEAIEREARAKAKVKGEDEDEDTDAEPETFSDVDDEE
FT                   IDNYIHTAEEVKLRRVIWSELNRDYLETQAAKEAAVAAAPPALPGIEGDGGKGGKKRKK
FT                   YTHQVPADTAAEAAQQMLSSKKISSKINYDALNDLFKQDESNERAKKTKGGDQSEGGGA
FT                   GSASAATAAAAPAVGHGKGRLSRLGGGERGLGALGGGKGLGGGGLGSRLAAGATLVAGG
FT                   DAAGAAETANPAVGSKFDSIAAAVDIRPKQTARKSRGLSAATLAMAGKRKGGKRDADAT
FT                   K"
FT   CDS_pept        complement(504679..505344)
FT                   /codon_start=1
FT                   /gene_family="HOG000265462" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637114"
FT                   /orf_name="MICPUN_108430"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64458.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG561501"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000199AD97"
FT                   /db_xref="UniProtKB/TrEMBL:C1E862"
FT                   /transl_table=1
FT                   /translation="MPTPDQTENPFLGMPHYVTGTYTRNSTFLNDEEYSRALDCFVKGC
FT                   ADIFLTDSKGNAMLGKRKVEPQPDWWFLGGRMKAGDTIEEAAARNCKRETKLDIDPSRW
FT                   SFVCAQTMLWQFRKQEPCGNGTADINVIMTAEITDEEKASMVMCNEEYETWGWFQPEEL
FT                   LSEGSKIKLHPVLRRGLTELVNNHIKQELHRKVCEGGTDAEIAALVRKIYSKGHDHYV"
FT   CDS_pept        505597..506184
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637115"
FT                   /orf_name="MICPUN_108431"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64096.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AD98"
FT                   /db_xref="UniProtKB/TrEMBL:C1E863"
FT                   /transl_table=1
FT                   /translation="MGNVCGSKREDTVIVYDERDRPRRVSVSEYSHINAAQQRKLQNMG
FT                   YDCAPPAGSYAQGPRRSGVRDEVPVEPIPEYVVDYRRDQAQLREELERDKLQQREMEER
FT                   DIATESRLVVANGEREETSLMDQNGGPALAKGASFKDGECVVCLDAARTHLMHPCGHLS
FT                   MCETCAGALMEKVLPKCPICRKDVDSVVKVWR"
FT   CDS_pept        complement(506273..509041)
FT                   /codon_start=1
FT                   /gene_family="HOG000201750" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637116"
FT                   /orf_name="MICPUN_59263"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO64459.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG317140"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199AD99"
FT                   /db_xref="UniProtKB/TrEMBL:C1E864"
FT                   /transl_table=1
FT                   /translation="MTSRGARRLIGLASLTPPNAWLAAQQGAQRARSTIVGLVNLRGLG
FT                   AARDFHTPVLAAGNLSLEVPAFCVWGANTAVGKTLVSAGLARSARRHGLPTFYLKPVQT
FT                   GFPDDSDASFVAEKATGARGQGPGMSTMGHHAATAAGRAQGGTNLPLTDGGGPAGNFWA
FT                   HTEYAWRRAVGPHVAVAEEGRFVSDRALLASVTNQLAQFADTVVGPNERSGGAGIAFVE
FT                   TAGGVCSPGPSGTPQCDLLRPMRMPAILVGDGNLGGISTTLASLDVLSMRGYDVVAVVV
FT                   ADGGAGLGNSDAIDRYASTYHGCPTFRLPRVPERRVVGGGATAGSGEEIFEWMDEGAKT
FT                   FDALLGRLVRWHDARIAKLRGAADEAREILWWPFTQHDMVPRENVAVIDSRSGEDFGVY
FT                   VEDAEGAGPGSVQLRFDGAASWWTQGVSKELQHRLVRAAAAAAGRWGHVMFPENAHEAA
FT                   LDAARGLLIGAGRSWATRVFYSDNGSTAMEVAVKMAIRAFYVRKGHVEAGSPSAIETAD
FT                   ALPQVQVLALDGSYHGDTLGTMDMQAPSVFTGPLQTPWYKPRGLFMNPPTLQLRKGRWV
FT                   VTQPRGGIRPEFEGESWGSDEATRGWETRAEAFDWATRDGSDLAKRYRFAVEKILDENA
FT                   ADPTAAPVAALVMECVLHGAGGMDLIDPLFQRTLILVCKERGLPVVLDEVFAGIWRLGA
FT                   EGAWELLGDGCAPDISCYAKLLTGGLVPLAITASTEDVFDAFRGPTKTHALLHGHSYTA
FT                   YPVGCAVAAEAMRIYRDPEANPNLIVEGAEPVGGSGFESGDRGGGLRIDRERPSGPVAS
FT                   SSDRKLRLRELWDETAVREISLLPNVAGVTAIGCVLAVEVDDGGGGGYSSGAAKEIVLK
FT                   LRAHSIQARPLGNVLYVMCAPTTAPERCAQILQSVTRELRASAMDDDDDAW"
FT   CDS_pept        509213..510358
FT                   /codon_start=1
FT                   /gene_family="HOG000256259" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637117"
FT                   /orf_name="MICPUN_59264"
FT                   /product="Predicted protein"
FT                   /function="dihydroorotase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="pyrimidine base biosynthetic process "
FT                   /protein_id="ACO64097.1"
FT                   /db_xref="GO:0004151"
FT                   /db_xref="GO:0019856"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG628648"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="UniParc:UPI000199AD9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E865"
FT                   /transl_table=1
FT                   /translation="MAALSLPVAGALRRAAPCATRRALGRIHATVSATAGSDRLTITAP
FT                   DDWHLHVRDDAKIASVVPFTARVFRRALIMPNLVPPVRTTHEAGTYREKILAAVPEGVS
FT                   FEPQMTLYLTDNTSPAEIEAAAASGFVRGCKLYPAGATTNSDAGVTDVNKCMPALEKMA
FT                   ELGLVLEVHGEVTHGSVDMFDRERVFLDEVLSKLVDKVPGLKIVMEHITTEDAVEFCKS
FT                   QGDNVAATITPQHILLNRNAMLVGGIRPHLYCLPILKRESHRVAVTAAATGGDKKFFLG
FT                   TDSAPHPKGAKESACGCAGVFSAHAALPFYAMAFEKEGKLGNLEAFASHNGADFYGVPR
FT                   NEGTVTLVREAWECPGEYEFGGDVVVPFMAGQEIPWRVVEA"
FT   CDS_pept        complement(510492..511490)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637118"
FT                   /orf_name="MICPUN_59265"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64460.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AD9B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E866"
FT                   /transl_table=1
FT                   /translation="MGIKLGCKEDLSGKVAIVTGANTGIGLQTAKMLADAGAHVVLACR
FT                   SAERARPAMKLVTEGPKASAEVIPLDLSDVESVKSFAAAFLKKHKTLDILVNNAGLNTT
FT                   GAYKGPTTTKQGYEICMGTNYFGHFALTALLMPALRASPDARVVALSSVTTWFASNKYQ
FT                   NYVKGASKTKGNYAASKLACLAATIECQRRMDSKFPDNKVKFVAADPGFVASDVWRNYN
FT                   VVFRTVAGALALDTAEGALCSVGCAAKVDIKPGALYMPFKGVKMSTLFGLNKRLAYDLG
FT                   MPFLTRLFHGFASDKPAPKSKSKEATEKLWELSVEFCRDNDVGVDSVLLSV"
FT   CDS_pept        511864..516465
FT                   /codon_start=1
FT                   /gene_family="HOG000199432" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637119"
FT                   /orf_name="MICPUN_59266"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64098.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG316596"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199AE5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E867"
FT                   /transl_table=1
FT                   /translation="MGRLHLTYPANIAKVTSQKRRFNLHGLGLHHLPFLILYVFALKAC
FT                   VETSGNPYAVALAHHKEKGYDPAAFDAKTAASAQRGKTVVDDWGGGDAEDDPWGDLEAD
FT                   EEHLAPDAPDAAAAVEASSTAPDADAAQAPAPANLTALEEQIKYETPPALPASWLPEFW
FT                   AVIYFSVVAVTHVLLMFGQHWSVRFRAFVNYVEADEVKPGNVLMFCPMPHQGKAEIVDV
FT                   NELEISDPKAPGGRRTMLWTVFQRQRFEYVTTEVGGDGKVRGEVREVQTPVAEPLASYL
FT                   QPTRGMSAGGVAASTSRFGDNSLRVPLPTFLKCYKEQLMSPVCVFQVFTTLLWLLDEYW
FT                   KYALFSAANLLMFEAATAFSRIKNIRTLRGMGATPTRIVAFRDGRWEVRSSEELVPGDI
FT                   ISVARPPGAGDTPIPCDCLVLRGSAVVNEASLTGESVPQMKDSLSGETVAGDPAAPLDI
FT                   NGEHKVNVLYSGTMLMQQSQGESEQAHGLPATPDGGCLCYVLQTGFSSTQGKLMRMMEF
FT                   SSEQVTGDTWETLVLLFILFVFACVASGNVFVMGMKDGKRSQYELVLRCILILTSVVPP
FT                   ELPMQTAMAVNTALIALMRASVFCTEPFRVPISGKVDTTLFDKTGTLTSDKLVAMGIVT
FT                   PKDDGSFTELTPCPEATKSASLVVAGCHSLVQVDGKTFGDPLEQAALMGVKWRFDPRSQ
FT                   TALPTENFPDPARDKALAEARAKRAEMVAKLPRDRAHTVPPVPEPKPPKRTWKGSPSVK
FT                   ILVRNHFSSALQRMSTVAAAAQTSGERAANWVLVKGSPEMVATLLVEKPKGYDAAYRRL
FT                   AEEGMRIIALAHRVLTDAESARLRDQKAPLTRDEMERGLTFDGFLAFACPVRNDTPDVV
FT                   KALRASSHTVMMATGDSALTALHVANEVHIAEGGLERAMMLVKDEDDGLEWVSAKTDED
FT                   TGEPVHRQPYRADGSIPDLAKKYSLCVTGSSLNAAAAIDGVSLGKESLMKDNKRTGRGG
FT                   GHGGLWDYLDSVVIFARMSPDDKERVLKRLKQQGRHTFMCGDGANDVGALKQAHVGVAL
FT                   LSGFGGANTKKVTPVGEEDKKGAKDDKAVAVPTEAQAETFAQKMERIKEQAAKVKEARA
FT                   REAAARKQDQKELVALQKVWFEEELAARTAAGEQWAQFSAMKAATSRMITETKARQAAR
FT                   ARANGGVGAAPGWSQMMQEMEGLEDQETPQVKLGDASMAAPFTSRIPSVRSAVDIIRQG
FT                   RCTLVSAIQMQQVLVLSCLISAYSLSVLYLDGIRSSDNQMIASGSALTAASLAFSYATP
FT                   VHTLSHVRPLRSIFHPANFLSLTGQLVIHLGCMVYAVRLVKAATGEEAEFPENIPVAII
FT                   PEELKANATEEQRSFWEQGPPFKPSLLNTVVFLVETVQRVCVMLVNYKGRPFMMGAIEN
FT                   KTFLLSIASMVIGAFVCAFEVIPWLNNWLQLVTMPDTAFRTTILSILAVSVVGTVAWDQ
FT                   LMLLIFAPDILFTAYRDTIRALPTPADMVKQSKKPLFGALMAYLYFFNPATAGNGILLV
FT                   GGFYAMRHPFFRN"
FT   CDS_pept        complement(516541..516900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637120"
FT                   /orf_name="MICPUN_100971"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64461.1"
FT                   /db_xref="UniParc:UPI000199AE60"
FT                   /db_xref="UniProtKB/TrEMBL:C1E868"
FT                   /transl_table=1
FT                   /translation="MRPEVAAELIEKKMKRPFGNREMPDAWKKDWKGLADGEGGGRGGF
FT                   SLGPVGDLFRSLFYMTATAGIMLGVACAINEEARLGVKDLWKDVKRMLKGKKRRKRRRR
FT                   SKVSSSHGRGTVVER"
FT   CDS_pept        join(517150..517218,517266..518309)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637121"
FT                   /orf_name="MICPUN_59268"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64099.1"
FT                   /db_xref="UniParc:UPI000199AE61"
FT                   /db_xref="UniProtKB/TrEMBL:C1E869"
FT                   /transl_table=1
FT                   /translation="MPKSAAGRSEGYSSYVDDDVYSVVGGEDRPIFEIRPCVATNRQTP
FT                   SRANSSSSAGPVPDPLIRPSLQAVREQTLHSIDASRLAPPDDGANPSRGRKNPPPSESE
FT                   ISDLVGQLERYAEHKTGRGDRFGGSNVANRGAGPRTSRGQDKWQTRPASNPGSQPGSGH
FT                   LPSSYRSARHDDENSLVGAWDVGSSVYASSIPDSDARSVYSVQADEFGGDYAYTDRYAK
FT                   MDTRMDSVSKNLKQHRKRLEDTLKNIDEGAQAGRSAMRSDWDRDGMARAGKTTTGVGMF
FT                   DVFAKDKDAATPSRVGAQGQGARHGGRVTNKAAEKWLSPGSPRPRSQSKARPRSPRNRT
FT                   DGPAEVTPFMSFVESVFGCGCGPRKGKSAA"
FT   CDS_pept        518665..518955
FT                   /codon_start=1
FT                   /gene_family="HOG000258424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637122"
FT                   /gene_name="TCTEX2B"
FT                   /orf_name="MICPUN_97536"
FT                   /product="Inner arm dynein light chain "
FT                   /protein_id="ACO64100.1"
FT                   /db_xref="HOGENOM:HBG713969"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="UniParc:UPI000199AE62"
FT                   /db_xref="UniProtKB/TrEMBL:C1E870"
FT                   /transl_table=1
FT                   /translation="MDEIIKERLTGVEYEADTCSMLARDISDEIKFKLKELGFEERYKF
FT                   VVQVVIGEEKGEGVRMGCRCFWDPKTDNHVATQFHNATIFCAAAAFGIWLY"
FT   CDS_pept        join(complement(520128..520142),complement(520004..520094),
FT                   complement(518996..519888))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637123"
FT                   /orf_name="MICPUN_97537"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO64462.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199AE63"
FT                   /db_xref="UniProtKB/TrEMBL:C1E871"
FT                   /transl_table=1
FT                   /translation="MTTSVQWRDAVSGSTAGMVSVLALHPLDVIKTRLQVQDHIDRRQA
FT                   TYRGTIHAFRTVLAREGVRGLYAGLSPALIGSTVSWGIYFQVYDNAKRRYRRSLAIETT
FT                   SLPSHLHLASAAEAGAVVSLITNPIWVVKTRLALQHGGGGGGAKISSNVSSNAPYAGFF
FT                   DAMGRIARTEGVAGLYKGFAPSLFLVSHGAIQFTAYERLKRAAADARRGGVNGVGSRSF
FT                   GDAEPTAFECAWLGVASKLIASAATYPSQVVRSRMQQRGNADVGVGGSEEVRRRYLGFF
FT                   SSLRCVVRREGFGGLYKGMVPNVLRTLPSSGVTFMVYESTRSFLSRGREDE"
FT   CDS_pept        join(complement(522296..522458),complement(522058..522074),
FT                   complement(520411..521844))
FT                   /codon_start=1
FT                   /gene_family="HOG000226733" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637124"
FT                   /orf_name="MICPUN_94492"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64463.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000199AE64"
FT                   /db_xref="UniProtKB/TrEMBL:C1E872"
FT                   /transl_table=1
FT                   /translation="MASSSLRSVNPNAEIMGKQAALFMNINAAKGLQDVMKSNLGPKGT
FT                   IKMLVGGAGDLKLTKDGNVLLKEMQIQNPTAVMIARTAVAQDDITGDGTSSTVLIIGEL
FT                   LKQAERYLNEGLHPRVIVEGFEAAKKASIKFLDEWKQPTGGAEAPDRELLVCVAKTALR
FT                   TKLREELADQLTSIVVDAILTIAKPDEPIDLHMVEIMHMRHKLDSDTKLVQGLVMDHGS
FT                   RHPDMPKHVEDAFILTCNISLEYEKSEVNSSFMYSNAEQRERMVAAERAYTDEVVQRVI
FT                   DLKKKVCDGTDKGFVVITQKGIDPISLDMLAKEGIVGLRRAKKRNMERLVLSCGGVCIN
FT                   SPEDLKPEILGHAGEVYEHVLGEEKYTFVEKVANPQSCTILLKGPNDHTIAQLKDAVRD
FT                   GLRSVKNVLADKAVVPGAGAFEAALNVHLLEEVKKTVEGRAKRGVEAFAEAVMVVPKTL
FT                   AENSGYDAQDVCIALQDEVAKGNRVGLDITTGDPFDPTTAGVYDNFIVKAQILHSAPVI
FT                   ATQLLLVDEVMRAGVNMRKR"
FT   CDS_pept        523274..524683
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637125"
FT                   /gene_name="TEF1.1"
FT                   /orf_name="MICPUN_91047"
FT                   /product="Translation elongation factor EF-1alpha/Tu "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="ACO64101.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199AE65"
FT                   /db_xref="UniProtKB/TrEMBL:C1E873"
FT                   /transl_table=1
FT                   /translation="MATEGKEHLSIVICGHVDSGKSTTTGRLIFELGGIPEREIEKLRA
FT                   EADALGKSSFAFAFYMDRQKEERERGVTISCTTKEFFTDNWHYTIIDAPGHRDFIKNMI
FT                   SGAAQADVALLMVPADGNFTTAIQKGNHKAGEVQGQTRQHARLINLLGVKQLIVGINKM
FT                   DCDTAGYKQERYEEIRNEMKNMLMKVGWKKDYVEKCVPVLPISGWQGDNLIKKTTNMGW
FT                   WSGVDVIDYEMKGDKHHIDTLLDVLNGMVTKPPRNDAADMRLPISGVYKIKGVGDVLAG
FT                   RVEQGVVRPGEEVVFIPTHTVSNPCVGKVFTVEMHHKRVDEAHPGDNVGMNIKGLDKIN
FT                   MPRTGDVMIYKKDTTLKACKNFNAQVQVLDVPGQLKPGYSPVAFVRCGRSACKMTELIF
FT                   KVGKETGGKKMESPVALKSNEVAEAVFEPQHPFVVDHFKACDGLARIAFLDGNTAVMLG
FT                   KITKVQFKEDK"
FT   CDS_pept        complement(524775..526658)
FT                   /codon_start=1
FT                   /gene_family="HOG000255711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637126"
FT                   /orf_name="MICPUN_59272"
FT                   /product="Peptidase"
FT                   /function="hydrolase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="ACO64464.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG315401"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI000199AE66"
FT                   /db_xref="UniProtKB/TrEMBL:C1E874"
FT                   /transl_table=1
FT                   /translation="MAPDPKLVAMRAAMKAAGVDAFIVPSQDPHFSEYVPTCFERRMFI
FT                   SGFTGSAGTALVTHDEALLWTDGRYFLQAEQELGPEWTLMRGGQPGVPEPSKWLADKMA
FT                   KGSKVGVDPAVHSLSEARALRSALEAAGSALVTLDVNPVDTVWDADRPAFPTAPLRVHK
FT                   AEFSGKSVADKVDFIRAKLDENKSDVLVVSPLDEVAWLFNVRGGDLDYNPVTLGYGLVS
FT                   KDEACLYVDLGKVTNEVRAHLDEAGVVVKPYDDCAGDMRAAAAAGKTLWIDADKVSVAL
FT                   VEAAEEAAAAAGPAEKKAKTENDDAKKTIKEGVSPIPLAKAVKNEAELAGMLEAHLRDG
FT                   VAMASFWCWLDEQAAQGKEWDEYEIGEWVSKFRAEQPGFSEESFATIAGEGPHGAIIHY
FT                   RASVESARKVGQNSLLLCDSGGQYDCGTTDVTRTHHLGTPTDHQKNAYTRVLQGHIGLT
FT                   TAVFPQDTSGFVLDAFARRHLWEAGLDYRHGTGHGVGAALNVHEGPQSISPRFGNMTGL
FT                   VPGMILSNEPGYYEDGGFGIRIENLLVVREAKTSHNFGDKKYLTFDYLTHIPIQKKLID
FT                   FSLMSGAEVAWLNQYHAVVWEKVSPRVTDEKVKAWLKEACAPVTVKTVVIG"
FT   CDS_pept        join(complement(528830..529526),complement(528414..528790),
FT                   complement(527256..527978),complement(527028..527153))
FT                   /codon_start=1
FT                   /gene_family="HOG000176000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637127"
FT                   /gene_name="MLH1"
FT                   /orf_name="MICPUN_96433"
FT                   /product="DNA mismatch repair and recombination "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64465.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG631009"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AE67"
FT                   /db_xref="UniProtKB/TrEMBL:C1E875"
FT                   /transl_table=1
FT                   /translation="MEPKPIHRLADEVVNRVAAGEVIHRPASALKEILENSLDAGATSI
FT                   VVTVKDGGNKLLQVTDNGCGIREADLPILCERHTTSKLSKFEDLSAMSTFGFRGEALAS
FT                   ISFVANLTVTTMTRGATHALKASYCDGALDGGGARPCAGNPGTTITVENLFYNVPTRRK
FT                   ALKSPHEEFAKVLDVVQRYASSRTDVAFTCRKHGEARPSLHCAVTPHRIDRLRAIYGSQ
FT                   VARELTPMTLTGDADGDGDRAAEYSVDALVSTAGYHSRRTTFILFINDRLVECAPLRRA
FT                   CEAVYSAILPKAEKPFAYLSLRLPPHTLDVNVHPTKREVAFLRQDEVVERVQRALERRL
FT                   VEANGSRTFAVGAVVGTEEAELRGYDVGNGGDGNISEISPELPDGETTELTSVRELWSE
FT                   ITANAHVALRRVLAGLTLVGCADERRGLWLLQHGTKLYMARVNRLARDLFYQRVVARFG
FT                   RHPCRALAEPAPIAALVRMALDDEEVPEGVEKAKAEEAKEKIANAAAALVAEKAEMLRE
FT                   YFGVDVDQRARTLVGLPVLCEGHAPNLARLPEFCLSLAHEVNWEEEKPCFETCARSIAS
FT                   FYSGHDDEDVDEDAENVVPPGEAIRHVLFPAIARKLVPTRASASDGTVLQVACLEQLYR
FT                   VFERC"
FT   CDS_pept        529728..530870
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637128"
FT                   /orf_name="MICPUN_59274"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64102.1"
FT                   /db_xref="UniParc:UPI000199AE68"
FT                   /db_xref="UniProtKB/TrEMBL:C1E876"
FT                   /transl_table=1
FT                   /translation="MTTTSASLLCSVSIATIRRGWRGASSSGRTPSAHETVPAAVHAPR
FT                   IRAPPLRRTPRAPGAVAEPPGPTSPLTDTSSSNWRDNPFARYCDDAMAIPEVVEGLRVL
FT                   EQTHPEIDGNVVLFAVWRATRGGDARPMSHAALRKATKISERWRWRVTDGLARVEASLR
FT                   GPDLAESPQAANLAAAVAALGDEVDDVARAALFELAASEAWWSDGDDAGGGGDDAGDAL
FT                   AYESGKATVRGPTAVAAANLRMYLLEYLGARFIANEWRRVRGVLDGCLAVGGVDAHADI
FT                   IGIVDARGGTVGDAPSSSSGMSDEAWRAVRGCVDLTMTKPRRDRPGEANRRYIDARRNL
FT                   RDADRLWKATCEDYRRARRTVKHARHEVHKSRKAVRVEFR"
FT   CDS_pept        join(complement(533462..533648),complement(530985..533290))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637129"
FT                   /orf_name="MICPUN_59275"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64466.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AE69"
FT                   /db_xref="UniProtKB/TrEMBL:C1E877"
FT                   /transl_table=1
FT                   /translation="MRTEEPRDALQNPFAQRNGMPGNRVEDEAVSLAKPGWVLACEESR
FT                   RLGEDMEALAERLVSSEGTDTSFSSFPGDVSGTLVSALRRYHKAKAAANNGRHDVAVQR
FT                   FTEVRPQPDHFSEPAPLLPLRSACLSDVPHANFGFWIVAHQGPFALTSPNETQALGDCV
FT                   LSWNEAKVITSIQVAKGLRLEIRRNEADTSSVLVAAHRRIVGEIISSRSESRLALGQIW
FT                   LAMMDAEAGVDSAPELAETHLRLGAVYEAAGGNEPSLRAYQRAAQLDPKSVAVARGLER
FT                   MRNTVVTPLGITPTGATPTLGPNGTPKLNGGGGSKGGKVFEMSLEQMDKEWEAIGLDCV
FT                   KSQEWYDLRRKACPHGVLVAIVDAVENNDATKALKDDQLKENDITTEEYTEKEHFAERA
FT                   MSLFAKKRHEGLPIPEDSTWLDLAFEAVNIDSLTPLEQAKICLCMANIFCWCGDFAGAD
FT                   ELYTFALEMEDMNGADTPLAAWRPAMLANRALARMRVGNSSAAAVDAETALKEGGPRWG
FT                   IGLARMGQVMCYMNEWAKAAQTFSIAQERAVEKLDLKAKISLAKTAGVGVPAAKEAAAA
FT                   AAERIQAGKEKEEMHVEFEALDRAVQLEAISAGEAPAESEPIMGPTPRFMSELTGTAAP
FT                   VPDAPELSYGPDGSQRTGGDGGMRGRVRPLGSANLSAELLRLDEQTKSGREAKRKSGAA
FT                   MSVSIGTDLRKEIGDEVKQEPSAKNKLALESDLIASIVGSADKKKGEGHDLKRPRYNAC
FT                   GGIAKWADQVYKDYGPPDICGLFKAGGKDVADAHKEAAKGTGDMFAQDAKALLETMPKS
FT                   PRKSPRHATKAEAKPSPA"
FT   CDS_pept        533901..534434
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637130"
FT                   /orf_name="MICPUN_100978"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64103.1"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199AE6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E878"
FT                   /transl_table=1
FT                   /translation="MAKLLGWDQDVTTVYARFTVPKGTRASQVRVDAAVNSLLVFVLPA
FT                   DSTLSYVYEGQKEGGELSKTIISADVLWTLEEDEKGRRVVHVVLPKSTTGQLDKPWRTL
FT                   FAEHEEVEGDEEKSMADCLKELTFCDEPSTPFDELPLDIRLHMEELRRRKYAMGAGYLN
FT                   PAEDFDDFRMVLTE"
FT   CDS_pept        complement(534594..535190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637131"
FT                   /orf_name="MICPUN_59277"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64467.1"
FT                   /db_xref="UniParc:UPI000199AF17"
FT                   /db_xref="UniProtKB/TrEMBL:C1E879"
FT                   /transl_table=1
FT                   /translation="MEREDRTGRKHRRVGWTLLWGLTVVAGFLFGVYHGERKSSTALFG
FT                   RGGFSGKVDALQCPTCPRCEPTRCPDPARRECPKCEGAAGSGVGSSHGATAPRDAEGAK
FT                   TTEAVVAKREDDGDTNGGNTAGDGGDGDAGGCPRCAPCPKCGSKGTCPDPPRCGDGAKR
FT                   ARGAVGVGAGGGCSCDECPVCKGQGECPAHPPCRT"
FT   CDS_pept        535384..540495
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637132"
FT                   /orf_name="MICPUN_100979"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64104.1"
FT                   /db_xref="UniParc:UPI000199AF18"
FT                   /db_xref="UniProtKB/TrEMBL:C1E880"
FT                   /transl_table=1
FT                   /translation="MPASAMDVDAPRAWLPDVRRQHLDLDVGFVPGAGGYVRGHTTIVC
FT                   RPLPTESGDATTLTLHAHELVVTRVTVNDAPARVIRRGRTAVRPDGSDDPSGDDVDALA
FT                   VADAGALSSGANIARNACEGMLADARAVADGAADELVIALEDGGVIASGGSSEDVVVRV
FT                   WYGAGTAMNAFGVQPPDSWRRIAPLVAHPRPPRAGEDPGGNDPTGGNDAGGDGNGGEGT
FT                   GGNKVAQLDEVAQLDEVAQLDEVARSRGEEPIDAYAGWCNPGDGALCAFVDSDEGNARY
FT                   LCAPGSALRPAAWFPCVDDGGSLVHFSAVVKVDPDLTAVLPGVLTKTDVIEETIRSPDD
FT                   GAPARTRSRRAFHYVSGGVPVQAHQMVLAVGTFATRKIPTSTAHGDTFAAAARAEEEDK
FT                   EEEAAKNDADGTNARFHQYLDNAAESTAHSSTHALHCPPCYAENELPAAASCATSALKS
FT                   FETYLGRPFPYPGGLTFCFVPPDALPVSMDLRLPAMLGAGVTILSTDRLGHPLSAADLV
FT                   TSRTAIAECAARQLFGGFLEPREDTDAWLAEGLASYMAGACYISSLMGADELKYQRARE
FT                   VEAVVECDDGDALPPLASPSARIWARGRSACGASAEEVKARAVGEARARGEDPDAVAAL
FT                   EHARDVAPASKPPRPPAPGVDTLVRCKAVAVVEMLERKLGEEGMQKVIRKLASLQGKAP
FT                   GAESLQEAAIAASKATRAAKEKAAAAAEAAKTEGADESANAAAKEKAAATAREQLQREH
FT                   QESIAYHALAESPARFLRSRVFLNLCRQNATMTKADMSAFNARWIEGCGCPRLTAAYTF
FT                   RKTRRQELLFAIKLDGCLAAAAADRVAWSKNPKVSVTVRIQENDLPPSDHAVSLSAHDR
FT                   AYVLMPLQLVTKPKDRRTIARQQEAAMRRQQQAMEAGKANPDNLDAMAAAEVLQWECPV
FT                   SWVRVDPEGEWLAKVVLPSAQQGLEGMITKQLMSERPADPAAQMWAIRFLRERAENGST
FT                   SAVNALLQCAEDPKTFCRVRALAAMALGACACDGTQRSNLALSSVTRTYRRRRCDPRTG
FT                   KPKPTDLADFAAAIVDEGLLTALGLPRAPPESTSGWEDADDAWVTPTECVDLLVDALNH
FT                   TESDGDPHDSSSLIATAIHALGRARPATLDGVRRITRAIAGRMRENATICGVGGRAHEG
FT                   GRRVMVAGMLALRTLLERLPPLPESIRAANEAKKAIEAAGGGANGQGGPGVRRRRSAVT
FT                   SLGDAEEKARLSAVAVAAVVSECVATARSFVADRVGIDPCPAVRRAAVALQFGIEASHG
FT                   GPCGVARALAFATLACKAEQSGGVRAAILWDARDALRAMPDAPAQLAALTGGSGTGTAS
FT                   DPDRHGFDVFEWTATSLRIASRRAGAETATAALAVMRAASGLDDDYPHERDLADLKARE
FT                   AAREAVLAGAAQAANDIEDEADEAERLERRRKKEEKAKARAEKEERRARKEERRARRRA
FT                   AEAAAAAEAAAEAAAAGGGVGDDGAGASEMITDADGDVTMGGFSDGGPVSGLTGGVTGV
FT                   TGVTDDAEDSGAEGGAEGKSAEPLSQATGTPSLETPVTAPAPAAPAHPAPPPPPAPVPA
FT                   PAAPAPAPAPAPAAAAPPPPAEPAQVVGVKRDRDEAFNSAAGTPSSAAGAAGAAAAVTP
FT                   AEQPAKKPRLVFAFGAKKPAAAAAPAAPEPEVKEKKEKKEKKDKKEKKEKKEKREKERA
FT                   AADAAP"
FT   CDS_pept        540599..542275
FT                   /codon_start=1
FT                   /gene_family="HOG000182790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637133"
FT                   /orf_name="MICPUN_82876"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64105.1"
FT                   /db_xref="HOGENOM:HBG445740"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199AF19"
FT                   /db_xref="UniProtKB/TrEMBL:C1E881"
FT                   /transl_table=1
FT                   /translation="MGSGRDKRKKAAKRSGKDGSGPSGDAKTSAKTDKNAAKLERRMAK
FT                   AAADDDIDALLANIRLMDSKLKEVEVHEDCPKPGPRCNCSFTPTLAQKPAEVIMFGGEC
FT                   VDATGKTQTFGDLFRYDVDRNKWTKVVSPNSPPPRSAHQAVAHGGYLYVFGGEFTSPNQ
FT                   EKFHHYRDLWRLDLEEHAWENITPKVGPSARSGHRMVTHPKGKSLLLFGGFYDTGDDIR
FT                   YYNDVWELNLEAMTWRCRFGGDVAGGASTLEGPSPRSASHVSASNDSLWVYGGYRKFAG
FT                   DGEGDDGDVEKGSTHSDLWRMDLKSWRWEKQKKAGMAPGPRAGATSATHGAKKRHVLFG
FT                   GVVDHEIRKGEVIISEFFNDAYSMSLDNGRWYPVCLYADKGSKPEAPREATGREEAERV
FT                   ARGEVFNENFNVRDATVRAAIKIQAHYRGYAVRKAYKLYRIGGQVSELLYSPGSGEAAP
FT                   KTAPRPRGRMNAALAVRGNAMYLFGGAVEIGDVEVSLDDVWALELSARPKWRKIAEYSP
FT                   EVAERVHGEAVESSDEEEEEEEKERAHAMEFRARKTVEGKE"
FT   CDS_pept        join(542478..542570,542768..545047)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637134"
FT                   /orf_name="MICPUN_59280"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64106.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199AF1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E882"
FT                   /transl_table=1
FT                   /translation="MSKPAAAAAVAFITLLARLTLLPGVDAQFYQPGDKLPASAITETF
FT                   DVAWPPAVNDVSLSRFDYTRNADGGKWVTVIATFYSGCTPGRADYPSFTKHVSSLRQKV
FT                   AAGFLGSGNVAFIASLKNGVNDGVAEAWAKINGSDVSTSASDTNGGFPYIVDDRHRSLV
FT                   YKFFDAAVHPAYAIVDHCMTYRALLPALPDQTGDDTLEKTVERLLLKTDEACPVAPSRQ
FT                   IEAIRPKREVRTFKASNENPSAANEKCAPAFGSGTPSARRLGVSDGVRGGSPLAQPRTL
FT                   AFHPSTGEMWVGNNDTDSVTILRGSFDGVKGAAAVSGVVHRFDRAHYHYMDKMAAMSFK
FT                   GDGAVVTCQESENTYDGMKRANRFMGPSLYDTVPKIGNVKTGGWPEGKNVFVNAKGAKC
FT                   DPDGLSDGTDNNPTCFMTHTDMLHASPNCMGVAHDPEPNTPFGNVFWVFDGLNSTLIRY
FT                   DFEQPHGPGSLDHSLANVRRYPEIKLTRVPGVPGHMTVDPETRALFIADTGGGRVLAVD
FT                   ADSGRYAAEARNDLGGNFTLWSSPLPSFEYTLFGCASFKTFATGIDKPSGLALSGNVLY
FT                   VGEHGTGKIIALHRTTGEKLGEYATGAKKLFGLSVNPTSGRLWYVDGAVNDAVFYLEPS
FT                   AECAEPVPNGAAIAWPASTVSESGTNWCGISTSVATLGLAVKHIQHEDGYLNMTPLGPG
FT                   YGVTDECMKCGPGCDNDMLLMSGFLCHKCIPDNCRGGIYPTSAGTCENIIGEGYRCKCD
FT                   DGAYGDHCQFRVVSGSERWVPNFAGVMLALLVAMFIH"
FT   CDS_pept        complement(545102..546211)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637135"
FT                   /orf_name="MICPUN_59281"
FT                   /product="Heat shock protein"
FT                   /function="heat shock protein binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO64468.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000199AF1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E883"
FT                   /transl_table=1
FT                   /translation="MGLLKAYNGLLGAFVTVFGLYHVFLPYHAIELYGEYDPAPPPPAP
FT                   PSPSLRHSGARLYEHRTPATGAWFITMMGIMMILLGTCLMASRAWGSEVRAIVGSVTLA
FT                   LFFAILGVLLIEGPESGLPRFTASNPVHVSLVVAISLYIPALIVNRMEPGVFEWDKEAR
FT                   VFEDSDGEDEKLTTTNTGDDSPVYGAIDEFESDEPSGAVARVLARQSDYYAVLGVRNDT
FT                   ARSLSTRKLRERYDALVNAIEKAPRGKDRENAVSVAQSAHATLANPLTRAMYDGWRQHV
FT                   FPAKAFGRAGTPRGGSHGEAGHVPRWCASVLRTPVVGSAFAILITVLLMPVAAALAAAF
FT                   AVWWLLMAPIRACADLETKPGRKRRESCV"
FT   CDS_pept        join(complement(548804..548870),complement(546548..548709))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637136"
FT                   /orf_name="MICPUN_59282"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64469.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="UniParc:UPI000199AF1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E884"
FT                   /transl_table=1
FT                   /translation="MDKNKSRRPKRDAQELCASIPSASPPRRRSRRRDLRDPSATPDRP
FT                   FQQLGTQATANTLVLGLPASLRAGDLEGGQPVPTQTQTQLPKPSLALPTQLIEQHATSS
FT                   FADVDVESEGGVKVGGDTYDFEHDEEEVDEALRRNEAAAARALGGEPRNSGGIERGDEG
FT                   CVLNHESSRSPYRRLAEMVAAASRRDVDGGAASVNPDRDPPAAAASPGDPKRFFSPVVA
FT                   YFAPEVSKTRRGILGDRITERGGAVARDVNDPRVTHVLTTSTTYRHWNPAARLVSPDWA
FT                   QACIRAGELRPEDEHPPALTGGVNPPASLSSSPLPPVASPMRLGPPPSSQDASQGHVVV
FT                   DSGSGADGLVRPWLGKKRGAFACQRPSTAAPVNLNPHITRPLEELAAIYEDVLGGTNAY
FT                   KARHHKQVAGAVERLDFVVTDVEQLCDPPVTPAFAQKTSTVRDKIRELLATGKLAKLEE
FT                   LKRKPDVEAVLELSGVWGIGTETARKLHREDGVSTVAQLRALAARQPGKLSANQHVGLR
FT                   FYEEFKERIPRDEVEALAGHVEDAVAAVCPGCSVTVAGSYRRGKTSCGDVDVLLCPSEE
FT                   FIRGGSQGAPGATVDTVEDILPAVLARLRTRGVVTDDLSTGTVSWMGVARLPDSRERLA
FT                   PTTTDGAEGDGAVAVVTPKRLHRRMDIKTYTPDEMPFALLYFTGSGYFNRSMRTWADKA
FT                   KGLSLHDRGFNLVRGNDMTAVRDAKFRDERDVFEYLGLEYVPPEDRSV"
FT   CDS_pept        549643..551055
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637137"
FT                   /orf_name="MICPUN_100982"
FT                   /product="Cytochrome oxidase biogenesis family "
FT                   /function="binding"
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64107.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG561516"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199AF1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E885"
FT                   /transl_table=1
FT                   /translation="MDSATERVGETISGDAAVTATSGLIDAPSSFDPVGIAATAIEQAH
FT                   VMTGLPWWATIGCTALAVRASLFPFVLKQTRAGVLLNTVKARARGPDGKPPETFREVLA
FT                   AAGELRRRTNATPLYWLVAGPVVQLPVFITAVLAVRRLAATPGIGMENGGALWFPNLTE
FT                   VALHVDAVVAPMGMAGAVLPCATAAALFLNVNSAWGKIAETNRGFQFVKLALEWLTLPT
FT                   LLVGMVLPQAVHCYWLPSSASALAQSYAMRSEWGRRMIRADPRLPLGASPRSGSDANAA
FT                   SNVRFSRPLDETEERAMMEAAKLVADKKEALAEKLLEAAAAAAAGGAVDSGASSTDGAH
FT                   PNLLFALGQTRQTLKRWKLAAEAYDACAAAEVHPTQRARALHGAGVARARLGDLPGAAR
FT                   RLEEAIDASQSAGVAHVKAMLSLASVRKTDGDAAGAMEALRRAERHAPEVRERYIEPLE
FT                   RQMAKEKKSRGR"
FT   CDS_pept        join(complement(551910..552177),complement(551160..551794))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637138"
FT                   /orf_name="MICPUN_59284"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64470.1"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniParc:UPI000199AF1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E886"
FT                   /transl_table=1
FT                   /translation="MGDTVPLIDAQTANILGSINKFTVQQHVKIFDNCIEQPNTYTIYN
FT                   LDTQQALIRVQERSECLPRICCKPHHSIILEFNALDPAGNEIFPVITMEREGCCSKPCT
FT                   GGFVCVDCCAQEAYVHAGAIQNVEAHQAGKLPKDRVIGRMKQPVPFAGGLHPTIQVMDR
FT                   TPTSDEHWASVVGPTLFGGCSENCCNVPFGVKRVNKDGSVSVDVGNIATITKLKPKSLT
FT                   GAIREMLTDSDMFQFEIHDPSVTPQQRASLIGVLLLADYMFFERNLDQCGYNDGCYINL
FT                   CLCYCMGALFPCQLKLPKQ"
FT   CDS_pept        complement(552395..553591)
FT                   /codon_start=1
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637139"
FT                   /orf_name="MICPUN_108435"
FT                   /product="Ubiquitin protein ligase, gene model incomplete "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64471.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG607874"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI000199AF1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E887"
FT                   /transl_table=1
FT                   /translation="MVESWGLAPEHHIQINRGRVFDDALAALGPAVLSGDQATWRREHP
FT                   DERPPGSLKGIVRVQFTNEHGVEEAGVDGGGLFKDFLNDLIAEAFDPVKTGLFAETPDR
FT                   TLYPNPASVRRCGPDHLRKLEFLGAMLGKAVYEGILVDLPLAGFFLAKLRDGRPPELND
FT                   LATLDPELYHHLLSLKRLPPHQVEDLFLHFTATDASTAGDVELAPGGSDVRVTAFNRTR
FT                   YVHLMAHHLLHRQVRSQSDAFVRGFRSLVAPRWLRVFAPAELRLLIAGAGGRIDVGDLA
FT                   RSATYSGGYAPDHPTVVALWQAVNEFTEEEQRELLRFVTACPNTPLLGFGQLTPPFCVH
FT                   RAGMTGGSRGSEADADTARLPTAATCMNLLKLPPYRTKEQVRKKLLYAIKSGSGFDLS"
FT   CDS_pept        556582..558174
FT                   /codon_start=1
FT                   /gene_family="HOG000100078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637140"
FT                   /orf_name="MICPUN_54403"
FT                   /product="Lipase"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO64108.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG561518"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199AF20"
FT                   /db_xref="UniProtKB/TrEMBL:C1E888"
FT                   /transl_table=1
FT                   /translation="MSKKKEDLEAEVQRLLAMNAKTVDTKTDAVKPAAPMDNNKSNKSG
FT                   DESTPLLEPEDGAPKKPWYACCTFSCGNPLSACGNPLSACGSCLSSVQSTLGVMGSWIA
FT                   GALVALLVVYLCLTFLIPPGDHGDKPLKFEPAHATSMAAMASAAYRPIDKITSWTCEPC
FT                   HKAHPQPEEVSVTQVNEADGLFYTAKIKTDEYPDGALVLVIRGTMLESARTWESDLDFF
FT                   YMKTTGIGKHTNDHFGRKKDVSWLPTKVDVHPGFFKLYQLYQKKIIRTAAEDTYLVQNQ
FT                   GYPVIVVGHSLGGALATYAAYDLYASGFNVREVWTFGSPRVGSEAFASAYAQALSHRTW
FT                   RIVNNNDKVPHVPHYPMYHHVPAELWCKNDDGSCKKYESGDGTGEDWSLSGHYHFAGMP
FT                   IKSLVDHNRGMGIPFDGAPTFTEDALLTTFKNGLFTKDFDLIVGPFDDPCEIREDKDVC
FT                   EAERAEFIETKKRANAWATANEQNALQKLMKRKSHSPSPPPPSPPPGQLEFMGVDTGYM
FT                   PEAEKYGEAKYGK"
FT   CDS_pept        join(558456..558649,558821..561677)
FT                   /codon_start=1
FT                   /gene_family="HOG000170596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637141"
FT                   /orf_name="MICPUN_104856"
FT                   /product="Alpha-adaptin protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="ACO64109.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG315674"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI000199AFD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E889"
FT                   /transl_table=1
FT                   /translation="MASFSSLSTGLSTGGILGMRGLNVFIQDIRNAPSKEHEQKRVDKE
FT                   LANIRKKFRNTDLSSYDKKKYVLKLLYMYMLGYDIEFGHTMVVSLINATKFEEKQVGYT
FT                   ATAVLLNESHEFLRMVINSVREDIIGKFEHNQCLALALVANVGGREFSDSIAPDVQRIL
FT                   CSPTCLPVVRKKAALCLLRLYRKNKEILVAETWAAKMVKLLDNEDDLGILLGVISLLIG
FT                   IVSHDYRGYEGCIPSVCAVMQRLARARSVPQDYLYYGIPSPWLQVKCMRVLQYFPTPSD
FT                   PDYVRSETEVIHHVLTNTGSVKNVNKNNALHAVLFEAVNLVTNLDLPDQKSLLAESVAA
FT                   LGRFLDVNEPNIVYLGMSGLTRVCAPDTIKAVQSFKSKVVDKLNDADISIRKRALDLLY
FT                   EMCDETVAKDIVDSLLRYLITADFAIREELALKTAVLAEKYSAGNARWYLDVALKLVEK
FT                   AGDFISDDVWHRVVHVVTDAPELHVHAARVALEKLRLNSYEEKFVRLAAYFLGEFGHKL
FT                   GASEPPFAYAKLLFEHFKTSSPTTQQIILTALAKISMHPGADDDLRGRLGMLFRQHASN
FT                   KEVELQQRAVEYYVMTNVGNNSQKLRSVMDPMPEWNTGSRQSKLERHLATQNAEAADAV
FT                   RVNKARGGGAIAPIAPPPEDVEPGTPIPTMGIADLLGGAPVPRVNGNGPAAAAAGGEAN
FT                   GAAASPAAARWGQVRAAVVDPMSDLLSGLGVHPGQPAAAAPSAAPAAVVDPLAASVAGM
FT                   GLSTAHAAPQSNPVPTINVADCLKKLYAADNGLLYEDPNVQIGVKSQWQGNQGRVMFYV
FT                   GNKSPGTLTDVALELTGNVQGLHARLAALPAQLEPKKQQQVLLELAAAGGYRAAPGLSL
FT                   RYSVPGQAPVQVPLKLPYGPHRFMQPWRPANPQEFFAKWQEASARHSEAKVVTVAPAMA
FT                   QGGLAAIQAALSSVRMTPLPGIDPNRKNLTAGSFARYGGANGAETFALARVESDANNPA
FT                   VFRVTAASVDAATAGGVLEAILSQIVP"
FT   CDS_pept        join(complement(562294..562389),complement(562091..562162),
FT                   complement(561789..561989))
FT                   /codon_start=1
FT                   /gene_family="HOG000255148" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637142"
FT                   /orf_name="MICPUN_59288"
FT                   /product="Dynein light chain"
FT                   /protein_id="ACO64472.1"
FT                   /db_xref="HOGENOM:HBG627912"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="UniParc:UPI000199AFD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E890"
FT                   /transl_table=1
FT                   /translation="MVAAVPDEDGLISGLSEDQLVTVDEIDTLIKEEIKKVVGESAFMH
FT                   TKVNQWTSNVVEGCLKRLAALNKPFKFVCTVNFVQKAGAGMHTASTALWDSNVDGKHTV
FT                   QWENNTIQCITTVYWLAI"
FT   CDS_pept        complement(562606..563439)
FT                   /codon_start=1
FT                   /gene_family="HOG000200948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637143"
FT                   /gene_name="DER1.1"
FT                   /orf_name="MICPUN_59289"
FT                   /product="Derlin-like protein"
FT                   /protein_id="ACO64473.1"
FT                   /db_xref="HOGENOM:HBG435574"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000199AFD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E891"
FT                   /transl_table=1
FT                   /translation="MAVTLEQWYRQMPVVTRSYLTLSFLTTAGCALELISPFSVYYNSH
FT                   LIFRKYQLWRLFTNFFFFGSLGMDFVFHMFFLSRYCRLLEEGTFRGRSADFFYMLLFGS
FT                   ALLSSVAPFINIQFLGASLTFMMVYVWGRRNRYVQMSFLGLFSFTAPYLPWVLLIFSCM
FT                   LGSSPVVDLLGMAAGHVYYFLEDVYPTMTNRRVLKTPALVRYAFGQAAVDGPVGGGERN
FT                   GGEGGVRGVFFGGRAAGGGNGGDGNGNGGDGNGDGGNAGGEGNAAIARALGGGGE"
FT   CDS_pept        563607..564962
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637144"
FT                   /orf_name="MICPUN_112643"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64110.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199AFD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E892"
FT                   /transl_table=1
FT                   /translation="MGDKVKILAFGDVNGNFDKLFNTVERLNERAGPFSACLCSGRFFH
FT                   PDGSGNDELLPYLQGRLKVAVPTYFIVGGEDANPVDGLPADGGDLCKNLTFLGRAGCRR
FT                   LPNGLKVAYLSGAYDSRRFDESGVFHRGGSSFKPFYLREDVQRVVDAARTGEEEELAGV
FT                   DVLMTAEWGEKFDTLLPEDQPAPLAARAVNTLSPAVTTLASSVPARYHLAGTEGVHLQL
FT                   PPYRNGLHATRFYGLGAVDGNLGQKFVVALAVTPTVQLALAAARDGVEEGADATPCPYM
FT                   SKPRPKPSAPTPEVVGPVARDDVDDEWSRGDHKDLEGGEWRCGECGNVNRAHQRDKCNM
FT                   KRCGAPREGLELWRLESMHGFNARGAKRTADGDIMSGFQAPKTYTMMTREEAEAEAARA
FT                   AEAAREEAAREEAANKKQKKGDAEKTSLYASQKPMSQKAKYRKGTRNPQAWR"
FT   CDS_pept        complement(565029..568811)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637145"
FT                   /orf_name="MICPUN_59291"
FT                   /product="GH family 89 protein"
FT                   /protein_id="ACO64474.1"
FT                   /db_xref="InterPro:IPR007781"
FT                   /db_xref="UniParc:UPI000199AFD8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E893"
FT                   /transl_table=1
FT                   /translation="MRFVSTLLVLTTLLTVGASKEDSIDPVTRLMERLLPNHAGSNLIE
FT                   FRGRHRDGGCAEGARCFSIQNGDKPGTISIAGSTGVEQAAGLHHYLRRFCGAHLGWEAT
FT                   GGHQLHSVPRGSLPPVDDAGVVVNLPFERTVYMNPETFSYSTAFWDYERWEKEIEWMAL
FT                   HGVNTPMALNGVEQVWMRVLTSKDFGLKESEVEEWFGDPAHQAWARNGAAQGSWTGGRP
FT                   KKWLKRQWDLQRDAVKLMRDFGMTPVLPGFNGHVPPAIARRFPEAKLRRVENWLTGETT
FT                   VERDHRERKRPAPTEEGGKAHAAARDGDDSLALLVEQDSKWSEHEVHHASHHHEEKHHH
FT                   EEKKEEEKVEKVERTEVHHASHHHEEEKKDEKKEEESHHADLALRESSAKKKKQEKDAE
FT                   LGKYAKKDDSVRSVHFLDPSDALFQSLGAAFTKQLVEDFGTDHLYLADTFREIRDPNDD
FT                   FSETHVVRVGAATLAAMRSADPRATWVFQSDAFRRNPRFWNEGRRGALLRSVDIGDMLV
FT                   LDSAAETDPYYLREPVHFAGQPFVWCVKHNHGGNLGMRGRLSAIATGPAAAMDSLASRR
FT                   DGERGTTHGRGTRVGSSRRMLADNKRVSREATHGSRKVGKSQLVGFGITAEGVEQNPVV
FT                   YELAALTSQSEKGVDVDWFLSDYSRRRYGGYSVRQPAPTTLPVGTGQGAFLAGFIVGNN
FT                   PIAGSPGYLGPGEWYDPAKHGEMGKEEAYDRAREAWEILGKTVYGARAKGEDEDHVRDA
FT                   CSWQPSLRADELSPDYFDAAKVVDYAFKPLIDAAPTLRANGAGTRVDYDIVDVGRQLLA
FT                   RQSNVLATQIRDSLNSNNASEAKMYGTQMLELLDDMDALLRSHKGFLLGNYIESAKSWA
FT                   GKRNKESDEANLERSARSLISGFGPSGSKLGAPLGHPMHDYSNRQWSGMLGRVGEGDQG
FT                   LYYRRWSAFLRRVVTTIEKAEEKEKKNAKVAKIGEEELLKKKELVKELSCAPDDTGKMH
FT                   CTTPGAFSAETKHQSSHHKDHSSSHHSHRKHSSDSERNPGESEKANPRDGKSTAAEMIE
FT                   MIEAEDAKRPSPIPHAVHPDWDQDAWEREDADIVGAWVEETGKSFTTEPQGDPLQVAKN
FT                   VYWKYKEAIKNSPILGEPEYIREDEEAKAKAAMWLAQSEKSDTEEVEVVHRKKNKRVTA
FT                   KEMINRLEKTERRRHEGYLDAEQELLMEEKADVSGSDVMRAMRSVDSTVWVVVSGVCAT
FT                   VFIACVASHRASKLDARPYERYDSYPHDERRPLLG"
FT   CDS_pept        join(569262..569415,569599..570758)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637146"
FT                   /orf_name="MICPUN_105715"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64111.1"
FT                   /db_xref="UniParc:UPI000199AFD9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E894"
FT                   /transl_table=1
FT                   /translation="MMDIEAAPVHPESAPLLGATSVETPAWRRRIAVGASIFGTVALCG
FT                   AAVVAGGKGARDSARLGEAWNPATWNPNTWNTWNPNTWANAWTPTPQPMPTPEVQQWTQ
FT                   PQPATAGWDTSVNYNTWPGAPADPQASLGQCQSSLRDSAEMVQLGTYIPPEQCQALVVC
FT                   AGSPRASSTAECTIAQHVLEYMLTGEKQKGYTDQDKATYLGYWNYHLHTLCGDGDGCEQ
FT                   KYPADLRYLRTRMDWSAKLDQTYDEDAKTRLSGILNEMDRYYEKRDAISPSSIIMTKSH
FT                   EFDGTLMNVCNKRIVLTSSRDSEEVFDSGLNLGWFTYPKEESRETFDKYYALWNGWKSC
FT                   WESAAENDLNSVLFDLDYSQLTTEGSFRAVVMQMTYEIAQLLNLQDVDMGGIVEKVLQR
FT                   DFQRELNPSLTTGGLPVKQPGTLGKGESKPVGPQYMFW"
FT   CDS_pept        complement(570948..571955)
FT                   /codon_start=1
FT                   /gene_family="HOG000100079" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637147"
FT                   /orf_name="MICPUN_59293"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64475.1"
FT                   /db_xref="UniParc:UPI000199AFDA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E895"
FT                   /transl_table=1
FT                   /translation="MVSTRSSAGRLGGEASPLLVEEAGVSAKAHGSIFGATPRRALAAI
FT                   AAGAVFVFACVAFVARGGQFGVDDLLKRRFSKTGLVTDLNLANLPDVDFTGKTLLIVLG
FT                   MSFSGTSALEGLLGTSGVITDLCKSNTWQCENTVLLEDMGFINENVHCDPEDVTAAEFA
FT                   YAYKDFAHKWWDMSKPVLMDKTPQNLCRPTKIRDAAAKLGVNVKFVVLTRHPFSWTSEK
FT                   HPFNQGYYMEQMVMARNLLADPSMSTLQVRYEDMAWNMDAVIQSVKAFVPEVSNIDPWR
FT                   SSLSDDSGAERGLPVGKYFQQKPLEWIGKPLTPDTFRLLCQLNYNSDGECSYFN"
FT   CDS_pept        572306..573364
FT                   /codon_start=1
FT                   /gene_family="HOG000100079" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637148"
FT                   /orf_name="MICPUN_108437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64112.1"
FT                   /db_xref="UniParc:UPI000199AFDB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E896"
FT                   /transl_table=1
FT                   /translation="MGEGDERSALLPETTGESARASAHQGGVGVGNGFNRWASGKRVAM
FT                   IAVGAVLGVCGLVGGYMHSMMPGVAPKEGDPDFRRLPPVDFDDKTLLIVVGLPFSGTSA
FT                   LEGLLGTSGVIADLCKADTWQCENTELLQNLGFKSKDADCDCCEDEYTSMSDVTAAEYA
FT                   YAYRDFANKWWDMSKPVLMDKTPNMLCRHRFVRDAAAALGIPVKFVVLTHHPFSWNSES
FT                   HPFNEEYYAENLAYTVDILADPSVDSLQVRYEDMAWNMDSVIESVKAFVPAVKNLDPWH
FT                   SSLSDDSKGDRGMGVSEYFQQEPLEWIVKDLEPSTYAMLCQLGYNEDGECAASAGANES
FT                   PSGYVETDEYDR"
FT   CDS_pept        573787..581211
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637149"
FT                   /orf_name="MICPUN_59295"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64113.1"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199B097"
FT                   /db_xref="UniProtKB/TrEMBL:C1E897"
FT                   /transl_table=1
FT                   /translation="MRTRSARRERGGDVAPGFPRCDDRQNGPASSARSRGISAPSRLLR
FT                   LALLVGILVAGAAAPHDPSVDAAAHVGGDVYALDLLPSRGPALGGTRVTFHGRGFTTDM
FT                   ACQFGPHTILPTSVSPEGDALVCVTPPFGRPAGGFIAVGITITTAKAWPAERGGAEGGA
FT                   EGKGRPAATPRGARSFEYAVAWVLRSVAPSRVDSAGGGVVWATGSHLHAAGSCRFESPA
FT                   SFGGGSPSSSFAAARVVSSALIACEAPAMGIGVGALAVVSENPSAAQEVLRHGHDPGDA
FT                   GVPGLALVTRRPPKVHRVVARGFSSGFSNYLAGTSLTMYGSGFDANGGSNREDASPGND
FT                   AGGDGSSGGGDDWPGNGAGGAVGTVWVAATYSSPGRVDCVAPDLAPGATKSLRVAYRDA
FT                   RDPAGVGVEWLAIERPGGGEFGAAREFGAYGSAASGAFFVAVPSTAATRGGGAAVDFFG
FT                   APPDDAFGVCGDDDVHAGSYGGSGSGSGSGLGKGSGAGFRFGCVAGARPGGGFVAVSAR
FT                   GSSAFPSGSSAGAPFVALAFAYVRAPSLRAVAPREGPSAGGYVAWIVGDNLKTFGDETG
FT                   SAVRCLFAWAGADAVARHSPPASAVSSTLAACEAPPAPTASGRDVRAFAVDVGSHALGW
FT                   SEIGSALIAWPVSLRVGSVTPSVVLSAGGVFVRLSGRSFPASAEAAWCRVGSVGPVAAR
FT                   VESSDAIGCVTPATRPTAAVPVTGPSAAVGVVSVDVVVGGWGERGVGLPSAFPARTGSG
FT                   SGSGSGSGSGSGSAVASADTTAGSMDAATDVRTPIARMYPLGAAPDPGSLAAWLADGAA
FT                   RCVFSNVVGGGFAAASAAGLHAVDCPVPLAPPGFVSARVVVGSHGSSVEAVGSVEIEFR
FT                   PSPVVSGLRGGVGDFGGGGSTASAGENAVFDVDGAGFFPGLTCVWCGVAGAEANVLSSV
FT                   AARCEQPGLETLTLTAAGATEGVACALGLVSGGADDGLLGAAAVADGPTALVMPFPAEM
FT                   TAVTPSAGPASGGSVAIARLAGFSFTRRRAETHGNGGFSCRFGTIGPVAGAPAGGGAGG
FT                   VRCETPAHVPGAVAVSVAGARGGSSFAYVDDGGISISFRRDSGSVAPSAIPSSGDAAGH
FT                   DAVDVHARGFGGGLVAAGIAYLCVLGDGGGVASATTRGVGWTRCGVLPSTAPSGFTTVS
FT                   VAAREGAEGAEGAEGAEGAYLAGFVAASGSVEVYVQASVQALIPRDVVSGWDSTLTLLG
FT                   EHQRRGDGGAGWTGDAHFFWCFFGDGVAVPARSVSSALAVCEILPAAADDDERRSSSSR
FT                   LASSSSRLASDDTNDASDESDEYPTSVRRAHPRTRRVDLAAPAAFNRGRGAPCGGPDSG
FT                   CRSFTHHPAPLALHRVRPTSVAVTGGSIVAMHGLRFADVPNLGCRFGTIGPTSAAWASA
FT                   ATVRCVAPGRAPGPAPASVLGTSFDSQVAVTFRDPVVDATKGGVVRVASRSGGSSTLVV
FT                   VRGIYAGTSTAEPLVATVLGVGGGGHARATCTTGAEGAEGAEGAEGAYLAGLNSGCGGR
FT                   LGAGAGAVVARFNVPAPGDRFESFGGVAFRVVALGFDAETFAHGGEHPNPGSGDVPTVP
FT                   SHSASPGWEGSIEVQYLDDPVVVAAVPAAASAAGGALVTVLGAPGPSSFRVDDSRVFRC
FT                   VFGRLAVAMNAVSSVVAVCETPPATGEREGAGSSAASALGASVDGVWFESRTSAASSGG
FT                   TVSFSHRAPVVTLDVAPARTVTNRHEPLQTSPIVLTVTGRGFGATSTDGFGASDPWAPA
FT                   CRVGTIGPLATTQTSATSVRCVAPAGNGRNGRATPVAVLRDGVRGGPHAPTLAFVEFVV
FT                   DASLASDGSSDGADNPSHDSPANTARRASEALIRGTDPASTTGGVPVEIRGSDVPHRQC
FT                   WCLFGRAYVSKVLRVSSAVSRCAEAPMSGGLGVGGGGRTRVVVRVACAWGAAGPPAALE
FT                   PSDAATLSTAAASAFAIGESGVALSLVSRPVISSASPLHLSGSGGVAMTLTASSLQHAG
FT                   GDDANADGDGSRYGCHFGSVGPIAARSIGEDRVGCVAPALGVGKVTVGLSLDANARETE
FT                   WSHLVVVRVDSYYLEGFLARGAEGAGMPSGGAASGGATYESVADVAGIRSSANADRTSV
FT                   SSVVRCAFGDARVAGTWIHRGGNGAGVGGGGVASVLCVTPPRLTSAGFVPVRIFVDGSD
FT                   ANALGDSAIFQYAVAPDARVRTIFPRTSWGAEVVSVAGAHLAGPGDAIGGAPRRSSGSE
FT                   NAGETRCVFAGFVFPARVVSSAVMTCETLAEVWSPGRANRRGRAWWGPDAYDDDGDQSP
FT                   PDQSPVGASLAKGAEGLRVHEGGDARRGVRAVSACAIGSDCGSTGDGFGAGSNGGSNVG
FT                   GANTLWFQSVRASSVKEADIDEGWDDGGTLVRLALSTRTPADWLDCVFGTTRVPARPAA
FT                   ASSDPPLVDAESARELADAMARLGGGKSGANMDLECISPAHAPGVVDVEIALTRSRMPS
FT                   SGGAVKFAYV"
FT   CDS_pept        complement(581308..581970)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637150"
FT                   /orf_name="MICPUN_59296"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64476.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B098"
FT                   /db_xref="UniProtKB/TrEMBL:C1E898"
FT                   /transl_table=1
FT                   /translation="MNTIWHPPFLNGVPIVVKEEPDDDHHTPPAVNVEPPADDHGEDEK
FT                   SEDLAGKMSTIWRPNLDRLYASVAEMEGSESEEEQKDATKKGVKRKRGPPTKGSCEHGV
FT                   KYRSNCTVCRACPHGRRRSQCKECGGASICEHGRIRSTCKECGGSQICKHGRRRSTCKE
FT                   CGGSSICEHGRQRPQCKECGGSQICEHGRQRPQCKECGGSQICEHGHRRHRCKECKK"
FT   CDS_pept        582148..582606
FT                   /codon_start=1
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637151"
FT                   /gene_name="ISCU"
FT                   /orf_name="MICPUN_96438"
FT                   /product="Iron-sulfur cofactor synthesis protein "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ACO64114.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniParc:UPI000199B099"
FT                   /db_xref="UniProtKB/TrEMBL:C1E899"
FT                   /transl_table=1
FT                   /translation="MAMLRTSTHRLKGLRDAQILQTCARGYHKNVVDHFENPRNMGSFD
FT                   KDSANVGTGLVGAPACGDVMKLQIRVDDDGNIVDSCFKTFGCGSAIASSSVVTEWVKGQ
FT                   HVDQAVNIKNDEIAKHLNLPPVKLHCSMLAEDAIRAAVKDLKQKQQKQ"
FT   CDS_pept        complement(582737..583210)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637152"
FT                   /orf_name="MICPUN_59298"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64477.1"
FT                   /db_xref="UniParc:UPI000199B09A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A0"
FT                   /transl_table=1
FT                   /translation="MASDPTPPVDGAEPFHVPEGATSVEVGKEFVALKVVPKEDEKGDK
FT                   NFPPHLHAAVELFCFVKRPECAKRLVDRVSGYLRVLREGPDGKGTNGMGQAAVCWSCGH
FT                   VGLPKNTDGISKGQLAKCGGCGSDDQTNMVKVTQPDGTVIPWIELKTKDEVKR"
FT   CDS_pept        complement(583312..584745)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637153"
FT                   /orf_name="MICPUN_104859"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64478.1"
FT                   /db_xref="UniParc:UPI000199B09B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A1"
FT                   /transl_table=1
FT                   /translation="MEEGAPLLGERRLKPKGMSVMRVAALAVSALGTAALIAVVGVSVM
FT                   SARNPGAAREAVSELGAGETVTETARRALGPMCTEDDRLMPTVFLIGVEKCGTTSLYDD
FT                   MISHIPALRPMHDDKGAPAKEMRYFDTGGRFVNMLKWNKDPTPFREWLTRHADTCATVA
FT                   SSLANEMSAHGPDDPFDMATSRTPRLHVDGTPAYFNAGVGAKIAEAYPRPEQRARLRFV
FT                   ATVCDPETRLKSAFTFFKTLYNGWGGDQADVWERNLYTHYFATYADWLKQTVAALPEAS
FT                   KPGGLLENPGAQMAETLDDDADEDATFDAESGESVGDLGSKGERAERRRMKNLFNEVVK
FT                   TRYESVLREYLDAGFSADQFLVLPNSYYFERPAAALKDIASHLGVDASDLELIGDAAHA
FT                   NAGRVKDPGTKARLVGNVRDGDRDALREHLRPQLEGLRKLHCEEGLKMAAWHGVGEEER
FT                   DRYWSFMPKEAARDCENAS"
FT   CDS_pept        585080..585889
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637154"
FT                   /gene_name="CBR/ELIP3"
FT                   /orf_name="MICPUN_104860"
FT                   /product="Early light induced protein-like 5, chloroplast "
FT                   /protein_id="ACO64115.1"
FT                   /db_xref="HOGENOM:HBG562551"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B09C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A2"
FT                   /transl_table=1
FT                   /translation="MAMSLTLSSRVALSARPAVKATKSARRAAIVAKAEMSVDEPVVEA
FT                   AVAPAPASMKDNFVNAMSFGGWAPETINGRVAQIAFVAGLGAELSTGESFTSQFAHHVP
FT                   SLVFASGLITLASFMPNMQNTDEYKANPATFKSIERPFTVEAERTNGRGAMVGLVAMFI
FT                   VEKLIGGPITGIFSDSGDELLTSTFYDESFAAQVEAPAAAPAKFVDFDSAVVAPAPVVA
FT                   AESADAAAAYEAAEAAEPIRVEGAVDADVEAEAMAMGRAVSMAEDAM"
FT   CDS_pept        complement(586016..589399)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637155"
FT                   /orf_name="MICPUN_59301"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64479.1"
FT                   /db_xref="UniParc:UPI000199B09D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A3"
FT                   /transl_table=1
FT                   /translation="MDAFTGSMGSSDPPPTPPKAPPRYRPGPWKHNSRVALALIPSIVV
FT                   VVSDGGRLMMGTLVVGLMVVYILDVLKMAEAALISLWCTLVGVYLAMLVATDLFTPARS
FT                   PLASIALLISNCLCLFLAGLWATLQFRWVQTGFPGVALACERALFAAIPPVCGAICAWT
FT                   AIASVGAGHAPFYAAAAFAWLYKTFSFPTPSSFRGPPSRPRSADTGRDAGVSTGRDALV
FT                   LGAGEAAAHCAMTCFAPACAYAAAHSPAMDPRYLFGLGSHSSTNLVHVANAFEHACSVA
FT                   LLLSFPVLFLCVYAERGALWWALGDSSLKSVDSSRGKTTRAVVAAVALVLFTGGLEGVV
FT                   LFRGFGEYVRLPGVPGVVAVTAAVYGGLLAAVAALSGSVGSKNGVPSEIYQAALVTAGC
FT                   AAALATGAPPWMLPFAAIGSIGASRFYLRGGAVDLAMFAGGVGACGAWFLHSNFWGLDV
FT                   NIDGLPLAELCQLLFLSLCASALAPGLARFNVHPSSLGLLVCLHAMVFARCEDALHSEA
FT                   LEDGEPMYPAYLVLATSALGVWLAGSLERTGKVTAATAWMARCVYVGKLALVMLPGSRA
FT                   LVPCVLVGMAATAPFAFDSSNVGSPMTGSGRRARMSVARGLAHVLSLGLAMVHARFAVF
FT                   DVVFAVTGHRPSDATLFGGLLLFAGAGSTPLVRRHFSHLPAARRGLALVVTAGGALVSL
FT                   RPPMPWKGEIGFWYDADHVPDTEPDDVDIYGDRRDASGRGYSAWLLIATVLLGVFVASA
FT                   PKPRRGATGTHATPAPLRAMLSAAAGASLGLYLSVEYFPSFRGDSVVTVSLCAACALCA
FT                   VFLAFTYVPSASSPAVMPHVFAAYLVCLGVAFWTQREEDGEFDGPGAGSRGREARIGLV
FT                   GVTAGLTAQMAFALKLKVAAVSANPGAARAARAGGARGHAGTMRDARSRFQPFSGRSPA
FT                   RFKSAGGALAQRALRAMRVGWMPVVGNISTFITFASATVLATWSRPDSCFTVFAVAPIL
FT                   LLLHEDELLFDSLSGTQRYVPPMAAIVISLAYNAVADALDGPPTPHAALAVGGDLAWTI
FT                   KNVLCVLAATPNAWFLAEYLWSYHATSGLAMATAAPLNVLVATIGDVFAARVLACVSLV
FT                   SAIAQWGTQRAVRVAGLKAL"
FT   CDS_pept        join(589629..589790,589986..591497)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637156"
FT                   /orf_name="MICPUN_59302"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64116.1"
FT                   /db_xref="UniParc:UPI000199B09E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A4"
FT                   /transl_table=1
FT                   /translation="MTEDAKKAVVTIASIADDVSSGAYCERMRIGDVQCRAAWLGLMDF
FT                   ILNAIRNNKGVSLPGLGSFAVGRCTDLLHGGASVRAPVFVLHPKFDVLPQKKARFFLKK
FT                   PATYTRINSLGLSKRCGFHKAGVTHVLKEFFDRIATCLENESPVDVDFTFARLTNVHGR
FT                   VEFTFYQSFLNDYDIMGEEQPEVVRRRYLKIGEAKELTDKVTNVTPLAQEEAAKKAAEL
FT                   KAVAERIAPQVEESTADLPAPLRNRPLHDSPPTAATDPGDRFIAICGKLDRIGSGCIDR
FT                   FVLERVLNGEECRGLIRDVRAGFLFDLLKAHAGGRSGRFVHYLPLLRDLEAENVAIARA
FT                   KEEAAAARERELARIEEEERVAAEKRARAEEEAAAAAKEIARCAIANVISKPVDPAESI
FT                   GFLFHSQGAGAKGQDRSQLAKFNREYAAAVAAYKKGSAGGVTPKVTNNHAADAAATESH
FT                   VNQLGAFLQSQMDEKMRKEREERENWAQIENERIERGRREEAEAHDQEREKARRIAQEL
FT                   LAGWEKQQADRSKIKQSARVMGESWPFAPEHFKPTTPLRL"
FT   CDS_pept        join(complement(595637..596094),complement(595213..595582),
FT                   complement(591682..595113))
FT                   /codon_start=1
FT                   /gene_family="HOG000265165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637157"
FT                   /gene_name="GWD2"
FT                   /orf_name="MICPUN_96442"
FT                   /product="Carbohydrate-binding module family 45 protein "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="ACO64480.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG561530"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199B154"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A5"
FT                   /transl_table=1
FT                   /translation="MIGIPLPEGRQLIATVKTNPQGVHTISLQCEPNAPLGLLLHWGVI
FT                   RSAVSQDWQLLPPELNPPGTVVYKQKALQSPFPAFGALQLVLDPGVDAVEFCLKVETTG
FT                   DWINDHGRNFRIELGGSPMGAGAAPRAPTTSNSFAPEYTLDVRMPPTPAGSSAVNELAA
FT                   GLDVLFGVAAYLRWEQMGKPRVDEDEKHRIYSDAVNHITQRLNSGESVEALETEFGVPP
FT                   GLVRQTAALAAPPAAAPTQAKPTPPPGFTPPAPPKAAPAPAPSYGYDAAPAPAPANAVK
FT                   LMVIEGRRTAQGMLQMIVFGRSDQGIVLHWAGLDQPAGEWKNPPHGWSSMPENSWGTGG
FT                   ASWETEMEALTTARGWHAATIEAPCDRDGLVFVIRTADSAHWIKDDGQDFMCFADEATT
FT                   LTDVRAIVKRRKEEERARRKAEKEEQRRREREQQRSSPQKLKRGGLSTTTVKEVKMPAR
FT                   PEVIKRKDWNHDEIKMHQGALGHAGAAGNVAGGSVDNICNSEEGATRSLMHRFNIASDL
FT                   IPQCKGEGEAGLVAMAVWFRFMALRQLVWNNDYNIKPREISAAQLKCTTQLAALHKDDP
FT                   AMRDVTRFIMATIGRGGDGDVGQRIRDEILVVQRNNNCMGGMMEEWHQKLHNNTSPDDV
FT                   PICEALIKFIAADCDISVYWDHLHANGITKERMASYDRKICGEPSFKPDQYEGLTRDLK
FT                   EYLRTLKAVHSGADLDSAAENVMGYHQDACKGKEINMPPVTEVATDRMRTLLHSARGFR
FT                   DLGEPLHSMEAMLEARRELWNWTRPGGSDNSRLKDVIYLDLALESAVRQVVEANLSSMA
FT                   TRAPVDVLKMTGLALENLALSSGGNDELVICLQQWQGVVGSAMNGGNDWALQAKSVVDR
FT                   VNNALGEVSQRYINALQPTAHAMGGRLGVDGHVLDIFSEEVVRGTPAAPLSQMLRALDP
FT                   RLREMSNMGSWSIISPVEAAGVIEVINDLKDVQNKTYSVPTVLVSRRVGGEEDIPPGVV
FT                   GLITPDMPDVLAHTSVRARNERVLFATVFDAGRMSELEGMHGQAVNCAPVGADDLRITS
FT                   VDPSSLGAAPGAGAVNMSMSAPPSGVNIAKREFMGRYAVPSPEFTGAIVGGKSRNLQEL
FT                   RGRLPDWINLPAQVALPFCTFDAVLAHPNNGHIAQHLQGLRQELEHLDFSNQAAFQDLL
FT                   GRIRACIMQMVPTPELVDEMSRAFAAERLPWPEGHLGPEGAGGSGAAAHAWAAVTGVWA
FT                   SKYNDRAVLSCRKAGLSHENVSMAVLCQPVVQSQYAFVLHTTNPQTGDPNEIYGEVVCG
FT                   MGEALVGNFPGRALSFVARKDDLTNARVTGFPSKANGLFTDAPTLIFRSDSNGEDLEGF
FT                   AGAGLYDSIQMHEAKLRPVDYSRDPIVSDETFRAQALAAIAHAANEIEQALGSPQDIEG
FT                   CIAADGALYVVQTRPQV"
FT   CDS_pept        <597378..>597629
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637158"
FT                   /orf_name="MICPUN_73989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64117.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B155"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A6"
FT                   /transl_table=1
FT                   /translation="EDWTPLHSASSCGHTAVVASLLAAGADPNAANSGGQAPIHYAASK
FT                   GHLDCIRKLVAAGCDPDAVDGTKSTPLHRAASQGRSNVI"
FT   CDS_pept        598169..599941
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637159"
FT                   /orf_name="MICPUN_59305"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64118.1"
FT                   /db_xref="UniParc:UPI000199B156"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A7"
FT                   /transl_table=1
FT                   /translation="MTGKEGGYGAIDSVGKGRSEEVDPYYDVEADEEVCRMPGKTVFAT
FT                   VCLYLTFVAMGFGTGWSSNDSIFQELNKFIERYDDLQFASDLVFASSCAASIVLVLAFV
FT                   GLYCNPSRYDLRSLGFFEGTISTVLAVSCLVQFSLFMFWQQSRYVVLACAFMGAMIGNI
FT                   QAFIIYPFFNAFYRLELIAYMNMGETLTSMTCGTLALAQSPTVGVETFSVQTYFTILFG
FT                   LTCMAASAWGSLAWQTGFRRDADEVDSPQDLSEGEEENENHPERKPLLQKVERGGGDGA
FT                   ALADGGGSGELVWTAGEIITRGPHGMTAPAEEVRGARRQGPMQKLRGLCTNVAGVLGKE
FT                   GTHLRSLLAIAGTNSILTWTVLPALLPFTAAAVSGSCRTDDPISKGFIRMCTSLSSMIR
FT                   VTGPLMIRSDGRYWGNPNFVKCVGVCGICLNLGFCLPAFFPDPDGYWQTVRGKLFLMVA
FT                   YFLTTPVEAFVQLHVLINTQRENAGSSKRIIDAGFFFTSLWVLGGFIVSEMLQQWTMTG
FT                   TAACPGIDELADTDPRDLPFDPKELDKDFEAKAIQDERSASLGYLLGYEPYGYQYQPHR
FT                   HPLMGPTWFNLFPG"
FT   CDS_pept        join(complement(600310..601171),complement(600026..600273))
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637160"
FT                   /orf_name="MICPUN_83112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64481.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199B157"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A8"
FT                   /transl_table=1
FT                   /translation="MAPTGVTVVTGFLGAGKTTLVNYVLNADHGYRVAVILNDFGAELG
FT                   VEKMLVQDKPDGDNAVEEWVELNNGCVCCTVKGSLVQTIDNLLEKRASTGRKFDFILLE
FT                   TTGLADPGPVAQELWVDDEILEEDGAVLDAVVTLVDASNIERQLSEGKEASLQIAYADT
FT                   VVLNKCDLVSERDLERVSELVAGINAEAKIVRSTRSVVDLGVILNQGAVSSAGRKAGTR
FT                   PTLAGDLAQTAPAPGFWARGVEKYASRPLSEVHDASIRTVCLVADGRIDVGKFETWLEE
FT                   LLWERGAGGGRQLEVLRAKGVLFAAEDEGTDRRRVLQAVREVYEITEGPPGRVGERPLN
FT                   RVVLIGRGLMSREEELLGGLKATTTTADA"
FT   CDS_pept        join(complement(603607..603643),complement(601352..603252))
FT                   /codon_start=1
FT                   /gene_family="HOG000199474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637161"
FT                   /orf_name="MICPUN_100998"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64482.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B158"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8A9"
FT                   /transl_table=1
FT                   /translation="MPVMSVTLSGDARAHPGVGTPPSANGDARPKTRGCPTVPLWDKVR
FT                   ADPADFNCWTALIGAAERTEDVHKIRAVYDAFLAEFPLCYGYWKKYADAESRLAGIDGV
FT                   EHVYERATHAFPYSIDLWTQRASHAIAMRRDAEKVRELFESGLAYAGTDWLAHPLWDAY
FT                   IHFEQHSGCGSPVHVTRLYGRVLRVPLKELDKYWAGFETFVTNRSPSAVIPPEELRAID
FT                   AAVGGIPPKGATAPGATAASRLATDAAASNGVDGGDGAEEAAEAAARAAATEAAGGSDP
FT                   RLLRFRDVRFETYRATLAVRATREPFEQRVKRPYFHVKPLDDAQLANWDTYLDNEERAG
FT                   DVSSVTRLYERCLVPCASYSRFWLRYARWQASDAGQGVAAARAALQRAANVFCKRDVEV
FT                   HFALARFEEAVGDVDAARAAYAHVADDVAPGLLRCVVERANLERRAGALDVAKETYERA
FT                   MQVEKSREGAGSKAYGVLACKYAAMLHEACGDVEGARKVYERAAEVGDGANALVWDGWL
FT                   NFERSVGASFANVRAVVERCCDGVFDEPRTSGSHPSGLQPRLPERDRARISSALVEYAD
FT                   LVGTTEQLADAERAHERRFPARAGGGGGEDGGAGRKRSAAAAGVEDVAAHHAAYYAQRG
FT                   YQLPAQYYHQ"
FT   CDS_pept        603594..604691
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637162"
FT                   /orf_name="MICPUN_59308"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64119.1"
FT                   /db_xref="HOGENOM:HBG561535"
FT                   /db_xref="UniParc:UPI000199B159"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B0"
FT                   /transl_table=1
FT                   /translation="MRRARASPERVTDITGIAASRDGFAVGRTKGGFRVAISLALLVGI
FT                   YFFSAVWGRGATSTTGASSDIASAGVTRRVIGDGRVEAIWNVPASAKGTVLALHGCSHS
FT                   ALDWFPRDESRCPECRGLAQEQKITNAALDAGYALLAVSSAGHCWSRDDVPRLALALDA
FT                   YGAEHGASRRRPMYAFGASSGGSFAGVLPSLSDLPRRPDGLIIQIAGGPGGTGLGLAHY
FT                   PPTVLSHMPRDESTAAAVRRSIDELTAAGARVLEHRLERRALTPSFFEEESAGKVTARE
FT                   SAGLFHALRDELGVLDAHDLLIRDPRSFDVGQIAKLRERTPAWDSLVPDESDVREILNV
FT                   AYAAHELSAQDFMKNLRWIVDASSA"
FT   CDS_pept        join(complement(605560..605712),complement(604742..605443))
FT                   /codon_start=1
FT                   /gene_family="HOG000006003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637163"
FT                   /orf_name="MICPUN_94511"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64483.1"
FT                   /db_xref="HOGENOM:HBG715921"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI000199B15A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B1"
FT                   /transl_table=1
FT                   /translation="MVGFDDSVVEEFVAQGRDARGERVVELIERATSAPKLYVFGELLD
FT                   LDGVKELESTPAAPHVALLRVFAYGTLPEYRQHESGLPPLSPAQLLKLRQLTVVQMADA
FT                   SVSIPYDELMSALEMSSVRELEDMLINECIAPGLLRGKLDHKRRAFEVHSCPVGRDLRP
FT                   GQLKEIIDQLAAWHDNSKDVLARLDSQMTRTTEEAERRKEHRKDVADAAETLRREMKVP
FT                   GAGEGGAEGEGGAEGEGGASGGAAGGEEGGDGGDADGEEDGGGLDLMDEDTPGTGIGSK
FT                   RRR"
FT   CDS_pept        606190..607671
FT                   /codon_start=1
FT                   /gene_family="HOG000163455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637164"
FT                   /orf_name="MICPUN_82818"
FT                   /product="Histone acetyltransferase complex component "
FT                   /function="DNA binding"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64120.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG714058"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR016827"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000199B15B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B2"
FT                   /transl_table=1
FT                   /translation="MATENAITKVNPSEPKRAMFHCHYCSKDISAVVRIKCAVCADCTL
FT                   CVECFSVGVEPHPHEASHAYHVIDNLSFPLFTMDWGADEEILLLEAIEIYGLGNWTEVA
FT                   EHVGTKTKLQCHQHYFDCYVNSETTPLPDMSKILGPKYTKEEPNEEPKAKKVKAEDGDA
FT                   DDDAAERADTLASFARPGDERHWGNVPELTGYNVKRNEFDPEYDIEAELPLAEMEFRDT
FT                   DTELDRKLKIRMLEIYNKRLEERIRRKEFIIDRGLLNVKRQQALERKRTPQERDIHGAV
FT                   RVFARFLDPNEYEIMLEGFMAESRIRNRIAELKEYRRNGIHTLSEGEVYDAEKRHRMAE
FT                   IARIKAIEYPGRGGSRANRYLGRDGFVQAPAGDAAPKELQKLTGIAAGGGGSGALTSLG
FT                   GTARKKAPLPLDLTHLPGVELLSKREKELCVANRLLPVHYLSIKEALMRASANGQVLKR
FT                   SEVRHMFKVEPIKAVRVFELLLQHGWVKDPNETEG"
FT   CDS_pept        complement(607852..608145)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637165"
FT                   /orf_name="MICPUN_108443"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64484.1"
FT                   /db_xref="InterPro:IPR022552"
FT                   /db_xref="UniParc:UPI000199B15C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B3"
FT                   /transl_table=1
FT                   /translation="MGLDASGEIVTRRISICRHSELDQVRGARMLMSMFLEIADVVVPI
FT                   AKSTLNNVKNFSSWLLVTLIGRSLGLVYRGIRESMNPANNNGNSNSSTPRFA"
FT   CDS_pept        610251..611330
FT                   /codon_start=1
FT                   /gene_family="HOG000265437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637166"
FT                   /orf_name="MICPUN_108444"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64121.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B15D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B4"
FT                   /transl_table=1
FT                   /translation="MRLINSRRTPARLSPAAFWMLVESRCLRPVLVDVRSAKELADTHP
FT                   EDDGISKRLEMVRIPIEELAHVLRNKATQWRLRARDGPHAKPPSLRDTMVFISTHGNAA
FT                   TQAAAIAMALGYQRVMAVDGGLAAAAPLAPPSSSGTPTASSLHNGLVTGEGGGGGGRGG
FT                   NGRVGSPRSGHDSPFGSSPRTPSASSLSFVPPGETLSRDALLLLMEYGQAQGAPLVTLV
FT                   DVRRHDERALYGSIRGSVHLAAEQLPRALLMPPDDFLRAFHFRKPGPDDVVVVHSRRQE
FT                   RASYAKQLLGDAGLHRCLVLSEGVMGWRSGGGGGEDVRAYDAFGEGEPPPEPYPTEPPV
FT                   EIDRPEAEAELMHKNVLLP"
FT   CDS_pept        complement(611477..613183)
FT                   /codon_start=1
FT                   /gene_family="HOG000264288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637167"
FT                   /orf_name="MICPUN_59313"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64485.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561538"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199B15E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B5"
FT                   /transl_table=1
FT                   /translation="MAATIVSSAGLRLNARARSSGAASSRVVARCESLPSQIRPPRLVL
FT                   PLAPHATRDGPDADASGPRLPSDLRGVTLRTQHVAPARLSRASLVTRAVATPAPVTVPE
FT                   PEQRVAISAPRPDVAMPNMQDPWNDPKWKDTKWTVYRDVAYDLQPFYDKHPGGEWLLNL
FT                   AIGRDCTALIESYHLRPEVSTARFNKLPVLEDFPVTAVPRAPRPNDSPLYNSIRDRVRK
FT                   ELFPREGKMEHRMGGDGAAATIVGTAVACYALYANFTGPIAGAMLGLAGAWIGLTIQHC
FT                   GNHGAMSPKTWVNNALGMTDDLIGGSSLMWRYHHQVSHHIHCNDNALDQDVYTAMPLLR
FT                   FDARQPKKWFHRFQHIYLFAAFPLMQLAFQVGDIKGLFTRDCEGAKLHGATALELATVV
FT                   IGKIAHFGLLLGPLAWGASGAAVAAGVASFIAVQGMVLACTFAVSHNVAETKVPEDTGG
FT                   EAWERDWGIQQLVTSADWGDKVGNFFTGGLNLQVEHHLFPAICFVHYPAIRKIVAEEAE
FT                   KFGVPYANYRTLPGIFAEFLKFVKDMGTADQIGDVVEAKHKNKSMCPLGFA"
FT   CDS_pept        613816..614829
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637168"
FT                   /orf_name="MICPUN_101002"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64122.1"
FT                   /db_xref="UniParc:UPI000199B15F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B6"
FT                   /transl_table=1
FT                   /translation="MQPLTMHARAPARASTGSGAGSSSRGGQMRERASFASPSADRLRA
FT                   GARRRPGGRRRRDGGTRVEALAVIRLLKFDPDRVSVSFAEDTCRRIAEPDRTRRYTLTH
FT                   NDLTQHLTLSVASDFNPDGQADVWYTRLLRDEVLAEWCDDGLHVHCNVTVEGHWWIAWA
FT                   KQLRAIVFRQKLPLVLDTLRYAEADLLLTNPSLASAPVFVHFHEGPCRSATSARFNNSR
FT                   SEGVREYWGLFSNAGQRKGFDQSRSYDEELSGSEAFSLERDLWTPESVAREMLTGTGSG
FT                   SGSFDDDGGGGGRGVGGGGGGGGADGRVGAGARSFAKSPGLSASGGPPEDAVVTSR"
FT   CDS_pept        join(complement(615509..615572),complement(615294..615352),
FT                   complement(614864..615151))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637169"
FT                   /orf_name="MICPUN_59315"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64486.1"
FT                   /db_xref="UniParc:UPI000199B160"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B7"
FT                   /transl_table=1
FT                   /translation="MSAANAFEAPKQPELSKDQAKDALTQTIELMKQPENMAKMEAAKA
FT                   AMAAQPDNIMMLMMMVMPVATQVCMPVLQKFGFTADQGGLMAYVAATMKHKDDAEIAAL
FT                   GKEMRSTFVPEALEGVIGMMLAGPAGGGVPAF"
FT   CDS_pept        615830..616495
FT                   /codon_start=1
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637170"
FT                   /orf_name="MICPUN_59316"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64123.1"
FT                   /db_xref="HOGENOM:HBG561541"
FT                   /db_xref="UniParc:UPI000199B161"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B8"
FT                   /transl_table=1
FT                   /translation="MPEGPYPELAVFDLDACFWDEEMYTLRDIVDPARSVRGNLGNGVG
FT                   EGVVSAMSGNTAITINPGALRALQDFHAGKYPGMRIAAASSADTPLAVRIGRSALDVLE
FT                   IVPGVTARAVFAIGWPEGFDGNMQIGRTPPLSSNKSQTHFPILRRETGVGYDRMLFFDD
FT                   CNWGDHCAAVANGCRDEMTGLGPVVVRTPRGLQVAEWEKGLELYRERVAKFAPAEPPL"
FT   CDS_pept        complement(<617548..>618255)
FT                   /codon_start=1
FT                   /gene_family="HOG000200822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637171"
FT                   /orf_name="MICPUN_72713"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO64487.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI000199B207"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8B9"
FT                   /transl_table=1
FT                   /translation="KNYEKTGLPDFRRLGTLSRTNEQYEDAAYDLRRVYDLLRALGEPH
FT                   LWEKTEHTGARWGPGFQTIHVAGTKGKGSTVGFLAGILRASGYNTATYKSPHVHSVAER
FT                   ITCGPIPPDAAYDERGAHLDPTTRLATHGKIDAETARIILDAQDKEKGKLTYFEILTVL
FT                   AMVKFRQLGAEMAVVECGVGGEHDATNIFTQESIAAVVITAIGKDHVDALGGTLGHIVR
FT                   AKCGIVQMHRPTFV"
FT   CDS_pept        join(618665..620747,620783..620808)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637172"
FT                   /orf_name="MICPUN_59318"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64124.1"
FT                   /db_xref="HOGENOM:HBG607716"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B208"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C0"
FT                   /transl_table=1
FT                   /translation="MAEIAAEGEPTTSAGHPETQSPEPGAKGGVVPRTPRASARNVAPT
FT                   SAYRDVLRREWDPRHRLRPRLGHSHFVKNLRLVQRLDRHAGCVNTVAWSEDASLLLSGS
FT                   DDLCVCVWSVGTSFPCLGTVYTGHNHNIFSAEFVPGTRGGRCVTTAGDGDVRVVDLIRG
FT                   FQSARGRGDPRDRPGGRSPFRTRRFGFDDDNAADDGAARSLFAGRPTDPNEIGDVMGMK
FT                   VRFVPGAPDVLLATHQDGRVRRFDLRLAPRATGDVVVDLSVQGGCSDLAFDPSSPSLFA
FT                   LGCDDPFVRVFDVRHLAETARDVSAARRARSPSEREHADLIPVVAKYSPGKSHGFNSRS
FT                   LRFDGVSGLAYGKRGELAVTYRGEHLYVIDQRAYESRRLASVGDGHGNGHGNGHGGHGA
FT                   AGAGTEWGSLFGAGGSPPPAGSESPEFGYASPDTSGLRSGGSDSDSGSDAGAESDSDAE
FT                   NGAAGARRSVSVPRDRVLSPRPHQPSEAGWDLFDDDPTHRPMERDDSAVRRYVGHRNVK
FT                   TFLKSVAFMCDDAYVSTGSDCGGMFVWDARTCELVLKVQADSQVVNNVCPHPSLPMVVT
FT                   SGIDDCMRVWEGGDGRHLIDLPERYPDDDDDDDFDDDDYDDLDEMDAWGDDGEYRPGVV
FT                   AYASDAEISSSDDDDEENESDHVHDPEEEGDGEEEEKAEPFGAFARAEAVGSESDERRS
FT                   AEREETEG"
FT   CDS_pept        join(complement(622006..622061),complement(620860..621847))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637173"
FT                   /orf_name="MICPUN_59319"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64488.1"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniParc:UPI000199B209"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C1"
FT                   /transl_table=1
FT                   /translation="MSTPAQVDVQIKAIYGQIDAGFADKKKLEGDPAEATAFVKTLTKK
FT                   MAESKSLIKEYERVSQEDPSVDPEHTAQRKREMVKQLNDYVQRKKAAQADIAARQEQLE
FT                   AAAGASPAPGAKKKGDPKPDPFAAARDAAEREKQNPFSSSGAASTSSEPAVAGAADAGA
FT                   GGGSKFSKFSKGSKGGAAAAAAQSEIVAPGEIELQGMQTEELLVYGRDKIKDTDAIIDR
FT                   SKATVARTIELGTQTAEQLRNQTQQMEKVVDDLDEIHFSLKKSMKVIKDLTRGLATDKC
FT                   ILTLLFIVVMGVVAIIAVKMAGLDKDDEVAKVRRLYSRRLLLEPEDVFHRETAHEPWRG
FT                   TTHRHRH"
FT   CDS_pept        complement(622443..622730)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637174"
FT                   /orf_name="MICPUN_59320"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64489.1"
FT                   /db_xref="UniParc:UPI000199B20A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C2"
FT                   /transl_table=1
FT                   /translation="MSALSFSAAVAARPALVGDKTRASSRVNKETRAIGGFGPNMPADE
FT                   YRKKMEAKKKLIEENKKKAAAKKAGGKPAAKGAKGAAAKPEKKGFFGFGK"
FT   CDS_pept        join(622938..623216,623331..624947)
FT                   /codon_start=1
FT                   /gene_family="HOG000226033" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637175"
FT                   /orf_name="MICPUN_59321"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64125.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR000738"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000199B20B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C3"
FT                   /transl_table=1
FT                   /translation="MALMTTRMMVRNGAECLGRSAPSLRSVLRCAPSTQRATLASPGAP
FT                   TPVRLGVGGAGRSMVSIRASSVTTTADTAAATSASAPFKRHERIAAIKGKDQGKSRVGD
FT                   TVQLRGWVRTVRAQKDLSFIEVNDGSSLSGIQAVVNGDVPGREHLDAGDITTGAAVVIK
FT                   GIVVESPGGKQAVEVAVESIKLIGGADASTFPLQKKRHTLEYLRSIAHLRPRTNTIGAV
FT                   TRVRNQLAYATHTFFQQHGFQYVNTPIVTASDCEGAGEQFQVTTLINGIDGPSVASAQS
FT                   NVASEADITAAKAAAAEQGVVVKTLKDAKKEGKATKEEVDEAVAELLALKAKAESLENS
FT                   PAAAAAGGDIPRDAAGAVDYGKDFFGKPSYLTVSGQLNAEIYACAMRDVYTFGPTFRAE
FT                   NSNTSRHLAEFWMVEPELAFADLQDDMDCAEAYLKHCLTHVLEHCDEDLEFFEKNISKD
FT                   NLRERLRGVATSDFARITYTEAVDHVLKAKKKFEFPVEWGCDLQSEHERYLTEEVFKNR
FT                   PVIVRDYPKAVKAFYMRENDDGKTVAAMDVLVPKVGELMGGSQREERLDVLERRIEEVG
FT                   LEKESYWWYLDLRRYGSVPHAGFGLGFERLVQYVTGVENIRDVIPFPRYPGSAEF"
FT   CDS_pept        625356..634121
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637176"
FT                   /gene_name="FAP47"
FT                   /orf_name="MICPUN_104861"
FT                   /product="Flagellar associated protein "
FT                   /function="structural molecule activity"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64126.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniParc:UPI000199B20C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C4"
FT                   /transl_table=1
FT                   /translation="MPGGRAGSTSPVDPNDPLPWLRLFPPAVNFHGIEANTVYTAEVTV
FT                   RNADSRIHTVKMIKPTTKKFFLVADAFKSVKLAPGMTAKFEVAFAADSQNDFWDKIVIQ
FT                   TEVGDAELPLAAYAPAPECRAEGDLDMGVIAQGCSVTRELTLTNHGSSPGAYRCDYDRT
FT                   LGPALRVEPAVGSVPPASGSTPGVAKVRVTCAPDAPGASTEQLEVFFDGKAAPFHFFVD
FT                   HTCVPHTLELLVDDGTGAGGAGGDPKRLTEMPFGAVLYGDAVTATCVLFNNGPNQTTFA
FT                   MDVTNEEDLQGTVHAMYRGEPGPGGSSRCGELDDGTLIVEPRSGILKPYERRRISVTVA
FT                   PKLATSTKGFKSVSRKIDGDAKSLACLGVITFSGVPKARCLLPITAKAVTGALDVQPAS
FT                   LDFGSVACHDVGDHIVMIKNMSKEAPVDYVIDRSTFFKPQPASGKILPGQSVSVVVRYE
FT                   PKNLGTHVEDLTVKAMATSGKVMAKRTVRVKGFSDFVTEKPPLPGGTMAVPEDFERPRK
FT                   FVSAEEVRKATIARSRAGRKHLNPIPTSLQRNTGRYTDDTLDRRFSETLTLQQATARET
FT                   HRTGYVDYIRTNRRRSTKAARVNPADPTSLGLVDRSGLVDNGPPLPDPVEPLWLNPDVP
FT                   EGRLRPQHRAQRLAEDDELLKLGVVSNFKRMPSTAKEMKECSRVLIPKELAKLKIGPSM
FT                   LDFGEVSVLSDNLKFFTVTNENDQAVLVHVDTAGQLELKNSTPTSQVVPPGKTAHFGIA
FT                   LCVDRVDRNFKTTVGYSINSNRTTSYAFDVLADVVPVQLDLNASALKFRFAPENWEDTV
FT                   TETLVVTNPNMYAAEYQWRVPPGCAYSVHPSRGAVPGNGMQPVRVTWSPSWTVGSPLSE
FT                   ENFATLVMDVVGGSTSRAVRCTADAGEPKLRFKETVVDFETIAAGLVATRYCTLKNVGR
FT                   FDAVYRLDENFKAKHPQFSCDPDFGSIRPGASQRLTVTFESPYPGAHKVNMQMNLRGGK
FT                   PVKIPVLTSVIVPVVHCKQQALNFGDTFRMEITKRPVTLVNTSDIDAELTCDLRQYPDF
FT                   DLEISPEAWSPEYYEDVPVYALETDPGTGGSLYKIHVAGKQELTFRMVFHPTDTARKVS
FT                   FAMPFLLEGVVDQPTPAEKLCKTVTAESKEPRVLLGTSLVDFAHKILLREGMRKVPHTR
FT                   EFTITNNDPASGPESLHWAFGKPVALDADEASVIDDGSPKPYDLVHTFQFEPKFGILKR
FT                   GESVTVKCSFSPMLATKFEGKVPVYLDGAAKTKNAHLRFGVAGLGAHPRIKFDEREVRL
FT                   APTPLGVVTTRRLWLINEGFDNMGISCKLPADKLAVPLQIEWPEGQMIGIAKQRLPVDV
FT                   SFESKKPLSFTATIEFLDEDGKRFPIPVSGIADNCTLTTEQFLAANDGCLTMDGADVNR
FT                   PVMLPRQARYMAPPMAQLDQGADNASLARWLNACTPEGPVRDIPGDFIRTKGLLLVEII
FT                   KFWTGREIVATVEKHGLNKRQHALWLCERFDKIITYLKGTGALLNGVYPEFLVDEQDYH
FT                   RLLRDKMAKVQSGEWSVVDGDRLQHWIALYEDRDRFRDVSASAWRAVLMQTIRIFVLNR
FT                   ITPKQFSTVPNCGDLAVNSATDASIAGSNVFSVAESIILKWMTHHRARVFPGAARVCDF
FT                   DDDLRDGTVLYGLLVSHWPNLSQFSQDMKFVPETREDIVANHEVVLDMLRYVQLSYDDV
FT                   TADELARSSPSERLLFCLFLYNHLPQLVPRTVIDFPTLLGQKVVKNIELTNPAMTPISY
FT                   SVRLEGNPDFTVEATTVRMEKRSSAQLAVSCTPTSSLPERCRLILAAVKEESQVNGSTL
FT                   VFDLNPVVKSSEPIRKIDFKAKCYEYTEQIIELQNPYPGDCEFGIVCTNYTADEVEAMA
FT                   AAKEAEQMELHSAAYTGRTPRTSRRSQKSIRELMGKPPDPALGKIDPSLYPDPFGVDRR
FT                   SVRLKKGEKVKLRVSFLPFIMGPHTAHLSFEDHRFGKFVYELAGGAEHPQPMSEHKAEV
FT                   DIKPQMSNIVVSFINNPLELAKRTFLEKHPLAKVKDQADRIRKAEPWPQSVVYALEVVS
FT                   SHMEIFGKPRLPLVKTPRAGKKTVTTGADGQKVEQFIPGENTVSLNLNLRNAGVYPGKV
FT                   VLKSQFDVRVVDLEYRCGLTGDAAQLEFECAAGQSITQNIPLVNSGMKPMSVTANFAGQ
FT                   REYFAGYGRDMVVDGKKKADFPLTFRPARPGTFLAKLVLKTGGESISYALKGVANEPLA
FT                   QGHVVIGADARGRTRHRFTVPNVFGAEREAAYEVSSDLNFVGGDPQCVVRPNATSTYDM
FT                   GVAPTCSGVFHGSITFTAPDGSFCWWTLEVRVAPPPVEDTLDLTVPVREALTTQITLAN
FT                   PSAAPATFRIYREGHGVLGADTMRIAARSEKTYDLVYSPMLTGPTEGSVRFVSAQLGEF
FT                   WYALRLDALDATAAVVPEMRSEVGGARGSTVLDIENPLDEEVLVALSCPDNPRNFIVAP
FT                   PSVTVPPFGVGKFRVTYAPSSLNQLETGTIVATNEEAGTWTWSVSGRGAEPTKLPATDI
FT                   FVTLGQTGSGSVSFQNPFHEPIYVDVAIETDEDAGVWEDILKKRQGVHVDGFQVVPIPF
FT                   KFSPRAMTRHEATMVITTESAGDTLTWRYPLIGIAEAVPKGDHFRIEGKARRRCEMGLE
FT                   VFLHGLKVDVPIEHYTFEVVVPESEKHHLRKALVIKPLMASLTPKTRSLRFAVAFRPKR
FT                   AMSCSIDFLVNKQSGGRWRFPIHLEAIEPEIDGTVVVEANVNEKAEAVFSLANPDPEAC
FT                   AFTAYFTPDSPAEFSVKPNVGTMLPGKSPETPLKPGADRGVAVETADGGPGVDLRIRYR
FT                   PKEYGGDRVGKLVVTTKENTWVFEVVGTMPEYNVPVVTTKLNTRIDPSVDEALKVAQRR
FT                   RRPGTIVRENLRAENYTSRRLLSKTPGHEITPKDLMDTTRSQFN"
FT   CDS_pept        join(634250..634937,635005..635579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637177"
FT                   /gene_name="LIC1"
FT                   /orf_name="MICPUN_59323"
FT                   /product="Ligand-gated ion channel family transporter "
FT                   /function="extracellular ligand-gated ion channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64127.1"
FT                   /db_xref="GO:0005230"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="UniParc:UPI000199B20D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C5"
FT                   /transl_table=1
FT                   /translation="MHHFQLPICAVVAILVLATCTPVHSVCSGPTDPGGVRTAMLASHD
FT                   EYSPPAPQSGETKVMVEVSGELELIKSVSEPTGSIQMAIQHTMTWPDSRLAFNTTTRNN
FT                   GCFDHERAVFPSAMLSEVWHPEYSFLNAIGSFGTASTFLVFKNDGEVRVTIREGVTATC
FT                   IFDFKKMPFDEQTCYARMLLNAPSKMVAFTAPTTGQELFKIPTGGLLGGTTEWTVLGTN
FT                   MTVGERAGMPPMSYVDFTVRMKRKPDYWIAFVLLPSIFLVALSYGTFWIQRGAIPARAA
FT                   FCFIAYLSIINLTKGALASLPKLSASDAWMLGVLSKSQYFCAYTVLGVVVANYLLHVET
FT                   RVDAALKDARDKEDASLGEKISDMRGFVRGKAGRFAGMLVGKDGKMRFADRHVDVFSRW
FT                   CFPAAYVAAVALVSIEAGVFA"
FT   CDS_pept        join(636062..636373,636470..636580)
FT                   /codon_start=1
FT                   /gene_family="HOG000223675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637178"
FT                   /orf_name="MICPUN_94512"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="ACO64128.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG521228"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniParc:UPI000199B20E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C6"
FT                   /transl_table=1
FT                   /translation="MPKGVKGKGGKNRRRGKNEGDEKRELIFKEDGQEYAQVLRMLGNG
FT                   RLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIVLLGLRDYQDEKADVILKYLADEARSLK
FT                   AYGELPESIRVNETDTFEEERDENDDFFDFDDVDAI"
FT   CDS_pept        join(complement(637875..638173),complement(636806..637688))
FT                   /codon_start=1
FT                   /gene_family="HOG000006822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637179"
FT                   /orf_name="MICPUN_97555"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64490.1"
FT                   /db_xref="HOGENOM:HBG561546"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="UniParc:UPI000199B20F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C7"
FT                   /transl_table=1
FT                   /translation="MSLLVEGVALTPSGRPVLAPEELELRMIERVDVEFGDKRAGNMRG
FT                   GLQGREADKYVAGVALVTSHRLIWLDQARAPGTEGLSCSVHLSRVIEAAPVPLKMTGAP
FT                   SSSSLATRVPPGQPPPPAAPPPPAAAGRPAAFAISAGVGGVLHRQHQEHKQRQETVTEA
FT                   FTDMNALMAKAKEMVTLAEHLAAVANRRQQRGTDSSGSDASDAETTEMDAMMLSMGIAS
FT                   PVTRETAGALYHQQLARQLADWLPQVLAKRGGILALPDVFCLFNRARGSELISPEDLLK
FT                   ACQLWRRLGVPLQFRRFESGVQVVQSLDRSDDEVCATLTEMINRPLGPSDDETRDAMRR
FT                   MDAYSASVALGIPPTIASEYLLMAERHGILCRDDGPEATYFYPNFFPECEATY"
FT   CDS_pept        641472..642197
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637180"
FT                   /orf_name="MICPUN_108447"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64129.1"
FT                   /db_xref="UniParc:UPI000199B210"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C8"
FT                   /transl_table=1
FT                   /translation="MAPVKSAEELRKAQDEEAAARREKEKRALFLREQRQRQQPAQREK
FT                   LLMVPPGFQPTPDAGNRKVMQMPAPRNLALAAFGAGPGSQTAMTPGRQAAIAAMQTPLP
FT                   NRNRRESVSMTPGPRGGRLSEIMSTPMAMSTPRSSGGRGTAPPGSRGAAMLQQAMCTPA
FT                   RETVVAETPAGSRGMVVAATPLHSRDGGGVGAQQQQRVGARKGMLGFGAMVREAREAEE
FT                   EQAPSKRAKKMFTFGGRGD"
FT   CDS_pept        complement(642992..644932)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637181"
FT                   /orf_name="MICPUN_101009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64491.1"
FT                   /db_xref="UniParc:UPI000199B2C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8C9"
FT                   /transl_table=1
FT                   /translation="MSWLAQAAAKAEARLTEALNKVDSAAAPALEKAKDRLEETKAQIA
FT                   EKASELGLGAGGDPQQPRRQVPRPRGEASGAGGANAIEVAPSVPAESKASSDAPTGTVG
FT                   DDAGRVDADPEIVPQIVQPPTAPTPASAEPTKKKTQLELLRERRLAREAAAANAKGIVA
FT                   GLVPEPPTEGTRTGPAERIPRAESDPSAPAPPPATHPPDPAEDTAKDTAGDSKRPEPEP
FT                   PASRRTTNQRVNEGTPAFAAARERADADAELERRVKRVALLAHARALRTRRAEETRDAE
FT                   DRADRAIAAREQRAASSARALEALAARAAKAAAALEDERVAHKLTREDAEERVAEVAQE
FT                   GGTRARALATEQRRLAEVTARRDDAADEFERLDRNARELRRRIVAANRRRERAEGVLAE
FT                   RKKRSNVTGGAGTGTGASDAEAEAAALQESLRRLRDANDAAAGRIASSADVSSSGVPDV
FT                   SAEDATDQLRLDVAFRTATEALIAEQTRAEALAASRSALVFRLETARRNADENNGRFAD
FT                   EEAGAVESAAAGYRYGSAGVDDDDDDDVLIAGLAETGRYAPKQLAYDIAAKALGGGDRA
FT                   RRVSNLAGAVDALALEGLRAVSRHGGARAAAVAYTCVLHLYMFALVFFGGSGPRATSTA
FT                   TMTAESLYPKP"
FT   CDS_pept        647553..>648336
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637182"
FT                   /orf_name="MICPUN_108448"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64130.1"
FT                   /db_xref="UniParc:UPI000199B2C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D0"
FT                   /transl_table=1
FT                   /translation="MMYGSGMPLLYAFASFFCLAIGFFDKRFLLRVCRRPPRYGTALAM
FT                   LALAVAPWAAFVHLLFGMWMHTHFLTPLITETAGVGDEYADAALSATGGGAANATDSAF
FT                   SGLLSSGATLQDLLDIANNASAAAQDAAATEYPPILSEISRRTMQTNGFPFFLLAILFI
FT                   VVNVVVNVVSQFWKAITTFLPCINALPCFREEADYEGVPTFEDAFMMDKLIGAHTYEMR
FT                   EMPMYKKFFFEGKGGFKERAAGDQADPDTPFKKGEDPYN"
FT   CDS_pept        648615..648797
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637183"
FT                   /orf_name="MICPUN_108449"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64131.1"
FT                   /db_xref="UniParc:UPI000199B2C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D1"
FT                   /transl_table=1
FT                   /translation="MAPPAPPGGWGRPVSAPAGTGPPSRVGPPGGRVGPPGGRVGPPGG
FT                   APARFGPSRVGPGRQ"
FT   CDS_pept        complement(649161..649337)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637184"
FT                   /orf_name="MICPUN_59330"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64492.1"
FT                   /db_xref="UniParc:UPI000199B2C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D2"
FT                   /transl_table=1
FT                   /translation="MKTAFDGARYAVGATDSMQGTGVWSGIKLSRDDAKPTAKPASKAA
FT                   KKSQPAKFPVKAK"
FT   CDS_pept        complement(649656..650330)
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637185"
FT                   /orf_name="MICPUN_59331"
FT                   /product="Peptidyl prolyl isomerase "
FT                   /function="isomerase activity"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64493.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199B2C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D3"
FT                   /transl_table=1
FT                   /translation="MTWQMPPIVQFTTQARPHTTRARTMSALSASFRIAASPVVSSSRR
FT                   AGSSSRRAAAPARASAGSDEKKVSSGRREAVAAAVLAAAALSQAAPALARGLPEFECTG
FT                   EVTTGASGLQFCESVVGSGITPSKGSLIKAHYTGRLLDGRVFDSSYSRGSPLTFKVGVR
FT                   EVIAGWDEGILGGEGVPPMKVGGKRVLTIPANLAYGSRGAGGGLIPPDATLKFDVELVQ
FT                   VL"
FT   CDS_pept        complement(650504..651706)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637186"
FT                   /orf_name="MICPUN_59332"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64494.1"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniParc:UPI000199B2C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D4"
FT                   /transl_table=1
FT                   /translation="MRQPVLIRHQFARVAQLHVGANADEFVVKLVHQPVGDPAWCVARP
FT                   RWTTALKLSCDGVVKVGLQAPLVVLQNVRGGTPMDFPFIKELRHEPVRHCASFCAGRVY
FT                   PGRQPMLTIYCRVSSSLSEIFISQHVERRLLLRGSLARHNPSRGPARDLVSNRVPIKGI
FT                   MSSAICRTFVVPARGSVASRATQPARGVFSGAKSLEPRSGAVTLVSAHGRHRDVSVCMG
FT                   RKGMLAELMDDGTDSAGDAKVDPRCPCGSGKDYSVCCGPHHDGAAPADSITPEAIVRAR
FT                   FSAYVKNVPKYIVASTHPDSKDMKRKDDPAEARAQLEKDADATMKKVQFTSLRVKGTKE
FT                   GDGETFVTYEVSYKAAGKKNRGGTKTLAERSRYKMADGEFKYFDALPLNSSSDMNAVGQ
FT                   I"
FT   CDS_pept        join(complement(653865..654676),complement(652040..653030))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637187"
FT                   /orf_name="MICPUN_83157"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="ACO64495.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B2CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D5"
FT                   /transl_table=1
FT                   /translation="MREVSFEPGEAIVTQGARDDDAFYVLASGTANVVVDGSTVKTLVP
FT                   GDPFGEVSLMYNTERTATVRAAGTSKCRAFELKRERYDLVRAAQADADARRRLDLVSAS
FT                   PTLRALDATTLRRVAESAEPQRYRAGETIFVRGDVGDALYVVEVGIVSVHAAGGEEVRR
FT                   FGVKDVFGEVALLNDDGRRTADAIAATDCVLLAITRDAFTAIAGPSIKAALHGADIANV
FT                   PLFAHLDVKQIAALAEATRLVKFSDGDEVIRAGMPPECLFIVDEGTFEEVVPPSLKLIA
FT                   TLGSGGFSRVFHVTARVLIGTNGAKVRRSYALKVVPIEQMVKNNVVHNVRNERDVMMAL
FT                   DHPFITRLHACFKAADHVYYVLDLIPGLELYWCMQNFEFSERGAAFYVAQVVLMLEYMH
FT                   ERQVSYRDVKPENLMLANDGYLRLVDFGLSKFLAPGERTFTFCGTPLYLAPEIWGHGGH
FT                   DKAVDWWALGCLAYELASNGTLPFHGETQGDIRKKILNEPVSFDGAAKRFSPELRALVE
FT                   GLLQKNQHKRLGVLRDGAGGVKTSAWFRDLDWIALARMEYPPPFTPDAAGGSKEALRIT
FT                   PRDQELVPPPSRECPMYGDMFPDF"
FT   CDS_pept        655679..656761
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637188"
FT                   /orf_name="MICPUN_108450"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64132.1"
FT                   /db_xref="HOGENOM:HBG561552"
FT                   /db_xref="UniParc:UPI000199B2CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D6"
FT                   /transl_table=1
FT                   /translation="MTSYEDNFSMDEATSVYNGTEETLAGNFIHKPGDGSGDWTMSDSW
FT                   DMFVKWEDNPLMYLFATFTLMSMLIWIGFAGDNLQHHRSYGSLSFAGGATHKQLWENSF
FT                   GGGGFVLMVFRVAAFCFCLWFSLTQIIQPNVDAGNKVTDYMNFHDWSFYCLTIFFGLGA
FT                   FVSVRGVFGGDGERASRYIGHSGDCNLVGHWLITWYSAAFTLCLACDLCVWLEMLFNPQ
FT                   CVGNTYGFKMSTLLDPASRLCYFEWNYMVGFVGNLILLLVESTLGQLPFPKCYLSTPLF
FT                   ILGLFITLAYLMHEFLFYHWPYEQLNFYRWQCFWYVNGFNGLVFGTHFFLNWFLSMGRG
FT                   DLTSEDVGDEHIPLFKGDTA"
FT   CDS_pept        join(complement(658985..659495),complement(658963..658967),
FT                   complement(658218..658880))
FT                   /codon_start=1
FT                   /gene_family="HOG000262545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637189"
FT                   /orf_name="MICPUN_82673"
FT                   /product="Predicted protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64496.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG303866"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI000199B2CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D7"
FT                   /transl_table=1
FT                   /translation="MSFGTADGAPYGFSSSFDSGNGELVSATPHTLTVRMREEPFTKAD
FT                   GRAHFQWFHFRVTGARGRALRVVVQNAGDASYPDGWRDYKAFASADRKHWRRVQTTTYV
FT                   DGELIIDMDPVPGDCVHLAYFVPYDYERHLDLVASASSHPNVSHVALGDTLDGRPLDCL
FT                   RFGEPGTFRRVVWILGRQHPGESMASWWMEGFVRRLLDDEDPVARKVLRRAVVYVVPNM
FT                   NPDGSVRGHLRTNAAGANLNREWENPTPELSPEVLWTRNAMDATGPVDLMLDVHGDEAE
FT                   PYCFIIGGEGCPGWDERRAETQRAFKAAYARACPDFQTTFPLEYGTAPAGNVVTAKTQV
FT                   TYRYNCVGMTLEMPFKDNVQLAQPDGWTPGRCEKLGAAAVDALLDVLPELRE"
FT   CDS_pept        659867..661144
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637190"
FT                   /orf_name="MICPUN_108451"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64133.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199B2CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D8"
FT                   /transl_table=1
FT                   /translation="MATASAEVDKATALLAWLADATNDPGIESRVALGETRHGRGLVAV
FT                   RNLVPGEVIFNVPFRLVLSEDHDEADASDLPWSALMAARLLEERSRGGERGRWIESLPH
FT                   LVSTPPLEYTDAELAACEDPKTIAEARATSEGHLAAYEALKPRLDAVGCDERDLRWATG
FT                   VLHSRCFTHGPRGTHLAVPGVDMCNHDFAGANAEVAVVTSPEDVQGVRATAEIADVDER
FT                   EKTGGARGDGDTMFFQLRAGDDGVEQGEEVTISYGPWPNDPFFLYFGFVPEGNPNDAVV
FT                   LFDDVDDVAMCAARLDMMSIAEAGERAAAATVAFAEEEKDGGSGAPTRMVITREGIDEG
FT                   MMRACGAMGFDQDTFNALLEGRCRELLRLYPTKLKEDRGLLMSGTLTENEATSTLYKMS
FT                   KKEVLLGPLAAAAARQSGAAGTIIQA"
FT   CDS_pept        complement(661259..661951)
FT                   /codon_start=1
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637191"
FT                   /orf_name="MICPUN_59337"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64497.1"
FT                   /db_xref="HOGENOM:HBG736553"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniParc:UPI000199B2CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8D9"
FT                   /transl_table=1
FT                   /translation="MSLKKNYLLAYNATLIFGWALVLTVAAKACITLGPKHVYENVEVM
FT                   LLVAQTAAVMEVLHAMFGIARSPVLVTAMQVSSRLMVVWGVLYVAPPSRAAFLPLANVG
FT                   GVDLGLGLPSLLFAWGVTEVVRYSYYFFKLLGTVPHAVTWMRYTFFIVLYPLGVASELF
FT                   LTYSGFPHLVSTGALSYPMPNPYNISIHFPSIVVMFFLGYVPGFPMLYMYMVNQRKKVL
FT                   APKKAKRA"
FT   CDS_pept        join(662965..662973,663218..664087)
FT                   /codon_start=1
FT                   /gene_family="HOG000265183" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637481"
FT                   /orf_name="MICPUN_108452"
FT                   /product="High-mobility protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64134.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG561555"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000199B2CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E0"
FT                   /transl_table=1
FT                   /translation="MPKRKQEDGMTIKPPKRARTAYLVFCDRYREQIMRAVHPQPNAKF
FT                   TREEMQAVTTKLAELWKNISPNELKECKAEADILKGQYEAEKAKFPAGSLKRHHKKGKK
FT                   AKNQTILVEGQGEKPKRARTAYLIFCDKYRNQIMKEVHSNPNTKFTREEMQQVTTRLAN
FT                   MWRNVTPTELASCKMEADLCKEEYKKQKDSYRAPVYAPASKSKKGKKEKADNGKPKRPR
FT                   TAYLLFAEDCRSKLKKTQPDLGFTDVSKVVSSEWKELPENKKQQYVRNAEKEQEKHRVL
FT                   KAQWEAKHPVA"
FT   CDS_pept        join(complement(665084..666901),complement(664358..664852))
FT                   /codon_start=1
FT                   /gene_family="HOG000268801" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637482"
FT                   /orf_name="MICPUN_82943"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64498.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B2D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E1"
FT                   /transl_table=1
FT                   /translation="MADREIEELEAAIKVRGATRASRRPKDLAAADNRCPPASSLTPQP
FT                   PFPHSRQATAPEKGTNPLAVAPRKSSEKGLGASLVGVRKFKDMPLSEATQRGLADARFK
FT                   ELTAIQRATIPHALAGRDILGAAKTGSGKTLAFIVPTLEALYRAKWGRQDGIGGLIIAP
FT                   TRELATQIFQQLVAAGKHHSLSAGLLIGGKNVKEEKDTVNRMNLLVCTPGRLLQHMDET
FT                   PMFDCVSLKVLVLDEADRILDLGFRETLTAILENLPKKGRQTLLFSATQTKSVKDLARL
FT                   SMRDPEYLAVHAESAHATPPKLSQMVATCELDKKMETMWAFIKSHLTSKTLVFLSSCKQ
FT                   VRFVHEMFRRMRPGIPVAMLHGRMKQMKRMATFDAFCKAKHTVLFATDVAARGLDFPSV
FT                   DWVLQADCPEDVPCYIHRVGRTARYTAEGKGLLLLTPSESAFAKELAAAKVPLKTMKLN
FT                   QAKNQKITSSIQGLLGKDTELKYLAQRAVVSYLRSIYLQPNKDVFDVNALDVEAYAHSM
FT                   GLPNPPRLRFLKSQKGAGKNGKKEEDSDDSEGDDSESEEAPARAEPPRAKARDDDDSDG
FT                   DEDDGDEDDSDEDDSDEEDDKTKSAGVLKRGKLRIKQGGHGANERVVFGEDGEAMAPLE
FT                   ALGVKSRADGPVPDGGEELAAAAKAHYDKIRAERLRADKADRLREKERLRDIRNKERMK
FT                   RRKADGLTQSDSDDDGDEEAGARLGGASDSDGSESESESEEPGKRRKVDVAVAGMATKD
FT                   ETVESMEERALRLLQGK"
FT   CDS_pept        667099..668559
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637483"
FT                   /orf_name="MICPUN_59341"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64135.1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI000199B2D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E2"
FT                   /transl_table=1
FT                   /translation="MGGEQDPPLVGTGWFPGITPEDFGAGKAWLDDIISPALIVNEAHV
FT                   RHNVKTIIGKCGRPDRWRPHLKTTKMKWVWRILIEEGVRNFKVATTKEAEAMIQLVREM
FT                   KSLKHTVDVLVAYPLVGPNLRALGRLTKTPGASQIKLSVLVECDRAIDDVVALDCGIGV
FT                   FIDINPGMDRTGLAYNRDGEAQHSFDDVRELIIKAKSRNVFRGIHYYEGHISECLAERD
FT                   GLSPNQSILKEKLDSRASDCFRCYNRWLLPIFHESLKDGKLPGCGGIKPEIITSGTPGF
FT                   THALRHELFLGGMIIISERVLYRYKQDLRGLPVDRSEEAKLSDSLFHGIHRVSPGTVVF
FT                   HDWRGERQNPGLGLKPAAVVMARVVSNPRAGMVTLDCGSKSIAAEAGDPAGYVIGYPEV
FT                   TARSCSEEHMPCSVAELAGSSGKRKRGATDPWQSKNRGEVCFVVPEHICPTVNLADEVV
FT                   VIREKSSEIEVRRVDARGHHLRLEDIQV"
FT   CDS_pept        669027..669941
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637484"
FT                   /orf_name="MICPUN_108453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64136.1"
FT                   /db_xref="UniParc:UPI000199B2D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E3"
FT                   /transl_table=1
FT                   /translation="MPFHDTERDADPEPAKKGIPKRYAHSGRYHVGYEVSRPDVDMIHD
FT                   GGDHVAEAHKNQSKGIPRRYATSSRYHVGYEVSRPDVDMIHDKGMHEFVAHAAHAVSPP
FT                   FKPRKSFASSSRYGGNRVGLSSSRAEKKRVDEAKRYAWARRDQEEALKALKSTKSTRAA
FT                   ASGDVKPARVTKYVGANPHHDKYFDWEKEDQRLNIVNEVIDRHLRDADEECQVNWIHGM
FT                   FSGGHEEECVRDVDAIMSIVAKHTDLAEAVAVVRELVDRGGSSAANAVRTWCAAHADLP
FT                   NATALSAMLDDMSKGKSIGTPSN"
FT   CDS_pept        join(complement(671331..>671791),
FT                   complement(<670106..671276))
FT                   /codon_start=1
FT                   /gene_family="HOG000200823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637485"
FT                   /orf_name="MICPUN_67204"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64499.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG610061"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199B380"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E4"
FT                   /transl_table=1
FT                   /translation="PKARAGRDFYAALNVKRDASEDDIKRAYRRLAQVAHPDKQASPAL
FT                   REAAARDFNRLNEAYEVLTDKDRRRIYDVYGEAGLAAGLEVGHRHKTIAEISEEFERAR
FT                   AKEAQQRMEAKLNFRGSYGFSFSAAHLVDAEIAQRRRYVAYKRGAKLSSGVLDDRATGY
FT                   VGAQGQMSRGMGAGGLILGMRVAASEHTSWELATVLGSNQSAATLATTRQLSEHTAGNL
FT                   TYSYSDAQGGLGLAVGLERALFDEHTKGSLSWNVGPTSGMSTGVARTKGRNSWKFDLSV
FT                   GPASTGIAGFFARRWSKKTSFRFGFRAGTTAIDVDFGGTRRVGHDSAVGMSVAVGIRGV
FT                   HLKLRFNHSGQRFSFPVLISPYQRLTPTIVACALALPWTIVFAVDRYLVSPAVAKKEAT
FT                   AKAKLRERHRERVAAAKAEAAEAAEMLRRDTEKRTEKERSVNGLVVEEAVFGNFPERGG
FT                   VPRRGEPIVSGWGSGGDDDAWVDVTTALRFQVFDSSLDMIEGLDKAGMLGFCDPCPGEE
FT                   KFLRVRYRYRGAMCEVTVGENDALALP"
FT   CDS_pept        join(671992..672063,672171..672464)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637486"
FT                   /orf_name="MICPUN_59344"
FT                   /product="Predicted protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64137.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR005351"
FT                   /db_xref="UniParc:UPI000199B381"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E5"
FT                   /transl_table=1
FT                   /translation="MVLAKGKLADDPRDADAVKPFIRPTYKPEEIPPELYTLGALVFSL
FT                   LGVTMQYKFCAWAGATFALAAFLNKRKHDSDSSQILSGVLFAVSGLAVVFMNGYHGEKA
FT                   RAFGSSKHFEGSVKVEL"
FT   CDS_pept        complement(672533..673276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637487"
FT                   /orf_name="MICPUN_101019"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64500.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B382"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E6"
FT                   /transl_table=1
FT                   /translation="MPGPRARYHLERIRESVWDVVANGALKITYGELKKGLDENKDVSW
FT                   VSPTAPDPGSQNVPPRDPNPTSADRSHQPPNDAQERTGLDGAKVRRAVTLECQAAGAGT
FT                   FVDFDEFHELACRRGGPGDDGFVDPVLATQMYMETHKLVPLLESMTAAVMTAKPDDPAK
FT                   FLEQKLRDHHFRGAPVLGYDEKDLDAVFTQFDIVRSGAITQEQCDKAIIAMTGHKAKPR
FT                   TDPGAPVTKAEFMRLAREALDEYTA"
FT   CDS_pept        673525..674919
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637488"
FT                   /orf_name="MICPUN_59346"
FT                   /product="JmjN/JmjC protein"
FT                   /protein_id="ACO64138.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000199B383"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E7"
FT                   /transl_table=1
FT                   /translation="MRPSSNRTATAVMPNRWADFEPMPYIEAEMMSLPKCEDDIPTIDA
FT                   SDLTAAEFAERFMRPNKPVMLTNIGCESWKAFDEWTKVDGSGERVPDVSRMSELFGDAK
FT                   VLVVDCEAPLDTDLSRREMRFEEYARYFRSRGDGSRSDGGDKRLLYCKDWTFTEDFPEY
FT                   PAYQTPPHFADDWLNEYWDEQRGKGVGDGLGSHRFVYLGVEGTHTPLHADVLRSFSWSV
FT                   NLAGHKRWLMVPPHRSRHLLDCTGRRHYHDVERWRQSDWNTFPTVDMAFPLMIIQPPNS
FT                   ALFVPSLWYHQVRNLTDCLSVNHNWFNASNARFSWAMLRDELDDVRAGLPDQDDRGDGV
FT                   LCQSLVERKAGADFKTFAGILASAIRRYRRRAVGECESESRTRSGKRRRLDGENKLDDE
FT                   NERGLRVAVDLLEEVLDADDEEGASAVASAWEGSEGALEEARDALKKGRETLVGNERLG
FT                   RRLDRK"
FT   CDS_pept        join(complement(677747..677776),complement(675005..676804))
FT                   /codon_start=1
FT                   /gene_family="HOG000256638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637489"
FT                   /orf_name="MICPUN_106965"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="ACO64501.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG521338"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniParc:UPI000199B384"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E8"
FT                   /transl_table=1
FT                   /translation="MSMSITNSLSANRGIFTADENAMIDKLLGCGQDHLFSSWPAPGTD
FT                   DDDKRRFLAQAAVCDAGYPGGIAQYVANAKKLLQDSKEGVNPFDGWTPAVPDGIVVEYA
FT                   SKEHVELESEGMREVGSAAFVLVAGGLGERLGYSGIKVELPCERSTDSCYLQLYIQSIL
FT                   ALQQRSAGEMPAHRSAKDVGIPLAIMTSDDTHAKTLDLLERNDYFGAKKEQVTLVKQEK
FT                   VPCLTNNDAHLALKDADPYALQTKPHGHGDVHALLHTSGLLDRWSAAGKKWVVFFQDTN
FT                   SLVFRVVPGALGVSKQKGFVFNSLCVPRKAKEAIGAITELTHTDGRKMTVNVEYNQLDP
FT                   LLRATINKDGDVNNDKGVSPFPGNINQLIVSLEEYKTQLAKTGGQIEEFVNPKYKDASK
FT                   TAFKSPTRLECMMQDYPKSLDASACVGFTVFDNWVGYSPVKNSPADGVGKFEGGNPTHT
FT                   ATSGEMEFYGCAAKVLELAGAEMAAPVDFSANDIVVPSGPKVVLHPSFACTFEELKGKA
FT                   GKGLKVTSASSALIVEGAGVKIESLELDGALVIKACPGAFVTVKNLKVSNKGWRFEKCG
FT                   ADAPEIDRLRGFVIEKDETEELVFDQPGAYTVP"
FT   CDS_pept        678870..679640
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637490"
FT                   /orf_name="MICPUN_59349"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64139.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B385"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8E9"
FT                   /transl_table=1
FT                   /translation="MPAFLDMVKAAERGEVDLLTRCLDLGLNPRERHQYTVSFYQQNIP
FT                   SEKHRKQMDGFSTESSAWTAAAACGQLECLRVLVSRCGCVPDRAVVHAAACGHTECLRF
FT                   LLESGGDAKAVDSDGDNGDNGDIDSTSSDDDELVNAFRMACASGRADCVRLLIAHGADW
FT                   EDDYAKWLAEQRPEPQLECYRGDGGHDLVLWIFQQALFAWRQGGNKRVRIAFGGQSAKP
FT                   VTSRDPHGPSLQKKGSTCGCLSAMCMPRKVKMHH"
FT   CDS_pept        complement(679782..680654)
FT                   /codon_start=1
FT                   /gene_family="HOG000239698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637491"
FT                   /orf_name="MICPUN_108455"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64502.1"
FT                   /db_xref="HOGENOM:HBG561562"
FT                   /db_xref="UniParc:UPI000199B386"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F0"
FT                   /transl_table=1
FT                   /translation="MIVDFDAEERSETDDDGNAFFSKSGVDTGDGGYRCRWTVTGRTAK
FT                   DGTWEYRATHWEKADWSGYKELGAEKSGFDDASGDTWWETWRQVYRRENGDASGSSDTS
FT                   GPALIERSADKWARDKHKKEWQEKWWERYSDAGLVERGVEKSGRQGVQAWWEKWGEQRD
FT                   DSDGGGDVIKWTDKWAENGAGTRWGDKWEERFGADGSGKKVGETWRVNAGGERWSRTWG
FT                   ESVGSDGEIRTYGQSTSGEQWDTTEQGNSSRDNSSRWEDAKEAAEYGWEQAVADSTRML
FT                   AIETPPREK"
FT   CDS_pept        join(681698..681919,682053..684668)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637492"
FT                   /orf_name="MICPUN_59351"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64140.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199B387"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F1"
FT                   /transl_table=1
FT                   /translation="MAARRDASSRVGAAIGQSPSQSQRSSLAKKIARFERADENSRGTQ
FT                   KFDGSMGEETARPVGARPMARPSGKTPLKSANNANRSLSGSPIVSKALAALDAASRGED
FT                   LTDSDDDDAALEPNVGDNPREEEEEESEDDAARRIQTWFRGYKSRREASEEKVREVMAE
FT                   KRRTLERIARARDEDRRAKPSNPAAAAAETASPERPVWPEDAPAPASASPIGGGFKSFV
FT                   RDVAARVIQRRVREFIAARRTQKTPVRAAEPAATPVSGPRVGAVPAPFRRAVVGERPGH
FT                   GDGDGEASHTQTSSPTQTSSPSQTLSPSPERLPKPSPAMARHATPPRLRRSPAGKPPGR
FT                   VVDAPPQNPRASVSDDTLASIMSYLDAVENEGAVPTHHAAPAGTSLAHQHAPSSSTANR
FT                   RVVPEWVRSGFSAPTHSHPPAREEEGPAAGRFGLAAVLSQYRPQTPIPGLADEETSSAD
FT                   GGVALATATNVYEGVRARMDSMKSELQRRDKLVAKLEAELRIAYDRAAAQTAQQLQDQR
FT                   QAHETATQRHLDFAERLLKDKDELAGRCAELSESLAAAEARHASQSAEMKAAYGEQLKK
FT                   AKQKWDEAQAKWESEKTLEIKEMTIRGLEPEIQRLVQKHRNEVGDLIEKHREETRRLES
FT                   HLTTKHEDAMRALRAEMNAQFEEELERERASGGARLRDQAERHEQSMKTFRERAAADGA
FT                   SGTEMYEKGRREEREKYEQVVQRLNEEHTRREERMADQAAASADAVRRRHDADLAALQT
FT                   RLDQESAAWRAKVTAKAQEALREREKEIKARAIAERDREIEAIAARLREEAVNVVGDSR
FT                   AEELRATRERADRAERAASAAERESAAAKEKACALERELRAVRETAIKEGVVGGAFEDR
FT                   IKALAAAAAAAEKRAAECEAELAKARLMKEDEAAALEARVRMAIGKKDETIAQLTAQLN
FT                   ATKALLEEAPMCLED"
FT   CDS_pept        complement(<685234..687048)
FT                   /codon_start=1
FT                   /gene_family="HOG000265456" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637493"
FT                   /orf_name="MICPUN_83076"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64503.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B388"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F2"
FT                   /transl_table=1
FT                   /translation="MERELKAAGVTSVDAKIQKARANAKGGGKKGKGKKDDSDISDDDD
FT                   SDDDSDDALLPGEEEEDTDSEAEEIEDDSEDEDDSEDDDDESEGDEDDDSEEEEEDEDD
FT                   DEEEEEEEEEDEEEEKEDIAPDTGAFTERAVVKGKNGEKDTTFSAANFTELNLSRPLVK
FT                   ACGALGYASPTPIQAAVVPLALTGRDICGRAVTGSGKTAAFMLPCLERMLHRGPKPVAA
FT                   THVLVLVPTRELAVQVHQMTERLAQFTSVRAALVVGGLSANVQATSLRSRPEVVVATPG
FT                   RLIDHVRNTHSVGLEDLATLVLDEADRLLEMGFLEEIREIVRHCPKRRQTMLFSATLTS
FT                   GVEELAEFSMKNPARLSADQIGTTPGTLTEEVLRLRPGAAAMKEAHLLAIVARTFTKRC
FT                   IIFSRTKQQAHRLKIIMGIHGLKACELHGDLTQTQRLAALEEFRTGEATHMVATDVAAR
FT                   GLDIAGVDAVVSYDAPRTLASYLHRVGRTARAGRKGTALTFMEESDRKLIKAVSKRGSK
FT                   LVARSLPTHVVEDFHAKIEGMGEAIKEVEMEERAEKHLARAEMEAIKAENLMEHQKEIH
FT                   SRPQKTWFQSEREKKLGQKASLKAAERED"
FT   CDS_pept        687352..688656
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637494"
FT                   /orf_name="MICPUN_101025"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64141.1"
FT                   /db_xref="UniParc:UPI000199B389"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F3"
FT                   /transl_table=1
FT                   /translation="MAVDNGLLAPLAIFIIAGAYYFLSAQRIINEDFVDASVRQMVGLM
FT                   YISDVGFNLVASRLSKSKRKKTASKKAPTGTPGLVLNLLPLTDLVGLVCAFEAIRLAGS
FT                   GFHQTVGGASIPISCLLNVLITGKVFSTGQLTGISIVILGLAVKAKALLDSNDDDDAAG
FT                   FPAVAVAHVLVSCVGYALRGIAMEYLSDNGVDGRTMTMRMGVTGVAAWGAYTLAFTARD
FT                   FGAKVIEPFSAASTRVGVIASFSLYASHALSRGIASGTITQIVSLGGATVLSLAQVTRA
FT                   SIIILLSSVAFCGVDERQCLDGYGIASAALVIAGSAYYGNAKSFEEELDDLIDPDVADE
FT                   MDSVIGEAEEILEELVDLYVEEHGSEPTEDEFLAWTESLKRAGAEAERKVSKKAATPKK
FT                   ATPAKKPKKAAPAKAKETKSKAKETTTARRRSARK"
FT   CDS_pept        join(688836..689156,689245..689613)
FT                   /codon_start=1
FT                   /gene_family="HOG000265458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637495"
FT                   /orf_name="MICPUN_101026"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64142.1"
FT                   /db_xref="HOGENOM:HBG607733"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000199B38A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F4"
FT                   /transl_table=1
FT                   /translation="MLPHSKQILVAGVVLISLGAVVVGITTARAVRGDQRARRAEDEVL
FT                   ALRTALDDVSAPVAHERRNRRELSEKMEGWIDARATWYGGPDGPGPDGMSIYTGSCGYG
FT                   TSLNNHYISAWHTDGGYDWGLTDKCGQCYEVMCVDGATRGKDWSDLGPWGGCAEPGKKT
FT                   VVVMISDSCPCHHPNSGNKRWCCGDRTHLDLSYAAFDQIAIRHRGVVDLKVRPAPCDKQ
FT                   GVVAYYE"
FT   CDS_pept        join(complement(689986..690093),complement(689700..689870))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637496"
FT                   /orf_name="MICPUN_59355"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64504.1"
FT                   /db_xref="UniParc:UPI000199B38B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F5"
FT                   /transl_table=1
FT                   /translation="MPGRHLRRRDITTKIFEKNCAREEERHRWNVPRTQQFELGKSQRL
FT                   RYEASGRFAFLLWKSVYVTKQVSFRNRVLILFDWMKTRVFGRDTSIF"
FT   CDS_pept        690175..692301
FT                   /codon_start=1
FT                   /gene_family="HOG000259522" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637497"
FT                   /orf_name="MICPUN_59356"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64143.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG607699"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B38C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F6"
FT                   /transl_table=1
FT                   /translation="MASRESFGNGGGGQGTSPSDRAIAAYEERFFQTANSNDSKRRMLE
FT                   ERMTRPTPSTGITAGDALNASNVGANDQPDSDDDEQNAFRVEPKRARRGPGGSGHANNG
FT                   ARGVATSPLGDKERATPGSAGGRGSIDTYYKRVDGVPPAPAFGTSPTHGVGGIPTPASG
FT                   SGGRKENYPPGSVPPEARHARTASHHDNTRAEHEWAAALEQAKAGAKREADEARKRASR
FT                   LETDLAAAAARCEELAAELEASREREASAEAARHQRDQNKTAGVIALAVKVARFERTRS
FT                   RRKLAEDGLRLGTVSVQRSGTVLQEVWEDGGAFRDLNSRAAAVQTAKDAADDERKRVKG
FT                   RLPLPGAAIDESEERALRAEFVLSEEAHKVRVAALKREEDLIGREREALEREKSAHIRE
FT                   LKRARDEDSSRFNQHPLLGDRYVLMNMLGRGGFSEVYKAYDVLEMREVACKLHQLNPQW
FT                   SEQRKVTYVKHAARECEIHKQLRHPSVVQLIDVFEVDQNCFCTVLELCTGDDLDARLKA
FT                   QGAVSEREARAILAQVFAGLAYMNSGSTTVIHYDLKPGNILFDAAGRVKITDFGLSKKR
FT                   DMNGVQTLSADTGMELTSQGAGTYWYLPPECFETGPTPPKISSKVDTWSCGVILYQMLF
FT                   NRRPFGHDQSQEQILHAGTIRHAKEVEFPQTPKVSAECKEFIKRCLAYRKEDRPDVPTA
FT                   ARDPYMTYAKPGSE"
FT   CDS_pept        <692527..>693075
FT                   /codon_start=1
FT                   /gene_family="HOG000216981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637498"
FT                   /orf_name="MICPUN_72031"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64144.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG747233"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniParc:UPI000199B38D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F7"
FT                   /transl_table=1
FT                   /translation="ASSASRAISFLHLTQQLKLTPRTGWVNHGVDKPESIADHMYRMSL
FT                   MAMVAAKEMPGLDQNRCVKLALIHDLAEAIVGDITPHDPVSKEEKAKMEADAMAKIRDM
FT                   LGDSLGGEEVEALWHEYEDQVTDEAKLLKDLDKLEMIMQAGEYERAQGKDLSQFFESTA
FT                   GKFTTPVGQAWEAEIVARRK"
FT   CDS_pept        join(complement(693798..693816),complement(693172..693677))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637499"
FT                   /orf_name="MICPUN_105730"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64505.1"
FT                   /db_xref="UniParc:UPI000199B38E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F8"
FT                   /transl_table=1
FT                   /translation="MAGATRDNTRVSPSFKMNALLVYCALVVDVFVAAYADITYGSTSQ
FT                   VDVMATIFQICSFFLTVMCLYNMMSETQLVKRAMFFKLADEFAPAVFLTFLYFVFILAT
FT                   RFYRLGLVYQNYPHLQIWNESAFTGLYIFTKIVQVMYYSTVVWSMQKLLASPELFRSSQ
FT                   SSFHSVYPANN"
FT   CDS_pept        join(694326..694364,694538..694633,694769..707566)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637500"
FT                   /orf_name="MICPUN_59359"
FT                   /product="Predicted protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64145.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR010309"
FT                   /db_xref="InterPro:IPR010314"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199D581"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8F9"
FT                   /transl_table=1
FT                   /translation="MGKVTPAKRKVETPSAVKALVDKIVATPCLQLADVFGPFAWTFGR
FT                   GDFQHWIAVLNHFDEFFEQHVKPRADLELRDLTRSVAEPFPLAPCLWILRTSNVILDNC
FT                   ANRHMYASSEHLASLLAHEDDDVALGALGVLASATRRPPGTRSSNRFRADARMAGRLAA
FT                   LCAGLHDGASKGGDEHKAAERGANNRSVASSATVFGQKIGANDLESGNSCDVHFEFYSE
FT                   GDGATRLIAEDVRAGSPMATASELVSKHGVPDELKFTLYARVRLAKLAATMRGAAIATQ
FT                   IRLCAFCVLLQSELTAAGGDDQGLQFIREPSPEFVAELLRILRLEGDGGCPPAVVELAL
FT                   RVLAALAGDRAHQGGVITAMRAGGQPQVFAALVNSAVQRLTAAPSPPIGKQVGESSLPT
FT                   LEVESINAEADAPVPLAEALVALLGTLVISHGGCQTLRDVSLLPVLLPLLRNRNPRHLH
FT                   IVSHAVHVLEIFMDYASAAAAAFRELGGLDLVVDRLRQETRDALDEFEATHKDRDDGDN
FT                   EKGSVHLVSSQRRVLIKALMRAMALTNFSPGMGNVPAAGLDDGKLCLALNDIFGSARLF
FT                   GSGVFSLAANLLCDVMNHEPTSYWKLEKHGTPEAFIAAWEKPKEHAPLPSADALACLPV
FT                   TLGALSLSAEGLERVKKSRALDALADAFTTRTYAKLLQGETASTIGGNLDELLRHVPSL
FT                   QDMGVRLAVDVLRRLVELGGGTVEHAQDSKVDKDPVKKARMDGDSSPGGASDSPRGMDT
FT                   DSAEKEEPDEKQLSPSFLMEAVANAAHLIDSMLPTDECGQKFVEQGGMQLLIQLHTLPL
FT                   HGPNFSSSSQCHALSVTLRALAGQHSKELAKKVQVALGTAVEKAILAMSHGHENDLYPP
FT                   FAPMRDFQWRCINEEKMETIGHGAPNPLPVDSIAAKAKKIRAALADAEALLNLTTTLIR
FT                   SSPGMLPTLCSGDDSWTSHRSHDANGWVPGLITRISHLQRQVQATAAVLQDEYGLRKCD
FT                   MEENQKKVKEHIAEWCKQTGGQEKDFDENDPNVDAALSGKIRLAKQSVEVLQLMQSLQS
FT                   LSNHFVTSHNYFCSSLAKAASGIRHRHRDENSVQSRGAACELAVQVCRTLQEIAEFDYK
FT                   ETDDHRDFRRAQRAFDDVYAILIDTRRRCSQGLVLNYMRQNYKRVADSTATDGTGLDLI
FT                   AEAFAVVWQQYVRCVGKKSALKPLEEGAEKTEIQTEHEKWQNRAEIMEHALKTGIGLIQ
FT                   QLVNIAVLMGSSVSATLLTASLPKFRAPNKLAKKAETYVSGVLALDEIIARNDAAVFEQ
FT                   SMKEDSSPTVKQFADVLHAAMLPALMKIWNSDSLKSCPTQVLVVLMAAMRHLRDGTGKV
FT                   DAHEGPPRRGRTGSGGAARLLGGLAPAPPPPPPPFVPSPSMMASIQEMGFSEPQARAAL
FT                   VAVRGQSIEIAMEWLFTHPEEAAAADEAAAAAAATTTPAPEEKKEEKEEKEEEITPSQD
FT                   ELARAMAMSMDEAEAADAAPPAAEPKIELISQEKLMADGLPASTCLRTLLDRECKMPAA
FT                   ADLIEPMMDICQANEDMVFPCVGLFKAAVGPAKEAEQKSAMTRILTMVVNAFDPETFSE
FT                   PDLYTNSRFLALLLSDRNGLREIAADVDCLMTVSSEPGDVQAERASRVDNMLVDFTDRA
FT                   VCALERFLSEHKESGSAVMPKWFATLVLVIHAIAQWRGVKPMEFDRTSNEWETKRPNMR
FT                   QRLEQERTDEDKLDAAYVKHKTNPADALKSVIGSPMGYLDDDMCDRATKLCIDILLLTE
FT                   TQGEEVDPSETIVGALTSDEDVGGVQAALQLLSHLTKDHRRACMLLKPKNCINTLLNVP
FT                   RKFAFAAYDALASSILRHVVEDPEVLQAAMATEIHTILGDQSKINSRRFMPQAMPVISR
FT                   DPAAFVAAMEKCCVITQGARGDPRQVGFFVHLRKRYIDDENRKVASSQGRNLDPRTDVS
FT                   PKDREAYLASPSSRALKSPAGDTAAKSQGKGHGKKKAHPSFATVIQALVDAVMAYPTDA
FT                   ERAAEWGEGGGTAAVDAMETSAEVDSKEVDSKEVDSKEVDSKEVDSKVNAPSLAAVRAS
FT                   LALRLLTDFTLVYGAAAGQILRMDAPTEGAKSGLLKHVLYVQLPEAKAKLGEADKDGRP
FT                   AAGGWDGGERAAYLLLALCVRSSEARRRVLHEVSVALKSADALVKNAREGPGPARAFVD
FT                   LVNALLAYAGGKPAGSAPGAQNNGEGKDLQRRYAGDLQRCMKDANLLPAMCAALDGVDL
FT                   NDAAAPVLVNAILRPLEVMTRPAPPPKSPASHPRLSQGAGETAAAETAADAANAPGSIE
FT                   RRNRGQGNEGGHGLARTATMAAEHDPEQMAQLEQVAGQMFESMDRDDEDDDESGEDESG
FT                   EEDESGEEDEDDDESDEDSDGEADIDLMDDHEEQEVEMVHDEGDGEEEDAAVDHGHHHG
FT                   HDDDDEMEASDEDAEDEDAEDDDEDDDHDEEEGAEINIEEDVDDDGDEEVGADDRWDVD
FT                   DQDDHFDLFPPFDEHGTDAAPPPGGWGPGEIVPLHGHAHALGHGEEEDVMHFGGEDDGD
FT                   DDGVDAGDDDDGDDDDGARLAEQLQGLIGNIANQVGAQGGGPAPVVELRVRDNRLRELV
FT                   MRRGGRAILRPDDIGSLVAGAGAPGGAGAARARGANNLAGGGILSDIFNLRNSLEEARR
FT                   GAATSPASRRGGANSTSAGIATDAELIYDPTRGAGGMDPLEHPLLGRRPVDFARGGTSA
FT                   NANANAAGGSGAGGAEALRGRTPRAAGMHSVLASISGEMSRLAVGPGAPQTGGRGAFQV
FT                   IGAGEQNGRLFVLPEVTDLGSLLRVERSDGGRGAASSSTAGGDDGGRRWDPPRVGDARA
FT                   ATWADPSRGSVAPRHVNPCLDAAASDLEAHLAGILRAEPAAQPPPAADQPAAEPEKTTT
FT                   EGDVEMATEPEPERAPEPSSTPEAEAPAPPVADEAPPVETAADEIREHPITAEPSEEED
FT                   DDEDEEEPEPEDQPIDSEFLNALPPDLREELLATNRQIARLNRRNTSADASAAASSQLE
FT                   PIDPSFISALPPDMQAEVVQQQSREVARVMRERAAEDARRSAQAAAEAAARAAAAAAAA
FT                   PEGERTEAQRAAAEAAAAAAQAAAQAGGAAQGGMDNASVIASFPEELRQEVLLSADESV
FT                   LATLPEALQAEARTLRERHAQQMRQFQNAGAARAAAEAAAADGMEDDDEAGGTAAAAFS
FT                   RQLRTMLGLSGPGPLGGGGGRGGRGERMLAGALTAADRAAKAAKLASPAVDRDALLTLV
FT                   RLLRLAPPPAKGLLPKVLLNLAAHAPTRDALLRLLFANLRAVMEANEGGGGDCGALYGR
FT                   DVHVVCSKPDAAARLLAKRALETAVFLARHSAFISRRIPALAVTLSDAADAAAAGALGA
FT                   KSPPKFANEIGTDETVLTRSPASIPLPAARPDAGSAGGDGVVALLLRCLGSTAFAPHVG
FT                   HLELILQLLDATLRSSAFELDYHVRALRIHREAEETRRKANEEKSKKEAETRRTAAEIT
FT                   EAPGEEDATLAMDEGVNTASTRMALHKEKDEKKDVEMVRPHGTEDFAVARIREALASDY
FT                   ARLSAVATLLGRDGLTDSVYAKAADVCRALADVAPAARDALASALSAQVRSRIEDAVAN
FT                   LESVRFTASVGRTAQTMGAKEAEAEAAAAAAAAKLPPSVASSGSAILRVSHVVAALLKF
FT                   DVDAAKREETEAAGNALAAAGAGPGEVIPPPRSGADVEAERRRRRKAMGRAIQSFADEL
FT                   NPVWAALSEACTVLEPQIAAAAAVAAASSRGGTAAPALPAGARQIQPVVEAYFALAAAI
FT                   NDASKRVAPEASVEEPGGRNATISSPERGGVVGSDEGLVSSNAASSGLDADDRAAFGLS
FT                   RVTSPAFGLARSATPANGAATAGGRAPHSSGPSASHPGGADLAPVAEEEADAGADKDGP
FT                   GGVTSVWNFTNEHRSVVNALVRSQPGLLDGSLRLMLEKPRLLDFDNKRSYIRGKLKRLA
FT                   EREQMRGSHHGPVRAQINRKQVLTDSFMQLQHLKPAELRGRLTIQFSGEEGIDAGGVSR
FT                   EWYMLLARDMFNPDKALFELSPSGDGAYQPFGNSGINETHLAYFKFIGRIIGKAVYDGY
FT                   LVDAHFTRPFYKHMLNIPLNYDDMEAFDPDYHKSLVYMLEHPLEESGLDYLTMSATADY
FT                   FGMETVVDLIPDGRDVSVTDDNKLEYVNLVAAHRMTNAIKEQIAAFTEGFNDIVPHEII
FT                   SILNPSELELLISGTPEIDIDDLKNNTEYTGYTTSAPQVRWFWEVVKDLSEEDRARLLM
FT                   FVTGTSKVPLDGFKALQGISGPQRFQIHKAYGGGQRLCSAHTCFNQLDLPEYNTKEELK
FT                   DRLLFAIREGSEGFGFG"
FT   CDS_pept        join(complement(709953..709986),complement(709760..709821),
FT                   complement(709527..709599),complement(709299..709366),
FT                   complement(707690..709159))
FT                   /codon_start=1
FT                   /gene_family="HOG000226732" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637501"
FT                   /orf_name="MICPUN_59360"
FT                   /product="Chaperonin"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64506.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000199B42F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G0"
FT                   /transl_table=1
FT                   /translation="MQGMQSPIMVMNTNTKRETGRTAQLNNIAAAKAVADIIRTTLGPR
FT                   SMLKMILDASGGIVLTNDGNAILREIDVTHPAAKSMIELSRTQDEEVGDGTTSVIILAG
FT                   EILHLSQPFLEKDIHPTVIVRAYMKALDAAVKIIDSLAFPIDVDDRQQLMNIVSSCIGT
FT                   KYTSRFGPLMAELALEAVLCVAVDNGDGTKEVDIKKFAKVEKIAGGSIDDCRVLKGVMM
FT                   NKDVVAPGRMQRRIENPRVMLLDCPLEYKKGENQTNVEITKEEDWAVLLKMEEDWIQGV
FT                   CAQIAAFKPDIVVTEKGLSDLATHYLCKAGITALRRVRKTDNNRIARATGASIVHRVEE
FT                   LKEEDIGTGAGLFKVEKLGEEYFSFFVDCKEPKACSIILRGASRDVLNEVERNLQDAMG
FT                   VARNVVHDPRLLPGGGAVEMAVSRAISEEALKIEGVEQWPFKAIGQALEVIPRTLAQNC
FT                   GANVIRTLTKLRAKHAEWTAESTGGKACTFGIDGDKGTIVDMKELGVWEAYAVKVQSIK
FT                   TAVESAAMLLRIDDIVSGLSQKGGPGAAAGTGTGVAPQQDDEEDPPEKLGE"
FT   CDS_pept        710221..712221
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637502"
FT                   /orf_name="MICPUN_59361"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64146.1"
FT                   /db_xref="UniParc:UPI000199B430"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G1"
FT                   /transl_table=1
FT                   /translation="MDPRSAPWYYLHVEAYQKGVVAQQGPIPFDELHVMYKDGKVERDT
FT                   FVWSECHEADDFFQIESVPELVAALEVPLEGDAAEAEDLTTSVTQSLPEDPPKDETRPP
FT                   ESAADTEANTTKKETEPVERASAPEQTTTLPIAPAPSPTPSSMRTPGRSGSGALEAIMR
FT                   RVGGSTAKRVASPRLASRGRFTTSRRGDGDDDDASDDASDDASSSDDDVEADVMLGRKK
FT                   WFPDVENALNVEYAALKRALHKDYVAHVRKLEASLESIEARIRDARERRAAVRRETARE
FT                   RREHERLARSANDVARELERLRRREEELGERERAARDREDEIASATAELASRAEDLVRR
FT                   ERVLERRERAVQNETEALDARGRELDAQFDACEATMAKCKAERDEHASAMREVSEVERR
FT                   LEEDARRIAAQGEALARRGEEDRRRVKEREAAIERREAAIAEKAEEAEAVLAMEREAVR
FT                   LAIGDRFEEMERSRREVMAAAARKAEDPAWDAVPPPPPRISHPSTAAARHSSPSSFRTP
FT                   RRPPPPPPPPPPPPQHSQHSQHQHQPHPHPRDDDVGVVGGEASVLTGAGARWAAGVPSP
FT                   AAAAAVRKGAVLVPVYRGGMPGAGGVRICDVAVASTTTLGGLRSALAAHLGLSTRDGLA
FT                   IRRRGTAVPPTQDHLPASTYFGSYDDAVVLD"
FT   CDS_pept        712414..714612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637503"
FT                   /orf_name="MICPUN_59362"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="ACO64147.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="UniParc:UPI000199B431"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G2"
FT                   /transl_table=1
FT                   /translation="MPFQVSGTKKGGMPVTVEKRPKGKVATVIGNVRGDKAELLAMVKA
FT                   AVGAGGSVAGHDSVEIQGDHAAKIQQLLLRHQDRTGHATMKGVAGLKPKPEKPEPREEE
FT                   SRARREEKVRSAEVLAQQKQRRVEARQRAVREAVNAKVESTRHFHVYANMMKTWRYWDQ
FT                   NWDALREMHDRHVRDLDEAARAGRGRGITSILDAEVDEPAPGRRRGEVLEAIDRGLAAL
FT                   GGAAAPESATRSPPPHHDQRAALMALGMIAAPSPFRQSRQERLAEAKRRQAAAKEAAKN
FT                   APPVAAAAKEATRAPAFDPALAALRAFGDYPDRSRPAASASARSRPPPVRPGATRPPPS
FT                   RVPRGGAGRGGAVGTRRRGHGKGDPKRSSLGYTGARKGTGGGVYGGDVEEDRDVAFDDD
FT                   ESEEEEEEEEDHDYLYAGGGDTRGWEASPSGGFSFGPIAGAENSPSWQHLSRGDEAEMD
FT                   QEEADLREALRRSLLEAESEPTRRVGLHVECGDLWGELTEEEAFELAKRLSEEQEKLDR
FT                   ASRAEFESFDEPARCGLGFRDRDSEARDPRDRLAELCGFDADDEAAVGLADLVSSMDTL
FT                   EEAADLVAATAGCDRGEAEEVAAALRDDGDEPETEEPEIEESSPADDDDAAGFMPKCMD
FT                   EDAALAEALRLSKLDAETRVAAPAFTDSAPALSGDLLGWADAQLSMFTGEEDNAFLAEY
FT                   VCDMETAAEIEEFLRESFPSEESSAAASFARALVLMRS"
FT   CDS_pept        join(complement(714786..717217),complement(714664..714697))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637504"
FT                   /orf_name="MICPUN_59363"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64507.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B432"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G3"
FT                   /transl_table=1
FT                   /translation="MGHGDVGDDGNLEALPDFELVIPRKRGPQHKRRSVEQVYIEARRP
FT                   ELVCMAWVPELRTVLAGREDGKVAYWRLMVLNNDVTISKDCRVFEGHRGRVGSMLSLRE
FT                   QADCFSGAIVVSGGADGQIRVWDPRVEIEGAVQDISGHDGTVTALAQCHAYLASGSTDR
FT                   TVRLWRPGGTPGEVPKKPSGVTYPWFEPHRVFILGTLPGWINTLTFDSTGEVGDLGSLF
FT                   AGDSEGAVVRWRPAKSIRDLGGCDFVEGSTHTEGSTHDEPFERVPLDPNGSSRGVFKAL
FT                   YIAEENMVVTLAYDMKARGYDTLSGRRMMELDNPERCMFTAVVYVGETRELFLVDRRGY
FT                   FYIYDLRLECVTLREQRTGLATVFDENTKKGDWLPAADLALLRGAPSLRALVLTAQGLV
FT                   KGIQICREKIFQFLYKPGEGHVGPVIALTAGMVDDQERIISASQDGSIRHWDTYDMCSL
FT                   RVFTDDSASEITCLAYSRHNRKIITGHEGGEVRLWGVDSGQCKVMYVPEKAHANTVSCC
FT                   ALVSTTDPTTGEAMETLYTAGFDGRVGLWDLRSTDGRSPYLKLGWKAHEKEILSCVAWA
FT                   SKECVITAGNEGIIRLWKGPEELIGELTGHERAVTCMAMRGTTLFSGSEDRTVRVWDTE
FT                   KASSEGALLETLDGHESTVVGVWAMSSTGHLISVSTHDPTITGERQGKLILWDVQQSEV
FT                   IEGALSDEVKADLEEKIGRLKEGLESEKDEEKKVKINEVLTGFETQLEESSKGEVSMQR
FT                   LILDTFTHPEKFRSVTVREGDNQVLLGTAECSIVATRALPEDVWTESGLPPRQSNCPPS
FT                   RQWEADSRL"
FT   CDS_pept        717330..718286
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637505"
FT                   /orf_name="MICPUN_101033"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64148.1"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniParc:UPI000199B433"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G4"
FT                   /transl_table=1
FT                   /translation="MASIARAVAAATASSAALVVTVHSVRRVSTPPIRPARSAEHARQA
FT                   PLREFYGTAATSSRHPPHVCNAAGFNSRRLRSSQELVGDGDAEDDEDYDPYMHGGRPNR
FT                   SAIKRLIDEYKGLTKELCALPKTSVAKIQMPDELREEVYAAISITSNIARKRAEGRVTK
FT                   TLRQLSDEDVLPIQTAVENIQNGIGLITVPPEVESTAHMWRSALLNGDKDVQSVVFGVL
FT                   QEREDWTFTRQELGQLATTARREREEAEAEREAFKKAQEEAEAAAVIMPDGTAVPSAKG
FT                   PVQVQPKRKKSGAGKATKKLLKHLRKIAEVAHDEGLL"
FT   CDS_pept        complement(718393..719277)
FT                   /codon_start=1
FT                   /gene_family="HOG000100080" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637506"
FT                   /orf_name="MICPUN_59365"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64508.1"
FT                   /db_xref="HOGENOM:HBG558564"
FT                   /db_xref="UniParc:UPI000199B434"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G5"
FT                   /transl_table=1
FT                   /translation="MDGAHANAYETDANEDLRFWTPEAIENLKKPMLVPAKLVAPTVVR
FT                   EWDTRKEKKSLSKQAEAALQRAMDLFDNYLANAEYAPPLAELLRPSVLDAYKEVAGEGF
FT                   SLYRIRRPDKKELQKDPEQSNPRGFTHGLLGELDIKIEDYHHLIDFNLTIDAGKLFAEH
FT                   VSMWPGCFAMRRGNSGKAASCGRKLTDADRAARGIAHNVTVTDVVVSQEAYIAYRSGNV
FT                   TELSESQKEFMDFRATKIATGTVGKNFYGCNVPGDPHYPCYLHRDEAAAATHYRKLEKD
FT                   LKRQREEMFDMFD"
FT   CDS_pept        join(719595..726551,726622..729279)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637507"
FT                   /orf_name="MICPUN_101034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64149.1"
FT                   /db_xref="HOGENOM:HBG561572"
FT                   /db_xref="InterPro:IPR003612"
FT                   /db_xref="UniParc:UPI000199B435"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G6"
FT                   /transl_table=1
FT                   /translation="MTRFRRIATAALAILALAAHPLVVESIDPGAAKFVDARRAGGDDP
FT                   SAGEGNSRAEASSPRVERTRDGGVHRLFARAIRRSLDRIRANREDDAPDPIAWSQPTAH
FT                   STSPIEPASRTLPRRLKLEPQQRRRSLQQGTDISGCPDLASGDLKFSVTTWSSLPSEDL
FT                   VRVGAVDAAITGGAAAAREMYVSLVVTHKKADASVNLRGVTVAFEFSRTVVVDESTGET
FT                   EVADPSRFVFMCWGAQLLPAAVDGSDGGHRSVPCSELTLDIDAVGPRVTFGDVTLGPGE
FT                   FLAGGYSNFLFSFKEMGAMPMENSVTLLAPFCDDAAVDRPAAELPLLAPTFMLGWNPNK
FT                   HLELSACPALLDMVFHSLVPEVDAGDTSTTIASGVVGHRSCASMDVTGVTVPVPYARTV
FT                   DPASFETGCSGIQLALPAPTFRSDGMSAMQGMEQPALTCDDVVVTMTSDGLRISFVDGA
FT                   LKLCPGCFLVGGPDNVMASWRTLDGSDASLIPIGPPAMPYCGAGPDMSLTAEVGPVTPC
FT                   NAEENAELDGEVLNGGTFLTSSAGACCLACQENPGCNVWTFCTDEGGCGGAAPTYSYSR
FT                   CSLKYQDPAQLSPGPAPGKRGPEITFTSGSLPEKETEIFVADTVQQIRNETGETCAVCQ
FT                   IEDAANYKGDPLIDGTNLLVDSPEACCAKCAEDDRCNSFVYCGSESGCGGEYYDYKHRE
FT                   CWLKFLAEDMWTQFPVPAWNRGEGIPWTSGIVNRTRCVERVFPPPSPPAIVTIPLPQPP
FT                   PPSPEQPSPVRTAPTTCSEGASSIAELCTGVLLGQEESLEVDDASECCGVITWMNADER
FT                   RCFCDSGVVDSLGRLADPLLLVGGIVCEVEILSGDACAPAPTPTPAPVPEPSAPEPPPP
FT                   DAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDAPAPSPPEAPDAPAPPPPDA
FT                   PDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDA
FT                   PPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAP
FT                   SPPPPSPDAPPPSPPPLAPPAPSPPPPPVVPSPPPPNAPTAPSPPPPDAPMAPSPPPPG
FT                   APAAPSPPPPDAPVVVVLAPPISVPQPPCIVLLTRLTEQCAPLLGDDTSATMMQDCCEI
FT                   LAEMNGEELRCFCAEDVLERLGTQIRPVTLLAPFLCGPELEIYSGESCELQAEPVIVPV
FT                   PAPDPPAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPP
FT                   PDAPTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPPPPNAPTAP
FT                   SPPPPASPTAPSPPPPVAPQAPLPVPKNACPVISLRGRGAGPDRNEALVGTVWVDPGAT
FT                   AIDAEDGDLTDEIVRDASQLDTATPGVYRVTYSVTDSAGCETRAVRYVRVIALVATSDA
FT                   EYLSTLCLRQVPRVTMTCEVGMQRHEDHRPNPAAFPACCLLAQEMDASACFCDGRVIGE
FT                   LNARNATFFEDLVDFTPMACGFKIKTGEVCTDMRALERFFAAEIVDTGEDVATVEELIS
FT                   EGGALNAELPCDEQVAAVTAMCQRLTRATPGPAPLVSDFVPCCTAAAVLNVSECLCDEN
FT                   FVFADEERTTFLQQLIGFAPLGCGFALTGTCPAITDKLELPSVEGITVPDAFSSESVPA
FT                   VLPVAGGWNTSALTWEFMFGDDDVVTVDDASEQLFWVQDGGVQLFNLISCAEYVSLAPQ
FT                   VCGDVRLNSEVSTFVLTECCAFLHAAHARGCLCPLAGLAALALVNPDLEDISPIACALR
FT                   LDTIPSLGEGYCKTQLTLEHVMSPAESQIFEETKSAGDGSQSQVDFFDDRNLQLGTFIG
FT                   AAPRATPVVITTPTTLKIAGEDDAVVTSVVPPGSVFGVVAPEVMRTVRDADIVENVLPE
FT                   TLAPGETYAIPSSAIVTSDVTSLPTYRASESNSSAGGAVAIKAGGDNRLLLTVPDLGGV
FT                   VKLPWTASLEPVPVIPEANYAEDGTDELPVVVVTNHIDGVTSLVPLASDGRSYAVVKAD
FT                   VAEAEGDTDNEDYENGYRGLIYGNGNETGLGNIVRGSTTSCLFAVVIAEASCIPMLESV
FT                   SEIFELDIGWRVCCSRISAVNDDGCFCDGAVNAALEVTARSNIHARVMDAIPGACGFQL
FT                   TSGESCPTAIFADSEDEDKLNVTTSDPTRELVSIHADVYTAPEVISSVTAAGAVVVSST
FT                   DASRDDAEVADNVAAEGLGANYDADTGLVTLTLPGDATVTADVAVFYPNGIKPSSVSSP
FT                   PPGPVAAEAVALDPEDPSRPLPGYGVVMSDGRNFLTVSLESGMESFVVMGAITHCKGFP
FT                   LEVPQVVLPIMYRPRGGDGGYAPPLSEPKVECLGITLISNQGEVLRDDLCDRFSFEIKD
FT                   YGVDVIIRDVSICVDCALTGRSTDGAIARVSHPRSDTLAAMQPDVTAMTCDVDAVAAED
FT                   RRRRLLESPSNDRRLLQFLAEQYSNPTEVNDFFSRLRPSDGGGDWSSGRDSGYALIGDE
FT                   DPRDPPSPDAPTPPEIMPENVVLCVDDVGRLAGNVQWWSRGSGPLQPGLPNQPYDEYVF
FT                   SGSVDALAGERGVDLQGIVLPIVFSPWVLDDDDGGNWRAVFDPASELEVACAGVKKISG
FT                   DGSVEPSTDEPCGGVTFALSTYSSPDGGEEGQETPTTTGDRAPAVLLLEVSFSAVGSVD
FT                   AGGRVEGGGPRGEMFRVRHASGASLDFVGPTVGALECAPDGVVGTVVTGIEPSSIAPSI
FT                   PTTIEPVAGADDRGSLVVSGADRDVSSCAGRPGLNLKGELLNDGGSLIKDEAGDCCADC
FT                   AALPECNVWVYCEGDCVNYAYHSCWLKRAAVGFDAGSAPDAWAASPEVPWTSGWFPPKR
FT                   GVQPVVDVAEPTGEPPEEPEDTPPEEAPPIRVVPVPVGPVEPEPEPEPEPEPEPSTTPA
FT                   PTIPSPQGADEGSGATFTLVPGQPVTIPAAEITIIPGGPEVVAVPAGEPSFAVPVADPS
FT                   STTCADADVFACPPDAVATAPLSTARLRSSFQLLRATSSETGGSETESLELLRPGDEVT
FT                   EIFVTGTLINANLQDTACLSNLEVPFDFPRVVIARSGDAFTARPEDFIVRCFYVGVRSR
FT                   EASAAPGASSPAAGTSTPPPPRSCEDTVDLAMTESGPVMAFKDDVALCPGCWLVGGRDG
FT                   VLFSWRHRDGLRLRVAAGDEVGDGAARCKPVA"
FT   CDS_pept        complement(729634..730173)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637508"
FT                   /orf_name="MICPUN_101035"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64509.1"
FT                   /db_xref="UniParc:UPI000199B4F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G7"
FT                   /transl_table=1
FT                   /translation="MSAAISSAHAVSGSVATLRSRRATRIRTVRSIKVRAEAEKPNFKG
FT                   WREIDIKQVQLGTAKIPSGIDEEIFCSSLYQWANGLTTSGQNMPFALPQRVDRLPTGFS
FT                   MAFLVSDPKGEPGTFVSCGEIVAEVVDHPLQEGQRVLMINGTGQVMDKGRLIDVDTVMQ
FT                   TFPNAIRNAVGMATKE"
FT   CDS_pept        <730561..>731100
FT                   /codon_start=1
FT                   /gene_family="HOG000233247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637509"
FT                   /orf_name="MICPUN_71737"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64150.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG319877"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B4F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G8"
FT                   /transl_table=1
FT                   /translation="VIAEVADGLEGGIQAIYLGSLLAILGFAGFIIVRQVLIRRELDDS
FT                   AKKMGERIRAGNATAEEYFEMGSIMLRKKVFTQAVRNLKLAAQMWEGDKEDLAQIHNAL
FT                   GFGYLSTDKVDEAIAEFNKAVELTPGYVTAWNNLGDALEQKKEFKGAIEAYEESLILSP
FT                   GNKVATVRLDEIKRRQG"
FT   CDS_pept        complement(731381..731953)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637510"
FT                   /orf_name="MICPUN_59370"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO64510.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199B4F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8G9"
FT                   /transl_table=1
FT                   /translation="MSEGLCANDPIFDVPPLPTDEQVKRFGMDGDGPYPTIAPGAMTWT
FT                   QLDTLRHQIAAFSHLCEQRALLTQQIYEESKPGHQRSQTLAAIANSIGVSAAGSQPSYP
FT                   GPVYSKGGDGPRGARWTPSAAQLARLEELFATGMGTPNGDLRTKITDELAKLGPVNEAN
FT                   VYNWFQNKKARTKKKLLEEQAAKNRSG"
FT   CDS_pept        732324..734171
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637511"
FT                   /orf_name="MICPUN_59371"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO64151.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199B4F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H0"
FT                   /transl_table=1
FT                   /translation="MSGGSDEATLRAECEAMGACACCILRFRGVPSGEVDEYRAAASAS
FT                   KDEPPCPCCLGILQLDLDASTAREREGADAAEASAPNGEDDATNGTAAAADARNRSDVL
FT                   VRVDPPAVHARCVSQYAAGIRAGGHEFDAFALEVTMPPALAVRQAATRCHLLDALARAK
FT                   RSADGGGDGGDQLDVPAGPAADVQLPKTTDVKDVLRALLVPALVDASAAQLATTTTAVR
FT                   RHDQAADFRFALLFEHDLSATEAAFAYQDHEETRGGGGGGGGGGAHNKRRRAPPPHLVG
FT                   SVFVPAESPAGAWQNHGERYNNAERVAMGQLTDIATIARWRRDGRATVTTPPSAPEVGA
FT                   TVRMLTWRQPVYVGGRYLKRARGTPQAPWIDSETGVTIGEGSVQTSLDAVVSRAFRADG
FT                   SKLNAAGREDIDVRMLGGGRPFILEVHNPRRPNAAATAEARAAMEAALEAADGGAVAAV
FT                   DVHVTDAAAYRAMHEASEEKEKEYTAVCWAEKPLTLEDELMLSGIKDLQIQQSTPVRVL
FT                   HRRTSMTRPRTIVSCRCERVPNAARFFTLRLKTQAGTYVKEFVHGDFGRTRPNVGEMLG
FT                   CAADIIQLDVTDVVMDFANGELKGVDGDEREAKRGAKVE"
FT   CDS_pept        complement(734248..734844)
FT                   /codon_start=1
FT                   /gene_family="HOG000258519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637512"
FT                   /orf_name="MICPUN_82550"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64511.1"
FT                   /db_xref="HOGENOM:HBG523421"
FT                   /db_xref="UniParc:UPI000199B4FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H1"
FT                   /transl_table=1
FT                   /translation="MFRKGGKSTSMNHGGRRRVVTEFDDGGEMIEEYDLKTDELLLRKR
FT                   RGRTVLGKDEEWEYLTGEAPRTFSPDVGILAESSVNPTWQRSQDTPQSFVWRVRNLPYP
FT                   IETYQVTCDHGDQKIVIRTTNKKFYKRFDVPELKVLKLSLQDDALSYDWKNNTLIVQYK
FT                   KPREVIKAELEEKVETQQLRLKRAPEDGDVDCKQQ"
FT   CDS_pept        735153..737390
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637513"
FT                   /orf_name="MICPUN_59373"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64152.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniParc:UPI000199B4FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H2"
FT                   /transl_table=1
FT                   /translation="MGLWSALHKVRAGQDRVLTDGRNHGHCLAPSGAWSPDSEWIVYDT
FT                   RSDAAGQKFDGGAIQCVNVRSGQVRTLYRTRNGAACGVASWNPRRDKREVVFVHGPENP
FT                   TASYFYAPHQRRGVRVDASAQLRRPKWHREPEMDAKAASAGVADHPEGAEVERAMPSGK
FT                   NARGGEPVVTSLVPARWPCRNLDARDLLGPQFTDGALRGGTGDHQYSPDGALVASSYVD
FT                   GVLLRNQASGAYGRVETACVCTAVTTLDGRGGVEVDKEEHPRNHDGDGWTVVATSHEDA
FT                   PRVGSDEISNATREAWIGARGYRRAGNGWVGRALAFLGEVHTGNSRAPSHLELFVLDLP
FT                   AKPRDLRLSERGKPLSGSDTARPQPPPGATQRRLTDTSGRTYPGMCVGPLEKHGHEGPP
FT                   SPRAGAGKSGGSGKRKNAGPKFWPRSSPCGSRICVVAMDDMCVPQLYLVATGSSTPARL
FT                   RQLTDLPKPGVQSAFSWSPDGAHIAFVHDGSVCLLTVPGDAVHRGADGDGGANDDGECD
FT                   GEDEDDALAKLMEQENAVGGPDDRGRKRRVKRLTRRRTGEAAPQPQGVTFSPCGKYVAY
FT                   VRRTSASSSSRDPAPGTTVAQGTQSPKSPLESERNGENTDLFYNSDDDTEGGPKYFNQV
FT                   CVVGIEVVLRQPFRLAAQIVGTVATVLCGFVATDLAKLGVGAVRDGLRRRRVEMLRKIG
FT                   RRGRGRGKQLRTDTWQDFQREYERTGRRLEKKPKRPAAAKGWDDFKREYER"
FT   CDS_pept        join(complement(737712..738601),complement(737542..737671))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637514"
FT                   /orf_name="MICPUN_59374"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO64512.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B4FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H3"
FT                   /transl_table=1
FT                   /translation="MRAALASSPTIHGAVSDRPTRARHPRGIRTPSRVRCGGDPAREGT
FT                   PGTRPGVSISVPDPSSFGPNGGRIFCFGLGYTSLGLINTLKRAGWHVSGTCRDEARVRS
FT                   LRAAGVHAHLWRPDDVVRMDADGIDAVLGATHVLNSTPPNADFDRDPVLADAACMDALT
FT                   RAHDRGHLRWLGYLSSTGVYGEHRGGWVDESSACAPASPVARRRRDAELEWETTDLPVV
FT                   TFRLGGIYGPGRSILDTVARSAGGEAIGESRRARSARKFTSRCHVGDVVNVLCASMSAS
FT                   AETSSSSSSSSSSSSSRRRGRTRRRLRGRSWGWSRGGSAGWTRAGWTRARRERAGRSG"
FT   CDS_pept        join(739651..739752,740659..741684)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637515"
FT                   /orf_name="MICPUN_91080"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64153.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B4FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H4"
FT                   /transl_table=1
FT                   /translation="MLRLNVNPADPTLVDDLFAKHDADGNGHLDYAEFLLREKALTLEK
FT                   GFRGARTWFKYFDRDGSGGVDKDEFQMAMNQFNIAPTPEVIDEMFLRYDKSGEGELEYM
FT                   ELLAALAPAKGLYHSTADMLESLDVNAPARVSAGDGVKQPARLSLGAPRAHADDQGKQR
FT                   LSVKQFKRKLTDWMAARGQGLMALRKLFKELDYDNSGYIDREEFAKGIMRMNIHPTKES
FT                   LAKILDYYDDDGNGTIEFEEFIASVLPDHDYRGYEDGNWQAIAHHDPKPPNIMPTSHML
FT                   YGNQLEKLLIDKIIQASDKGGSARKIFRELDWDHSGTVDKDEFRKWIKYLNFFPDEGTF
FT                   ERLWRNYDRDNKGYFEYKDFVNKVAPKHDLNASVF"
FT   CDS_pept        complement(743634..744488)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637516"
FT                   /orf_name="MICPUN_59377"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64513.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="UniParc:UPI000199B4FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H5"
FT                   /transl_table=1
FT                   /translation="MSSAMSDPKYLIKRVPDNAKRPGECKHCHEAFIEGTLRLGWKETP
FT                   GALKSGPWSWAHVDCVPEKRWKSAVALFGDIDEIPGVNDDAITVQLINAARVGAQAVEK
FT                   AVEKEELLKKELEDLSKAALARGYARIAAFDYKVCEYVINDSPTSKTRCDRCDEDFVDL
FT                   SRSLRLGWKEKPGEIKRDEWTWAHAACVPMVRWDNAADVYGTLDPKNPDVPGNLHAIPG
FT                   VDGCEATAEEIREWYAVSAVSVKAQARAWETEALAALREEKKRAALAAAQVENAGRASL
FT                   AAA"
FT   CDS_pept        complement(744977..745897)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637517"
FT                   /orf_name="MICPUN_108457"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64514.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="UniParc:UPI000199B4FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H6"
FT                   /transl_table=1
FT                   /translation="MQEPMYIIQKPMSAKGKCVHCNMVFPDDELRLGFRETPAAIEKGP
FT                   WKWSHVTCVPVDRWDTAEDVYGEVDEIPGVATTEGASRTVRLAHSNARANAMRRATATA
FT                   QHEAEKVAEKEREASRKAAEKAKAKAEKDAAKEAAKIVKAEAKAAEAKAKAEAKAEAKV
FT                   KAQTAVNTAAKALDFDSPQKTAGASRIKNKCVVLVGTLHGMSRADAKTAITAAGGHWRD
FT                   TITCKTELIVLGLSKPSALEKAEETAEQKQIDTITGNELLEEFRLAGVSDVKAPAKPAK
FT                   KKREDGEVQGVTRGGKTRRTSLPAA"
FT   CDS_pept        join(complement(747533..747915),complement(746236..747169))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637518"
FT                   /orf_name="MICPUN_101042"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64515.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B500"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H7"
FT                   /transl_table=1
FT                   /translation="MAVTRAKDSEIKAAFQKFDKDNSGSLEIGELYDVLREIGVEITKE
FT                   HFDGYSQIMMDDFDTDRSGALDYDEFTRFYEQVLVNESGKGQYKEMLELKEEGNTFFRS
FT                   GDYLKAAATYTKAIKAAADHGIENRTQTRVFDPRLTLTTDAVPSTTPRLTDSPNASSQE
FT                   SLKLAGPDQVPIVEQKIRLVKQRLHRHEREMHKNEKRNHGSKPPSPESKSPAPEKTAEE
FT                   IAAEKEAADKAAAEKEKQRAANEARMKKEKEEADAKAAKLAAEGAERAAKAEADAKAKA
FT                   EADAKAAAEAEKAAKAKAAADAKAAEKAKAEAEKAAKAEADAAAKAKKEAEAKAKKEAE
FT                   AAAKAAAEATAKAKKEADAKAKAEKAAEEKAKKEAEAARAKKAKAAAAAAQGGKPTGSS
FT                   GSSLLVLGVGFVLSVAVFALVFGGKKTAAAATKGVKGKK"
FT   CDS_pept        complement(748280..748930)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637519"
FT                   /orf_name="MICPUN_59379"
FT                   /product="Peptidyl-prolyl cis-trans isomerase "
FT                   /function="isomerase activity"
FT                   /protein_id="ACO64516.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniParc:UPI000199B501"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H8"
FT                   /transl_table=1
FT                   /translation="MTSIVALRAPVALRAAAATRKQRAPLAAKITAAAKPTVKAPMVVK
FT                   SVATKSSIARLASAATFLGSAQAAFASEVAQLAEGDDLIPTLAIFASLAAVLWSSQGAI
FT                   KGILAVLVGGEEATASHILVKDPSLAQSLLERLQDGPQDNLEDRFAREAGNYSECPSKS
FT                   KGGSLGTFKPGQMVKEFNDAVFNGPVGVIQGPVKTQFGYHLILVTDRVEPEKK"
FT   CDS_pept        join(749202..749430,749558..750456)
FT                   /codon_start=1
FT                   /gene_family="HOG000208487" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637520"
FT                   /orf_name="MICPUN_59380"
FT                   /product="Predicted protein"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO64154.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG318268"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI000199B502"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8H9"
FT                   /transl_table=1
FT                   /translation="MGRQGHKGREASIHAALDDFVTKLKRKRLGGSSLALARHTTEVLI
FT                   HAVAAQQAPTAEGIIEGVRAVSKKLVEARPLELVVGNMCRRVLHIIREEAAGDGGKASN
FT                   AASDANDASDGSDDEDNSVRGGAMKAFKAEVIEVIGELIDELESVNAHIVQQALEHVSP
FT                   SSVVLTSGGSDIVEAFLREANRKRKFQCIVAEGAPALAGHQMARALAERGVETTAVADA
FT                   SVFAMMSRTNLVVLSACGVFANGGILAPAGHHTVALAAKSHSVPVVFLAGLHELSPIGP
FT                   GDDAFHANDLRSPADVIDYTALADCGIGRNGSGIDRRSGAQAEGDVAQLCVANPAYDYV
FT                   PPELVTLVLTDVGGAVPAFVKQLLGEIYDPADRTF"
FT   CDS_pept        <751218..>751724
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637521"
FT                   /orf_name="MICPUN_73443"
FT                   /product="Predicted protein"
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="ACO64155.1"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI000199B503"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I0"
FT                   /transl_table=1
FT                   /translation="NCVGFVIPNYFEPDLVYKTMWLQDTPDEDISPVLYDCFDFIEEAT
FT                   VERGGRVLVHCSQGVSRSCSVVISYLMWRDGGSYEDTFAAVKEKRGIANPNMGFTCQML
FT                   QWAKRIGTEADRAPPHRLYRVAPHNEHDPTYLVAKPCTSCDTTQLDARGAYVVATSNRK
FT                   AFAWVG"
FT   CDS_pept        join(complement(753215..753481),complement(752916..753020))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637522"
FT                   /orf_name="MICPUN_108461"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64517.1"
FT                   /db_xref="HOGENOM:HBG561584"
FT                   /db_xref="UniParc:UPI000199B504"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I1"
FT                   /transl_table=1
FT                   /translation="MSAIAGSVSLSAAKARGLGFKQSAPMGARVAAAVPAQPRARTERG
FT                   ALKVVAGNDYEGGLFAPIVVVARNIIGVKRFNQIRGKAIALHSQVITDFCKEIGADGKV
FT                   RQNLIRTAKQNGGKLGFLA"
FT   CDS_pept        753912..755447
FT                   /codon_start=1
FT                   /gene_family="HOG000265423" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637523"
FT                   /orf_name="MICPUN_59383"
FT                   /product="Monovalent Cation:Proton antiporter-1 family "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64156.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561585"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI000199B505"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I2"
FT                   /transl_table=1
FT                   /translation="MDETGVKMSTMLDDGASTASIPSPTHWYDDPQRALGAELVEILTR
FT                   TPFVLVLAYYVGKAFAKARLPRISGYLVTGVVCGSHVLGILGRGATRRLAGLDNLCLAV
FT                   IGVAAGSELHLADLRRSPKPTLIMTAAITAFSWAFVFVTFCVVAPSSNLDFLDGLSVVH
FT                   VVAVGSLAATLSVARSPASAIAVLREMEGRGPFCSLVMSVTVVKDVLVVVMFAVNLELV
FT                   AAARLDFSAVGGGAGSGEGSGAGGGLGGEEGGVSSTAVAALVAFMHPVFSVATSVGLGV
FT                   VAGFALGQCLKPPRLRTLANRPALARAVRCVQTLALSASSFWAAKALGLEPLLLCVVAG
FT                   ALAANRQHVTGEEERERLDSVLRASMPLVNVVFFTLAGVGVHLTSVYKSSVVATLLVGA
FT                   RLLALYHAARIGCDAIGAPESHKNVAWMGYVTQAGVALGLVRTAAARFPQWGDEFGALM
FT                   VATIVMNQLVGPPMFRAAIVSVGESGVDPGPTPNRAATSELDKTLEVPVASEA"
FT   CDS_pept        join(complement(756135..756170),complement(755937..755990),
FT                   complement(755651..755749))
FT                   /codon_start=1
FT                   /gene_family="HOG000215187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637524"
FT                   /orf_name="MICPUN_59384"
FT                   /product="Predicted protein"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="ACO64518.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG318018"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="UniParc:UPI000199B506"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I3"
FT                   /transl_table=1
FT                   /translation="MVFEAFYKTFMSRSSVYVGVVIAGALVGEKVVNNGFDALWESRNK
FT                   GKLYKDIVGNFPPMEEE"
FT   CDS_pept        join(756576..756650,757116..758984)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637525"
FT                   /orf_name="MICPUN_101047"
FT                   /product="Predicted protein"
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="ACO64157.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI000199B5C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I4"
FT                   /transl_table=1
FT                   /translation="MASTLARLSKYAKGENTTSVLSHAKHIAVAVEKATNDDVVSPKEK
FT                   HVQTLLEVVRSGASVADVTFLVNYLNHQVTDCKRVTQMLKTHVLLHRLLLDSGEEFRTQ
FT                   IMKMHKWVVEDRNTDSTLKCLFSIRAWKDEANMEVSGWCRTYASYLDEFVSNWEDFSDF
FT                   ARINKNPQGDATQMRSLPADELVRKLPKAQLLMRRIIDCEAINESLTANEVVIAATRLL
FT                   FKDSFKWYHMCNDGVIRLIDLFFDMNKHHAAKALEMYKKATTQGDDLSRMYRNAEENWL
FT                   AFRSEKFPAVENPPGSFLQTMEEYVKNAPAEGKGPAPSPPRAAAPAPAPPPPAPVDPMS
FT                   DLLGGMSLNTPSPSQQAPAAATFDAFGSGDTFGANGGAGFTGGSAGFTGGSAGFTGGSA
FT                   GFTGGSAAQQTPSPTAAAPPGDIFSASPPAAVAAASASASPPQVDFDPFGTSAAAAAPI
FT                   PPPAAGAGGAPQGPPSVNPFGSDPFGAPEQPKPAVDLDSLYAQGTRSPPQQMGGMGMGM
FT                   QQPGMMQQPGMAMGMGMQQPGMGMGMGMQPGMGMQPGMAMQPGMGMQPGMAMQPGMGMQ
FT                   PGMGMQPGMGMQPGMGMQPGMAMQPGMMQQRYAASQMQPGMQQMGMQFTPPQFGKTSPK
FT                   NDGGAQGGGSLL"
FT   CDS_pept        759318..760604
FT                   /codon_start=1
FT                   /gene_family="HOG000230811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637526"
FT                   /orf_name="MICPUN_59386"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO64158.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561587"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199B5C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I5"
FT                   /transl_table=1
FT                   /translation="MNDAAPIKSTARLSPDARRVVLLCAVTMLLASADRTIFSLGSLAI
FT                   ARDLSLSMSTVGLLQSAFFWGYGVTQILGGVAADRFGGAKVLLAGLGLWSVGVAMIPAA
FT                   TLTPTPVAVIVAARVLFGAASGCVMPASAAAVALSVPAERRSSSLSLIFTFFNCGSAFG
FT                   LLLAGSLIQTVGWKAVFLAFGAVGVAWSAIGLATVPESAKKGKVRQSSSRGSEREGDDG
FT                   RPGGWLSLPGWMYPQLGALAWCHVCINWGFFILQSWLPVYLAKELGFSLGGSGLASALP
FT                   WFLTAACSFSSGQIADILVARGWERWKVRRLMMNIATVGPATALMLLPAARSPVVAVFL
FT                   LAVMLGTQAVSIAGYHSYLQDVLPSRAGSFLGMTNTLGVIAGIVANLFVGYVVETTGGF
FT                   RLVFLVTALVYASSGVVWNLSARGRVMFA"
FT   CDS_pept        complement(760749..761645)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637527"
FT                   /orf_name="MICPUN_59387"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64519.1"
FT                   /db_xref="UniParc:UPI000199B5C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I6"
FT                   /transl_table=1
FT                   /translation="MALNRGKVKNFVLGTRKIYKGWAHGYLGAVRSVRREMVRTVAAGV
FT                   KSTLGPSAVYACSMQVATSAMGLPSLVSVGAANVATPVIVSKLGGRLRRLSAHQVAARA
FT                   VPIAAHYLIEWDLYDKIKRRMDGSEGAIASLHPWVPTAHGRVTNAVHGAVSGGVCAFGA
FT                   TALTAVALSPYYGRRLISRAVRCADVPTAARLGTAALRVTRIRLADSLQQGVVWFATYE
FT                   AMRAATAKLEGSAGEEEGSVGVPARMSRTARGVLSPARLHTAYGVHLRTSRERRALSMA
FT                   RRQPARPHQRRALAAAC"
FT   CDS_pept        complement(762203..762622)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637528"
FT                   /orf_name="MICPUN_59388"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64520.1"
FT                   /db_xref="UniParc:UPI000199B5C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I7"
FT                   /transl_table=1
FT                   /translation="MPLMVAATSVSLKRWSGGETLVSAQYTHESHEASGSGLTQYLATA
FT                   LFGPKAPAPRSPCYSRACTVPQNMLLRPTAENRVKALTTCSSFSSICRLLHGWLFCGDF
FT                   SDSRNTSLFRCRFDRHGRFRQPAQLDLALVGRFAR"
FT   CDS_pept        join(complement(767850..767910),complement(763296..767632))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637529"
FT                   /orf_name="MICPUN_101049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64521.1"
FT                   /db_xref="InterPro:IPR013665"
FT                   /db_xref="UniParc:UPI000199B5C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I8"
FT                   /transl_table=1
FT                   /translation="MANGGDQDQWAKQAAKALFGGGGSRQRRMSLDDDDEPTANAPGRS
FT                   NAGLTMSPVRTADDDRGPGLQDGEVVAFAVDGLPYVVDVDNSRGGDAVRFGVSRLDDAR
FT                   SIADPATHLTVVKQGRYVGFASQMLGGKMLQARQRTAGGRLCFYNPNFGVNEQWETNDE
FT                   PEEPDWSSCEMRLKNRRLPSCILRVEVMRVPRSMRDPGDGFHNPVTTPRGIRAHPLADA
FT                   GGDVDSDSESDARSRELAFAARQLPDPTPAPHHAPSISPAGTSPRKHHGTAGVNPAGVN
FT                   ASRASVDTEVDQSVRRLVGYHELEIVEKNKPGTSSRPGSPARRLPPEVPGRWEGTKDEV
FT                   PVAPGSLRSQQTRSTRGGGGYGYGVGGGMTPGVSSGGRPPPGHRRDSAGEQSHALRSMS
FT                   GVLIKEWSAFVLKEVRARKEVERQMLELRDEMRGMADGFRAEIGETRAGWISDAQFYGA
FT                   KVREAYESQAAQREKVMQMAARTFFQRWLTKAWRKWVQVTEDRRRRRTAANRAMRRMYY
FT                   ARLAAPFATWREYAKKIARMRRALLLFDDRRGARTAVSTLRAWKHRSVFMKQRRRLAHQ
FT                   MRVDRVKSCARRALITWRMRSEVGGKSHEHVMRCIATRAVTRMKMRCVSNAFDAWAFHW
FT                   REQRRLKAAAERVIARWTRAAVADTFYSWVQVAKGKQRRRDKLSALVLRVLGRQLHSSF
FT                   MQWLQTVRKAKRDRHVVGVIGRRLNRDALSRAFTGWCQISGAQRSHRNRVLAFTRRTLT
FT                   RWAAQSATMAFERWRHQSTTMRVTRVKAERLVRTWRYRDVANAFEVWQTHTLAMLAARD
FT                   SAVLFAVRLMRGSAYKALNGWRDAVRERRRMRKKCDKLLRGWLNRNLSSAFRGWHATVV
FT                   RFKVHRARVRSFVWRMRYADATRSFRGWRDTTALLLRQRSVVANIHGMWTHKTLAAAFR
FT                   SWSQTARQSKDKLARAKKIVARMRSMKQSIAFVAWRDAVERLAKDRAVANKIVRRMMMV
FT                   KITASWYKWIDWIADRREWRAKEARAVRFATRRARDRVEAIWEAWFTEVKRLVVYRRRA
FT                   TKVVARIRNSVMTRSLNKWLDATNEIRRMRWIEQKGAAHFAKVLGSRIMRAWRSQSFVL
FT                   ARKTATAKKAARKMDVLRTRHWWKIWLSHVADNLHLAAAMRRAVKSWTKGQLGQAWRKW
FT                   LSHIDRARVAMRLARHQHQMRQAVYREKSSRVHFTLWKEWCREYRRLANLVQKAYVKSQ
FT                   RLYKQSVFNQWREFLAEIDRRKETVSRAVTSKRLLTSWFLDWYWQAFEGDISSALGLIT
FT                   GNTDAVIEQVYGEDRRVDRGVFQEWQRLGSSLDALAQPLERDANVKVAAAKFTDKIRRA
FT                   SVDRRGSIDGASLSSALSDDGSRGGFDSPGAGADESFRSADAGDSSFATPGGGSAVSSP
FT                   GFTGGKRLGGSILGGGGGATGTPGSVKSNKERALDRLLDSDSDGEEYTQSRRAFANAVS
FT                   VDSD"
FT   CDS_pept        768886..771315
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637530"
FT                   /orf_name="MICPUN_54445"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64159.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniParc:UPI000199B5C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8I9"
FT                   /transl_table=1
FT                   /translation="MVLATTQGPKAKLWFDAGFNSDGVSTDARYMQAFYFLGMPLAGYN
FT                   NPADRNEEQRVPGNELLLAASDALKERFNMKETWSKSSFQTEAVTTTADGGMKVYWWSL
FT                   PGQEDEWLTLSDKDLNWTVLSFLGVMAYVAYHTGSIIISATSMMMTVTSIFVAFFLFRV
FT                   VFQVSFFQFINFLIIFVVMGIGADDVFVFMDAFHQSIDELRAKNKPATLPHRIKHTMRR
FT                   ALHAIFVTSFTTSAAFCATALSPLIPLRSFGVFSALVIFCVFAINAVVLPPLTVLYIRN
FT                   LHGRGWIGSLKAMIQGVLPFTVFTLPAYEDPGLALPDDEDKAMAASTDPADKYNVKHMR
FT                   MTERFFYVRYFNFLNSPAKYVILAAFAGLFAGGVALWVSLEVPKEPEQWFPKSHMFQQY
FT                   QDMGSQKVMKGGSKAERLDVSLVWGLDGLNTKGTDPWIPSDLGEVTYDANFDPSTAAAQ
FT                   KHIMESYESLKTAPCTAKACSGGKLVDPVVTIRNILAETDASGAVVGGFYKYLNALGGA
FT                   YASSHPVNAPIVGDAFNVEMCKYSKLDATKVRYAGHVGYYVKDCDASPVPSATFILIEA
FT                   TSSIRMPQAPVDFTEAQEAWEDFGKSLDTGAPAELTGAEATSTNIFWLWSVTSISLMDN
FT                   VYLGLAVCFPMVFFVLSVSTGNVILAFYSTMTIAGIVTTVIGIGAGGLMGWDLGTTEAI
FT                   AAVIVIGFSVDYCVHLANAYIENDAVDRVSRTRIALTTMGISVTAGAITTIIAGAFLGL
FT                   CILTFFVKFSFLICWTIISSYIWAVIFFGALCITAGPSGKFGDISWLLAKMFPWCH"
FT   CDS_pept        join(complement(772178..>772581),
FT                   complement(<771406..771979))
FT                   /codon_start=1
FT                   /gene_family="HOG000029369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637531"
FT                   /orf_name="MICPUN_69490"
FT                   /product="Predicted protein"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="ACO64522.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG713936"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniParc:UPI000199B5C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J0"
FT                   /transl_table=1
FT                   /translation="LASLDLADEDTVRELLGRLPVGHVNERARLKTALEKNFARWWQLL
FT                   QSEFSLLLYGFGSKKELMEDFAGKMLTDGGVIVVNGYFPGLTPKQILAAAAAAVHPGVP
FT                   SRDLHGTNTETLLAMIAEATSAPHLLAQRTKHHHHPPKRLYIVLHNIDGQQLRSPEAQA
FT                   LLGELAAMPRVHLVASVDHVNAPLLWSKREAARFNFVWQEATTFAPYKYETAHVPQMLA
FT                   SKGEERHVRGAVNVLRSLTSNARDIFRLLAEHQLANPESGGMTFHAFYTRCREQFLATS
FT                   ETTLKSHLTEFVDHELTRTKRGSEGVDLVHIPFADDVIAQLLEQI"
FT   CDS_pept        773351..774442
FT                   /codon_start=1
FT                   /gene_family="HOG000265580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637532"
FT                   /orf_name="MICPUN_108462"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64160.1"
FT                   /db_xref="HOGENOM:HBG561593"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="UniParc:UPI000199B5C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J1"
FT                   /transl_table=1
FT                   /translation="MAACMASKMAVAPSRGALARKVSVKAARRTAIRVRAFAPAYDEVF
FT                   DGNTGQMEKVLSQSVESVSAGGLEWSYRVGVPEEGTEAKPTKVLMVHGAGLNSFTYNKL
FT                   SRELQKMGYTTFAPDMPGHGATSKPTSGFDYSAASYQSALEAFMTAAGIADVEDPVDMV
FT                   VSGFITSQAALLLAAANPGLFRRVIVMNTPLGPGHKLPDPLAVYTRPFGMGKGAQADVY
FT                   KLAYFGNEFAIPEETMAKYEAPYAGGDGEAARAALEATVTKNDLKALTSAVSKAWSVRG
FT                   LPKVRIVWGVNDKYLGDKDMYKWAEDVRATFDCIRSVGHMPQEDFPQEAAKFVGAYLES
FT                   ELKVSALGSVRLGKVTKDDDYQR"
FT   CDS_pept        join(774638..774717,774839..775019)
FT                   /codon_start=1
FT                   /gene_family="HOG000038164" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637533"
FT                   /orf_name="MICPUN_59393"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64161.1"
FT                   /db_xref="HOGENOM:HBG587877"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199B5C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J2"
FT                   /transl_table=1
FT                   /translation="MAAAELSAVYRAMQKSAARFSNYNVREYFKRRVREEFEKNANLVG
FT                   EEAAAALAKAKKDLAVIDRQVQVYSLYGSELRSVLEITRKP"
FT   CDS_pept        join(complement(778879..779905),complement(776111..778416),
FT                   complement(776034..776078))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637534"
FT                   /orf_name="MICPUN_101053"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64523.1"
FT                   /db_xref="UniParc:UPI000199B5CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J3"
FT                   /transl_table=1
FT                   /translation="MNSSSDRLALAGHSLRSVSASVKMRHGLALPPEPGIPASSHGSGV
FT                   PVLKSSHLLSIRIPPASNAPCAALLTTFRNGSDGVAGGLGPTGSHSCDHSASAAGRDPL
FT                   AYSAAASAALASQNWPPRPATGDGPLSSRANAFAANPTSPAPHRAIAALKSSRCATVGG
FT                   PPRKPARSAVVGTSMPPFSATPAAPPAASARLLASTAAGQSARAPSARLLPSCASARVN
FT                   APARSRLPGPEDSSASSRMSVASAYARSASVHRESPPRHVALEYIQFPPVGVASSPDRL
FT                   ASRTTSSQTSSAISASGSCDARDARLDASDARAGRAGMGMDAPTPAARNSARLPDDNDR
FT                   PSEAPLEMAFRNALPPREQALAELAMCDPADLSKVQKLRVIHSRCAQAGVLTGASVSSA
FT                   SATAHAASAAGDGASDVAKLHQLFDAAVANGMPQLVCHYVDEVCGHDDFSSPDGVEAYL
FT                   QDGEMVAEWAASSLRSAEQALDQAAALRTQGAADEVDRAGAVFEALRDVLVALGADPAA
FT                   GGDSAEAADAATSTQLAQLSADGSPGFQRRLQVAHDDAARRMQHAAALSWALREGLVAG
FT                   AAASQDRYGGPAQWASEVTVRRAAAAAAAAAADLPPDADGGGLFLDDLLAGVGVHAPPY
FT                   PFKSATEAAERVFRHGSAAPAALVAKQSLFLYYLLDAGLPPDGAPARFASHVRLHPRLF
FT                   VETRCAALLDDHSRGSSLELACALLPGASHPGLPLRFVATLAARGKPADALAVARARRS
FT                   DVAAGFKGRNLTHSNGTVGVGGTGDASTGGADGYVTDATVEAELGVAVRLECGLATEAF
FT                   VCARDAVAAAPHASRRAVADKLVARLASHAAARGALESVLDLPFDGELEPALMSWLDSN
FT                   AGTAAGAAEHLGVVYYLTRGRTTEAAARAAALAGGARALPADALAALEAAVRSMPESMQ
FT                   RLHLVGAAEARDEAGGGKRALARGLVVQPATPMDFAKTPAGAILPSEKSPSAGGVLRAM
FT                   GGALAEGEPKSAGGHVPFFAAPLAASAAAANTLGEAGLDSGLDAGVSEDGAIDASPGPL
FT                   ARAADETGRPGRAATGGGGDAWTALDLRGDGDGEDEAMDVDADDGDDAGDGSDGSDGSD
FT                   EGFRGARRVEGPRARGGV"
FT   CDS_pept        join(780219..780275,780407..780504,780609..782985)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637535"
FT                   /orf_name="MICPUN_59396"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64162.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI000199B687"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J4"
FT                   /transl_table=1
FT                   /translation="MVVIEDDSVRMDAVCQPLQYHPGATVTKVVGTSNFPPSFAAVGYA
FT                   PCFKGFGPVPGGKAENNPDVAFVKRAEVQPDAGAIHGAFQHVAIFKNILVAADGCKSAK
FT                   LRVFDVRDWSEKQVIRVGAVSEATTGDSSGAGGPAPAAVTSLVFDGTTIACGTAEGHAH
FT                   TWRLAEHEGKRGYVRLLHPLRVDSQPVTRLSLASEANLLTAYSPTKRTLVVWSLETGKL
FT                   HAAYSVDGVAKGTPLRFTAHVESVIACVHAFGDGDDPDGGKGVLAALLDVKTGEGGAVK
FT                   GAREVTEGEGEPRCLTFDGELLCVGTSGGAVIAWNVGEAYAPWKGYHGGEVGCVANVPG
FT                   DAARIVSGGADGRIILWDGEGKAQARMEVGSPVTAIHAPSPRLALAGTEDGAVHVVALC
FT                   DGETDADEALTAELRGGKRRSNELARYSFKFDAKGASPGCESFEAFTRTFRIEEGAYTA
FT                   PPAEKEDTKKSRADEARDKKVAEAMMKGVGETEEERKKREDEEEAAKHRAMDGAGVARD
FT                   PNIKSSTEGLRRCSNPRCVEREDTIAGKMLRCSRCKAACYCSSHCQRTHWRDGHRESCK
FT                   PPGAAAPELTEEAAKDAPAPPSPAPQRRQLVIEDDSEDESSEEEEEEEKEEEKEEEKEE
FT                   KKEEEEEEEDKEEEKEEEEEDKVEENEPTARDEKEAEPELEKDESPFDETEEPLVVRPG
FT                   LPPLDEIFADLDLDPDELAQLNNMNDMNDMDESLDDFDDFDDFDVIRAGDERTRAMDDE
FT                   LFEDLDDDDIDEEDMEEFQKAMDMPALPPWMTTHRPGAQQSVTAPSDTGGVEEPSASAS
FT                   KPGSNPSPAVEKEEAPEVAEDSDDDPLYDLD"
FT   CDS_pept        <783479..>784180
FT                   /codon_start=1
FT                   /gene_family="HOG000198145" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637536"
FT                   /orf_name="MICPUN_76111"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO64163.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG745256"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000199B688"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J5"
FT                   /transl_table=1
FT                   /translation="FPYLHDSFCFDGKECTTEGLTRAFEPQVSEERIARLDAVVQQRSF
FT                   DLMPILEGVYDIGNVLAVCRSTEALGIGSLGVISDAGLAFKQSGRTSGGAVKWTNLEQW
FT                   RSTEEAIREVKARGYRVLTTVFEGGHPLEHYDWTVPTAVILGNERDGVSDEAKRLADGG
FT                   VYISMNGFTESLNVSVASSMIMHHAVQDRTRRLGSHGNLSEREKETLRAVYLARLVPRY
FT                   QKHGYLRQLLER"
FT   CDS_pept        join(complement(792010..792732),complement(791764..791873),
FT                   complement(784459..791617))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637537"
FT                   /orf_name="MICPUN_105736"
FT                   /product="JmjN/JmjC protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64524.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG607737"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR004198"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B689"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J6"
FT                   /transl_table=1
FT                   /translation="MGKKYRLSALKEAPVYHPTEDEFADPLRYIASIRAEAEEFGICRI
FT                   VPPSSFKVPFNQDAASFAFKTRVQTVNELQLRLKKGKNRSFRTEYADFMQSRGQSVTRW
FT                   PVYGGKKLDLQALYDNVTQRGGFDAVCRAKGWRDMARVMDTPATVTSAAMALRALYQKW
FT                   LLDFEQHKARQENLSPAGKAKEAAQTKKEQERLAREEKSKELKDRARRDSIGVEEDLIE
FT                   ALFELGNAAAPPPRAKLEMGLEEVAQQLEEQPAGCVNCGGTSHEESMILCDGCDRGYHM
FT                   YCLSPPLDELPQGDWFCPDCIAAANDAEDIGFNSGKTFTIEQFKEECARFDAQFFGQDE
FT                   PVSIPDIEEAFWKMVEEGSGKSVDVYYGADLDTSVHGSAFPRTWDADHGPGKRPDEHNA
FT                   AAEHPWNLNNLPSAEGEHPSLLRQVNDHIPGVIVPWLYVGSTFSSFCWHFEDHMLYSVN
FT                   YNHVGAAKTWYGVPGAAADAFEECFKQAMPDLFAAQPDLLLQLVTMLSPSLLVSEGVPV
FT                   YRTDQHAGEFVVTFPKSYHGGFNTGFNVAEAVNFAPPDWLRFGYDGVERYRLYRKPSVL
FT                   CHDELLCVAAADSPSEETARWLIGDLRRLTNEERGAREQLLTDGVVRTRRYTPRKLAAA
FT                   AMTAKNAQDARASAGIKSESDGASPEADAAATATRAAMDAALDPLDDAESLLPTSNANG
FT                   AYDRECTICRFILHLSGVACSCNPDRAACLRHSAELCECPNSHRVMFYRKSIAQLERLC
FT                   SSTERACGKRAKVSEKEKAYGAAKLRQKRAAAWVKRAKEALEQKSPPTPTTDLEAIMIA
FT                   AEEFTWAGTDMDDVRKMAANVSIAIAFQKELAILKRRINLGEDETVDGRTGWEEPELDD
FT                   ADIVVAAAAGAPLRRRRGGKYGKEETPTPEATTKKEPAEVKAEVKAEDGVQDAMDVDAK
FT                   DANPKPNKDGKTGGVAPPRRMSLNRLRQLLDAAPFPLPAEEEEMFRRVLAAGEDLESRV
FT                   VATLAETPNPNPKKCISLAAEVARGPIEVTSARRLKEAVAAAHAWSERVRRALPGRRHR
FT                   PARSELPTLDQLAELKAGAVNLPVQPNDLDSVDSAVEETQAWSTKAQTLMERVPAAEID
FT                   DAEALLEEGLDLPCQCPRVELLEAACERAKQWVEVTIKADEQNAKLERLRSLLEEGESM
FT                   AVCPVTDLAALRERIRVREWADPAKLVAAGKPDPISLDEIRAVVAAGAAIIEGVKTPDK
FT                   APEPPAPTAKGGKKGKKGGGGGKKAPTTDAESDAAAPPAVPPPVDEDHVTDQERALLDR
FT                   LRQNVANGEAWEKRAAAMHADAEVGNLKPLEDVEKLVKEAQAIPCALALFDVLYDASNS
FT                   ARSWVEKAQQCLKGKQLTRRGAAAPPPTLAHAERLVRDANKFFVQVKELQALTERVAEA
FT                   KEWGDRAEKAVERWKEEGAEQTFTELMLDHERFGLELPAAADVRACLAALEWEREVRDA
FT                   LSMPAAAADAKDKKKSLSKSADSSPASKKPGGSEPLPQLEILEDLRERAKDINTDDMEE
FT                   ELRDELARRLEKIDEWSEKVDSAMGLNDRVATKQKPASVLQAAANAEKRPTPEVIQELV
FT                   EQGKKLPAIVPRVTELETILDEHRRWVEAARKLLGPPKPKPSAEQLAEEAAAAAATQAA
FT                   DQAAADEESATAAAKAAEAAAEAERLRKSKKKGKKGSKHVTRKESPAAAGAVKDEEAAA
FT                   EAREVARMAAAATRVAAAVNQRLAAAKDKVDDRPAMADVLEMQSTGEGLPLKSEEGVEL
FT                   AAAAAAMTAWSERLRKLLIRPRSSAGVHAIAVDDSITALKLVVQSIRAATADLEGTGEP
FT                   PESEEGQFCLCRQPGGREMLGCDVCGDWYHLRCAGVTATFARNAQKYTCLACQAAAGDV
FT                   LKLNNPKEVYKHIHRTRRPALVNLGEMLLEAMDFAGKLPEEDLLAEVFAEHAAWRAAVA
FT                   DALERRSTLAPLEKEARETADKANKAADAYMELRGAREARTRAVAERAAAVQHAQVLAG
FT                   ATAMAAALLGAGGGGTHNAAMEAAQRMAHLPPDQQLEALGQQVGQAAAIKQQQLMQLKG
FT                   AVTAAAAAGLAGGNADEATVAKAAESAAPFEAMLVAQLQEIGTFVHQLATCQQSIQQQI
FT                   AAAPRAAPGSQEAATQQYQVMIQVMMMQQHFLTLSKQHDMQLDALGSGLMEQQRVAAAA
FT                   AAAAVEQDEEDDSQAGDEPPAEAAPKEEADTATKADTAIEEEKPEADAEIAEAAPEDAK
FT                   VEAEEEPKKEEEPEVKAEEAALLATNEDVPKSKSPTPPAPDPPQAPKPRRKKPPEQPSE
FT                   EEKELETVAMELAKIAQAAAERLAAVTGPGNPLRQIFAGLKGALAMEIDPNPLEPELPS
FT                   LLREVCGAAWRERANAALAEKVGSAADAADADDVSKFPTLAVLTELRETGVAAGVIIPG
FT                   KTAEVPGPDPLGDRVQETEAKGQAWLDRAADAVDGSKNVPVEEVVKLMDEGRALPINLK
FT                   DELEELGERCEVYCLCKTPYDALRPMISCDKCEGWFHYDCCGMAPPTEEEPEDPDIHFT
FT                   CPPCCKSNGSKYKPFRPLPVKKQRESSSEEQGDEKADAEAIVERSEEDIDAVAEALTLG
FT                   LPISAKEEAKEEAKEEAKEEPEPEAEPMETDEKPPPEAEAAATPVADTKPPKEEVTVEE
FT                   EKKEAPPEEPARGGRTTRRSRR"
FT   CDS_pept        793167..794198
FT                   /codon_start=1
FT                   /gene_family="HOG000208822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637538"
FT                   /orf_name="MICPUN_82557"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64164.1"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B68A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J7"
FT                   /transl_table=1
FT                   /translation="MADLGLELSSPPTDGVTSLRFGDDSGLLLATSWDAGVRLYDADPV
FT                   SGSSTLRQHFTTPGPVFDACFAAGGDTAIVSGGLGKSVVRHDLTSGADDVVGTHGAAVK
FT                   CVEWDHETGLILSGGWDGRLKCWDARLPEERRCIADVELPGKVYSMSLTGSGSPTRRLV
FT                   VAMAGRAVHVYTPMGLTMSGAPEQARESPMGHQSRCVRWLPDGTGFALASVEGRVAWEY
FT                   LDLTPAAQEKKYAFKCHRVRDAGVETIHPVHAVAFHPWGTFATGGGDGVVNVWDGAHKK
FT                   RLYQYPKYATSIAALAFNADGDKLAVAASYVGESGDAPAPRDAVYVRKVEPGEVTPKSG
FT                   VPK"
FT   CDS_pept        complement(794267..795208)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637539"
FT                   /gene_name="HPF_5"
FT                   /orf_name="MICPUN_59400"
FT                   /product="Cysteine-rich protein with zinc finger "
FT                   /protein_id="ACO64525.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B68B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J8"
FT                   /transl_table=1
FT                   /translation="MMDARPVNVGLGSAPAQRGVKRQRDWSDKPTPKSGFCEHGRRRSR
FT                   CKECGGSAICEHGRQRAQCKECGGSAICEHGRQRSHCKECGGASICEHGRRRSQCKECG
FT                   GSQICEHGRHRSQCKECGGSQICEHGRRRSVCKECGGSEICEHGRQRAQCKECGGASIC
FT                   EHGRVRSRCKECGGASVCEHGRQRRYCKECGGASICEHGRQRAQCKQCGGSAICEHGRQ
FT                   RSHCKECGGASVCEHGRRRSQCKECGGSQICEHGRHRSQCKDCGGSAICKHGRRRSVCK
FT                   DCGGSAICEHGRQRSRCKECHGSSVPIGSWVF"
FT   CDS_pept        join(795637..796383,796456..796656,796768..797334,
FT                   797419..797895)
FT                   /codon_start=1
FT                   /gene_family="HOG000265460" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637540"
FT                   /orf_name="MICPUN_82571"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64165.1"
FT                   /db_xref="HOGENOM:HBG635182"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR008616"
FT                   /db_xref="UniParc:UPI000199B68C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8J9"
FT                   /transl_table=1
FT                   /translation="MRRAATAPRLRATDRPTHHRRLHPASTAAVATRADAAEPSPTGTT
FT                   GAPAPRAKGVKLPAFDYTALVASVCEVRALGVPTKVELAAQADAYTLVLGLRGIDGNVA
FT                   LHVSWHPDAARVCLGPPPPRIHKTEQLSFGEQCHALLRNLVLTRAALPEPWERVATFSF
FT                   ADRPGDEPRFTLHCEVMGRNSNAVLVDDATGKIAACAYQVGAAQTSVRPLSPGFEYRPP
FT                   PPAPGVAPNDAPALAEWRDIVTRAAALPTPGVEKGMVRAFRGVSPALAATLLAGSGANV
FT                   GSSDPSPSALTDDAWRALHEEWRRWVDALTGAVDAPADPIGAGLTPLSAASRAADPAGA
FT                   GGPVGALFAEVYGGAGDADVFRREKDRLLQAVGAAVKKNRQKVNSFRKQIAEAEAHEDV
FT                   KTRADEIMAYQHGYQQGASALTVYDFETGEAKEIPIDALKGPVAAAEALYKKARKQRRT
FT                   AGAVEPLLEAASREAEYLEQVEFSLRELTGQGGKDDVLALEEIDAELGKRGATPSKPKK
FT                   KGGRDDPMINIRRYVAPSGKEVLVGRNSRGNEAVSLSIGKDQDVWFHVRGAPGAHVILR
FT                   QQPGQEASDEDLQYAADLAAFHSKLRTGGKVDVSFTSPKFVRKPSGGRLGMVTIDKERV
FT                   MLGMPDASEAAAEEERDRAAGKKTASSW"
FT   CDS_pept        <798307..>799740
FT                   /codon_start=1
FT                   /gene_family="HOG000016456" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637541"
FT                   /orf_name="MICPUN_67761"
FT                   /product="DNA photolyase"
FT                   /function="deoxyribodipyrimidine photo-lyase activity "
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO64166.1"
FT                   /db_xref="GO:0003904"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG286981"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR008148"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199B68D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K0"
FT                   /transl_table=1
FT                   /translation="PRRVRSLRGGDVPVGEGPVVYWMSRDQRAMDNWALCHALAVAREH
FT                   RRPLHVVFALVPEFANAGARQYCFMLRGLRELESRLRDLGIPFHLAQGPDPGVSVPAAA
FT                   ERLGCSMLVTDFSPLRIGRAWRDSVTTLLCPVDVPVAEVDAHNVVPAWVASEKQEYAAR
FT                   TIRKKINGRLTDFLTDFPTVEDVREAATEAAAGAEKHPVRSAGSIDWDGLIDAARAGAG
FT                   GAVPEVLSPSPPRSRAPGETAALAALFGTSASFLPNRLALYGSRNDPNVPEALSGLSPY
FT                   LHFGQLSAQRCAVEATKHRAKHPEAVDSFLEELIVRRELADNFCLHNPHYDSIAGAPGW
FT                   ARESLALHASDAREFAYTLEELEHSRTHDELWNAAQKELTHLGTMHGFLRMYWAKKILE
FT                   WTGEGPEEALRRAIYLNDRYQLDGRDPNGYVGCMWAICGVHDQGWKERDVFGKVRYMNY
FT                   AGCKRKFKIAEYVERVEREV"
FT   CDS_pept        800503..802644
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637542"
FT                   /orf_name="MICPUN_59403"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64167.1"
FT                   /db_xref="UniParc:UPI000199B68E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K1"
FT                   /transl_table=1
FT                   /translation="MRGRASLLAIVVASLLATASAQPKPERPSGGGPGGGGAGAGDKKP
FT                   PGSRPGAPPAEGKPPSRPGSGGSLAAGGKLAFDSATGKLKGTWAGAIIPSYRAPMAAPL
FT                   LGTVGYGTDSKLIYGPFEAGFGAGPTSTSASDARPPYPCKDGSTYSGYCPGGMDVKTCE
FT                   ETLFKTCASGTVRTELFMDECGGHANPYHYHMDPVCLYKPDDPGHSGVVGVMLDGRPLY
FT                   GRHETTGTAPADLDPCGGHTGTVPAYDSWGIPEGAKIYHYHARTKPPFLLGCYGDETTS
FT                   SLQHCRRLYQSGTRKCGDGAGVTMSGSVELEYDLWCPCYDSDGKQADGDSDDDKGGVVA
FT                   APGLPASPPRPPGLPDGYDTWEEYKKEQDRKAEHAKRDAEKKKEAEEKKKKEAEEKKKE
FT                   AEDKKKEAEEKKKQAEEKRKKLEEKKKEAEEKRKKLEEERKEAKAKRDAMLAKIADAKA
FT                   ARRAKVLADAAIAGKNATRVKFKKPAPNATAACDLAFAAMPSVNSSKAFCNATETSASS
FT                   GRRRRILNTEYDVTIEVNPEEVNVTAAVTELQSGGITPTTTQVDPLVALASVDGVDSGD
FT                   LTALKTEVAGAAEVQAEVAAIEDQVDSTEAEVSDAEAEVKDAEAEADGLQAEADELQAE
FT                   ADELKAEAEYADQVADEEKKKADAAADTVSALPPRSDDEADVDIITTTKPKGGAAGLAG
FT                   LFTALVATAAALVSVGQIG"
FT   CDS_pept        join(complement(803901..805505),complement(803521..803729),
FT                   complement(802749..803382))
FT                   /codon_start=1
FT                   /gene_family="HOG000007936" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637543"
FT                   /orf_name="MICPUN_82791"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64526.1"
FT                   /db_xref="HOGENOM:HBG358291"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B748"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K2"
FT                   /transl_table=1
FT                   /translation="MDEAAVASAEAEAEAAAAAKAAEAEREAAELTREDRRKILLSLPA
FT                   VLVGSKRTVRGQVKVSRAAVSFIADRDQDDDRNGEESASTAEGSEKSKKRFWRWPIARV
FT                   DEVHHARYRLQHVAVEIFLIDRRSAFLAFQDKRSARDAAMRIATCRPGITLMDRRRKLA
FT                   AAQRAQERWCRRELSTFDYLMSLNTLAGRTRNDLTQYPVFPWVLSDYTSDSIDLNDPQV
FT                   FRDLAKPVGALHEPRLKQFIERYQLLAEDPDSLTPPFHYGSHYSSAAIVLFFLIRLQPF
FT                   TGLARSLQGGRFDHADRLFASVDRCWRACLESTADVKELIPEFYSLPEFLANSSGFNLG
FT                   ATQQGASVGDVALPPWADGSPHEFIRVMREALESETVSARMHLWIDLVFGHAQRGDESV
FT                   KRRNVFHPLTYEGSVDLDAVKDPDARAAAESQIVNFGQTPAQLFRKPHPRRAPPPSPLP
FT                   PIRHSPHSVALTSVTAPPRFPPNAPASPVAFVSVEGSDLASVGGGNLFGQSANVPGLPS
FT                   GVKVVTASVDCAVGSHRFRRVAPFAAEAVVGSQHFATLAGGKILLSCGHWDHGLRVLSV
FT                   EDSRELQIATGHRDLVTCISTTAGRVGRAGSRDTTVAVWEVTPPPDGWGGAHPSFSRGG
FT                   GLGQRPRRILFGHADGVTCVAASAELDLVASGGADGAVLLHTLRQGRHLRTLRDAGSDA
FT                   GVPSWLCFLEAPVAAVLVYDGDQLTLSTHGINSPSDAPPLATANATERLHALTLSPDGR
FT                   FLVTGGEKGAVVVRNCHDLRVCARYDGPGPAVTALRTTPEECIVGGLADGRIAVWAPGV
FT                   AGA"
FT   CDS_pept        join(complement(815008..815026),complement(813439..814826))
FT                   /codon_start=1
FT                   /gene_family="HOG000153773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637544"
FT                   /orf_name="MICPUN_91087"
FT                   /product="Predicted protein"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64527.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG400967"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR014028"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="UniParc:UPI000199B749"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K3"
FT                   /transl_table=1
FT                   /translation="MVKITTICCIGAGYVGGPTMAMIALKCPHIKVTVVDISQPRIDAW
FT                   NSDELPIYEPGLDEVVKACRGKNLFFSTDVAGAIRESQMIFVSVNTPTKKTGLGSGKAA
FT                   DLTYWESAARTIAAESKDNKIIVEKSTVPVRTAEAIEKVLKRNCSDASVQFDILSNPEF
FT                   LAEGTAISDLTAPDRVLIGGKIENEAGQAAVDALAEVYANWVPKNQIITANLWSAELSK
FT                   LAANAFLAQRISSINAMSALCEATGADVAQVAHSIGTDSRIGPKFLNASVGFGGSCFQK
FT                   DILNLAYICECHGLKEVADYWYSVVGMNDYQKSRFVRRVVSAMFNTIRNKKIAMLGFAF
FT                   KKDTGDTRETPAIDVGKGLIEDGAQLAIYDPQVKEDQIAYDMEGMMGNITCYKTAKEAL
FT                   QDAHAVTIMTEWDEFKSYDWKEIYDVMQKPAFVFDGRLILDHDHLREIGFIVYALGKPI
FT                   DPFIKSAEGA"
FT   CDS_pept        complement(815446..816309)
FT                   /codon_start=1
FT                   /gene_family="HOG000100081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637545"
FT                   /orf_name="MICPUN_105738"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64528.1"
FT                   /db_xref="HOGENOM:HBG561598"
FT                   /db_xref="UniParc:UPI000199B74A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K4"
FT                   /transl_table=1
FT                   /translation="MWTEQIWAGHWIKEGLTSVGKCFAKQEPGKYHNQHRRRRHVMSCA
FT                   ASVVRCGATRAQIGVSLLSRRVDANRVAIRPVRAKAVPTGADVENGTIDLVVSTEEARR
FT                   TLQFDKVILDEREGPVIFVTGVAIGSAAEAAGVTPGQRLVAVSDPVNDGELWFIDGTER
FT                   LAFVNDAIRSTRAYECTVVVESEVSVTKAAVDAVRGPPSDEERERDEQRRRNAAKADLG
FT                   VPPAPPQKKREREDLYSDNWAGDEYTGGTWNELTVGIAIFVAVPALILTLGVTTRGVLW
FT                   DTGGFF"
FT   CDS_pept        816588..818789
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637546"
FT                   /gene_name="AMI6"
FT                   /orf_name="MICPUN_59406"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="carbohydrate binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64168.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199B74B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K5"
FT                   /transl_table=1
FT                   /translation="MAALSTTGPAAVARPARSLSLTTRRSTHARAPAGRARTVQVQAQV
FT                   RIQFELEGASPDVRVIGNHPALGNWDPAQGLRNGDYITLEDPGAMRLEYKWHNGSEYEM
FT                   GGNRMVVLPDAADRDVTLALAVVDRLRAVPDVVYQPPVVQQQQAPPPNVPTVEPVYKGQ
FT                   PAQYAGQSGYDGYQAPVNITYHDHHDPYYDDHDHDNDNDVIDHSYGSYQAPAAYQAPPV
FT                   HEAPAYEAPTRSYHDEASPGASIDDGAKRMQFVPVSAAGPDAGDRKPDGSGPPRWFREG
FT                   VVYSIQTLGFCGCEGPPGSFSEGERLMKLLNEGWIEHLARLGCTVLYLGPLMRASHDLG
FT                   HGYDTADYFQLDPRLGTVETLRAVVDACHLLGIRVIVDGVFNHTGRDHFAAQDVVRNGR
FT                   SSQYWDWYRGARELPGGGAEIPGWEGHAGLPQLNHQNPDVRRHITDCGRFWMSSEGANI
FT                   DGWRLDVAHEVAPEFWREFSAACRDAKPDCVLLGELMHGDYNTHVGPGLLDSGTNYQLS
FT                   KALWSSLNDHNYWELAHSYGRDKDMYGALTMLNFLGNHDQMRIHSRLNNPSAHYPLAAA
FT                   SMILGRGVPCLYYGDELGEQGKPGGPEGDLAMRRAIDLRDALANQSAKDVARRTAELVA
FT                   LRRSHEALRDADADQVPLAHTNETMAFARVAHGGASAVVAFNNSDNSQRMTLPVGEKIG
FT                   AHDGCEFEEPLANGQRLHVSGGQLHVELPPNGLRVFLRV"
FT   CDS_pept        complement(<819203..>819914)
FT                   /codon_start=1
FT                   /gene_family="HOG000264501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637547"
FT                   /orf_name="MICPUN_71325"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64529.1"
FT                   /db_xref="HOGENOM:HBG608640"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="UniParc:UPI000199B74C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K6"
FT                   /transl_table=1
FT                   /translation="ALIEDGRVFSEIFPVRFDEVGPDKACTMRTVASMMQECACNHIQA
FT                   MWGKGQSSPAEMRSNNQAFVCTQMHIEVHEYPRWGDEVEVKTWVEVERSVSARRDFELV
FT                   LCDGPEGTCRAVGAATSRWVAFDVAKRRMVRIPKKTTEDVTNYHALLNNYIMGEDYVMP
FT                   KLLDVRNTNLPLSQPKAFTGDRLDLDMNGHVNNVVYTEWILESVPVDMWTDYQLCELDI
FT                   EFKSECGYGDVIAAV"
FT   CDS_pept        820804..821961
FT                   /codon_start=1
FT                   /gene_family="HOG000024493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637548"
FT                   /orf_name="MICPUN_97570"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64169.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG335295"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniParc:UPI000199B74D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K7"
FT                   /transl_table=1
FT                   /translation="MARGVSASKEDVHAAIANVDKGLFPKAFCKVVPDLLTGDEEYCTC
FT                   MHADGAGTKSSLAYMYWKETGDLSVWRGIAQDAVIMNTDDLLCIGCVDNILLSSTIGRN
FT                   KSLIPGEVLKALISGTEDVLATMRDNGVGIISTGGETADVGDLVRTVIVDSTVTARMKR
FT                   SDVISNDGIRAGDVVVGLASYGKATYETEYNGGMGSNGLTSARHDVFHKALAAKYPESF
FT                   DASVPSDLVYSGKYALTDVEPETGLTVGKLVLSPTRTYAPVVKKLLDSMDRSDIHGMVH
FT                   CSGGAQSKVGHFLVDGLHVIKDNMLPVPPLFRLINECSGTEWSEMYKVFNCGHRMEVYV
FT                   SPENAEKVIEVSKSFNIDAQVVGRVEAIEGKSKVTVKSEYGEFTY"
FT   CDS_pept        822169..823401
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637549"
FT                   /orf_name="MICPUN_59409"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64170.1"
FT                   /db_xref="InterPro:IPR013893"
FT                   /db_xref="UniParc:UPI000199B74E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K8"
FT                   /transl_table=1
FT                   /translation="MGIRVRASAFAHPKSPHVAALDERHFVSALQLVLPRGGGDAGDGA
FT                   SATEGFADVSDALRRRGAGGGVDGATSLVGPAPDGDDFRVARMTLAQLVDDAFLAQHVR
FT                   PESGARFFACPLDGRLDADDVVAITPSGHLRASFTPSTHARAGVTGAKTDRGTLKHEAS
FT                   VHLAKKEFVPGEPFRDRLVACLARLDEEGDGRGVGWYACACERATDGEPLAVRFPPGVE
FT                   SEGRRITHSRRLVRRGGEDDGDGEGPPAPPVEFFRRDRGDEACAMDADGDGDGDEKSAP
FT                   GDGDDGDDCGDVATRLAGFHEWIGAVAAGVGREAWVGTAGDQEAWVGTAGDDVVAEAHR
FT                   WEGLLTPRMVRSAVEFCADAVDSGRYPWAAVTSWGFPEDPTRAPGASGCGELTFAVTPG
FT                   GRYLLFADSSS"
FT   CDS_pept        join(complement(824509..826752),complement(823597..824475))
FT                   /codon_start=1
FT                   /gene_family="HOG000205147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637550"
FT                   /orf_name="MICPUN_59410"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO64530.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG315458"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI000199B74F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8K9"
FT                   /transl_table=1
FT                   /translation="MGGRYNNKKRKGGGGDDRILKRDFKKGKRENVWDPKKSRVPDAKG
FT                   EYKPYCKENEKFEEYYKGQRIVPEDEWDAFMESLRTPLPTSFRINGTGKFALDIRDQIE
FT                   NKLFAKVNEGDQSIDEEGNVVEPPRAVRWYPDRLAWQFNYSRQQLRRLPFLESIHDFVK
FT                   RANEYGSITRQETVSMIPAFFLNITPDHRVLDMCAAPGSKTFQLLEMLHGSLGEEKEKL
FT                   PTGFVIANDVDLKRCNLLTHQTKRANSPGLLVTNHEAQHFPDIVSRGGRTFQFDAILCD
FT                   VPCSGDGTMRKAPDIWPRWSVGNGNGLHPLQLKIAVRAAQLLKIGGRLVYSTCTFNPIE
FT                   DEAVVAALLQQSEGSLKLLDMSDQLPKLVRSPGIHTWEVHTKAGKANSFEEAQEVAKVH
FT                   PTMFPDPSYAKLPLERCMRILPHQDDTGGFFIAVFEKVAEMPASLNPGPKKLKGPITIK
FT                   TDLNVVKDSVKVELTLVNTHELRAEREAIAANGGAPLEPEAELLLTEVRGGGTRNRQGG
FT                   GSQFGGLDPILPVSDTKVIHSIRDTYGIDLAKLPLDKNAVTRTADNTRPKRIYALTDGL
FT                   REYLAADHREQLKVIAAGLKVFERQEHKDATASEGACDYRLVQDGLHVMLPFVNRQIIH
FT                   PTIDELRLILQRRSLQLPGAEDPEKPDRAKFMDDATKAEVNAAVSGSCVFVPRISAADA
FT                   SALPAGCSPEEIAIACWKGKSSVNLLVSKVETDHLLEKLGMDVNKNGPKGGGMDTTSQT
FT                   RKTRLATPRPWSEGARAEGALASLAGIAAVAEEGTGLDDAAKREAPAAAAQMHMPPGYP
FT                   GMPPFFGMPPNPAAAAAAAAAAGMPFPPFPFPPIGQPGDGTNPPPMNPFPPCPPGVDPM
FT                   LYAQHMGAAASAAAVSASAAGPLGSSAAAAEFVSKFYSVLQGAVQHQQETFGRVGAAST
FT                   SAERRAEAIARFLKKRKERNFEKKVRYASRKRLAEARPRVRGQFVRLKEGEEVDDHDEH
FT                   EAEEKQGSGGDDVSHEGEDGSGGGSNNGGSGSGSKENSASPTRHASTQDED"
FT   CDS_pept        join(827031..827309,827492..827794)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637551"
FT                   /orf_name="MICPUN_59411"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64171.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199B750"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L0"
FT                   /transl_table=1
FT                   /translation="MGDYDRGGWGNQGGFNQGGFNQGGGFNDRGGDRGDSYGGAWGGGR
FT                   GGGGSRGGGFSNVRPGDWSCPNGCGNVFASKSNCFRCGVPKPEGAGDSYDQQGGDRGFG
FT                   GGWGGGGGYRERSAPSRRPGDWDCPAGCGLVFASKSNCFRCGVPKPEGAGDDFNGGGNF
FT                   NGGGDVNGGGYVDPGQPPRDHGAPPAQGGY"
FT   CDS_pept        complement(828013..829572)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637552"
FT                   /orf_name="MICPUN_59412"
FT                   /product="Equilibrative nucleoside transporter family "
FT                   /function="nucleoside transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64531.1"
FT                   /db_xref="GO:0005337"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG607719"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniParc:UPI000199B751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L1"
FT                   /transl_table=1
FT                   /translation="MARDASTSDHLLGDADADPERPDDDRPRDDRFGLCYIVFLLAGAG
FT                   TMFPWNVFITERAYFDVRLFAPPFTPALADSFESVFGVVYLLTNACAQYAMVVTGVANR
FT                   LSPGAMLTAPLFAMAVLLALTGCITYARRMSGDATMAITLVTLMTLGVLTALVQAGSFA
FT                   LASVLPPVYNQAIMSGQAVAGIATAVIALLSTAAGRSGDDDASDEEADAIAAQAAAYFF
FT                   TSALAVFGCAASTRFLERIPFYAAAAARAAQLSGPNRRGMGSAPSHHRLDSDATTVPLL
FT                   DPWGDGDGDETAEEDDGEDEDDGEAAGTAGDGRWFYRLAVALTFTVTLCVFPAVTSSVC
FT                   SAANGATSPPCLRRPERGTSRLLGDLFVPTLFLVFNVGDLCGRAFANVYPRTTTTTTSS
FT                   TTTGATTSLTTGAAPGGRSVFACALARFALVPPLWACNVVVPGRWRFPRFLAGTDVAPA
FT                   LLVAALAFTNGHLASVCMMYGPSRLVPRERAEEGVKMSFACIAGLGAGSVASFALYSLL
FT                   QS"
FT   CDS_pept        join(829717..829980,830158..830484)
FT                   /codon_start=1
FT                   /gene_family="HOG000232663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637553"
FT                   /orf_name="MICPUN_59413"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64172.1"
FT                   /db_xref="HOGENOM:HBG634491"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniParc:UPI000199B752"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L2"
FT                   /transl_table=1
FT                   /translation="MATVLNSSIAVSRVTVAPRAVRARTVAAHPAARPAASSSSFVASP
FT                   SVASSLSKRNRLATTGLKASVARNVGSTRRGGLVVRAAGDEGEAPGFFYTRAGVIAIGV
FT                   GVTGAGFALYYGLQANGVDPIWAGNIVQLTFVLGLTVAWVGSYVSRVMNKDMTYVKQLK
FT                   DYEDAVMAKRLEELPEAELEKMMEEIKRVDAPK"
FT   CDS_pept        831771..>832159
FT                   /codon_start=1
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637554"
FT                   /orf_name="MICPUN_59415"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO64173.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniParc:UPI000199B753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L3"
FT                   /transl_table=1
FT                   /translation="MRAALLAVARRVPSRVASASARGRDVATTAGAGTRDSPFDPAAED
FT                   APVVDIAELQTGAVFTRRRAFTAHDVASFASLAGDHNPIHVDPDAATAAGFRDGPVVHG
FT                   MLCASMFSAIIGTRFPGAVYATQSLA"
FT   CDS_pept        complement(832358..834463)
FT                   /codon_start=1
FT                   /gene_family="HOG000265444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637555"
FT                   /orf_name="MICPUN_59416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64532.1"
FT                   /db_xref="HOGENOM:HBG561602"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniParc:UPI000199B754"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L4"
FT                   /transl_table=1
FT                   /translation="MGEASYGVPAILAVTLVTAYMLHYFAASECDLAVRFMVMVSWTLS
FT                   LSIVALVPADVAATMYDEETSSLSTLWDLSYWITFTLTWFVLPFHQLYEDAGDFSALAR
FT                   ASTSLRENGIFYGVIVFILLLGAILLTSYGAMTSESMATFALASSTMFGICAGIFALGF
FT                   GLVDVPKIIWRRADVAKRQAEAHRRLGVASRALEDAFVGLRKVIKASETTREVIPRHHV
FT                   YAWAVAVIARETPKSSAFEGAMDKVDDDVDGVLDYDYDELSDLVALRRELRRRTRVYRR
FT                   TAAQYAVAVENAIEAEAVFNCGAGAGGLGDRGCLMTPDGGQRRFRSPLRAPRQGRYGEA
FT                   VEAVEWWWKCRVEPVLLRVLAVALGAFSVLTVWAEGTMFSTQAMEGADVSPFSAMVRAA
FT                   KDKGGLHMAVAIPLGYMCWCAYHSLFRLGMFSFYALVPGHTDSFSLLINAALTCRFAAP
FT                   LSLNFLMMVPSLREGDANKETTFGRKFVDGVPDSARNFAAVFPAILVFYCGALAFGVFD
FT                   KIFSACTSSFGGSLRDKYKFESDEKDLERNVHTTDGKRIAERERSAMQNQTKPKIGSGS
FT                   PYYFELASGDMGRESEMADLGGRGGDVDVERAGLLSAGGRRSQPRSDERPESRWERNKE
FT                   RLASALERTGELRVAKPPGAKPPGSSSRASRFGLGRGLLGGSGGTDSSTGGGSRLDSMF
FT                   ASLGGDK"
FT   CDS_pept        834604..835371
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637556"
FT                   /orf_name="MICPUN_59417"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64174.1"
FT                   /db_xref="HOGENOM:HBG635169"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniParc:UPI000199B815"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L5"
FT                   /transl_table=1
FT                   /translation="MLAALAPRALPARTAPAPRPRFARASAPSAARAPSRAAPRASGDA
FT                   DKVGTVVGGVAGPDEGPIDESSFGATPWDPADGEDPISDEVLLKIVLSQISDQEVNELV
FT                   WTALGYVKEIELDMETLTGKEVWKPTNVFPKWAAAYPEAPDVIGVTRKYWPEIDAPVKA
FT                   ACAALTRSVADDHKQGLKKTLRRLGWKGYRMDGLTPNMTRRAQAANWLLYYRRELRGVP
FT                   IEELKRRREERRKREEAEQRTDAPTGTTKQGVV"
FT   CDS_pept        join(835537..835590,835718..836968)
FT                   /codon_start=1
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637557"
FT                   /orf_name="MICPUN_94539"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64175.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199B816"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L6"
FT                   /transl_table=1
FT                   /translation="MSAIRTAEPFGEGVPFGDPGWYTKFNSPYYTQSHVEYRAKVRAFV
FT                   EKEIMPHTHEWDEKKSLPLELYRKTYEAGILPGVVGSPWAGGMGAHLDVKGPKDFDYFH
FT                   ELIILDEFGRCGSGGVLWGLLEGVHIGLPPVLNFGSEDLRERCGLRVLRGEATICLCIT
FT                   EPYAGSDVANIRCTAKKSNCGNFYVVDGEKKWITNGVWADYFTVAVRTGGSGMGGISLL
FT                   LIEKTMPGVQCRRMDCMGVWASGTSFITFENVKVPVGNLIGAENNGFKYIMHNFNHERW
FT                   GFVVQANRFARVCYEEAFKYAHRRRTFGKRLVEHPVIRAKLADMVRQIDATHHQMENIT
FT                   YQMCTMPKEQSAKALAGITALAKVQSTKVFEYCAREAAQIFGGASYVRGGQGEKVERLY
FT                   RDVRAYAIPGGSEEIMMDLGVRQAMKEWDAVQSRM"
FT   CDS_pept        join(complement(837552..837681),complement(837017..837387))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637558"
FT                   /gene_name="ODA-LC3"
FT                   /orf_name="MICPUN_45674"
FT                   /product="Dynein 16 kDa light chain, flagellar outer arm "
FT                   /biological_process="cell redox homeostasis"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64533.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199B817"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L7"
FT                   /transl_table=1
FT                   /translation="MAAAAVVERNVYEKASMSIAVSGETDAEADTFLKDKLCEQGLKVI
FT                   EVYAEWGGRCEPLVPVLKRIQKEAEYAQNCAVVLHCKAESHDLLAEYRGKSMPHFLFYR
FT                   NGTQVASVAGANMPEIEALLREHAPTSADADVLEENPMWIQRQEEKAAAEAAAQAALMG
FT                   ENE"
FT   CDS_pept        837800..838780
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637559"
FT                   /orf_name="MICPUN_59421"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64176.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000199B818"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L8"
FT                   /transl_table=1
FT                   /translation="MQIRALSGEPLGVEVLGADLRTATAEDVERMVDAMHRTGRGVLVV
FT                   RDQHLAPTDCERACAMLAPHFVAQQPYTRWPGQSKPIPGCPHLALLGNYRAREDNEFGM
FT                   DVVKGEVIGEYKPAKQNLEEWHTDGSFLPNPKVAIALYAPQLDDALPPEGGETRFASCT
FT                   AAFEALAREEQEKLRGLCSVHSWEKFMRLLESRDPGRQKVTAEQIAEKPPQLWPVVRTH
FT                   PVTKAESLYINPKNTAAVVNKATGEPIPEEDARRLVDRLAEAVVGDGLPGNSKVYAHTW
FT                   KRGDFVIWDNRVLLHAASPFDAEKYQRLLFRMEFKGEPVLGPSTP"
FT   CDS_pept        join(complement(839029..840862),complement(838924..838973))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637560"
FT                   /orf_name="MICPUN_59422"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64534.1"
FT                   /db_xref="UniParc:UPI000199B819"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8L9"
FT                   /transl_table=1
FT                   /translation="MLQGALVGLAAKAKAASAKVGDVVGDFLDNSVDNPLYEDDEDAEW
FT                   SEDGDDEDEDLDGTDDGIDSPAPAPSQSSALAQLRARLAAERAKKAGDASEARAKPSSS
FT                   ATSGLMPAEPGSLRPYVPNGSLPPAPPTPVAPQSTTAPPPPPPQPEVTTPTMTPVRPPQ
FT                   PPRAAAAASPTSGVVGAVPSVVPTSPGGTPIAASMSALEQRARAAEEETARLRRRIDAD
FT                   ARAAETEKQRAVAAAVAEAMEREQRKAAAMMEAMVEADGAASAAHDAATIGALREELRA
FT                   VRAAAGDVEATWAGRLEEAAAEEEELRRRLTRAEERATAAEAEAAAARAGEDDNGAEAE
FT                   ELRDALARERARARGEIEARDAEIEKNQKELVRLRHHLLELEEEDDAKVEEAELNATAL
FT                   VREREEEHAALVNELTARLAASERELEVMRVAVDAKDRELANLQVAMDIFNTDEEARGR
FT                   LSLEAQALREKNAHLAAELVVAKEQVTAANERASGAERDARAEKERADAAAAETQRAIG
FT                   EAGKARQALQQSMQQAKHLMDSSTELLDKRIVSKLLLTYFEREQSPDVLELMARMLNMS
FT                   EDEKSKMGLGERAAAKPGLIRSVATAPVRVAFGALGRSLRRRRNRPWRTSG"
FT   CDS_pept        842822..844309
FT                   /codon_start=1
FT                   /gene_family="HOG000199449" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637561"
FT                   /gene_name="ALK1"
FT                   /orf_name="MICPUN_113993"
FT                   /product="CALK protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64177.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniParc:UPI000199B81A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M0"
FT                   /transl_table=1
FT                   /translation="MTQTQRLASFPSGRTWSLSDFRMGERVGASRLSAVYHAMHKSTGM
FT                   ELALKCYLRDRLDAFSLAQIKREVSIHAKLAHPSVVPFYGSFEDERGNIYLLHEYARGG
FT                   DVFALMNKSGGTFSEAQTCRQVIQPVASAVAYLHARGITHRDIKPENLLVSDVDAACKV
FT                   TDFGFAMDFTQNQCKTRLGTTDYMAPEIVRCDKAMRERLRAENRSGYGPEVDCWAIGVL
FT                   AYECLVGAAPFEGGGTEEVYARILTGKYHLPGRFTPEAADFIARALDLNPGTRISAEQM
FT                   LRHPWIVAHTQSSEPSPEPARRRRTSMQSNLRDVLENEPSVMLSEDEPGEQPEVFGLRN
FT                   PASTDLLSYSASSSPAGLAVGGAGLGGGHRQGHGPGEVAEVFGQGPPGRFEPHQNYHRA
FT                   RSDPQQRALANASAMRYNSEENSQDDLRANSFSHRIHHTFKRGWGRVREFIYSGESGVD
FT                   SMYEGEMSPAGYRSPSMSSPVAPHPMAGIEDSDQMTE"
FT   CDS_pept        complement(844672..845061)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637562"
FT                   /orf_name="MICPUN_59425"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64535.1"
FT                   /db_xref="UniParc:UPI000199B81B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M1"
FT                   /transl_table=1
FT                   /translation="MRRIFVPSVAALILAAAVLLALPVPSAAECARFCAQIPPEELETA
FT                   ELTRCDTCGEDLEYDGSPCVDPPCCAGWCEWVPLKVQPLVSRCEDCPIPDEEEESRSRG
FT                   CLKPSWCGFIPRNVQELVGPCSTRC"
FT   CDS_pept        complement(845278..846117)
FT                   /codon_start=1
FT                   /gene_family="HOG000265447" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637563"
FT                   /orf_name="MICPUN_101067"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO64536.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG561608"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199B81C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M2"
FT                   /transl_table=1
FT                   /translation="MPGEDIAIVARVSSGKPLDVSDLPEDLPRLEVAHEDAHFAVVVKP
FT                   EGVNTVGDARGGWTAERMLPYFLAPTIGVEGALVRPRPVHRLDALTSGLLVVAKTRLAA
FT                   TSLSEAFASRRVTKRYRAVLCGTPAEPEVLVDDDDDDENDRAGAAALKLGVIDAPMEGK
FT                   QCVSHWRVVRDAPDASMRHGRLTLVDMWPKTGRTHQLRRHAAGALGCPILGDARYNPKH
FT                   SPEDDVDGLFLRAVEVTLPPSATPWRFGDGNAADDGDRTKYLRVKVDDPAKFSARVP"
FT   CDS_pept        846607..848586
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637564"
FT                   /orf_name="MICPUN_105740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64178.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="UniParc:UPI000199B81D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M3"
FT                   /transl_table=1
FT                   /translation="MSALGIVTGAFGAVWSVVATVLRGLFGFLNDFKAAASVAIFGWCV
FT                   GLFVGTVIVRHWRRAVARSERESARKVAAEAVKSRRKDIPNPLPPDVIETALKHIPRWA
FT                   RDPDWNRAAFLNRVLDALWPHVDTSVCEVVRDSVEPILRDLVPRNIVHWIGFEKLTLGP
FT                   TPPTIGGVKVLGSSSDDVVLELELQWASGADFVLAAYVFGVRVPVRLSDVQLVAAVRVH
FT                   FTPLVDELPCLGGLEVSLLGMPDHLDLAAVVPPGVDLMALPAMDVLLPWILRKILGPMF
FT                   VYPSRMIIPIMDNSGLEPPATGMIKVRVRGGYNMQKRRKDGKATGLVLPGSKLIGFGGE
FT                   RYQVRLYTREQRKVMLMSKSRDEPTWDELHYFLANPESTLHCVLLTMNMRELGRCEIPM
FT                   RLLCDPSREGKTANLHLPIEDPTPFQEPEPEPPVPPKRATAADIERLNKEYALAMKNHR
FT                   EKLARLRLEQLAKAKLPEPRPNTPTVAIDLEYVPMGSGKSRRTSLAGITSVASPGAKTA
FT                   SGVEEDEEEEEEETVAGNREGRVGILRVTVNRAVNVRKADNAKQPQPVCVAQISGQKFV
FT                   TAAPVDPTNKPLWDETFLFFNVSDRDAVSLTLCDGGERGEFLGECVVDMRKITRDMELS
FT                   DMFHLAGVKNNAQIFAQFKFSYLG"
FT   CDS_pept        complement(848687..849424)
FT                   /codon_start=1
FT                   /gene_family="HOG000100082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637565"
FT                   /orf_name="MICPUN_59428"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64537.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG561610"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B81E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M4"
FT                   /transl_table=1
FT                   /translation="MSTLAARVPATAASPRGVSPSAVAARGRNVPFAPARPRRSSVVTR
FT                   ALTPEEERRYFVLGVSPGASQEAVKRAYKRMAKMHHPDVNREDPLAPAKFAEINEAYHA
FT                   LCAERGNLSNVGTEEWKEKWSAQLRQMKDVEAGKARVNVRRRRVVRKTVLDETMEKERD
FT                   RLEDIMRESEAADGDDAWLEDEVPDEVRRAAAAKAVASQLGGLRDRTRRRRQVVPPQKN
FT                   KFKEPFEDVSPTAHDDEWNHSVQ"
FT   CDS_pept        851348..852199
FT                   /codon_start=1
FT                   /gene_family="HOG000164685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637566"
FT                   /orf_name="MICPUN_83121"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64179.1"
FT                   /db_xref="HOGENOM:HBG737456"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000199B81F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M5"
FT                   /transl_table=1
FT                   /translation="MFWPSSSSNSRATFRCVCRSRPYRRTSPVAPRPILFLFSGTPRSA
FT                   FDLSRTHRTRRPKKNAPVGSKGAALKQHIDATLGSGNLREAVLLPPGEDLNEWLAVNTV
FT                   DFYNAISMLYATLAEYCTDGSCPTMCAGPKYEYRWADGVKVKKPIACTAPQYVDYLLSW
FT                   VESQVDDEALFPQAQGADFPSNFPDVVRKIFTRLFRVYAHIYHSHFPQICTLGAEAHLN
FT                   TLFKHFIYFTSAFGLVRREELAPLGELVDGILGVVPSHVKINNNVGGGGGGGGGAGGGS
FT                   AV"
FT   CDS_pept        859015..860331
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637567"
FT                   /orf_name="MICPUN_108467"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO64180.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="UniParc:UPI000199B820"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M6"
FT                   /transl_table=1
FT                   /translation="MQAALEASVRETRKERPKRGYARALSGEALDGLAPDSPQRAEGPG
FT                   AGLRNLEGEYNCFLNVVIQSLWHLPPFSRAVQDSAKGGGAWRGNGRGDEDPDAEVAAAL
FT                   RDVFRAMDQSNGSVRAMDQSDGSVADSGDSNGAPHADIGAVQNAVAPTALRKALAVLTQ
FT                   GRGSLFGENEMADASEALQAIFHSVHRALRPAPGTKHARPLSAAASSRSGGMFLDQESG
FT                   YCSVVHRCFGVDVEESMTCSRCAVRSRTLRYTKFLHLVPAAALNLAMAYADGVDSMESA
FT                   MRHIDGSDAKPCDVDAGGCGAMNGIEHALAADGVQRKSPAIFCVALAWESASATSDQVA
FT                   ETLANVQTTLNLAEVYERAPRDAGTYHLRCAMCYYGEHYAAFAVTDAGRFDGHERWMLF
FT                   DDHRSKEVGEWEEVARVCAAGRMQPCVLFYQRENATVEV"
FT   CDS_pept        complement(860595..861467)
FT                   /codon_start=1
FT                   /gene_family="HOG000265450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637568"
FT                   /orf_name="MICPUN_59431"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64538.1"
FT                   /db_xref="HOGENOM:HBG561612"
FT                   /db_xref="UniParc:UPI000199B821"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M7"
FT                   /transl_table=1
FT                   /translation="MAATWAARAGAVICIARARANPVSARRSPPSRLTTARASSADGGP
FT                   SGSGGDDVDGSPEDSSYRPVSGEELKAAIQECREILEEATRIAGEQARAELAAQFLKVP
FT                   EGAQASLAVDMARVQLFFQGKGMRPYQAEKVSATLIEIDSIYGDVELLAVKFDRLVRTL
FT                   PDVDVSEMVFNDPRVLTVKIADAVPRLIELLDIFPLEKVPQMITEAPKLLYETEPIPER
FT                   FERTCECIKRVYPKETTEGCKYALSEEPTLMFDLPDLQIFQKDERVDIAELPMAVQESL
FT                   VYATRNEHE"
FT   CDS_pept        862901..>864060
FT                   /codon_start=1
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637569"
FT                   /orf_name="MICPUN_82741"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64181.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B822"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M8"
FT                   /transl_table=1
FT                   /translation="MLSSSSAALRRNNSFFESTPKVQYPTQASDYRLMEEIGRGVSAKV
FT                   YRAECVPLNNEQVAVKKLDLEDQDPGHLEEIRREVASMSMLSHPNLVMAHCSFVEGQYL
FT                   WIVMPFCGGGSALNIMKWSHPKGLDETSIATILKEVLKALDYFHRNGNIHRDVKAGNIL
FT                   IDDNGSVKIGDFGVSAASWGSGAKPHATFVGTPCWMAPEVMEQVNGYDWHADIWSLGIT
FT                   VLELCHGHAPFAKYPPMKVLLMTLQNPPPQLEAEQAESGHHFSRALRDFVSICLQKDPS
FT                   KRPSAAKLLEHKFLKEAKKPDFLVKHLLDGIPTLGDRTAKLNEREKARQAQRAAAVAAG
FT                   GLSSAPSTEAAEEKRSNAEYLKGVSRWDFDMDAIRAEAAAMTLDDD"
FT   CDS_pept        complement(864723..865088)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637570"
FT                   /orf_name="MICPUN_59433"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64539.1"
FT                   /db_xref="InterPro:IPR008590"
FT                   /db_xref="UniParc:UPI000199B823"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8M9"
FT                   /transl_table=1
FT                   /translation="MGAGVQRRTFARLDTLDEPSGDDPRFTMPAHMDPKLRKPGKKTVA
FT                   LGVGLTFVGCVLLGCYLLWYFGFMPIPDDEERGTSLALLVLGCITLAPGLYVTTILAAV
FT                   WRGIPGFTYEMIPSFED"
FT   CDS_pept        865205..866200
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637571"
FT                   /orf_name="MICPUN_108468"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64182.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B824"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N0"
FT                   /transl_table=1
FT                   /translation="MGLGIGPNKDRVQAAIKELQQKKAAEAAAAGNGEGKENEAPATPA
FT                   PQSGGGGSPAKASSKRDRDPNEKAAALAATKLVKKKQRKRFIPKDPCLFFLYYFGLVIV
FT                   AACVVRVINGPFQFEQKILAERDRIREIQDANEEALRVMKESIPLVFAAGDGNTTEVER
FT                   LLALGQDVMERSPAGETPLHTAAISGEPVIVKMLLDAGADPDARTMGREYLKMTPAHWM
FT                   VFGNKREALKILIDAGADVNAMNTKGKTPTDMAWDLPKDTREGILTLLLENGGKKGEDL
FT                   NEDPPEDDPDPSEDDPDPAEATTATDAEEVEPAEEVEPASPADAESAAEL"
FT   CDS_pept        complement(866278..868314)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637572"
FT                   /orf_name="MICPUN_59435"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64540.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="InterPro:IPR006759"
FT                   /db_xref="UniParc:UPI000199B8ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N1"
FT                   /transl_table=1
FT                   /translation="MRARDVPASVRRAYEIAGKQYPGDVGPHTPPAPPSPRSNRAWERH
FT                   GAHSGGPARSSRHRRGHDGAGGFIGFGRELEVLALICIVACVPLLGGVGRLPSSRLTRH
FT                   DLRQATGFVAEMHRDPAQGWTERQRKLAQREGHDGALGRERGADDRLNRERGTAGDGRS
FT                   SSSSRSSSHESSGKKPSPGFARRDSNTGVRPPGDTGDVCGDGAAPERGPVRIWDGVEIR
FT                   GGDLRRGPPVPAPASREDCCRACLADPDCRGWVLVKDAGVCWLKGRWAGEPEADACCEG
FT                   ADMRPGGDSRAREAARKTAELEEQKEARERSYNGGASHRVARGGSAARAEELRRERERD
FT                   AAEGLARRKAPPLAAGGRIGGHLLILVPTVARPGVDYLTRTVDSALAEARRGEHGFDRV
FT                   TVRVVSHSSAQEHAAFRKIRDRPAGPRDMAARVALEAAVDADRRRTDPGAQVAVDDRNN
FT                   PDDVPGPRVRQQTLDLVSVLRDVGGVGGGGGADYLLLTEDDATMCEGHLAGIGRRMAAA
FT                   AAVDPMWTMLRTSIGFIGIVMHRADSNALANFLEMHYQRKPPDILLIEWVAGNWEGGVR
FT                   AHGARARGERLIPDSKDPTLRTVSKSAARAPLARQHFVSLKNSFAHIGEVSSLRLTHAS
FT                   VTPECDAPLTSFLWALERFKDTARCADVGIVPCERSAPREPRG"
FT   CDS_pept        complement(868460..869152)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637573"
FT                   /orf_name="MICPUN_108469"
FT                   /product="Predicted protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64541.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="UniParc:UPI000199B8EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N2"
FT                   /transl_table=1
FT                   /translation="MTGDYVFQLMRKGTKWERRDMYFVGDDDGPKGRRRIGFANEGDAD
FT                   VLEEDRFFRVLLKYSYKHSLMGAANVTGEREGQGDNGIVSGHAYSILQVRRAGTTLGMG
FT                   GVKLLQLRNPWGTFEWKGAWSDGSDEWKKHPGIASEVGYKETDDGTFWMEYKDFARTFN
FT                   MVDICDRTTKDDLRLDVNEDDGCLGPMKGCVGGCGQFWCCCMGARVIYWGNQTSSETEK
FT                   GAGCCVTG"
FT   CDS_pept        870341..871573
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637574"
FT                   /orf_name="MICPUN_101075"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64183.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199B8EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N3"
FT                   /transl_table=1
FT                   /translation="MVVDKVPAKAAMKAAAPGKRKAPEESTVWDPSSKSPKPDSNGGSA
FT                   DHQQISGANALAVVDPSAIGGAMVPDGKLKGKVARGGSKYKGVYRDKNVSGKYKCSIRR
FT                   KEREVHLGYYGSEEEAARAYDKAHWCCKSSTKNFDISTYDAEEMAKIKEMPSNDLTELR
FT                   KHLGVGLSKEGKEGSSKYRGVCKEKKTQKFRAEIQIAGKKESLGYHANEMDAVRAYDRA
FT                   LIVMKGDKAKTNLPIEQYDAERAKLAAYDFNEFQAKEIETKSHRNANWTSNFRGVRRYT
FT                   HKQKNDQLNVKWRAEITVNGKKKSLGYHDTQEEAARAYDKAVVSQPGFKRHWLNFPEGA
FT                   LPAPAPAAALPAPGDAPGGAGGGARGAAGGAGGVKARGGLKAKKAAAAAAAGVKEEAGR
FT                   PEGGFLASLAE"
FT   CDS_pept        complement(871753..872709)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637575"
FT                   /orf_name="MICPUN_101076"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64542.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B8F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N4"
FT                   /transl_table=1
FT                   /translation="MEEHPPISAETLRETVKDLTKKAKFGEACDRLRGWTERAEVVGSL
FT                   RSDLLAAILRSATVLRSRHAPDSSGWRHGLRLFEAAAVVFEGHDDAGKISECLEAAALT
FT                   VDADDDENAKNVIGSSEANEERNAPKAFEGQFSGEVESEFDRQRRTAGPGTGGAIPAEL
FT                   FEMFRDPTETAERRRDALTAWLSSAHPSSNTAVDVDALMEVLSGFDASSFGSDAAVDGA
FT                   AFGARRTMGSAGSDALAALAERVVTLRTGDDVASLGEPECPICRDEFDVGSRVIKMPCA
FT                   RTHVFHRDCVATWLRKDDSCPLCRSSLPIWLGRPQYA"
FT   CDS_pept        <873225..>873951
FT                   /codon_start=1
FT                   /gene_family="HOG000242058" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637576"
FT                   /orf_name="MICPUN_70089"
FT                   /product="Glycosyltransferase family 64 protein "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO64184.1"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG607728"
FT                   /db_xref="InterPro:IPR015338"
FT                   /db_xref="UniParc:UPI000199B8F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N5"
FT                   /transl_table=1
FT                   /translation="FTVLLNTFKRRDLLKKAVAHYATCADVAEIRVVWSEQVPPPTRGE
FT                   ENGAYFGPKPSMVTYDTHPTTSIQNRFDPPSGSNAISTRAVFNVDDDVRMPCAALTRGF
FT                   DAWRANEDVLVGYYPRTHKPDDAGCGWRYVWDDFSLWRHGDFSIVLTKAAFMRTGYMSL
FT                   YSEGLPQSARRYIDEYKNCEDIAMQILTAKITGKPPVYVPVPTMHYLWAKLEGFGVAGI
FT                   SKGSGHHVHRGECITDLSRM"
FT   CDS_pept        join(complement(876251..876271),complement(875782..875958),
FT                   complement(874086..875678))
FT                   /codon_start=1
FT                   /gene_family="HOG000265451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637577"
FT                   /gene_name="RIB72"
FT                   /orf_name="MICPUN_96444"
FT                   /product="Protofilament ribbon protein of flagellar
FT                   microtubules"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64543.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG561620"
FT                   /db_xref="InterPro:IPR006602"
FT                   /db_xref="InterPro:IPR010554"
FT                   /db_xref="UniParc:UPI000199B8F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N6"
FT                   /transl_table=1
FT                   /translation="MTFVDPRAPVQRRAQSLAYINGYAVPGERSTGLKPEVSAPPPAPE
FT                   QLKETTLPMSTLPKFVAFDRKVLRWNCYFKESVTESAVENHRVRKCTIYMYLEDESVHV
FT                   EEPRQPNSGIPQGVFLKRHRVPKDNEGGVFGPADISVGSTCTMYGRTFFVVSCDAFTRE
FT                   YLTGALGLEVAPDGAYPDDPIDGYRATLKKDTSANPYPPAPRDDVLAAYIEAAAGKPSN
FT                   ALAPDKLKKFLANDRKVLRFFAVWDDRGALYGEKRPFVVHYYLADDSVEVLEVSEPNSG
FT                   RDPFPVFLRRQPLPNKPLEVDALGPTKSTTTYTHKDFVVGQYVKVYNRDFYLYDADNFT
FT                   KAWYIENEGMSAADFPEIDVEEKPLPIPQNAVPPYNGFGGLEDSLQNCIALIPKPVAPD
FT                   FHKQMDYARTILRYKAKIAPGEQYELSDIDAERDFILSVYLANDTIAIYEPPDRKRNIP
FT                   AHITGGKFLERQTVLKPGSAEKYEAHDLYVGAVVSVFRRNFVLTEADEYSYQFMEQHPA
FT                   SFPRSDFDQVLMRIRAQLEGMEAEVYGTFAGKEVTEESLTAALSACGAQFVKQEVVTVL
FT                   RKVAGSGDAWLAALGFQAPA"
FT   CDS_pept        join(876504..876631,876689..877361,877527..877943)
FT                   /codon_start=1
FT                   /gene_family="HOG000170496" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637578"
FT                   /orf_name="MICPUN_96445"
FT                   /product="Actin superfamily"
FT                   /protein_id="ACO64185.1"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000199B8F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N7"
FT                   /transl_table=1
FT                   /translation="MTGTRKDIVVVDLGGSTIKVGFAGDADPSRCASPAASLPPDRCVV
FT                   PNCVAKPKGEKRSYIADEINQVKDISSLNLRRPVDRGYVVNWDLQRDILDHVFKKVLKI
FT                   NPRNCHLVITEAPFNLPALAAEQDECIFEKFGFKSALICPPSLLALTYHLAKRPRSDPC
FT                   VSARCGVVVDAGFSFVHATPVFDGRVLRNGIRRVNLGGKALTNYLKEMVSYRQWNMMDE
FT                   YVLMDDVKEKLCYVAGCAVDELKRAKVRGASNEVNREYVLPDGVHCLGMGNERFMVPEA
FT                   LFHPADIGLNQAGVAEVVTQAVRSVATDLRAMMYANVIVAGGCAAFPGFKERFEAELRP
FT                   LVPTDEALTVEVSTSPTLDAWRGGSVVGAGEDFERLAVTREAWKKDASEFRRRYEEHAG
FT                   VVKGRM"
FT   CDS_pept        complement(878060..879085)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637579"
FT                   /orf_name="MICPUN_108470"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64544.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="UniParc:UPI000199B8F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N8"
FT                   /transl_table=1
FT                   /translation="MPSLLSQTLGISAKSSSWGWMEKAAQEKRIEERLEAERMGLNDDT
FT                   KAVVRALKVLNPGFEDVDDVLITRTVNAATEDYPGKPPEYRAQKASKEIEKILAWRAAQ
FT                   EVDSILERDLANTEEFHRSWPVTLHGCDEFGHPIICERIVDIDAKGLEGPGFAKGLAMM
FT                   HRVQIMEALDHVKRRTAIAKGHRLHKHVWVIDLQGITTSHLTGSVRTFLYDLISLCQDK
FT                   YTDTLHAMWLVNAPYVFRAMWSAIKTMVRKSTKDKIQILGESDASGIESAMELLSVSPE
FT                   AMPTCVPGGKNDGTRAWDVVLRAREERERAREKGTEANEGSPASTCTVENAAFEDDSSK
FT                   D"
FT   CDS_pept        complement(879398..879730)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637580"
FT                   /orf_name="MICPUN_108471"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64545.1"
FT                   /db_xref="UniParc:UPI000199B8F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8N9"
FT                   /transl_table=1
FT                   /translation="MFIHLSLASGDDAEGWSAEEIEEYSGWMSDRGRRWRDGGVYAAEA
FT                   GADWYRAKFGPEAFGLHHRFYLHLDGGDNFWLSAEDGCEGVAQSKQKPAFDFGGPGARN
FT                   PFSIFK"
FT   CDS_pept        881925..883058
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637581"
FT                   /orf_name="MICPUN_83006"
FT                   /product="Set domain protein"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64186.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="UniParc:UPI000199B8F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P0"
FT                   /transl_table=1
FT                   /translation="MFQIQEAAKAAKEAKKAADGKTADATADGNPPAEPAGNTEAIATV
FT                   PRTGCGAECFNRTCLTTCDPRVCPCGPSCSNRPFHQLKSPKTDTLLTENRGWGLFLAEP
FT                   VKAGTFIVEYVGEILDEHTTEKRLWEDKKRGEDNFYLMEVMPNQCIDARYKGNLSRFIN
FT                   SSCHPNCETQKWQDSATGETRVGIFAIQDIPEGTELTYDYNFAHFGGEGTTSFSCMCGH
FT                   PLCRGTLDANPERTRHYNRRVAISWAHDDVFYKGVVLSYNMKTTKYEILYDTGEKEYVA
FT                   LEEQLTEGEDYYWLTPPNPDEVKRDEKRKSDAGAKGDKKGKNGTKAVKAKGGVKKTSSK
FT                   PKVKQAAAPEPAGEPAAVVPAAAEAPTLEPKPEPVQA"
FT   CDS_pept        complement(883234..889827)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637582"
FT                   /gene_name="PYK"
FT                   /orf_name="MICPUN_59445"
FT                   /product="Pyruvate kinase"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO64546.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199B8F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P1"
FT                   /transl_table=1
FT                   /translation="MACGTATGAGMGPPAVRPPMPKFSFVDPDDFDESRFWTPEYVPES
FT                   VMPPTRGVAQNTLTVRSTSISPAMIMEDQPMMRKTKIVCTMGPKCWDEESMGKLIDAGM
FT                   GVARFNFSHGSHEGHQEVLDRFRKVCEEKKAHCAVLLDTKGPEIRTAMLKDHQPIELEA
FT                   GQDIIVYAAGPDEYTEWEGYKTPEETKIGCSYAKLCQSVKPGNRLLFADGSVVIEVVEI
FT                   LDEKNLKGKVINSKKLGERKNGNLPGVKVELDVLQEKDIEDIKEFACVNKMDYVAVSFV
FT                   QTGDDVQMVRKLLDENGGENIQIISKIENEEGMRNFDDILKYTDGVMVARGDLGMEIPS
FT                   EKVALAQKMMITKCNIAGKFCICATQMLESMCDNPLPTRAEMTDVANAVFDGCDCTMLS
FT                   GETANGAFPEKAVATMAAIATNAELGVDYWAQYQFLHRSNAYTHKVGGLEASLSQVAFS
FT                   AVCFSADKDGDGVIDATEGTAIVLLDETGKAADLITKYRPPCPIFVCTTSKSVLAHTNT
FT                   RFGQIPCQLDGVPEVANSVLKAWEIAKERDIPFEGRRVILVASPDGFAVQNSAVATVVS
FT                   VKDGVSTPEPTEAMLTTYVDPGVLNPVLSLRSSRIGLDLILNPTHSFRKTKIVCTLGPK
FT                   CWSEDGIKSLLRAGLGVARFNFSHGTHEDHQQVLDRFRKACEEEGEAMKKEKGLDYTHH
FT                   WGCLLDTKGPEIRTAMLKDHQPIELEAGQPITIEAVGDKYVEFEGYKTEEETRIGLSYA
FT                   KLCQSVKPGNNILIADGSISIRVDSIESDTVLKGTVLNSKKLGERKNCNLPGVKVDIPV
FT                   LTEKDINDVQNFCCKNKMDFVAASFVQTGEDVQLIRKILDEAGGHKVKIISKIENGAGM
FT                   ENFDDILKYTDGVMVARGDLGMEIPSEKVALAQKMMITKCNIAGKFCICATQMLESMCD
FT                   NPLPTRAEMLDVANAVFDGCDCTMLSGETANGANPAVAVATMAAIAANAEVGCDGDMTY
FT                   KNVWNNTPKPVTALEAVASSAVKACLDMGACAMVVFAQTMLPAALLSKYKPPVPIVVVT
FT                   TNHRVAAQCNVVSSLVPMYLPEMGTSDETLPMVLNTIRKLGIAALETGDLESDQVVIME
FT                   SIGTNPMIGIDWEDRTPIFKVKVVGDELASLIKPTGYEGDHTISFCSTKIGLENIVTTG
FT                   DTVRKTKIVCTMGPKCWDEESMSKLIDAGMGVARFNFSHGDHEGHGEVLHRLRTVIKKK
FT                   GSNTAVLLDTKGPEVRTAMLKDHQPIELEAGQDIIVYAAGPEEYLTWEGYKTPEETKIG
FT                   CSYAKLCQSVKPGNRLLFADGSVVIEVVEILDEKNLKGKVLNSKKLGERKNGNLPGVKV
FT                   ELDVLQPKDIEDIKNFACPNQMDYIAVSFVQTGDDVQMVRKLLDENGGENIQIISKIEN
FT                   EEGMRNFDDILKYTDGVMVARGDLGMEIPSEKVALAQKMMITKCNIAGKFCICATQMLE
FT                   SMCDNPLPTRAEMLDVANAVLDGADATMLSGETANGAFPEKAVATMAAIAANAEEGVDR
FT                   CQIYNFIRDFTPMPVGSIEAVVSCAAKTAVDLGAALGCIVVFSELGFRANLASKYRPAV
FT                   PIVVVTSLDHVARHTNTAYGQYAFKIPEPADPETETYWTARALLFALEHNLCHPGAKVV
FT                   IIGGVAGATNTVNSIPSYRILDAPGIYKRKVAQHAVPGSEFAQFAVQKDHKTVSLRATA
FT                   ISLEEVFSPEAPKRKTKIVCTMGPACWDEESVGQLLDAGMSVARFNFSHGDHEGHQQVL
FT                   DRVRKVIAEKGANCACLLDTKGPEIRTAMLRDHQPIELEAGQPITIEAVGDKYVEFEGY
FT                   KTEEETRIGLSYAKLCQSVKPGNNILIADGSISIRVNHIESDTVLKGTVLNSKKLGERK
FT                   NCNLPGVKVDIPVLTEKDINDVQNFCCKNKMDFVAASFVQTGEDVQLIRKILDEAGGQS
FT                   VKIISKIENEEGIANFDDILKYTDGVMVARGDLGMEIPSEKVPLAQKMLITKSNVAGRF
FT                   VICATQMLESMCTNPLPTRAEMTDVANAVFDGADATMLSGETANGANPAVAVATMAAIS
FT                   ANAELAHTSQAAISFIRDHTQRPFTTLESAAASAAGGALDCDAELIVVVTGAGAASRAM
FT                   SKYRPSCPVLVVTADEAVGRQTGAIFAQFPMVVDDLSPGKFAWDKESPAIVKAKEMGLY
FT                   SGNGSNIVVLAGPGGGDADKCPLVSFLE"
FT   CDS_pept        join(890268..890565,890695..890915)
FT                   /codon_start=1
FT                   /gene_family="HOG000265494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637583"
FT                   /orf_name="MICPUN_108472"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64187.1"
FT                   /db_xref="HOGENOM:HBG561625"
FT                   /db_xref="InterPro:IPR019181"
FT                   /db_xref="UniParc:UPI000199B8F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P2"
FT                   /transl_table=1
FT                   /translation="MVSDKWGIGHSVSGVMPNGEKFSGEVFGYDEATGLVTVRAPGNIG
FT                   GTHDVRIIKAEACTDVKSIPPKTPAKTDGAMPAVDDTRSKKREEENIKAAQARAANVGV
FT                   GVTQEAQDIFDALARTLPCRWADRDIVVMDEVIIRPPYAACAGVAGGDPRAVERVQKVL
FT                   ANEKKKLGL"
FT   CDS_pept        complement(891046..891351)
FT                   /codon_start=1
FT                   /gene_family="HOG000171962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637584"
FT                   /orf_name="MICPUN_59447"
FT                   /product="Predicted protein"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="ACO64547.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG737791"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI000199B8F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P3"
FT                   /transl_table=1
FT                   /translation="MDFRGQKLAERMYQVILVIAGIIAFLAGYLSGSFDTMSYIFTCGV
FT                   IVAVILCVPDWNYFNQHPIKWLPIDEDHPDWETKYKPQMEAKGGAKGGKQESKKKR"
FT   CDS_pept        891510..893750
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637585"
FT                   /orf_name="MICPUN_59448"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64188.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199AD9C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P4"
FT                   /transl_table=1
FT                   /translation="MSKPRGVVEPSMVAVSVNEYVGDVSRAGYYEGHGVAHFRAGHRYE
FT                   GGFSKGKMSGSGRYEWVDGIVYEGDFVDNVATGVGKYTWPDGATYTGEVRRGLRHGRGV
FT                   QAFADGRVTYDGEWKDGMRHGIGTLTFDADGYARYEGEWRHDRKHGKGRMQYASGNWYE
FT                   GGWACDQKNGRGVMCWPASGETYRGEWVDGKPHGVGTHAWDRVLSDKTETDAFNSSFNS
FT                   WFNTHNSYRGTFAAGMRQGYGRFAYANGSSYDGNWYADQKHGDGAYTFEDGSVFVGRFE
FT                   RDRPVLGTHPGDGDNPGGSARFEPTDHLRLDVADLMSEEEQARDDEPATSLDFTLKRYS
FT                   SELRAIYRRAAIAGTAIDPTDEQPDRNPTPLSVPGFVRLMRRAGVAGADVTCVQLARAA
FT                   HAAWRDSPPVMEPVGDADEDESSREERRLRHERELRRGNVMDPNGVMVYRQFAEACVRV
FT                   AHVKFNEAFGLDRRAEHLIVEHLLPSELDEALDESRTLPWDAKMEAVEVRESAEAKAET
FT                   YFREVRGTAESDGADEESHSCATPTVTGRAFLRWLKSKGALADGDEGGEPVTWPPPEPD
FT                   PDADPGNDDGEGEEEKAADGDGAGDAEEAEEGEKTEEGAKEKAPPAPSLTTLQALAAFY
FT                   HAIGPVAAAAEEEAAREEADRARYEAEEAAAATGTENGEPDGDAALESARIAAEATRLA
FT                   RAVDCEAMFPEFFEALGRCADAAVKTEGSSLAEKLATFFAEVVDVTPAVASA"
FT   CDS_pept        join(complement(893927..894304),complement(893818..893826))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637586"
FT                   /orf_name="MICPUN_59449"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64548.1"
FT                   /db_xref="UniParc:UPI000199AD9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P5"
FT                   /transl_table=1
FT                   /translation="MVDGGRRPKVSVDVLRADLAEARLEARELGEENVQLRDELAEALA
FT                   KVHDLGAKYGSDMSDSVVRKAKAHAADQREHIKRLEKEVHMLNSKGRMLEVQCDMLQQQ
FT                   EEQLRNSFDRILSWLGLLGAAVRS"
FT   CDS_pept        join(894639..894777,894887..897762)
FT                   /codon_start=1
FT                   /gene_family="HOG000261409" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637587"
FT                   /orf_name="MICPUN_59450"
FT                   /product="Lon protease"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64189.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG566281"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AD9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P6"
FT                   /transl_table=1
FT                   /translation="MSLRNAARAVARATARPWGRAAVPSNADTAVAPLRASGRRQISDF
FT                   PGGSNGDDAWATRMWNTMRARSRQRSARAFHSSSNAASEGGSATPTSGGGIMVASGHPS
FT                   SHPQVLVVPLNRRPLMPGVIMPVRVMDERLIQEIEEMKARGQAYVGTFLKRTEGESENV
FT                   SDPSDDMHDIGTFAQVQSVIRIPDISADTLKDEDEKGSSVGDDKVDIKAKAEARVRAAK
FT                   GEDGGGGATLLLLGHRRLRKTATVRHQPMVVQVDHIKDPKVADRDDDDVLKATANEVIA
FT                   TIKDLLKVNPLAKETLQYFAQRFQDFQDPAKLADLAASMCSADDGALQEILDTLDVRER
FT                   LQAALVLLKKEVELGKLQADIGRRVEEKISGDQRRYFLMEQLKSIKKELGMERDDKTAL
FT                   QEKFREKFAPFKDGAPAHAVKTIDEELNKLAGLEPSSSEFNVTRNYLEWLTSIPWGHSS
FT                   EERLDISQAADVLDADHYGLEDVKERILEFIAVGQLRGTTQGKIITMVGPPGVGKTSIG
FT                   QSIARALDRKFFRFSVGGLSDVAEIKGHRRTYVGAMPGKLVQCLKSTGVSNPVVLIDEV
FT                   DKLGRGFQGDPASALLELLDPEQNGSFLDHYLDVPVDLSKVLFVCTANVLDTIPGPLLD
FT                   RMEVVRLSGYIADEKRAIARTYLEKTAKERSGVGEKEASISDAAMNSLIEDYCREAGVR
FT                   NLQKHLEKIYRKVALKLAKAKGPEASKKMGQARNKVAAAKKALEAKEDELKKANASAKS
FT                   KKTVEAAEKEVEDAKEALAAAEAAVIEVIESTAVSDPIVVDAGKDLIEYVGQPPFQTDR
FT                   IYDQTPPGVVTGLAWTSMGGSTLYIECTAIHQNGTDKKGGTLTTTGQLGDVMKESSSIA
FT                   HTFARSFLARRFPGNTFFDDNALHIHVPAGATPKDGPSAGCTMITGMISLATDRPVKPN
FT                   LAMTGEVTLTGIVMPIGGVKEKTIAARRSGVTTILFPEGNKKDWDELSDDIKEGLEVHF
FT                   VSTYDEVYKHALSVE"
FT   CDS_pept        join(897837..897862,897948..898458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637588"
FT                   /orf_name="MICPUN_59451"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64190.1"
FT                   /db_xref="UniParc:UPI000199AD9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P7"
FT                   /transl_table=1
FT                   /translation="MRRADRHGDWLSGASRNPSASTGVWSSGDSSEPKGFFLDPALFHF
FT                   LLASGCSAESEARTTGGDWTGLGAGASAAFSSESPVASAASSGPLFEYDASSSLSFSAL
FT                   SRSTFAACLSLRACTPPRRFSDSNCSLALLRFFSVRVSRALIVARLFASTASALASADS
FT                   WISAAASLFTASTMH"
FT   CDS_pept        join(complement(898607..899333),complement(898478..898527))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637589"
FT                   /orf_name="MICPUN_101085"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64549.1"
FT                   /db_xref="UniParc:UPI000199ADA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P8"
FT                   /transl_table=1
FT                   /translation="MATTDTRRPGLDHPPADDAASQAHRDMTRLRIKIAHRIASLRLLQ
FT                   SEPKVAAASPAEAEDSTARLPGNEGLTSGIGLEDHRRHLRREDDDEEEEDDDADSQGGV
FT                   HKLEPHLRSWWRDLVKLARAFPEQACSSRRDAVSVLYLAQMAAVDKVRAAETYTRRVRA
FT                   ERDEIRARRRPGAGADPPEGGERSLELFKTPDWKKAKTSSSSSSSSSSSSSSSSSSSSS
FT                   SSSSGEDEDDFTRDDDRRLPGSSKPPSSRSIRQRAT"
FT   CDS_pept        join(complement(900204..900420),complement(899510..900069))
FT                   /codon_start=1
FT                   /gene_family="HOG000265184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637590"
FT                   /orf_name="MICPUN_105742"
FT                   /product="Predicted protein"
FT                   /function="chalcone isomerase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /biological_process="flavonoid biosynthetic process "
FT                   /protein_id="ACO64550.1"
FT                   /db_xref="GO:0009813"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="GO:0045430"
FT                   /db_xref="HOGENOM:HBG561631"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="UniParc:UPI000199ADA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8P9"
FT                   /transl_table=1
FT                   /translation="MIGFKEHIQGVRADVARRRNERRGEPPVEFRLRPVPTARRLWANA
FT                   MGGRLGIGSDGNRVALVTEPKTGLKLPGEYCVNGGKCAPLTGMGVRIKRIAGIGVKVYA
FT                   CGLYVNPASARAAVGDRYVGKSVKDVAKDQALFDVVNAAADVEKTVRLVFARDIDSAKI
FT                   RDALSERLRPALGADSPSLRRFEAYFDGVTFKKGQSLTFTASGGKLITSFGSKEAGQIA
FT                   DGKLCTALFDAYLGKSPVVPSAKESLGEQLAGHVTG"
FT   CDS_pept        900590..901390
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637591"
FT                   /orf_name="MICPUN_59453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64191.1"
FT                   /db_xref="UniParc:UPI000199ADA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q0"
FT                   /transl_table=1
FT                   /translation="MAPTHWEEALDASAVSRPGTTQYEPGPTWEAWEDELREEHEYDDW
FT                   ESKLQASAKRDPAMRPARVTTVDVMVREALVSGLGQDEAIARAAAAPPPPSPFHPPYKG
FT                   LGIVPRDRAPKREEDWWDHDDIHPDAHRAHGGANAETATYADGSPRKPPPHGCSNGVEP
FT                   GTGSFRSPRGKTLDWKPHLLREGEGEWFDPRELDQGVVRDTTEGRSWLQHPRRGDRAPS
FT                   RAGERYDAEWEGDGWYEQSPPRGETGGATSSETSSRTDTDESRL"
FT   CDS_pept        join(complement(902778..902840),complement(901536..902651))
FT                   /codon_start=1
FT                   /gene_family="HOG000171828" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637592"
FT                   /orf_name="MICPUN_108476"
FT                   /product="Nucleosome/chromatin assembly complex protein "
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64551.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI000199ADA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q1"
FT                   /transl_table=1
FT                   /translation="MVDMKEIKDSLPDEDDANDPDFAHVDKAEMLKALGQLGNNAGLIG
FT                   ALQHKLDDLVGMSSGFVESLHWKVRARVNALSEAQGEHDELYGKFLEEKRALEERYAKL
FT                   YAPLYAKRAAIVKGEKDVDAKPEDGDDADEEAPKGVPDFWLCALRNHELLGEQITEKDE
FT                   GALKHLLDITSRSLTKEDFPKDEDDEEEDDEEEEEPIGFALEFHFEPNDYFEDAVLSKK
FT                   YFMADMDDPILEHSEGTDIAWKQGKNLTVKVLRKKPKKGAAKNAKPITKTEKTESFFNF
FT                   FSPPEVPDEEAELDPEEVEQLQEAMEMDYEIGAIIKDKIIPNAVEWFTGEANEDEDDED
FT                   YSDEDDEDDEDDFDGDDSDEDDSDDEDAAPKKGKGKKGGADGEEKPPECKQQ"
FT   CDS_pept        join(complement(904853..904942),complement(903710..904716),
FT                   complement(903011..903443))
FT                   /codon_start=1
FT                   /gene_family="HOG000265426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637593"
FT                   /orf_name="MICPUN_59455"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64552.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG561633"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="UniParc:UPI000199ADA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q2"
FT                   /transl_table=1
FT                   /translation="MAFWGLKVEPGKWTPFVPPPDEALRLHISQATLGGGIPEDKERII
FT                   VKCRAEAEDEEGAQEFNICTIIGGVVESCHLDLIFDGYAEFYVEGSYPVHLTGYFMPDM
FT                   DDDEMDGMYDRQMGDDEDDDSEDEDEEYDSEDDADDFGVLEDFDDEEDEGDFDDSEDED
FT                   DSESESEQDDAPKKTKKGGVTIQEIEEEDAKPPAKKEEKKKRAAPEEPPAKKEEPPAKK
FT                   EKKEEKTPAKKEEKKKEAPKPETPASGGKQLKREFKNGMEILNVAMGQVDGKKAEPGKR
FT                   VTMKYVGKLQSGKIFDQTKGNATFQFRLGIGEVIKGWDVGVAGMRVGDKRRLTIPPAMA
FT                   YGKKGVKGAIPGNATLIFDVELVNVHLDAANTSPMRPAPMTKPAISFAGGSALGGATEA
FT                   RDRAGRMDTRPVGCAATDGTVGIATTPICHVLARLNSGGAWDNFWRSSLVAGRSTQIRP
FT                   PPLLSFRSFDLGCRLHPKPDFTFKTTVNFENSRVINLHFVYQITYQSQNDS"
FT   CDS_pept        903261..903575
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637594"
FT                   /orf_name="MICPUN_108477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64192.1"
FT                   /db_xref="UniParc:UPI000199ADA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q3"
FT                   /transl_table=1
FT                   /translation="MGVVAIPTVPSVAAHPTGRVSIRPARSRASVAPPRALPPANEIAG
FT                   FVIGAGLIGLVFAASRLDGVIADAQVRGFERDKDERWKKTTKSVEGGGNIFILPDDEEE
FT                   "
FT   CDS_pept        906108..907571
FT                   /codon_start=1
FT                   /gene_family="HOG000244181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637595"
FT                   /orf_name="MICPUN_108478"
FT                   /product="Monovalent Cation:Proton antiporter-2 family "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64193.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG561635"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI000199ADA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q4"
FT                   /transl_table=1
FT                   /translation="MERTRTEVAKGAAIDDAEWSKVVDSVDVDLALLLVSVVAVVPLCK
FT                   KLNVSPVLGFLGVGLLLNQEGVFSENREVDQFCELGIQFLLFEMGLELSVQRLKALGKY
FT                   AFGLGLCQVVFGNLLFAAALLPPGEAFGTKVLEMVQSGRGVDDLLQIRSPLEAIVVGFG
FT                   LTLSSSALGLQLLSDRGMMTTRLGTASLGVLLFQDLAVVPFIIALPVLQKMQSAGAGDG
FT                   LDVGLMAAYTATSFLDLGVLSIGGWFVAKKLYEVITELECDDDVFVALSLLVLFGFSNA
FT                   SAAAGFSDSLGAFIAGLVLAGTPYAHDIIGKLRAFKGLFLSLFFVTIGTTIDVPLARDL
FT                   FPIVTLMTAGLMAGKLATITALGPLTGLTWREALVAGAFLSQGGEFAFVIFGQATSGSG
FT                   GALFPQNLDELLVVVVIVSMALTPLAVDAAMAIAGPTLDLSPCDASEDPNGSCDVAWEM
FT                   AESYGQELPVVEGEESVLKSEATPAEFND"
FT   CDS_pept        join(907642..907902,908022..909133,909265..909276,
FT                   909700..911659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637596"
FT                   /orf_name="MICPUN_59457"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO64194.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR015683"
FT                   /db_xref="UniParc:UPI000199ADA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q5"
FT                   /transl_table=1
FT                   /translation="MKALATMPTLSRTAAVARVAPRGSRSHRCPSPLLAAPRSATCLPR
FT                   RVVRSEARGWPRPRAVGLGLATRAVADDGTVASSALDPHSFEGTRALAKLAMLVYWNAG
FT                   QDGFWDPTYDGTGLDLSTPLGFEPLIASDPAALRREVLSSLVPGEPALWLDPDPGMGPL
FT                   TPSFATVEEARDAALGLVKPSPPVSRVAVVRLAKPDWIAVIFRGTTPSPLRGLLREGQV
FT                   NSMAGQETWEETPLAWVRGDDEGPRVHRGYAAAYRTVLAEVEGAVTAHARAELEARSKA
FT                   SAGSSQDTPPPCKVVVVGHSLGGALAALCASRLAHDPDVTRLGAQVECVTFGQPRVGDG
FT                   EWASGVDERTPRLTYTRVVKAGDLFARVPTSGFWLPGGNGGRLRVEYAHAGALVWTSET
FT                   DEKVRASAGRGEAVPAGFWTDARMANPISVARDHAGYAYFFEKEELGRAWPSRDALFPS
FT                   GIPCHATVDGTTYRAPADDETIMSIALGVLTTLVLVACRPVAAQSPSCPCLQTASWPIL
FT                   GTDRITNASCNRVLVGGEVHCYPSTYGLGSCAKHDENREPHCDGSSPASYCAEPWCYVD
FT                   PVTCRGSTKRFAESDILIDGGSKAYYSYDTCGGDVSKWNNLVVNSLLNGKTLRAAVAIP
FT                   YYYPDHYIEDAAGEPIKSAASYAPADLPAGAKVKGIWIDFYNKIAQQANFTLDWRPVSG
FT                   GSKGAHSSSFTACAQDVADGIVDLCVGDYWTTEERLSMTTFTTGTLTDTFSVLHRKQVN
FT                   APATLSSKLAMAGAPFSIELWMTCLAVCVATGVCYNTLRVGYKEYLPKISHKEMSTGQK
FT                   TIAWLKGSAAYTFGAFLEFTSQDVQAGYDAKGNPVPNRAYELNLVKMAWSLFCMFTLLT
FT                   YTASLTARLVRNDGGKVGITTLDECQQFKCKVCVPGVMMNTMKRLYKDRILYHASSSST
FT                   NVFRDLEKGECDLGLMIERRFNTMWSSGEYKLDAACGFEIGKAVMPIGCSQPVRQEYSA
FT                   AISFWAKKVADKDYFLGSLIEDTYMPSPPCPMAEVIDLSAKSLGVDAFFAPLIIYVILI
FT                   CFALASRLFFTKRKHKRSFRMPFSFSFKGRKSVEKPPTSIEAPPSSNGQAQMAADELPP
FT                   VPERARA"
FT   CDS_pept        complement(911775..912542)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637597"
FT                   /orf_name="MICPUN_101091"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64553.1"
FT                   /db_xref="UniParc:UPI000199ADA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q6"
FT                   /transl_table=1
FT                   /translation="MAPALKAMERASLATEKASEQMEKAAAEFEKLSVQTNIDLPRTLE
FT                   EMEKASEEWDALGEELREIIGNVERWGKFSGAEEALTKLTESILEEPSRAIDGARDEAE
FT                   SYLKRLTNDFDRAMGQLSDWERQLKGAVEGWEQSWDENARFIDDGLDGSGDDVDVKARD
FT                   EMIERRNARRAKVKEALAAAEAATEQAREASRALLSDDSGDDANGGEDAQTKEEKLLEM
FT                   GKQADEVSQRMKVALLAMEEAKGETNSARDSWK"
FT   CDS_pept        complement(913142..913906)
FT                   /codon_start=1
FT                   /gene_family="HOG000240872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637598"
FT                   /orf_name="MICPUN_83134"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /protein_id="ACO64554.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="HOGENOM:HBG745859"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniParc:UPI000199ADA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q7"
FT                   /transl_table=1
FT                   /translation="MSLEGETQGSDKWLALRSSRLTASAFSNACGFWRGGRNELWEEKL
FT                   GLAEPFAGNEATEWGSGKEDEAVAAYKNLTGADVSHMLFRVLSPDEAELWLGASPDGLI
FT                   AAPGAADVDPATGVPPGVLEIKCPWNKGDPVGAKPYPRAPWYYVPQVQGLMAVFDRQWC
FT                   DLFCYTVEHGSAIYRVERDPEYWAMMYRALSDFWWQHVVPGKHAIAAGEDPERFRPSET
FT                   HALTDELKRRSREISNAAQMRRYTARDTRGSG"
FT   CDS_pept        join(914903..915019,915123..915506,915642..915704)
FT                   /codon_start=1
FT                   /gene_family="HOG000238056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637599"
FT                   /orf_name="MICPUN_59460"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO64195.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG397974"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199AE6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q8"
FT                   /transl_table=1
FT                   /translation="MDSDDEQRGPVEVTFRDLTPENEPELRRLNSVVFPIRYSDKFYQE
FT                   CAAAGRVTQLAYIGDELVGAIACRLELTPLKSGARLYLMTVGVYAPHRNGAIGTRLLRH
FT                   ALNEGSADTFIEDAYLHVHTPNTEAIAFYKRFGFVEDGVVQNYYKRLDPPDAAVLKLNL
FT                   REWKREPLAKVRYGRGANGAEPGE"
FT   CDS_pept        join(complement(916697..916758),complement(916288..916387),
FT                   complement(915960..915968))
FT                   /codon_start=1
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637600"
FT                   /orf_name="MICPUN_91099"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64555.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG589144"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI000199AE6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8Q9"
FT                   /transl_table=1
FT                   /translation="MGFANIWATKAECNGKGQRRCRVCANQWGIIRKYNLNICRQCFRE
FT                   YAKDIGFVKNN"
FT   CDS_pept        join(917341..917721,917773..>918291)
FT                   /codon_start=1
FT                   /gene_family="HOG000196669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637601"
FT                   /orf_name="MICPUN_82640"
FT                   /product="Predicted protein"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="ACO64196.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="HOGENOM:HBG736470"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199AE6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R0"
FT                   /transl_table=1
FT                   /translation="MSSIDVEELEVRVRRRLALVDARRADSIPGDARARSEDARSGKGT
FT                   ASRERRLPSDGGVVAQKAASDVATIASACEGIAIFDSLRAEDRDALFRAMYRLEYAAGE
FT                   AVVRQGEEGFNFYVVVAGSAAVTEEDTEVRTLWPGDTFGEVALLHSVPRTATVRCGLKA
FT                   TTVWALDRETFKRTLSRGAFQRREAYERLLGGVKTLERLDEYDRKRLADAVVPCAFARG
FT                   HAICVRGKAEGAKFHIIERGECSVELVGGKEINRLKPGDYFGEVAALQGAEPTATVVAL
FT                   TGVQTLSLDRDAFVRMLGP"
FT   CDS_pept        918832..919641
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637602"
FT                   /orf_name="MICPUN_82505"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64197.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AE6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R1"
FT                   /transl_table=1
FT                   /translation="MRSFGDSPFVMQSLCSFQDSAHLYLVMDFMPGGDLFQLLVNGTEK
FT                   GVFAPPAAVFYASEVLLALEYLHGRGYVYRDLKPENILIDGEGHLKLADLGFCKPLRPG
FT                   ERTYTTCGTSDYMAPEVMLSQGYDRSADYWAFGVLVFEMLAGYAPFQAKSDSQRHRRIL
FT                   TADLRFKDGFQLRAKDLVSKLCVVDTSRRLGMLSGGVDDIKRHAFFHERGKTDWAARAR
FT                   REATPPLMPVIRRAEEMTRGEALKSVARATAAEAPSPASDRVFSEYY"
FT   CDS_pept        919825..924684
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637603"
FT                   /orf_name="MICPUN_59463"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO64198.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="UniParc:UPI000199AE6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R2"
FT                   /transl_table=1
FT                   /translation="MGIGDDGRDAAGGVARDEIVRELVREPKGSDGRSEKGEVGERGDP
FT                   RAIDELRRYVCRVLGVDPKVEGESVVPFNGVGSSATRVDWARVGAICRSWRDGEASEDD
FT                   GDGANEANEANEANEANGADGADEADEADGADADDPKLTAAQERDLAIGRIGPRVVAVE
FT                   RASASGDMHLGDGPHGPNTSVSSRSNFCSFRANACVFGGRWQYEVTIRTAGIMQIGWAT
FT                   VRCPFTQEHGVGDAQDSYAFDGHRVRKWNVACQPYGQPWVPGDVITCCIDLNSDEDGGG
FT                   TVSYLRNGASMGVAFRNVRRSQPGLAYFPAVSLSVNEAMDLNFGSSPMRYPREGHAPLT
FT                   AAADVAPAWRKSVEAFARLCAFGGVDDPAPSNVTYRCEASGTMYRQSGTPALLTWDDEA
FT                   MLACATLQAAGPAEGIDEDDAVRARRRLIRDRRRGLIRTVTRAGERRRVDEFERTMRLL
FT                   RVGLYDGRFRVELNEMGPESGDEFDYANFSNSEYALFVGELTRALAEEVRSTPFLEDPE
FT                   SIQGTSSIEPGASEKTSGLPSHSPLAFAVAIACDRYARRAWMSHAKWHAELEDLLTLKS
FT                   PSPRDLEAMLPASSVWWPGAAASEAVFRAADGGRHAGGRESEQRCKAAGLKLSAAMSRS
FT                   CALHCGLVDAVWNHGGKAWQDRSGECVIMQFGPGGPFGAHGTIWLAALLKKNVPGQHGR
FT                   ARRTDPSVMGALYFAMLALIRPELENPTWKPFFDGLGKWHPLGYYNSFAHQFDLPLFGG
FT                   GVSHVRKEYPEDHLAPALEIDASALRPTAAMKLVNDVPDFSEAGLPPLTWHQKHANAWH
FT                   FDSIQFMYHLAVGAQYRSAAGQLQTQIQAAKHLEEYCENLPKVEAAHQRHNAQTKIMTQ
FT                   LQSISNESAAYPPGENASEAFIQRLRAALTEARQLASQGLVSDEVAGAIAVATRDLQER
FT                   YDVALVDEGAEFTAAADEARESASVFIGELKEEIVKLRDEVVESSRVCWWHRATLHRPE
FT                   QQAGMFAAAAYQARVILAAMERGGEPRKLPSDTDDEDGDGDDGGSVSSAGDSSDDEDDD
FT                   DEEEEDAEAAGGDGSELEGSVERENVDTDDDENDDENDDENDGDDTAGSCSIPGVATKK
FT                   GALLQHVPAYHLEVLIDSFHALRRGDPPYAPVAPARAAASPGLHGVVKLLVRHFADERV
FT                   VNPDVRDMMLQSVSVLLQYKEYVAVFEANEEARAEMVPSLLRSFDSRFWIPVSNILLRL
FT                   CKGVGFGQYDNKAIKVLAAIKAIKKDSADRYRETGNVAVVANSQRGEDDHAASPDAALA
FT                   EAIANSVDSSSPLFQALIVETFKSDPKLLEKFLDRVFNTLNWTITEFGVALKEMLDMRQ
FT                   RAAAARNLQRKCTVMLELSVTLERVLEFLTLELPVAFLDSSASMRMKRLVEILLFVLGH
FT                   TCGAGSDAKLFEQALSMKLPVFVADKISRAPVLAPIAGIILNLEVAAAAWVEGRGEEFG
FT                   VNEVSDTVADELAAGAGENNISQLEYICAFDWEEHFGAFTGREEAIAELRDVVRRVRDT
FT                   REDIERRRKAEDEVDVPEDFVDPIMQSVMTDPVTLPGSGVVVDRETIRRHLLTGDGTDP
FT                   FSRTPLDESMLRDATDLRKRIDEWRSGLHKNVETALEDID"
FT   CDS_pept        complement(924778..925653)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637604"
FT                   /orf_name="MICPUN_59464"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64556.1"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199AE70"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R3"
FT                   /transl_table=1
FT                   /translation="MASRRSKKQPEAGGKAGLAYIVAAVAVLIAIAVKFAPPGLLNDVA
FT                   SSSSASGNARRAMTIEGSRIPAIEAFDASGGVVAVAKDDGPYDAALVIGYGVDNKFPST
FT                   PALESRTLLGAQLFCAKSAKNLILTGAPVDYSWENVSPAETMRHFAEKLIANYTKTEYV
FT                   HDSYPKCPLPGFGYVYPGPPEGASKDGRGEHRRIRELTGNSGGCEHRARRHTCVGKKFT
FT                   WVLEEASMNTRESAIFSFEEAKKRGWSKIVIVANDDQLRTAKVYASVAEEMAAADPEAA
FT                   MTIRVARTPD"
FT   CDS_pept        join(926030..926080,926277..926354,926517..927140)
FT                   /codon_start=1
FT                   /gene_family="HOG000265427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637605"
FT                   /orf_name="MICPUN_101095"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64199.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG607700"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014646"
FT                   /db_xref="InterPro:IPR014892"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AE71"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R4"
FT                   /transl_table=1
FT                   /translation="MPTPTGATGAATGAAGGRGQGRPDSLVPVTVKMLQTAIAASNVDD
FT                   GLRVNGEEVHNITLLGKIIEASDTATNQVYTLDDGTGTVIVKQWVDADDADASSRKDEL
FT                   VVGKYARVYGHVKQFGSDTSVVAFSVRPVQDHNEVTYHFLEAVYCNSHNAQRADAKPAA
FT                   GTAYAAPSSAPASAPAVDPGGSCVDQAKAIFEGPDGRRDEGVKIDVVVQQLNGRFTEAQ
FT                   VREAVEHLVNEGHLYSTIDDDHFKSTNL"
FT   CDS_pept        complement(927255..928496)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637606"
FT                   /orf_name="MICPUN_59466"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64557.1"
FT                   /db_xref="UniParc:UPI000199AE72"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R5"
FT                   /transl_table=1
FT                   /translation="MSASESPAEKCSAGHDMSLRPKKRAAKDEEDSKEDVQGRKAAKGS
FT                   CHCCGGMLKRNPDFAKVCGTCGARFHTYDCGNRRGDVGFRDYSNCLRVSHISARIRRGS
FT                   RPGTGAPHQPIQKRCLLREGCFHWVTRRKKSPGLPIPPRPRREKKTGTHPAPFRPLRSP
FT                   KQCFKMCACVDGPVVCHVTALRQSRQAKRSHAGSVCLAGPTSGPFGADPSSKSGSFDLD
FT                   PASESGSFDLGKETPSLHAVAPLGSDYFDEPDEAFGCEEDDAYGFDAGCVRPAPADDVN
FT                   PVRVAAAVSKNPATTQGVAGAAGGFVKYVRHEWLPVDLGVENEALRREVEELRREEEYL
FT                   RTQLRLARREAKSMVRAKTLSDISDMVRKEREGGDRPNNLLPATVAEITDNAWTTEMTK
FT                   TYKEQADWAGLVKS"
FT   CDS_pept        join(complement(930345..930489),c
FT                   omplement(<929635..930290))
FT                   /codon_start=1
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637607"
FT                   /orf_name="MICPUN_82554"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64558.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AE73"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R6"
FT                   /transl_table=1
FT                   /translation="MKPRRWTKGDCLGSGSFGTVYLGLNGETGELFAVKEVAMTRRTGD
FT                   TGGEAVEQLEQEVELLSRLQHPNIVRYVGISRESRALYIFLEYVPGGSIASLLSRFGAF
FT                   EESVISVYTRQILIGLDYLHSQRCVHRDIKGGNILVEKSGRIKLADFGMAKSLVEQMAD
FT                   GGSFKGSAYWMAPEVIRQKGSGNHPAADVWSVGCTVIEMASGEHPWGDCSGQVQAIFKI
FT                   ASTKELPRVPEQLSPAASEFVLMCLQRDPDARPDSEALLLHPFVV"
FT   CDS_pept        931438..933645
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637608"
FT                   /orf_name="MICPUN_59468"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64200.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AE74"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R7"
FT                   /transl_table=1
FT                   /translation="MSDTSPAPLTSGRATWADRDAGRGRDIQVGSMGDQSRASEPAARS
FT                   DARDSAKTNGSEASFEDNATRHVTRRGARRCLLTASLVACLVALLIVPVPVIAASSPKT
FT                   RRWADPNEVKAGEASETQREEIRSFFSSLDADGDGQVRGDELGAYVASSVGGKDFDTDV
FT                   EVADAVRAVQERIDGQDTGDAIDAEELMVSLTSTKNQMLRPHKVARWVRHGLNFPQYAE
FT                   RFMSHGITLLDFPALLADDGAALREELGVESALHRAQLTRALKRQLLQLGRSPGEPTDV
FT                   RAAVVAEDVVVVKWRPPRQHGHPPVHAYAVQVREPGSHEWRVCGGATHEDEDDEVHSAK
FT                   AFVTPTREMAAAALAAGVGNGRNVPLRFRVVAWGGHGGGVSDESASVEMKPLRRSYKRE
FT                   GVRAGGGQVESDSITAGNTVVTGSNPRVRTATGSNRSTLLGSLYSALGTFLIAAGIATR
FT                   FALNGASFVATRGVQFLLRRPKSHRENAAADSGAREPPPRTDEATANGDEDRASPPPPG
FT                   LAGPQPRYDRARVLESAMAAAVAAGVADASDEAILSSPSVAAVNGAVVGSNSANGSFYA
FT                   SDDDDDDDDTAGDIDVAPVVCGLSSEPKKKGRCCVVGCNARWDRWSSMGDFRMMYQKHY
FT                   CGLCQRAYCQAHTRVSPHGTKGRCDPESKCYCAVCWDDLNAATREALEATNRLPRREPT
FT                   SGSATPDARKRAKTRWRSVLNYKLRTPSRAENLNLMDEDVE"
FT   CDS_pept        join(complement(934934..934985),complement(934732..934788),
FT                   complement(934011..934549))
FT                   /codon_start=1
FT                   /gene_family="HOG000216664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637609"
FT                   /orf_name="MICPUN_82870"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="nucleocytoplasmic transport "
FT                   /biological_process="signal transduction"
FT                   /protein_id="ACO64559.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006913"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000199AE75"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R8"
FT                   /transl_table=1
FT                   /translation="MAQTPTFKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVAVHP
FT                   LEFHTNCGPIRFDCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDI
FT                   TRVCEDIPIVLCGNKVDVRNRQVRAKTITFHRKKNLQYYELSAKSNYNFEKPFLYLARK
FT                   LAGDPTLQFVESPALAPPEVTIDPAEQAQYEAELANAAAQPLPDEDEDLGDA"
FT   CDS_pept        936455..938173
FT                   /codon_start=1
FT                   /gene_family="HOG000294940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637610"
FT                   /gene_name="SSIA"
FT                   /orf_name="MICPUN_104862"
FT                   /product="Glycosyltransferase family 5 protein "
FT                   /function="starch synthase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO64201.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0009011"
FT                   /db_xref="HOGENOM:HBG596384"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniParc:UPI000199AE76"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8R9"
FT                   /transl_table=1
FT                   /translation="MRVEQAARVTGVTPRPPPKYEKTEWPLSIVFVSSEVTPWSKTGGL
FT                   ADVCGSLPRELVKRGHRVMVVSPYYQRGTKEDKYFEGAFDTCSNASVGCFGAAHEVGFM
FT                   HQIHDGVDFVFVKHDCYERPGGIYADAMGNAWDDNQFRYTLLSHAACEAPLKINFEGKG
FT                   TYGDEVVFVANDWHAGLVPLVVASKYRQYWNTYHNARTITVIHNILHQGSEPATTFPNL
FT                   GIPDDWYWCLEYQYPEHMRAHELDLGLVVNILKGAVATSDRVLTVSEGYAEEICTPLGG
FT                   KGLEGILTERKHRLDGVVNGIDLDEWNPANDPHCEFPYDVSNLAGKLMNKRALQRELGF
FT                   DVRDDVPLLGFIGRLDWQKGPDLIRDSIAEMMNEDVQLVMLGSGIGELEGFMQWAEATY
FT                   NDKFRGWVGFNVPVAHRITAGCDILLMPSRFEPCGLNQLYAMRYGTLPIAHATGGLNDT
FT                   ITRHNPFALDDPEVAVAAAIASDEGEDGNREMADLGPGTGWLFDSMDTWSFMYCVSNAC
FT                   KLFRENPRMWRAMQIQAMSQDLSWYHAALKWEKIFEWSKIDPPHCEIKQEHHHHY"
FT   CDS_pept        complement(938376..939371)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637611"
FT                   /orf_name="MICPUN_101100"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64560.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000199AE77"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S0"
FT                   /transl_table=1
FT                   /translation="MAYRALGLGWGRALAARVAFDSLESSVASHRRFTSPLLGAPLVRR
FT                   FGGFYPNDPWHQTPGTSGEPRGESARRSEPAPDRTERELRGLLEDLMGARQSRPASLGM
FT                   DEAAEALTRWWARETRNGGGDPAPLSSRRASVLVPLSRGPDGGVQVLLCTRASGLSTHA
FT                   GEVCLPGGKNDDGEGDVDAALREASEEVGLSPGDANVLASLPPFLSKGHVSVRPVVAAI
FT                   PDDFEPVPNPEEVDRCFRVPLESFLTKEGYSFRDWEFTRGKRIRVHRFERGGHDVWGLT
FT                   AVMLVRVAEIVYGRQAEFAMSPPGPGGTDIQSIVSEEHPSANMEPPRSMM"
FT   CDS_pept        941686..944481
FT                   /codon_start=1
FT                   /gene_family="HOG000294940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637612"
FT                   /gene_name="SSIIIB"
FT                   /orf_name="MICPUN_104863"
FT                   /product="Glycosyltransferase family 5 protein "
FT                   /function="starch synthase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO64202.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0009011"
FT                   /db_xref="HOGENOM:HBG596384"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniParc:UPI000199AF21"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S1"
FT                   /transl_table=1
FT                   /translation="MQAEAEARAIAEAEEAKRKEEEFLANIEVEVAKSAIDHIANAPGR
FT                   NLYFTVPEKLVAGKPAKIYINTANSGILGGRHSVRLEAGFNDWKLDKFDTSMKPAGPGG
FT                   FFYTDFVVPELAYCFNCVFEADNMYDNNGGENWYEEVHYGKTKEEVEKYFHDKKIYEAA
FT                   LEEATKEIEVEKYEQGNRKEGVAEGELHKDGRCIVKSDLPVKPGATVQMMFNKAMNPIG
FT                   GDGKIRIHVGFNKFAQGFEQEITMELVKGAAMDDQNYWWGATVKIPPTAYTVDMVISDE
FT                   AEDAWDNNDGNDYRLLVKGGGNATNEEWDARIQERMAYIAIQKELEAKRQKEALRARRL
FT                   RKAEASKKAREVTVRQTQHILTTEPTHPVAGEEVTITYHPENTNLGMAQEVYLTGGFNR
FT                   WTHPEPPGAVKMEANPDKLGVGSAVTCKIKIPEDAWMMDFVFSDGIAEGSTYDNHFGKD
FT                   YHIPIEGSTEEKPPLHVVHVSVEMAPIAKVGGLGDVVTALARAVHDQGNMVEIILPKYS
FT                   FFNMSPMLGGMQYETQFEWGGTTIVVQRCIVEGIQVFFIEPQNGFFDVGSVYGRNDDGV
FT                   KFDYFCNAALEFLTCTQRQPDILHCHDWSTAEVASAYWGNYHHYGLWKPKVVFTIHNMN
FT                   YGQMKIGEASFHSQITTTVSPSYAGEVAGHPAVNQNLHKFHGVRNGIDTEIWDPETDQF
FT                   LPMNYNADNHEAGKRAARETLQSRFGLTWGSDQPMVAVVSRLTAQKGLDLIKHAIGHSV
FT                   KRGAQFVLLGSAPDPRVQADFNAMAGHMGGPNAAFCFAFDEPLSHVVYAAADFILVPSM
FT                   FEPCGLTQMISMRYGAVPVVRATGGLRDTVFDLDTEKARAAWEVDGSTDFKETGDQTNG
FT                   FSFEGTDPEALNYALDRALDCYYNDKVWFRTLQERIMRQDWSWNRPALDYIELYYSAIR
FT                   S"
FT   CDS_pept        944822..945529
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637613"
FT                   /orf_name="MICPUN_101102"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64203.1"
FT                   /db_xref="HOGENOM:HBG561645"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199AF22"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S2"
FT                   /transl_table=1
FT                   /translation="MTTTARCAAATSASARRSAFLGGRTPVAASARPAPPARSSRGAPV
FT                   RVVSDVRKDWKSSKSMTLTISDEDATHTFESYISDGERIISVTFPDQARRRKLSDTTWE
FT                   VQLLPFSFMQWRATVFCTLRLEPVSGELRLSAEDLRIDGLPPELGVDGKVWLTMDGALK
FT                   PARTAPAGRRKVLGKITVNLSADVNDAVAMFPGLDDAVNLINDTVISNLQGSINATIAK
FT                   DYAKWKVAQRVPA"
FT   CDS_pept        945726..950060
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637614"
FT                   /orf_name="MICPUN_101103"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64204.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199AF23"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S3"
FT                   /transl_table=1
FT                   /translation="MAGPYARSPEKASPSTGSPLTRDIPGSPSRGGSKRAPRSAPPRPS
FT                   SDVSRQLRSPVKSVYQDALLEGFMGKYGPVDDASIAAADKHAIELKKRYARARTEEERE
FT                   RWINLASEATLKANMMRAERDFLQRQGREVRGAARVDARGAPAHRTFVGTDEEHAAAVR
FT                   MQRIQRGRAARDRVKAMRRERASNREASNRARDDARVRHDAAARIQAAVRAKTARERVG
FT                   KMRADERVAAARARVARNAAAERAARWREPEPSFESPYLHSAASSREATPVKSRPASAS
FT                   SQKEAAATTTQLSTTTTTAVSPSGRRPASGITFPGEDDHVRRMRAFRERVEAKANAIGA
FT                   LPARRTRPAPPPKPSPAKSILKSPADRPRSSPGAIEYASPRRGFLDDDDALVRSAQPPS
FT                   PGDAHRSREARPREARRSLRVSFELAEDRERREEDSPATLARKAELAMDERFRPRVPRD
FT                   AVAAARDAERALAAAEAAVATATRNKAARDRVKARAGGGRATPGRKIVVVDEDSERSRD
FT                   RIPLSPSPSPRRTQSSARRTPPTAGRSPSLELSPSPVPATRAPVRATARAFRPSKNERA
FT                   REYNNRLREREHRERLRRRERSVQAEKAAAVRAGVSVADHLDSKLTARQRAAAIMRQVD
FT                   AAQRNSETVAGIFVSYVAARKSGEEIDRRHAKDVAAMARSMPAFRALPPVHVADALAAA
FT                   EVSRHATGSVIFHEGDRGDALCVVVGGEVALFQKGTNLKGPRELAPDYELLWATESVRR
FT                   GREGADAAFRLAKPGDKRPGSAVTPTKERRTRGKGGHQGGGGAYDGDDGIITDAAHDVQ
FT                   AAALGAPKHCGRLARRVRLGHAFGEKAVTRRGGEARAATAVALSPVTVLAINRFKYAAI
FT                   MKAVGATESADVADFLRDTELFPETRVSDEDLTELASKLVVIRAGPGDVVVAAGDHAKG
FT                   AFFVRSGRAKVSATARVMVEPPSDEVVRRDVGNDESRDGFRGASVRSSVRSSRDSSYDA
FT                   EARSSSSLPVSPLRPRTGSGGGAWRRAPTYETRDVPLGELVPPAIFGEECLVPFEYSDE
FT                   AGGGVGPGRHAFTVRVDPEGDPHGAVFLRLPPTYLASLPAVVAKRLTQLAKSTSAASKE
FT                   ATKALDDAGSELRRSTEGGGWARRSPSSGGAAPPPPARSVASPSVRAGFGTSAAPRNEP
FT                   TAALDSARYVGVEEGRAPIGVGLGGGGGRTREVGTPSALARQARRDSRVRPATALAAMT
FT                   RTEMRAGGFVPSSPSGGPGGSARRPRSAVVAGASPVRPYAPSSSLDPDSTFEDYLDHDD
FT                   DADASFGSPWGTPAKASSSAGYRAAMARELRSSILGPPAIGSAPGRAGASRGGSTKAWR
FT                   KAPDVQVRLTKKAAALAEKNRPIREWRERGRGREIGGVDDDGYFSSRPATATGAGAGRS
FT                   TAGVVGDRGRVRPATAAAAMDYGGLWGDDAYDMGGWTRGSKL"
FT   CDS_pept        join(950417..950548,950804..950965,951138..951377)
FT                   /codon_start=1
FT                   /gene_family="HOG000265173" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637615"
FT                   /orf_name="MICPUN_105748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64205.1"
FT                   /db_xref="HOGENOM:HBG561647"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AF24"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S4"
FT                   /transl_table=1
FT                   /translation="MGVDDHDTFSGLTPLQQAAQEGDVAKVVELLDAGADVNIQANGEM
FT                   AGKTAAMIAASNGNTEILKALGRGPSLLDLKDADGGTAAMTAAVHHHGSVLDYLIEKHV
FT                   DLNATDSDGWTALMYAVTVGDAVCVEKLVKAGADISIKNADGETAIDLCKQSKKRYPLI
FT                   QIIDPKEPLPDITE"
FT   CDS_pept        complement(951573..952706)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637616"
FT                   /orf_name="MICPUN_108486"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64561.1"
FT                   /db_xref="UniParc:UPI000199AF25"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S5"
FT                   /transl_table=1
FT                   /translation="MGLGGSKCCKDLCSTEEVKKPLVDPETGRVPRAGTGGGGRDDERR
FT                   EGDRGRRASEPVEPDPAVFYSRPPRSRSQRRLVNNDTARETASDRREARARKHHHRSNQ
FT                   KVGEETVLRFHQENPAKAPIVGSSSEDDIGAKPASATRADDVSPARSVEKDEEEKNWIG
FT                   VCDAKLQHRVWWWSITFVLFFVVGMGVFLGLAHGYRPEREDHPTSPLYPKVSVLEDEPD
FT                   VVVPVRHQKETTHRSKETSTIRTPKPSAGPDASTQMLREWEAMDESLWSERDHQPARRA
FT                   DKGVKGTAESSKASAMKVKERAGLAHSRKMTPGGKAKERGDKQGAVKRDVAPPGELESI
FT                   DSPLEDPRLRADLNAAVSRLLRKEIESVGTDAPSSTH"
FT   CDS_pept        953597..955006
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637617"
FT                   /gene_name="TEF1.2"
FT                   /orf_name="MICPUN_91112"
FT                   /product="Translation elongation factor EF-1alpha/Tu "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="ACO64206.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199AF26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S6"
FT                   /transl_table=1
FT                   /translation="MATDGKEHLSIVICGHVDSGKSTTTGRLIFELGGIPEREIEKLRA
FT                   EADALGKSSFAFAFYMDRQKEERERGVTISCTTKEFFTDNWHYTIIDAPGHRDFIKNMI
FT                   SGAAQADVALLMVPADGNFTTAIQKGNHKAGEVQGQTRQHARLINLLGVKQLIVGINKM
FT                   DCDTAGYKQERYEEIRNEMKNMLMKVGWKKDYVEKCVPVLPISGWQGDNLIKKTTNMGW
FT                   WSGVDVIDYEMKGDKHHIDTLLDVLNGMVTKPPRNDAADMRLPISGVYKIKGVGDVLAG
FT                   RVEQGVVRPGEEVVFIPTHTVSNPCVGKVFTVEMHHKRVDEAHPGDNVGMNIKGLDKIN
FT                   MPRTGDVMIYKKDTTLKACKNFNAQVQVLDVPGQLKPGYSPVAFVRCGRSACKMTELIF
FT                   KVGKETGGKKMESPVALKSNEVAEAVFEPQHPFVVDHFKACDGLARIAFLDGNTAVMLG
FT                   KITKVQFKEDK"
FT   CDS_pept        955398..957704
FT                   /codon_start=1
FT                   /gene_family="HOG000258203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637618"
FT                   /gene_name="IFT88"
FT                   /orf_name="MICPUN_97580"
FT                   /product="Intraflagellar transport particle protein IFT88 "
FT                   /function="binding"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64207.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG315509"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AF27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S7"
FT                   /transl_table=1
FT                   /translation="MDDDDDLYGGYTATSSSFNPAPNDDEFNYDAPTAAGGPGGPMRQG
FT                   TAGGRLGTAAPARPMTASNKAAGYSGGRPGTAVAGGPAVAGGKGPAPPLRKKPEDGPDV
FT                   AIKEHEAKCHELLEASSRAQINKDWARAVETAREACKRERQLARVRENAGMGDSQNLEL
FT                   AFATQLCLGNALEGNDQIADAMDTYTQIVKNKAFVGGGRVRVNMGNVYFNQKDYQKAIK
FT                   MYRMAIDQVPANQRWLRMKITRNVAMAFIRMGQYVDAANTLGEIMDNEPDVHTGFQLVV
FT                   CHYAVGDKDKMKRAFIALLKLRAYESDEPDEDGDDTAGGAGLGATRRGATADDVLGDDG
FT                   LRQMMREKQLEARRKILQAAKLIGPKIAGNEELGYEFLLEEMHAHGYEFLANELEMEQA
FT                   LAHLRGRGANFEEGKRALKEFEKKEHALKARAATNLSFLYFAEGDFENAEKYADMSVES
FT                   NRYDASALVNKGNCMLQRGDMEGARDCYLEAVGVEADCVDAIYNLGLVNKRLEQYQDAL
FT                   VNFRKVISIIPNDPEATWQLADVCELMGNRSMAIKQFDLLHARLPTDPGVLARLGALHA
FT                   EAGDEAKALQCYNESHRVYPPNIPVIEWLGTYHAQQRAYEKAHEFFAFASEVKPRDTKW
FT                   PLLAASCQRRAGKLADALETYKSVHARNSDNAECLRHIVNILTDLGRTSEAAEYDEKLS
FT                   AAESRGAGGGGDITAETQKPLIGRAKLEMPEGGLPPDEESPHAPETPGKALNQSVMSDE
FT                   FGMGGVLDDELLPGM"
FT   CDS_pept        complement(957903..959216)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637619"
FT                   /orf_name="MICPUN_108487"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64562.1"
FT                   /db_xref="UniParc:UPI000199AF28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S8"
FT                   /transl_table=1
FT                   /translation="MFSPLSHACFDPSIAGIEGVIALEHGLIMAQESGLFSPGELLVTA
FT                   VSTRDLLTCFSGGGCGEVIGAPAERMVGTSLIAGLHAEDIRNLVFAFHLFPTILPEIEC
FT                   EKGKDGERESKDGGEGVGAGMMPAPNSVRLLPHGFLRRRHISGAFVSMERLGGIIITND
FT                   AAAKARKESAEVAPAPEKGEIDDGGDEKTTPKTIAAAPKEERPFPTEEEIAKTIVEEPA
FT                   VEKAPEPTTAVVSTPAGDIVVPINKYHPANKKDAKPAGATSAVRSALSAPSTVGAGRAS
FT                   SMTASASPFNPNLAREKSVTEGVPVTGAGKAVSAAPGGLVNKGRGDANGKTSEADLASL
FT                   VAHCVRHAKKASTSPRSSLDGDELPEGIKDILLRLTGETFSENTILVTIERVRRVGGTV
FT                   GNEVRHNSQMMVVSKLLNDLATRKHRALPERTPHTMTA"
FT   CDS_pept        960960..962000
FT                   /codon_start=1
FT                   /gene_family="HOG000230779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637620"
FT                   /orf_name="MICPUN_59480"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64208.1"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="HOGENOM:HBG691293"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="UniParc:UPI000199AF29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8S9"
FT                   /transl_table=1
FT                   /translation="MVFSFCLGSTACSDLFHDIPLSDRSLPTLVHSTRSSRPCMATKAI
FT                   HLASRPPRIVTLAPRATPRAYTASRTLISPARAAMTSPKTELVYFSDTYQTSCEAKVVS
FT                   CEPVEDPGDDGVARFVVVLDRTVAYPAGGGQPSDTGRIVGPGGVAFVVASVASTKDGTV
FT                   THLGEFEEEGAAPFNADDEVIVTVDADKRLLHARIHSAGHLLDVAMTNIGFGPDVMVPA
FT                   KGLHQPDQAYVEYTGKVEGLDKDKLMADLKAEMNKLVSLGGGSAAAMMGYDEAAEACGG
FT                   ELPSYIPKDSTPRIVTIVPDTAGCPCGGTHVANVKEIGSVDVTGVRVKKGTTRVSYTIE
FT                   GMKDHK"
FT   CDS_pept        join(complement(964267..964536),complement(963842..964122),
FT                   complement(962174..963392))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637621"
FT                   /orf_name="MICPUN_101109"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64563.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199AF2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T0"
FT                   /transl_table=1
FT                   /translation="MLRTVVSRALASRAPAAARAGGNTAWRHTRLMSTEEEPATLAAGA
FT                   EGEEGEFAPSDEIKFESSEPRYMTTLTFSEAGLQAMIKRDIDREKSAAKIIGLLGGRLQ
FT                   SYHVTTTGDANAVVTYTFPKNHNVQTLLYTLMASGSYSKQRTVKLMTWEDAAMSLKQSR
FT                   AIYANGGVSCNLSLAVPKVDACHCRSSSLAAGVSPWRRAGAAGRLRARACVAAPPAAFG
FT                   RREAPRRDPAAFRLFASGSGDPGESADDDGPRDYLAELSWLPPLDPTKEIEEIDPEASP
FT                   QTMVLPLFPLGSTAYLPHSDHILNIFEPRYRQMYSDILFNGSRRFAVPVSNPETGRLAT
FT                   VAPVFYLEDLKEVSEQTDDAVKYVCSHKVIGRVRINRTLNDKVWRDRTTYLKAVVEPLE
FT                   DGDDDEDLSTRERTLTDRFTSIIENQTKLQEPVRFTENLKATLSAARGEDGLWRMAGLW
FT                   QSLMQNRLAAKESELSDEIQKLLRQYLESQGQDMRSKVTVQFDSLPAEIRAEFTRLQQQ
FT                   YREESAAMVSATIYPFVLLVQCDTHAERLSVFGEMLEEEEKRLQAKVALQSLFSGGMGG
FT                   ADAKGLDEPPTEA"
FT   CDS_pept        964963..965889
FT                   /codon_start=1
FT                   /gene_family="HOG000029190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637622"
FT                   /orf_name="MICPUN_82786"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO64209.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG462742"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AF2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T1"
FT                   /transl_table=1
FT                   /translation="MVVAVTGATGFVGKALVDRLMADGHEVRILTRNAISARLAMPNAA
FT                   LNGAKFYSWDTMKGKIEWYEAVKGCTGVVNLAGAPISSPWNAEYKKTLVKSRIVTTRRV
FT                   VDAINALPAAERPTLVSSSAVGFYGSSKADAGFSEKARAGKDFLAKLCVDWEKEAARCE
FT                   STTTVVRTGVVLEKGGGALAKILPVFQLYGGGPLGSGKQFVSWIHRDDLVELFVRALME
FT                   PKKYAGVVNGTAPVPTTMDGLCEAVAKATDRPNWLPVPGLALRALLGEGATVVLDGQKV
FT                   LPTRTRELGFEFKYENVEEALEAIVAK"
FT   CDS_pept        complement(965975..966664)
FT                   /codon_start=1
FT                   /gene_family="HOG000243424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637623"
FT                   /orf_name="MICPUN_108488"
FT                   /product="Predicted protein"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64564.1"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG715255"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000199AFDC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T2"
FT                   /transl_table=1
FT                   /translation="MHCIGRVAPVNVAPIAAPGTKRTARRTAAARQLCRAGSSDEDGND
FT                   DDRERRPAQMPRRKLINLAAATTALVVSNKANANEFAGDAAMAIMNRVGKVKMSDDEWK
FT                   AKLRDEPYAYEVLRHEATERPFSSPLNTEKRTGTFTCAGCGVPLFKSSAKYDSGTGWPS
FT                   FVEPITPAAVTEVPDYSIIFLPRTEVRCANCQGHLGHVFDDGPRDRTGLRYCMNGVSLH
FT                   FEPAADA"
FT   CDS_pept        966958..968220
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637624"
FT                   /orf_name="MICPUN_101111"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64210.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000199AFDD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T3"
FT                   /transl_table=1
FT                   /translation="MGPAKDLAKPLLDVDELLAANAARVEKILTSLKNGTGDDAPSLPV
FT                   GEGTPYDDIWALRFCLSHDEDDEALATARKTLSWRKEHAEMLEKAAKRERVKKFASIER
FT                   FVAADYHGEDKRGNPVYCIRAGISNPSAMMDVHTKDEVLMFMMYRKEIGFLIADERTRR
FT                   TRKLHKLITVNDLNHVSLMAGTDKRFQKVLGESSKMSETLYPQLLDRAVLINVPYIFSV
FT                   IWSMVRGLISAKTKAKVAICPGDTLKGDVSKCPFAKHVKMETIPTFMGGTCRCSPGCIC
FT                   GVPNDQKTMVAKKDGDGLIAANVAARDKLLAYVEVSRGDKVAWHLQVEEQGVELDVVLR
FT                   ERGINSGTPMTVVKRFKHKSGAGVKSEVLESPGDGTLVFTFNNEYSYFNSKNIKYKCEN
FT                   ITAVAKENATEAGAEEEEEES"
FT   CDS_pept        complement(<968394..>969398)
FT                   /codon_start=1
FT                   /gene_family="HOG000223641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637625"
FT                   /orf_name="MICPUN_68908"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64565.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG585708"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI000199AFDE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T4"
FT                   /transl_table=1
FT                   /translation="EVTPPIAPAEALTSLESGTVALFERCTRSVVNVVDVTVLSGKAMT
FT                   SGAVVPEGNGTGFVWDSDGHVVTNWHVIGSILSQVPKGRDPGEVAKVTLEGADGRTKTF
FT                   PATLVGAERSKDLAVLKVNAPKEYITPIARGKSDGVRVGQAVFAIGNPFGFDHTLTTGV
FT                   VSGLGRTIQSQAGSLISGGIQTDAAINPGNSGGPLLDASGRLVGVNTAIFTSTGASAGV
FT                   GFAIPVDLVQRVVPQLIEFGSVRLPSLNVTAADPNVGKQLGVKSQGVLVQAVPSGGEAA
FT                   KAGLLATRRGLGGIVAGDVIVEADGRRVVTEGDLVAAVEAHQVGESVVLKVRRG"
FT   CDS_pept        970248..975125
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637916"
FT                   /gene_name="PWD3"
FT                   /orf_name="MICPUN_104865"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="ATP binding"
FT                   /function="carbohydrate binding"
FT                   /function="kinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64211.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG562910"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199AFDF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T5"
FT                   /transl_table=1
FT                   /translation="MSAMRPLVAPGHAAPRVTQLARRRRPAGAARGNEMHSQLPVGSRR
FT                   VGSGPRPARRAIVGTHEAPSHVANVSTGGSDSASQQPGGGAGGSGAAPSGTTLLVSIHG
FT                   KLDYGLQMGISGDATEFGSWKPEKAYILKWTEGDVWTARVDIPATVKEVKYKLLTTYKG
FT                   MEFDWEDFGNRTLDLTPGGGDAICRISGEYGQALDVQISPRPTPGPPTTPAASAQGQPL
FT                   NVNNITSQPASVNNQSSSSSPPGAHFEPAPGARKEPTPGTPGKRTTPGGISLDPPDFSK
FT                   GSWRSSSSGGSSAAKGSSGLGAFSQSFSERVERAREAARGEKTAAKASKTDDLPTLADR
FT                   YAEWDADLPSVTTTPPTSRSSAQSELSMAAEQASQGFAAAFGFETKTAEPVPVNAYDNA
FT                   NAGLTQAMAAYESYEDIRRRQSSRSPSYDESDGDSYSSFNDRVSKTLERLTGLANRKSN
FT                   NAAGRDESDNGYGAAYAVDSWQSAPPSSKNTNGWSSNSGSESSSNSGSSFSATDGTNGW
FT                   SSSSYEPSAPPPSKAATAADDYQPAYTVPDGRGGESVSSGSSGSSYGSGSSSYGSGISY
FT                   NGGSQGGSESGRSSSDWYTEPATDGYNGYGGQSAQNGYQSAQNGYQSAQNGYGGQSAQS
FT                   AAAAPRVDSYASRAYEYEPPRLSNSVHLLPDGACRDLAVADDAASTWLEKLEIVSGMIG
FT                   TGNEVTVDKIAACCIYVRWLGNCDVDCGEDDGRRGPAAACGVARDIFVNLETTAGELYK
FT                   RGTRVGEVERALMRQIQPWLPSFADEFERGGAPMARIRGITSMPEVPQPLREEISKSIE
FT                   NKLARNAGPVALFATEAMLKTIKEDAYPGQYPQRFVDEFVAFTQELKRYFNCAGALDRL
FT                   YAMEALDDDQKLMVDELRDAMSQLTRSASATTTAGSGLTTPEGAAVLRALRATTAVRGY
FT                   FTSLLSTALRESTSGEAAMTQRQQWRMAEVSLEELGFVLLTRTLFCAGFVGDDDEGKGE
FT                   FEQSLSYDPSVWTAACNCVSQGLRHVALSMWRPMECHAVARELEAWCAKGDANGQGPIG
FT                   TPEAALRMRATLERALRLLQAHTEAVTKAYGESPALLGTALNVPSYVSDAFADTAIRGG
FT                   VPFQLSRLVDPMRRAASVAAGLGEGSKKSIVLGKGVGRLVECDVLEPGACGTEADGPVI
FT                   AFVWNVDGSEEVTCAGRHVRGIIAARALNPTSHLAVRARQEGVPLTATPSAKGAENAAR
FT                   AARELMGDWVQLTVNDGGVLLGRASAQERDEARYNVRGPNGPKPHASCATLNPRLISNG
FT                   VECVRLAEAVAERAGRKAATCGDLTRIAARPGSGFTALDGVVVPFGAMESRLRERGRWS
FT                   AYQNAIAAVDDATRRGSPPDIERACDAVRELVTNAGCSLELAATICAGFFESGKFGTGL
FT                   LAVRASANVDDPAQMSGCSGHLSVVGVQANSCAAVAEAVAAVWASLFTPEAVQTRAAAG
FT                   VAASADAHMAVIVQEMAPAATSFVLHTGGRIESVKSLNPGALPDPRLEVELAVGLGEAL
FT                   ARSGSGSRGDPWRVEVDLATGDATTTAFGGVGMARVYQPHLGLRDEAVDYSKQELSLDA
FT                   GARERLCRRLAAVGAALEAEFGGPQNVEGCLVGDDVYVFQSRPQPL"
FT   CDS_pept        complement(975305..975790)
FT                   /codon_start=1
FT                   /gene_family="HOG000012711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637917"
FT                   /orf_name="MICPUN_59488"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64566.1"
FT                   /db_xref="HOGENOM:HBG749531"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199AFE0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T6"
FT                   /transl_table=1
FT                   /translation="MCSIASTRLSAKARLRGVSIGNSSAARRSPSAVVRQPRGESLRVF
FT                   AARWLLKNCGPKTIEHLGEDVEIPGDFELKGPRVVVGRQASESVSLEIAVPTVSGAHAM
FT                   LEVSDDAVMVTDLSSTNGTFIEGEELQAGIAYELKEGSEVIFGDEFLACFELLKLKN"
FT   CDS_pept        <976196..977503
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637918"
FT                   /orf_name="MICPUN_82978"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO64212.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199AFE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T7"
FT                   /transl_table=1
FT                   /translation="DWSDAPLFEKNFYLEHPAVASRSEKDVDAFRAARGMRVTGRDPPK
FT                   PASTFEESSLPAYCVDELAKCGFPSPTPVQSQTWPAALSGRDVISIAETGSGKTLAFLL
FT                   PAVVHINAQPYLERGDGPIVLILAPTRELAVQIQEQAATFGKSSKIKSACIYGGAPRNA
FT                   QIAALREGVELCVATPGRLLDLLNAKATNLRRVTYFVLDEADRMLDLGFEPQIRRVERL
FT                   TRPDRQTLLFTATWPAEVAAAAGDFTNDVVTVRIGGEALRASDNVSQIVEVVDEDDKHA
FT                   KLVGWLERALGEADAGGWTPRVIVFLSSKARVDSATRRLRHEGFPALSIHGDKTQEERE
FT                   WVLGEFRAGKSPVMLATDVAARGLDVKDVSLVINYDFPAKMEDYVHRIGRTGRAGAKGA
FT                   ARSMFAAGDARHARSLCGLLQTAGQPVPRELVQFLT"
FT   CDS_pept        977853..980543
FT                   /codon_start=1
FT                   /gene_family="HOG000257670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637919"
FT                   /orf_name="MICPUN_97583"
FT                   /product="Predicted protein"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64213.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG289207"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI000199AFE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T8"
FT                   /transl_table=1
FT                   /translation="MASSAATAEKVAEAPKPIYLKDYTAPDYRFAKVVLDFELGEEVTV
FT                   VGNTISVEPTFAAGGDPRPLFLNGDPTVELAGVEVNGTALDASAYVLTKKGLTITAPPA
FT                   APFELKITTKIKPQENTELEGLYKSSGNFCTQCEAEGFRRITFYQDRPDVMSEFTTRIT
FT                   ADKAKYPVLLSNGNLVDSGDLDGGKHFTVWEDPFPKPAYLFALVAGDLGMIEDKFTTKS
FT                   GREVALRIYVEEHNLDKADWAMVSLIKSMKWDEDVFGLEYDLDLFNIVAVDDFNMGAME
FT                   NKSLNIFNSRLVLATPQTATDMDYSAIEGVVAHEYFHNWTGNRVTCRDWFQLSLKEGLT
FT                   VYRDQEFSADMNSRGVKRIGDVARLRMAQFPQDAGPMAHPIRPESYIKMDNFYTVTVYE
FT                   KGAEVVRMYETLLGKDGFRKGMDLYFERHDGQAVTCDDFLAAMADANGADLTAFKPWYS
FT                   QAGTPKLDVTTEYDAAAKTFTMTCTQSTPTTPGQSDKKPVLMPIAVGLLASDGSDMELT
FT                   LEGEAGAAGETTKVLRFSEASQTFVFTDVAEKPVPSILRNFSAPVRLSTDLTQEDLIFL
FT                   MANDSDQFNRWEAGQTLTRALLLDLVEKAGKGEELVMDQAIVDAMRNIVNLAKEKGADK
FT                   AFIARAMALPSEGELSEMVVPADPDVIHAARDFVVKTLAKELKEELLWTMRDNTSEKYE
FT                   RDGESRAARTLKNTCLALLSYLEDPEIDAEAFRRFKTADNMTDQISALSALSGRADCVE
FT                   REEAIDAFYEQWKHDPLIMNKWLGLQAGASLPNNVENVKRLVDHPAFDIKNPNKVYSLV
FT                   GGFVGGTPINFHAADGSGYEFLGDIVLKIDKLNGGVAARMVGGFTRWRKYDEKRQEMMK
FT                   AQLERIVKTEGLSENVFEIVSKSLE"
FT   CDS_pept        980998..981807
FT                   /codon_start=1
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637920"
FT                   /orf_name="MICPUN_108490"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64214.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199AFE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8T9"
FT                   /transl_table=1
FT                   /translation="MSAGLTVNTCLFPLNTLKTRLQSRPVGAAMGFADRSILRGLYRGF
FT                   LIDTMGTFPGTGLFMATYEVLKATGALHPTLCAAGASVAGSLFTAPCDAMKQRMQVDPN
FT                   ASIRGELRAAFKSSNPLRRLFVGYPQFLIRDLPFDAIQMTSFEALKSWHSKAVEPGRPR
FT                   TPAELAWLGGAAGAITGLLTTPLDVARTAEVCAMRAGLKCTGVACLRELVRQGGAKVLL
FT                   RGSLPRMIEISLGGVLYFSALEHTKRVLGYHDPPAHFGDDDGKVAAA"
FT   CDS_pept        complement(981928..983025)
FT                   /codon_start=1
FT                   /gene_family="HOG000245597" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637921"
FT                   /orf_name="MICPUN_82637"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="RNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64567.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG561652"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniParc:UPI000199AFE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U0"
FT                   /transl_table=1
FT                   /translation="MAREKAREEVESEAWVKERARLENLANSSRLTHHAVALDPDATVP
FT                   ERDQRCVRVGVVGVPNAGKSQLVNTLVGAQICAVSAKTNTTRVETLGAVTRGDAQAVLL
FT                   DLPGVVGPEHYRNPTHATKVSSAWAAAAQCDLLLFIVDANRQARRPDPRVVDLLASARA
FT                   NLERLKYTEVTGLSMPPAVLALNKVDLFRGAEDREALKRVARALAAVHPFEDIFPISAA
FT                   KGRGTDALLSHLLLRAPLRPWDLPPSAVTDKSMVDQAIEVVRESVYRRLHQELPYSIVP
FT                   VHDSWTNFDDGSYRIEQTLVVDSVPMKQIVVGTRGSVIGQIGIRARTVLEKMFSRRVHL
FT                   VLNVKVRKKNNSLRGKARTTEFELY"
FT   CDS_pept        complement(983580..984221)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637922"
FT                   /orf_name="MICPUN_59492"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64568.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000199AFE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U1"
FT                   /transl_table=1
FT                   /translation="MLRRVARDAASALASHSRRTHPIAPSRATPRHHDELVRSSCTVLE
FT                   GSKLSIECRRWFAKTSRRPARRVSGPNGRGPASSSSSSPAGHPGALQPTGGGAAWTEVM
FT                   DPSTGRTYWWNKATGQTTALGDPKPDTFRLPESSPGNALTRPFDVHGRPTIGLAMGQMV
FT                   VFGFGGALGVTFVSAVIAWVTGGAAGMEGKMTAATEEEATEEAALAGKVD"
FT   CDS_pept        complement(984322..984561)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637923"
FT                   /orf_name="MICPUN_59493"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64569.1"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniParc:UPI000199AFE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U2"
FT                   /transl_table=1
FT                   /translation="MFFSAVVQAVKKGPNSTGGLVWKTHAFWRVSKTRKANQLKKLKQV
FT                   RAVDAVLKEAEKLELAELAKAAKLVTEALPGAPK"
FT   CDS_pept        984722..985654
FT                   /codon_start=1
FT                   /gene_family="HOG000100083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637924"
FT                   /orf_name="MICPUN_59494"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64215.1"
FT                   /db_xref="HOGENOM:HBG561655"
FT                   /db_xref="UniParc:UPI000199AFE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U3"
FT                   /transl_table=1
FT                   /translation="MSTAASFSTPGRAGVSARTRSRARSDRRAVRASGVSSSEGYEEVR
FT                   YGLGRGSVAYYPIDASSSSSSSSSSSSSMPLLRADTEPTTRYIDGPLDAAAIWLFNLKL
FT                   EQAVNDGADDEERRRNAKGLPAGGFDRLVALADRIASSGRTPPEQRAVVLATLLGLIPP
FT                   WVRTQFKRLIDPRWAWVDKMNALITVNAFAWLVGPCEIVPRDDDGELAAVKLRKCRYLE
FT                   QCGCTASCANFCKRPTEGFFREAFGVDAHLAPNHEDGSCVMTFGRKPPEFNDPAFSQPC
FT                   YSSCAKAAACDPATAGLLYPKPCHRLGDP"
FT   CDS_pept        complement(985711..987660)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637925"
FT                   /orf_name="MICPUN_59495"
FT                   /product="Predicted protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64570.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000199AFE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U4"
FT                   /transl_table=1
FT                   /translation="MGARRRFAVLCAILLAAARGGASGDAARTGDDALPRSDDDDVRIG
FT                   GTAESSFDRSPAVFAVRRRESPSTPTALAHLREHDAHRRRRILESPAESPGASTFPLHG
FT                   SVKEHGYYYANIALGDPSPRTFQVIVDTGSTLTYVPCATCAKCGTHTGGTRFDPTGKWL
FT                   TCQEKQCKAAGGPGICAGGRGAAANRCTYSRTYAEGSGVSGDLVRDKMHFGGDIAPATN
FT                   GTLDVVFGCTNAESGTIHDQEADGLIGLGNNQFASIPNQLADTHGLPRVFSLCFGSFEG
FT                   GGALSFGRLPATPHTPPLVYTDMRVNEAHPAYYVVSTAAMKIGDVAVATPSDLAVGYGT
FT                   VMDSGTTFTYVPTKVFHATAAALDAAVTTNAKPEKKLAKVPGPDPSYPDDVCFQREGAT
FT                   EIEPIVTMANLGEYYPPLTIAFDGEGASLVLPPSNYLFVHGKKPGAFCLGVMDNKQQGT
FT                   LIGGISVRDVLVEYDKTVGGGRIGFAATDCDALLRDQLARLAGGDAGRSDPVVNEAPAP
FT                   PPPGESPPAPKNGSSAVTPDAEKNDVEARAHNAYDYDEAEAGGYVLAFILCVACAGACY
FT                   ARCVADPSKRRGVELPYLGEVRFFRWGDSGYVEVDGEDEERGGGGGVSGGGMGRRGGGG
FT                   GGGVQLTSVSSSLD"
FT   CDS_pept        join(987868..988100,988332..990642)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637926"
FT                   /orf_name="MICPUN_59496"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64216.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B09F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U5"
FT                   /transl_table=1
FT                   /translation="MDLLFAKALGDTAVVQTRACDDPRKGKGVFALVDLHDGEVVMRDS
FT                   PLALLPSAELSEAAIEDARDVPPATIDTCTTCGAFTGTLTTQLKTLLNARAQSRSAAAP
FT                   KPKPKSGKRKGSGTDAEKDSLPPPPVKGLDALALPESEWQPTRLRERMFVKKNGAFCCS
FT                   TCATHPVATMRERAEGKWKTFVDSVGGVPRADRRCLLLGAKILAVALAGDPDAQAGVAH
FT                   LCSRPVWDLAPSNAEDAEEYAANVRSAVEASWPKLKAALTAAFGADVTKNGQNNGGVPC
FT                   TLETYASLCGATQMNALAVKVPHPLMKYVVSTVAAEGALTEHVQWLAREKADRVAKKAL
FT                   EEEKVLDGAMDIDDIDLDSDSDDDETREAAKDERYSFRWGYGDDEGFDFDTTVFPAFKG
FT                   AAIFPLASSLNHSCDPNCEVAYVDDSRVHILAKRTIGRDEECTIAYVDPDLDGEERREE
FT                   LRETYGFDCECDVCIAGGFVPHLKRRKVLPPKQSGGGLIWGKLDAELKAQSAAEKKAEE
FT                   KAAKKGARDPKPAPAKKTAAVTKNTPAKKATPAKKTDAVTKKTPAKKATPKATAKGGKA
FT                   NPVAVSEDDKYDDLPADFEDEEIPEEEAFAPSDDKKYAKIFGGLDLPDDFDDEEIDEDA
FT                   AFTAEDKKKYGKIFSPATKKTETKKAAPPKAKAEAKKTPAKKATPKATARGGKAAKANP
FT                   VAVSEDDKYDDLPADFEDEEIPEEEAFAPSDDKKYAKIFGGLDLPDDFDDEEIDEDAAF
FT                   TAEDKKKYGKIFSPATKKTETKKAAPPKAKAEAKKTPAKKATPAKKTAAETKKTPAKKA
FT                   ATPPAKTPKTPAARSGAKRKAPEPVSTRRSTRSGK"
FT   CDS_pept        complement(990752..992038)
FT                   /codon_start=1
FT                   /gene_family="HOG000036697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637927"
FT                   /orf_name="MICPUN_108491"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64571.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG315134"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016650"
FT                   /db_xref="InterPro:IPR019010"
FT                   /db_xref="UniParc:UPI000199B0A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U6"
FT                   /transl_table=1
FT                   /translation="MAASDASKHDLTSELGKFLDRHLVFPLLEFLQAKKVYPEAEILEA
FT                   KIALLQKTNMLDFAADIYKSLHNAKDVPPEMTKRREEVIANLTELQAKAEKVVTFLSDP
FT                   TLVKQLRSDKAYNINFLKENHGIGEEDIDALFHYAKFQFECGNYAAAAEFLYHYRSLCT
FT                   NGEKGGSALWGKFASDILQQDWNAAVEDMNRLKDAVENRQYPSPLAQVHARAWLIHWSL
FT                   FVFFNHENGRNSIIDLFFQERYMQSIQAEAPHLLRYLAAAVITNKRRRSMLKDLVRILQ
FT                   NEQYSDPITEFLVCLFVDYDFEAAQQKLAQCDEVLANDFFLVGCREEFNENARLFIFET
FT                   YCRIHQCIDINQLASKLNMDRDSAERWIVNLIRSTKLNAKIDSEAGTVVMGSEAPSIHE
FT                   LVVEKTKAITGKTYALTHAVLSNTQGAIV"
FT   CDS_pept        992572..998067
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637928"
FT                   /orf_name="MICPUN_59498"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64217.1"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniParc:UPI000199B0A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U7"
FT                   /transl_table=1
FT                   /translation="MGRGAAVSEDPLPGHSGRISTMYETIEPQVMTQRYERAHVWGIDC
FT                   VERLTWRGWEPGGSYVRTVTLKNVGKKALKVKYRLPTTKYFEMEFPETMKIQPGLSATV
FT                   DVTFRPIRFEQYDDFIEFKVAGCGSFQVKVSAVLPFISLKMPPTVDFGYGAVNELMTKD
FT                   FSFVNDGDVAVAYKWAVDSPFVFSPLQGELQPGQSAHVHAEFTPVDATVNVVNAVCVLS
FT                   DVSGHSLPEQSYACSVTAVGKYPYVRFSEPEVDFGEVLVGRSVEQTVKLMNQSLVGTSY
FT                   EVARGADDHDHVFRCTGKGGYLKQKSHEEFKLAFTPSMPGTFSSESFKVYTPGGNVASV
FT                   KLTGTAVGPRVSLSQTTFQFGSVISGKSARRVLDIENHSDLPVHWQIDSECLGTFQLSK
FT                   DRGILEPKFQGIPGKAQVVVTFAPIEPANYHKRIIVALRDHRPLAFDVVGTGYDDKRRP
FT                   APMRVSHVEEYRALCATGLVTPGQPPSRSERSLFPNEIDAVKASAMTAQETFMAMFEPD
FT                   PLVAVSLDKSQIDFGPTNRFKTPQSRTVTVTNDCKQKLTVFWGGQEPSEPNDTSLDAEA
FT                   KRAAAAERNPFFVFPEQCDLRPGQSAEFRITFRPTKDKQHYARQLECFAYVKAMRSFRQ
FT                   VTETNFTPPWTSTVWAFGHTHGHQGAQLGFQPKCSFSARGSRLYFPPTVKGDFAFQTIA
FT                   LRNDGDTTVGFEFPAKSGPPGLEIDEETGHSSPFSCHPSKGSVPPKSFTLVTFRFDATD
FT                   TEPHREQMHCVLNGLPERALTLDVRARGHTPRVTVGDSNSFVFTPTCVGASATREIEMR
FT                   NASRINVLYEWAIPERLANVLDVSPHAGLIRGDQTIKSTWTFRPNKSRKFGFTIPLVLR
FT                   VPDSEVSDPGATGRREAFAGASTVEERVDVCIHAEGTSGSVAVRPENIDFGQSVVEQPV
FT                   ERTLELLNRSGGIVRYRLETVFDEGCTEFDADVKFDESVGQIPAKSSKQVRITYVGRCR
FT                   GDVGFRIVCRVVDPSRPSRARTTDEESEEDAPPSAHAIATADYPTLCVTDAACPGVAKP
FT                   VLWKRLSINSLNAELAKPPTATEARLQANGGYDGSLASARSLQGLTSVALGLGVGLEGG
FT                   EPTAVYLEICNTGALAAEWRLMTRDESEVDMENWVEIGEPDDEVTAHQRFVVENGIVEI
FT                   TPRLGTLQPGERQPLRVLYKHSHAGQHWLTALLHVKDGRDVRLELGGRTIGSKLRCLDI
FT                   SPANPSMASHTFAPVRIGDVEPPKQAIELRNPTGETVEWSVDLDPCRALRDANWGFDIL
FT                   TCHNPTGTIPPHGTALLNWTFQPCEERTYECAVPLEIVKRFPWETAETCVLTLRGAGTL
FT                   PTDRGGKPVDETLAGDCDRGCWIGYRTVPSLPPAQEVALSSGSCVFGAVPTLSVVRRIV
FT                   TLRSTTDDREYEFEWDLGAFGQDAGGLEPGSSIAIEPVKGTVERGEEVFVKITYRAGPK
FT                   PQVFDGEIRCVLTPPARTKEEIEEEERYLEQKANEPEYIAIDGPPEPSMPTRKELAGES
FT                   EVWGAIASKDATLRKSVVHNHTTSSAAKFPHLEKLHDAAHERTLPKPRPPPAPITLHLT
FT                   LEGRSVPQVAFREERGADAFDRFFVPDWRPDVNLDFVPANLDAEDMETIFQDMLHEMLS
FT                   DPAVRRGMEDLADEVVPMYLAQRGGGAPRDFLPIVPEGDDVGGDFAGYDDGVRVVDPEP
FT                   EGAVGGAVGGAAGSTRGSAPPSRGSPSKAPSSLGDAGDVAADAAHSCATPDAPAGDDDE
FT                   YAFLDPLEVAKAQANPEFRTLAEWAMEATLFNLVKELRAEAYSTGRWRAADPDDVGVGV
FT                   VGGVGTGAGWASDVDD"
FT   CDS_pept        complement(998173..998514)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637929"
FT                   /orf_name="MICPUN_59499"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64572.1"
FT                   /db_xref="UniParc:UPI000199B0A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U8"
FT                   /transl_table=1
FT                   /translation="MPLQPPKSPAKDPAGFVPPPGTGIMPGIAALTTGSGKPVQVSSPA
FT                   VAKARCLLKEKSPSTPTAEADHLDPFATVRACDSPRVTRSDVPRAQATTHEPPAPESEE
FT                   AAAQKRRRR"
FT   CDS_pept        998852..999238
FT                   /codon_start=1
FT                   /gene_family="HOG000230527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637930"
FT                   /orf_name="MICPUN_59500"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64218.1"
FT                   /db_xref="HOGENOM:HBG523921"
FT                   /db_xref="UniParc:UPI000199B0A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8U9"
FT                   /transl_table=1
FT                   /translation="MEGAAVTFDENYRVRVLAQDKYDKTLALADSATEFCEKVAQLNGI
FT                   VKEVVESVDRQAARTEREKLRAVGKRNQVAADAEQRRRKKAELASLRLEKQAELDRLQA
FT                   EYDSLLRVRQEQELLIAKLSDSSS"
FT   CDS_pept        999635..1001044
FT                   /codon_start=1
FT                   /gene_family="HOG000265471" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637931"
FT                   /orf_name="MICPUN_59501"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO64219.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG561660"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199B0A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E8V0"
FT                   /transl_table=1
FT                   /translation="MATLGTDKQWWPTREPPTRQPDEVDMDTTRRETRRNVNLRLPFHD
FT                   AQCAVVCQEGCYPDKKAHVNQDTFILETGFAGEREHVLIGVFDGHGGAGEHAAQIAAAT
FT                   FPRELEKHRRDPELESHGDRSAPVPLDARATAYARAFVDTDLVVQKNLGDACKSSGTTA
FT                   VVAHIVCDMLHMGNVGDSRAILGTARTGEDGNAGAWDIVEVTHDQTCFRRDERERMRKE
FT                   AREPVLFATLGMILGETPLSEDFGDESIEAADDPPRVFRNGASYPGCAFTRSLGDTVGK
FT                   RLGVSSDPELLTYQLDKNSRCLVIASDGVFEFMTNEEVMAAAKRHWGNALAACEEIVAT
FT                   AYDYWATEDSRSDDVTCAVVFLTPRSGAADGADPDDLGLPKISEAKDNWRKLRDVLRAG
FT                   AIKNRPAIRFANAVLAKMAIDVRHRRGSLAMEELFPGFDFESVGLAKRMSSLKGGLSHP
FT                   DDYVEPTGEDN"
FT   CDS_pept        join(complement(1003389..1003695),
FT