(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_5

ID   MICSR_5; SV 1; linear; genomic DNA; GRV; PLN; 1394110 BP.
XX
AC   CP001328_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 7, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001328.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1394110
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 7"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(complement(1891..2358),complement(892..1644))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630788"
FT                   /orf_name="MICPUN_83283"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65033.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199B222"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G7"
FT                   /transl_table=1
FT                   /translation="MCPELQEVWLEDEQPEYWEGVTIENGRVVELDLEDVGLTGAVPAE
FT                   VGQLPSLVKLSLRHNQLTSLPAEIGQLPSLTRLWLAGNQLTSLPAEIGQLMSLEGLFLN
FT                   GNQLTSVPAEIWQLTSLRALNLYGNQLTSVPEEIGQLTSLRRLFLSGNQLTSIGLLSAL
FT                   RGLGVSGNQRTSVPAEIGQLTSLEVLELHYNQLTSVPAEIGQLASLKWLNLHGNQLTSL
FT                   PAGIGQLTSLTYLFLDDNRLTSLPAEIGQLTSLERLYLRHNQLTSLPAEIGQLASLEWL
FT                   YLEGNQLTSLPAGIGQLTSLTYLYLNENQLTSLPAEIGQLTSLKALGLNYNQLTSVPAE
FT                   IGQLAALRELGLFENQLTSVPAEIGQLTLLEGLELRHNRLTSEPAAIRELRAGCRVGMD
FT                   RGVTVDE"
FT   CDS_pept        2934..4337
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630789"
FT                   /orf_name="MICPUN_59718"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64675.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000199B223"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G8"
FT                   /transl_table=1
FT                   /translation="MAYAVACTRLSCLPISSRPARAGKHVACATSSRDEEVAKPAEVRV
FT                   RLPWTGDIGPREIKLLADAFTDPKLLSSVPSIGGYMLRNGTAALRHQASILRGGPGGKV
FT                   GGGSATYPSSWSGPFAFANELIAGFLEAVSASNELERYRSRTRGEGEEEALRRVGEYVR
FT                   GLRGLMAVGIAPMPGTKVQSIEIDGRSAVWLTPDGKSWDHPDAPRRTVMWMHGGAFILC
FT                   STNTHARLLSSLGIAAGAKVLSVEYPLAPDEGRYEEMLSHVVEAYQWLTSPSGGGVDPG
FT                   SIVVGGDSAGGHLAVGLVQRLMSSEVAKGPAGVVLMSPWLDPGRDDPATEDAWNSARDT
FT                   SCCYLRGVKDSLKVVHDLVFERVMEEEEENELAFSYLPPRNMLRRELWDGERASRCPPM
FT                   LVQYGGAEVLAAESRNFVRIASESGIEVTSQEFKDLPHVFQVFDALEAEGERAIQSAGA
FT                   FVSDVCKTS"
FT   CDS_pept        join(complement(10970..11039),complement(4390..10889))
FT                   /codon_start=1
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630790"
FT                   /orf_name="MICPUN_104872"
FT                   /product="Acetyl-coa carboxylase"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="ACO65034.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG320067"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI000199B224"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9G9"
FT                   /transl_table=1
FT                   /translation="MAVSLLVNPIEPLRLRPAILFHGLGAVKAIRSLRLWEYETFRTHE
FT                   ILHIVCMATEDDVKANAEYIRLADEFITVEGGSNRNNYANVDLIVKVARRCQADAVWPG
FT                   WGHASENPKLPAALAYHDIAFLGPSAESMDAVGDKICANILAQSCDVNVIPWSGSGLTV
FT                   PDISIPEDVLLAATLGDLAQAEESAKKVGFPLMIKASEGGGGKGIRMVSNMEELRTGFV
FT                   QVQAEVPGSPVFIQQLSTNSRHLEVQVVADKHGNAISLYGRDCSVQRRHQKIIEEGPVT
FT                   VAPRELCEELERGAVRLAKKVRYSGVGTVEYLYNITTGEYSFLEVNPRLQVEHPVTETI
FT                   TGVNLPAVQLQIAMGIPLNKMPHIRRFYGQADPNGVTPIDFDTAPQNPPMGHCMAARVT
FT                   AEDPESGFKPTSGAIHSLHFRSLPGVTGNFSVGLTGGVHQFADSQFGHIFAHKPTRDEA
FT                   GTLLVHALSELSIRGEIHTNVKYLCSLIEKDQFRADLHSTAWLDGLIAEQDRAQALDDH
FT                   LVVVCGAVMRAASRHQELESRVVDALTRGVPPEAWMTNLSEHSFELIYKDIKYSLRVTM
FT                   GSHTLFYIHVNGEAVCEAEVLVLQDGGLKVLLGGRAHSVYTEPSKVGLKVHVDGHPCFF
FT                   PDDFDPTKMSAPGTGKLIRYLVPDGGRAVEGVAYCEVEVMKTVMPLLATSTGLVTHLLQ
FT                   PGAALETGDALCAVEVEDPSSVKVSQPFSGEFTKIESRKLTGALKDDGALVKFNVNTAG
FT                   IHQLLAGYDFNKTADPVTPLLEVLGTLELALDDFSETKQAVSSRASKAALAELASIEEF
FT                   MQSAMVTDDGTDVVSVAVKRVRDLIDEHGPDFAPLRSFVDQFEGGLHMNRVRVLTRHLE
FT                   TFLDAEEPFACSASFEDAIMVLRSRYRGDASAVVQYAHAHSRLAQRSALILKILDEVSS
FT                   NDMIDAQPMLEAVRRLMKLESASQSGYKEVSYRARQIIVVKQDASRKSRRERMKAMSGS
FT                   NLAMASGGNLEKLAHSRQESLSDFGLASAGSLYGGSMDDLTSLNGSETESSLGPGTPGV
FT                   PGDRTKRRSVGTLFLDNTNTLARFNSYANLAEEIGMIRGHEEAEQEDDGPSWQTLFEAP
FT                   SETEKFAAIEALFAAAGIDLPATQGAGPHVFDADPAVTFVRLDGGRNLVLFAPSLGHAV
FT                   SALPEANAEKPEELAFVINYPRLHGREDRDIRDAAQAFVSGQHLAGAISLATSRVAVTL
FT                   LAIGERPQHFTFARNFANGSLVPASAAPAHLPPPSPTSSPLAPEGEFKEVSVARGFWPH
FT                   MAAQMEVERLANFQVECVGMISSRTHGKRTRNWVNASEYSIGVFLAEEVVPQSRRGAKL
FT                   PQRDRRVFLRAAVYHKELLLAGVEAPNGGHKRTPSGSVSIDLDSLADHKWTSVHDDSVL
FT                   ADVLGSLELAVGQHGTAWNHVYINMVGTTVEDLPRIEAAIASFIHLTFEDLRRLKVSCV
FT                   EVRVGGGEVVALNTSGLKFKMTSTVHDTLVPAPRPPLYPLLDTIQRKRMICQNLNSTYA
FT                   YDFPEIFANVLAEKGGNGEDAPQPGIKRLVELVLELPAGSSHQLVVPGHGKSGNLVEVE
FT                   RAPGMNDVGMVCWRATLVTEEYQNGRDIILVANDITHMSGSFSPREDAVYRAAFDLAVA
FT                   EGLPCVYISSNSGARIGLDEAVKAAFKVAWVDASKPSRGFEYLYLTEDDYEMLGTNGRV
FT                   LADRVVDSETGQVRFALTDVCGGQGVECLQGSGEIAAATSRAYKSTVTLAYVTGRSVGI
FT                   GAYCSRLCQRVIQHNDAPLILTGASALNKVLGREVYTSNAQIGGPKVMANNGVSHMVVP
FT                   DDVRGVSNILRWLSFVPAKKGAPLPFTLPKGDGFDTIHRPVGFTPANAPHDPREMLQHF
FT                   FDRGSFMEVMTDWGRSVVTGRARLGGLPIGAIAVETRTSEKTVPADPAFEGAQITEETQ
FT                   AGQVWFPDSAFKTAQAIGDMNREGLPLIIFANWRGFAGGLRDMYGEILKYGAYIVDALR
FT                   EYKQPIFVYIPTNGELRGGAWVVIDSSINPEQMEFYAAQGSKGGVLEPEGVVDIKFRRA
FT                   DLVKVMKRSLPQMQNVGDDDGAEKKLEKELMPTFKQLATHFAALHDTPGVMLHKRAIKE
FT                   IVPWDKSREFFASRLRMRVAEERVKELIRAQCPVITNEQMASHLSELRETLEEIAAAED
FT                   EAVVPEEKEEVMRFIEGIGA"
FT   CDS_pept        11728..12474
FT                   /codon_start=1
FT                   /gene_family="HOG000115733" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630791"
FT                   /orf_name="MICPUN_59720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64676.1"
FT                   /db_xref="HOGENOM:HBG609998"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199B225"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H0"
FT                   /transl_table=1
FT                   /translation="MSAVNFALGALAGAAATAVAADAYPSMMPSLGFSRPKDIELKYFD
FT                   IAGAAEKVRFTLLMGGVPFKDTRVSFGDWGKMKETTKFGQLPLMYLNGEEKPYAQSGAM
FT                   LRFAGAITGLMPKDPVQAFKVDEAIGLDDDLRREMRPSIMLSYDQTIKPKEKARKVKEM
FT                   REKLAANEIPRFLSHFEKMLENSEYLCGSSATIADAQFLTTCRWLGSGVIDHIPADITT
FT                   KYPNITAFRARMEAKPEIAAYLNKPK"
FT   CDS_pept        join(12733..14332,14629..14654)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630792"
FT                   /orf_name="MICPUN_101260"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64677.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199B226"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H1"
FT                   /transl_table=1
FT                   /translation="MGVPNDDNDGEAWATGQQIAARLPRLDGVEPDHPVVACGLLVDVA
FT                   ARAGVLAMPSETAVGLNLEGAPMMTRRVDGDEDRFEYSPTAASILLEYLTEHPEIARGV
FT                   CNSAHKAPDGDEFRCGKFIRGVSAEAAAAAMAWRKSKLPAEIIKLDSLAEPPNPWKKAE
FT                   SAKHGTEQTEMDASKREKKQRKEREKKEGKAAEKKPPVVLVPAEAPAVPAWGGSASAKP
FT                   PPAASMSQILKEQSTRTVAKQPHPAASRTPGIIRLPKGGAAPASRPGGGGGWADILRDR
FT                   PTEGGSTTAWDVQSPDIPSLGLTQRPAPPKLPEVTPERLSAEARKSKVDQFGKVRCLVC
FT                   GKTFGSHKPLEQHLAASHFGLNSMEAKALEAKLVAAGVHIPGDGSEKTKPDRMAIQFGE
FT                   ILDQPRSRPGDAPIANLATSLAAYIRETPKKKEKRAAAIGATGRMRHGGQMVMNPNQAS
FT                   SSGLVHRRGKERIDGKKKKPMTKLKKIILSDRAARLEREEKAKNEREMNEKETGEKEAE
FT                   DDKEEAVMELEVTVEVARGAENEE"
FT   CDS_pept        14740..15495
FT                   /codon_start=1
FT                   /gene_family="HOG000200120" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630793"
FT                   /gene_name="SBP2"
FT                   /orf_name="MICPUN_108533"
FT                   /product="Secis-binding protein 2 "
FT                   /protein_id="ACO64678.1"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniParc:UPI000199B227"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H2"
FT                   /transl_table=1
FT                   /translation="MHIEGAYHKKALLRKEREAAGEVIQPPNPPGTGKRAQKKLKSFPP
FT                   GVEGSTNDTSKKNMNTFMGTDVKIRYAEQVVTPEVNKSVVECIGELKRFQDRLYFKDPI
FT                   KAKMRRRLVFGLREVHKSVTLQRAKAVVVAPNIEETEQEGGLDDVVGQIIEEAKANGTP
FT                   LIFALTRGRLGQIVCKRMRISALAVLDQSGAEEQFKKMLDDAKEGRKLYANKKRQEEEE
FT                   AAKAKNPPAEAKLNPTAPLFVPRSANNSS"
FT   CDS_pept        complement(16183..20130)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630794"
FT                   /orf_name="MICPUN_59722"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65035.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B228"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H3"
FT                   /transl_table=1
FT                   /translation="MGAFSNGRPQSAGGTGQPSWRGSIENMASAPNPLMQGGAFPGAPP
FT                   RASQLPPPPPVRGYGGGGYGALAQAGRASSGMGGMGSGRGEGYWGPKPGGGGGSIGGHA
FT                   GDKRKYPGSDDVWKPNDTAGKVGKQPKLPKSPSEKAPAKVAGATKDGSPWHPPLRRVTV
FT                   ARAAIDAMRHACDAELPEGLLDEAEIHKISSVPDLTYLDAPAEEQGGGLKAAPARVMWA
FT                   PPLPRDGGPHGQVRRSLPVFRYRQALIDAFQNNPVTIVEGETGSGKTTQVAQYLLEHAA
FT                   ETGQPVNIICTQPRRISAIGVADRVAAERGERVGQGAIGYAIRGESRICDNTRLLFCTT
FT                   GVLLRRLERDPQLKGVTHVLVDEVHERTVEGDFLLMALKEMLHRGDGDADAGSDRSKKS
FT                   KKSKKSKKSRLGPDGGDDGSDTDSDSGKSGDEKDATAAPPKTTVKLGLMSATMDGDVLA
FT                   RYFDDAPRVSFPGRAFPVATLHLEDAIAVTKHWVDRQAEWAYGSFAHQRKAGKAASRDE
FT                   SLRPPAENEWFSRLSRSARNQTRARAACRALAQLDTDVVNRQLIVELVQWFVGQAGGDV
FT                   DRALQILPGSRDDRWDPGMADKDEARGDMDTAAILVFLPGTKEIDDLREALVNVAGRTA
FT                   GGNFVLDPNWILPLHGSLPPDDQRKVFERPPRGVMKVVLSTNVAETSITIDDVVCVIDT
FT                   GRVKEERYDAERLMSSLDDVAVSAAAAKQRRGRAGRVRPGIAFHLFTSDSLERMNRYTD
FT                   PEVRRVGLQQLVMRVKALNLEGNAEAVCSRLPEPPQPAAVHNAVEDLRCIGALAAADEH
FT                   LTPLGKLLAQLPTDARLGKLVVYGCALGLADEALTLASLLGSRSPFLMPAEARETADES
FT                   KKRFGTPPQSDVLGALAAYNEFDATPGEARFAFARERFLSIKTLQQIANNKRQLLENLS
FT                   TLGVVPRGLRANHTEWVGRKNDGTDGVRLVLGQTPTAVALSAQMDEHTGPEEGAVEAGR
FT                   GAVPTGLLAALLCAGLYPQLAYLYAPPTKKGAASSSAVKLHVRPADRSLSEPDSATVHP
FT                   SSVNSPLDGSQWRSCYVAFHERVKTTKVYVRDSTPVPPLAMMLLAGGELQREHGAGKDG
FT                   QQLYETGGDGNDDILALDDFYRLHVPRGACDLILKLRERIQALVRRLVNNSGEIKGKKQ
FT                   WNPRNNDPTPAPPWTGDLEGETIVRDLVDTLSHISKWEDVKVAPELSAQEKKKLEARRR
FT                   HEAKLAEQRRLKAARQAAHNNRGGRGGSSRSYGRGGGGGGRNRGGRGGGGGRGHNRGNQ
FT                   NWNSMQKGGGAKRPHGSGGARGGPNKRHKKF"
FT   CDS_pept        join(20348..20609,20735..21762)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630795"
FT                   /orf_name="MICPUN_59723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64679.1"
FT                   /db_xref="UniParc:UPI000199B2E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H4"
FT                   /transl_table=1
FT                   /translation="MRRYRSAGEEVMDAAGAWRQPQRPRGRYMRSSGVSREDFIANEER
FT                   RSRSCAAFALAGGLALIIAGSVIMRRADYGHVKSHLVEEYNKAVDAWTTEHAKTFNATT
FT                   FEVKFGDTVVPAVFTDAAPAVDGAWGTSHAYEPVAFEVASLLETVAIPDMQAAGMLPDK
FT                   LPTLGEIKANVRVPASAASGTGGEDGDGDGDTAGEDAGRGDVDDPADHAPYNATAVLEY
FT                   LMTPRELAVVVKREGGEDDVVPVGSYPLVTRRVSGVNGWKVCKFQRAGYYHRGTCTTYE
FT                   VTSNLCAKVKLADGTWRLDDTYGGPGCSPRGKWDVPERKRIRAPTQGNAPKLSSVRLTG
FT                   AGRAVLHDGHDPLFTAMNLTGGSLFFAESAAESSAMATVMLIVGVAMLVPATVLGYPRV
FT                   RQWVGGGSRGGSRRYRQGRGIERDQFDDVL"
FT   CDS_pept        complement(21854..23053)
FT                   /codon_start=1
FT                   /gene_family="HOG000100092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630796"
FT                   /orf_name="MICPUN_59724"
FT                   /product="Bile Acid:Na+ symporter family "
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65036.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG562209"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="UniParc:UPI000199B2E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H5"
FT                   /transl_table=1
FT                   /translation="MTAADVQPRETCGDHWKRWKPWLIKNYLVLGFVFVIVLALSWPLP
FT                   GRELGSPKSGDFPIAQTCCIVVIFFISGLTLKTADIKKALGQPAALAYGIITILLVTPM
FT                   MGFVVVQIPFEPVEFRYGLALFACVPTTLTSGVTLVTSALGNGVMALMLTVTTNVLGVF
FT                   TVPFILNAVLLSAPGGDSGGTDTDMAETAAKLLLKLIISIIIPMGVGKATREFVEQAPS
FT                   FTTKYKTELGLTNNSCLIAIVWMSISNSRGKLVRESALNIFVIVVAGVLLHLFFLTMNW
FT                   VMTTAVMKIPEAERRAVLLMTSQKTLPVAVTIIAYLDEARWGAQGLIAIPCIVGHVSQL
FT                   FIDAYIASIWAGQDPKEIDERNAAKRAGVGAEEAESKVERGASSEARVGVAAAGGEVKA
FT                   "
FT   CDS_pept        23246..24100
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630797"
FT                   /orf_name="MICPUN_59725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64680.1"
FT                   /db_xref="UniParc:UPI000199B2E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H6"
FT                   /transl_table=1
FT                   /translation="MSEIASEPEVVGERVALHAAGTAELVEDEDLARGELGELDIRGEE
FT                   DEGGGSWELLISLQRTVNRFSRRLLRLRAPAAAYLRAKLATSEGTDEVYSKLQEKVESP
FT                   GFLEKLRESRAATGEAGEGEAEAPSSEEPLGSFDVNDPTFWEPEVPEREDSALSTSHLP
FT                   GAGADKDDWVFVEAEDVVESIAAFIAGYVATHPRAAAVSPERLQRALGRSFGELRTDGK
FT                   GKARRVWELGVGVFRGASWTYGTLTAFTNPWIAQMIVAAMYTAGRITCGIGTTAVAAVA
FT                   GAV"
FT   CDS_pept        complement(24198..26267)
FT                   /codon_start=1
FT                   /gene_family="HOG000100093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630798"
FT                   /orf_name="MICPUN_59726"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65037.1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199B2E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H7"
FT                   /transl_table=1
FT                   /translation="MPIEVLASPMGRSLALPARLAQWNRGEGTVGLSSNKATTRRQHRN
FT                   FPPEKGCIRAALKLVPCGDGTKDHLPKGTRVPGSLAKTQIRLPSRAGNSVVVGREKPAD
FT                   VSLGIGTVSAQHAKFEAGEDGEVYVTDMGSSNGTDVDGRPVPRGQMFKLSVGDIVTLGD
FT                   PHLARYEVVEAGGDSLADRLAGIQETAAEAEKNARAVGEALNKGANTVRNAQAAIAGVG
FT                   DVFRGFGGKRDEQVAEEVLATIDVDDDDEDEDAGQDDPVEVIQPTYLSDDNDVVDETEA
FT                   PAAVAPVRKKKFASEERVVFTPVGWSGPAVELEPGVPIKLGTGRKKGDADVILTGVQGV
FT                   DSSHAVLLRVGGAVYIEDLGSSMGTFVGGRQVRPGLQYELTPGADVQLGDGGCAFTVTC
FT                   PDDDEGGLDLVPPAIMGGAGAAMVKRAGAESAAVVRNADLSLSKVDDGSDPAASPWGLM
FT                   GGLKGMGENLGAAIFNSKIQVNYQYKPEIKVGGAGGGAAGLSDLKAALLLALADTERGL
FT                   RADKERVKKIEQLARALEAKNPTRSPLKSPLMNGRWALQYTTALNVLGKGKPGFLRPKG
FT                   AIFQTVDIFTLQVKNEESFEPLPFIKFTNASTSDLNAQTDSRASVRPKDYRVAGFKVDA
FT                   PPSSPGRVARDLEMEATGAGSLAWMDTTFVDGEVRISRSQSGDLFILVRDDPND"
FT   CDS_pept        26636..29098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630799"
FT                   /orf_name="MICPUN_59727"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64681.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013621"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B2E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H8"
FT                   /transl_table=1
FT                   /translation="MASAMDWLGVGSACSPAQDADDDDDDPRRPRRNSPQETPHSEVRR
FT                   GPLRGLDDHDGWSDEDEDSDGPNRNRSGRDGRSEYASSQEYSDYARGLSYSESEGEGAR
FT                   SNGQAGASKWRAASQTLGAVATLKSSLKSPSAVRREQKKATFAVIEDEERHVLDDPAMK
FT                   HRLTGNNAGSWSGAGAGDEAAAKGSPDGQVCGVNVVILPSAWYVLYWDMFMMMLLFAII
FT                   FLLPYEAAFVKSYTDLSTSEMSNTQFTFLVVNRVLDAFFIMDFFLQFVLGYVDEQSGKV
FT                   VTSLTQIRNRYLRSYFVIDVVSLFPFDQLVQSSSTPLLRAIKFLRMLKLLRALKANRII
FT                   SRLLSHVDVSHATMKISKDIVILLILIHFLVCAWAYQANSDLDDDPERWIYLNSVDISS
FT                   ADAMYITVMQLIFTSDIQVALLGDQQLKIFTSVVIYVLTALTIAELTDMVQNASAGDAA
FT                   FQRMLDELNSLMRERNFPSDLRFRLRDFLRFKHAREKDMVSNPERLEMMRALSPQLQVQ
FT                   VTDQMSQAGMKASPLFQGCKPDLIMKITMAASSMLLGATEAVSREGEPADHLCVLEKGF
FT                   LISAGRVVMTGSIFGQECLLSGAFDEVKNVHSTHTLTFASMTRIHIHQLDQIVRKADPA
FT                   FWRIMRNRAVRFLVGRGLLMYCQLAQRRREGGMKGTNALAREMISLGVGKIVIYKMMLA
FT                   YRYVNGEAEQIEYAVRKIQSWFRGVRVRKAFRSVVFRARMTNAYVPRELRNSTKGAHET
FT                   GTKHEISRLITTFASQGPEGHEERIELIVHQSESTAQQIRALIMEQRRMARTVDTIAML
FT                   IRKMTLGL"
FT   CDS_pept        join(complement(34275..34828),complement(29205..34065))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630800"
FT                   /orf_name="MICPUN_101265"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65038.1"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="UniParc:UPI000199B2E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9H9"
FT                   /transl_table=1
FT                   /translation="MNSTVAETGASAPPPSPLTSTSAAGPFPGRVSSPFSATSRSASTF
FT                   FPLDFFCFLFFFASEEEEEDDDEEEDDEEEEEESLLLLLLLLDDDEDELEDDESESESE
FT                   SESLLLLLDDELELLSRLPRFPLPLALPSICAFLASYSALRSGGSSPVKSANFCRTFGF
FT                   FSCCVRLGLETYTLAVGSVQHSLHTEAREEGSGAMAELSRVRPDLNETEDQLLELQRAF
FT                   LASQDHRANAAARVTRVGGAPPKEPSPENLAGVLPEDIRRAEAARAAVGPSATPKSHAE
FT                   LDSFGTGPAHGFDPTAEIREVVGEVIERAPRSRTGAPIPPTAPTAPGPGLAFPEAKHRT
FT                   KGPFAGRPKSKFMLERERKAAEAAAAAAGGAVGVAGASPQPPQPTPTTTTARHPLDESK
FT                   GIEEETARRLAAMSVSEIEDAQSTIAAKLKPSALEFFRKRGADKLSAKSKPATEEAPAP
FT                   PAAAAESGADAAKQHPPRAPPPASTPPTSPPRSTKKPPLSPARPVEAPPAAPAAAADTM
FT                   ASTAESTSVATSVRFTLEGVPLNADEQPAAGRQASRLGSAVERDPLRSGTQNPADLGYT
FT                   TRECLELARSSVPAQRSVGLNVLTRVLAHARRWGGGGGAAAQERQEPPPKTGPLGNAGA
FT                   KFMRRRSVGMVGVYGGNAPPSNPLGLPTPLPAGVHWGDVWLHALVDHNAVLLLRRCLDD
FT                   AHMPAAAAAAGAIAALVGGATGGGWAPGEVGPSTVAPDQVDAAAAADWFDALESAPPSD
FT                   QSMTCRATPLWRSGGWGVTFAPFAWEQASGPITLTDQGAVAHDPADEIGEDGSEMGDEE
FT                   RKSRGMAHAVDPIAALLRMGLLLRCRYLLEVAKHPGCVAPVLATLAACARHSAAAATAV
FT                   ARCPRLLQLLVSMASGEGGEYPSGTPSGAIRVLRIIASSAPEHARRLGADGVVTAAVQS
FT                   AAGASHKTAEGASLWAETLRLWSAVARGGGATPSIDGLFPLLAPMMEPSTANTAPRSPL
FT                   EAATSAALAAECFALFAALTTSLRDAAGAKFDKIHGWIPPEVDDNGVFKETERNHPDEV
FT                   HPSTSLTMTSESGDRLSWACAAGAAAAAEAWCVRPPVQPPEPVPGVPAGRNSKGGYSPA
FT                   AWRAAGNAAHFLASLIEASGIGGESESSAAATAAGRRVLGLADENIEEEGANKPTKGVG
FT                   VLAVDGLVEGALDALGSSANDATDPELAGRAAFGVALHGGLRLAAATRGAAENTTTVKL
FT                   AGRTVRQLTLAASISIQANAGDGDGVIRQGRAALVAAAELPSQRALVVALELQESAVEA
FT                   AGDDGEDEDDEAGIRREGAIAAVEATAALVRALPPGAGSAARDAISAGLLAKRTLGSIL
FT                   RIAAERLTAAVKPPPGDGGEGDALAIKHGGFSHFAARDLELDGEASKHPGSLVPTVTAA
FT                   RGALLGGFAIELLSDGERLDALGESSPPLDGVGSTTPLPPLPQWLLAACSPKSTVNGWG
FT                   PDGAASCLALLLGLETSGSLVTRDLPADAKLAAVSGIFCLGPGTWRNPSVSAAAAALTD
FT                   TYWGRLEEEKEANSANPRMGLHSYGEAGFGTGDEDEASSQAAASLAQEVCEAFSNESFG
FT                   DKLFARHAAFQLRDGAPARARAAAWLALREGVAFHLLPPMTAVAPRPERGDAYMFLPPG
FT                   GESDPEMLELYVQCLESGALDKSLEGINTGGMPTLPAALALHAATHAVFKDTGVASSAS
FT                   VLRRLLGRPNTRTVLRGIMCTPLTQRRRPAVARAAATGTRRVSVDGAGSNFGPGFAYGM
FT                   DPPSNNVEARRSVMLAACGEDSSLRKELRVALVEAIPPPPLSDDDDDE"
FT   CDS_pept        join(35201..35718,35775..35961)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630801"
FT                   /orf_name="MICPUN_59730"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64682.1"
FT                   /db_xref="UniParc:UPI000199B2E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I0"
FT                   /transl_table=1
FT                   /translation="MEGGASNKDLARARFKQQQHGRRVHGRGGGRRGTFGRKGEPGNSG
FT                   SEEDDDEEDAPAHGRSLDLPPAYDDSDAEDPLAGPRLRSNGADLAALLAECDASALPRQ
FT                   HVSAYMDPSWSVDDLGELQRALGGGGSGLGGDELSVDAHGLIRQLRELPLAELLGLSRE
FT                   YAEALGEGPDPGYGATGSAGIYTGFEPTGSEPTGSEPTGSEPTGSKGRGRRPRRAPFKH
FT                   PGRTVGSGARHS"
FT   CDS_pept        complement(<36141..37423)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630802"
FT                   /orf_name="MICPUN_108535"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65039.1"
FT                   /db_xref="UniParc:UPI000199B2E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I1"
FT                   /transl_table=1
FT                   /translation="MPMGTPADRSQAFVSSWSAGGTFPYGMSPHAMNSAALHPLHFGQS
FT                   PPTAQMSHMGFAAGMQNPAAAAAAAAAVQLPALQGGGVPGSPMAMGTPQGLAYQMQQRA
FT                   GQGGQQPGAGGIPQGFQGFHPGATFQGPQSMPHNARAAGGMGPPPPKPAQQQVGFNIPG
FT                   AQQSTPPGRGKPPAASPSSFTPGSLSQTRGFRIHTVEEDGAESDDMDMDGASGSGPNSR
FT                   RSSGMGARKRSNEAFNDPSEWDPNFSDELLLDGEGGAQHAAPPTAAAQGSSAMSIPVTG
FT                   GFGDGGANGGFGGFQSQSVPKWQSVAMTGRAGFSPQQQVGGWPGHMNIDQQNAAIAANL
FT                   NAYLQQQQQNVAAAAAMNTFHQGSPQQQMGFFPPGGVNPQFAMQQQAFAQQQQQQQQQQ
FT                   GLNLTGLAQQPHPFNGQAQHQQKDSGST"
FT   CDS_pept        complement(<37847..39109)
FT                   /codon_start=1
FT                   /gene_family="HOG000200825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630803"
FT                   /orf_name="MICPUN_83368"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65040.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B2E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I2"
FT                   /transl_table=1
FT                   /translation="MPSQVTARASVYLSDSYKKCNPSFGYSSNLNPRRQLTKPSEPAGN
FT                   NGHDNENSDLIISVNDVLVSDDGASGEYEVRDVLGSGTFGQVVRCRQKGTGKAAAIKVI
FT                   KNHPAYFHQAHVEIGILHMLNTECDQRDERHIVRMMDHFVHRSHLCIVFEVLNINLYEL
FT                   LRQNNFRGLSMSLVRVFLRQLLAALSVLRGANVIHCDLKPENILIKSLDTGEIKLIDFG
FT                   SACFQNRTVYQYIQSRFYRSPEVVLGAPYGMPIDMWSLGCVAAELFLGLPLFPGASEYN
FT                   LLSRICETLGTPPAGMISKASNSHKFFQRTDENAGIDGASNASYRLMTLDEYERRTGKK
FT                   TPVGKKYFKHTKLADIIQSVGFSSGLTDEQIAKERTQRSALLDFLQGLLQADPNDRWTP
FT                   DQALQHPLITEAPFTGSWTPPP"
FT   CDS_pept        40086..41465
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630804"
FT                   /orf_name="MICPUN_59732"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64683.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG561848"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199B2E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I3"
FT                   /transl_table=1
FT                   /translation="MHIATARGLASPCRAVSARPDRARRASASTSCASPRRRTDEADQR
FT                   GRTSVASRSRDDATGRVLSHRGASTRFRAIGEPETGVIADDSPPPPRDGDVEGAEGTSL
FT                   TAARGLLLAVPVLWATYNPALRFIYDSPTSPTPAELTSVRMLAAMVPFTPVFLSIARDA
FT                   ASAKMTTTKVAEDAASGDREARGGRDVRLLLRAGAELGILNFLGTACQAWGLEQTTATR
FT                   AGFLLSTINVAVPIFAAAGLGGAGAPPVTKTAWAACALALVGVLITDAPNVSSSFDASS
FT                   VLSSSTDGFNGGDLGVLLGAACYAVFTVRLGKWAREYDGPEDLAAVKLAMVFACCCAWV
FT                   LVDQAAYGSGVGGKWPNGGPWGSVLWAGGFDAGLWAAVVYSAVGPGAAANLLQMKGQRI
FT                   VPAAEAQVIFATTPVFNAAISVAFLGEAAGGHTLLGGAVIVFASVLPLVAERFGDAGKS
FT                   S"
FT   CDS_pept        complement(41536..42363)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630805"
FT                   /orf_name="MICPUN_59733"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65041.1"
FT                   /db_xref="UniParc:UPI000199B2EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I4"
FT                   /transl_table=1
FT                   /translation="MEVMHAKECDTLLAQIDRLQTYAARLVVHNDYLLRLHPLQSVEEE
FT                   PATPRGFSLPEIPPPWHHPEPAPPPEGSLVPEKLQLQANVLIEKLALLEHTSRQASDTL
FT                   KDVCQRAAASAWAPSAFRRLAREVEPCIRAEGEALTVLSKTPTAMRAEARADDTDEGVD
FT                   EEAKLLIASLRELLRCSAVMATHGAQLVQVGAILEVAAAALGTAVTKMDRDREELRAAR
FT                   RALTRRMDLFWSPANDDGAGKKTSRRRVRTGSKRSRDDEYTDEGYASDYDTTP"
FT   CDS_pept        join(complement(43898..43946),complement(42459..43756))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630806"
FT                   /orf_name="MICPUN_59734"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65042.1"
FT                   /db_xref="UniParc:UPI000199B399"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I5"
FT                   /transl_table=1
FT                   /translation="MSAADGESKPLLQRPAGGERGTTRDAYLDNCKFALMILIGVGHSL
FT                   QWLLATEDRRTGRLWCGADALDDSSEDGVAPSSAVVPTLRALYTWSNAIAIPMFCVVSG
FT                   RLSRSLVASCRPQHGGDDRVSERLRRVFEQLVVPFVTFQALACAVYEISPALRDALAPG
FT                   GTQSSGEAGATSGPAAEAAATFDFWTPHVSWYLAALALWRCVSVVTAQMNDVAVWIGAL
FT                   TVGIGVGFTNTGAATGFFLKWGTIWGNFPYFVLGTFVEDDHYRRLRDASGALKLACGTI
FT                   TAVALVVAWCGLSHEVLCFDLWQWEAWKSSPFVHYNQFTVESAVEGVDASPRSLFFAAC
FT                   FRAFTYVYAVVVGVAFLGSLPRVHVPLVTDSGTRTMYGYLVHAPALLALLALNGVFQSA
FT                   GTGGGLGVLGWLTWGVLAPVAVTEACMTAPVARVFWWLCEPKLGKWVWR"
FT   CDS_pept        join(complement(47928..48018),complement(47777..47862),
FT                   complement(47412..47737),complement(47213..47324),
FT                   complement(45692..47122),complement(45409..45623),
FT                   complement(44642..45323))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630807"
FT                   /orf_name="MICPUN_59735"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65043.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG558988"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B39A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I6"
FT                   /transl_table=1
FT                   /translation="MLRALLGSFLLLFARAVETRAQNARARGPTTRTDGNVSDDAHAAV
FT                   SGASFDRASIDHGHAAVPNYAPEAWKSQGAVLDAYAALHGVPQVKLSQLLNEEYLVELG
FT                   SAYPEDPDFPAKPSNGNYRFRTYRWISRMVDVGTHGREKFPDDVTAAIRERWPSEEYTG
FT                   YKPRSGRRRKESGRRPRLRVYRVASPHLRTLLRHSPSRLHRKEDAPAIGAADGGHANQV
FT                   LAWLASVHITPPSSGPGFCARAAKRRHEGPAPGSPVAVPGALVGAPTPLALGELREDET
FT                   EQDQPAPPPPPPPPFFGDRVIWDLGCMETTLGQLTCPKCSDAHLLFSRDAAGNLLDQQQ
FT                   GLRHKYKLVCDCAECDFALDMETSRVMQTGKTGRPPAEVNVAAVAAAEMTGLRQKALDL
FT                   MFVAMGVRGIHNRRTYTRHSRYVQDAMVQLGHAQILENRRIVRAFLKEQGVEEDEHKRI
FT                   PVTVSADGNWPVRGACSACGHGCLIFRDDMLQGGKSFVIAQGFRHKHCAVCSYYNSNEH
FT                   AQLLEPPQHACKKDWDDTSKAMETDILINLVGEVGQYYDKAREGGAVVPRDETTLLRVE
FT                   YVVCDEDSSFMVRIMDQLPEDLRPGKLSDVNHLANNFFKALVAIKTSPEFKNSRVLTKI
FT                   EVWHLSRYWRTIVRQNPKDPQRAHEQMMNLEAHVFGDHSKCNLYPTKDAKGVVHQWCAH
FT                   ARGAPDEPQRILFEEEPEVSRVDPSDKKKRVKVKLPLRKRLHEVISKFGSLEVMEKAVH
FT                   GLSSNPNESLHATATHMLGGKHKFHGQSGFFEATMRGAVMKKVSGQAFQLDVLVKLGVP
FT                   VTDAMRARFAQIDAERAAKRDFLYANPKEALKRLRRKTERKHAAWRDKESYGKGVALQH
FT                   TLGTSADDDAAEGGDASESAEIVEEAEEESDEEDEVVCDFCHEGKDAGKGSMHLCEGGD
FT                   CDQVWHRDCLVPKQDFEDMTDDDTFICPMCRYQQCLVSDEDGCGELQVTL"
FT   CDS_pept        join(48360..51139,51186..51270)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630808"
FT                   /orf_name="MICPUN_59736"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64684.1"
FT                   /db_xref="UniParc:UPI000199B39B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I7"
FT                   /transl_table=1
FT                   /translation="MNAVSMTKRKLAQISRRLGGVRASGGGMPAGGTSARPPRASGYVQ
FT                   SWLAKGQGDGKKGEDASHPAETVEHLERDLVDLNDAELAPKNASKDLATRVLPRLCAHG
FT                   VPGPNTLEVLTRMLADGACPERFALRYAYYLMHRILEHYGRAGLGTNETVKAATSQCIK
FT                   TLGEEAKIRAGVRRMLATRALVAAARAGVPEAAGALHQGTVGAIESLSAGEHPRGKSSM
FT                   FDSKTGKTEGGDAAHTDAAARAALGARRRFIAGSEEGDKKADSAVPSPSALATAVRSPD
FT                   HVAARHALSLALAAAKGPRYKELAIALEPVIGAVAKRMEARAANLEAAAAAGDSKEAKA
FT                   MARKSEGKQKGEPNLDDPGAEPLLLRLCGTLRARLLGAAERGGAPHDCAWACEKVLAAE
FT                   LKTYGGAAAGSESSPRVAMAACAGLFASDAPSGADGAKARAAAWQAIVRGGGEGGEPRL
FT                   LANSATRMRGVLLDPSAGPVARSAACRAVAALGEARAAARAVSGGDRAGQDGSLASLVA
FT                   ALKATAGPNSPPGVRVEALRALVWLQTPDFANAEATSELTTHLDDGERAGGDEGGEVES
FT                   FVGSANGLANRQKSLGGFDARNRLLAAVARRCALGCASEDENESDAWLTLTIDTVTVIV
FT                   GSNARQCDADLALASLRAAQKAAPKRSRPSVSSLAANLARIARAQDAPALEAALTWYLG
FT                   ENANYCAGEYAWVADTDGALVAAAAEGANPDTDEAAPGPSCAAAARNPSLDSSVTTLQR
FT                   ILMTSPDFATRCAAVQALTTVAVRSGEPFRLRCYAALRGLQRAASADPAAAAGPPALAH
FT                   EIDAAVTMLDHAYRAKERFAAMLADNGSDPSVWNPGALAEVTGRSEVVTEMASRTCFLP
FT                   RSKYLPLGPSSAPFIDRFKETQGADRVADAAVAAAKLMGQEAEKAAAQRRRRANLVSGG
FT                   STSSSTSWRRRRPRRAGDTASTGC"
FT   CDS_pept        complement(51325..51675)
FT                   /codon_start=1
FT                   /gene_family="HOG000208239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630809"
FT                   /orf_name="MICPUN_59737"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65044.1"
FT                   /db_xref="HOGENOM:HBG756691"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="UniParc:UPI000199B39C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I8"
FT                   /transl_table=1
FT                   /translation="MATPMRGSGSPLAPEKGVFPLDHFGECKKGMKAYLSCLKRHGEEA
FT                   SACRQLSADYLKCRMERELMAEQPLEELGFSNKAEAVKGKNEKKAERREGPSKSEGFVG
FT                   GVRYASRGARKE"
FT   CDS_pept        52609..55149
FT                   /codon_start=1
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22630810"
FT                   /orf_name="MICPUN_94613"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="metal ion binding"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64685.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B39D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9I9"
FT                   /transl_table=1
FT                   /translation="MTSPEAIVLAVDSEHLGGAEPSTHTRLKVQGICCPSEVPLIHSIL
FT                   DKRPGIRAVKVIVPTKTVLVEHAAKAAPADSIVDALNAARLQASLASAGGESSSHGGGD
FT                   ASDLGRCCGAGSTPPVPILLACAFLAVSLLHYVGGDFEHLRWVALGAVVVGIPPIARKA
FT                   AGSLRNGVVDINTLMTVAVAGACALQDFGEAAAVVALFGVSEWLEDRAMGRASSAMGAV
FT                   LALRPEKARRLASPEKEVPVEDIKVGEVVLVKPGDKVPLDGVVVEGSSAVDEAALTGES
FT                   VPVPKSTGNEVYGGTVNQGGTLEVRVTAPAADSAVARLVRLVEEAQAARSGVERAVETF
FT                   ARHYTPVVVLAALLLATVPYAAGHTGPKYAYMACVLLVVACPCALVLSTPVVAVCGLTR
FT                   AARRGMLVKGSAHLERLGRLKEICVDKTGTLTEGRFTMTQVKLATPRTEGEKPRPALGA
FT                   GALLRWACALELRASHPVAAAVLAGSGAAVRIAAKQCKVTEFETLPGEGASARVDGKLV
FT                   EIGGPALARRRGWGRDDPALAAAAAEWERAGATALWVGVEGDCAGALRCEDALRATAPG
FT                   AVASLRKRGAEVVMLTGDNQGSALRVARACDIPNGNVLAGMTPARKMEEVVGRVAKLEA
FT                   AAGGPKSLRRRFIGRGTLAMVGDGINDAPALGAADVGIAMGVAGSAAAMETADVALLTN
FT                   DLSRVAEAIAIGHMCLVKIRQNIAFSIVAKGIVLVLSLMGYTGLWEAVVADVGTALVVI
FT                   LNGMTVLSGVKESKEQGNEVEGCVSKAAENELPAHTHAHSHGGAAGNHGYSHAGAGGAG
FT                   TGGCDSSGQTDGPFRLKGTAGSEAEVSSCANKKC"
FT   CDS_pept        55496..55777
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630811"
FT                   /orf_name="MICPUN_59739"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64686.1"
FT                   /db_xref="UniParc:UPI000199B39E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J0"
FT                   /transl_table=1
FT                   /translation="MLQLAIETVPSDTSPSTPKPAGAPRRLKATPYLIGSTCYLLGSCL
FT                   FLVGGLGVQGDLGGGDTRVWGDLYTAGNLLFVIGSVLFVLDGYRAATR"
FT   CDS_pept        55843..60162
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630812"
FT                   /orf_name="MICPUN_59740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64687.1"
FT                   /db_xref="UniParc:UPI000199B39F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J1"
FT                   /transl_table=1
FT                   /translation="MAPTDGFDEETTLGDILSAGPQPTIEKGVTKSPTRKALQQAAQRK
FT                   EAALRRVLAAQTRRGYVADHLVHPVCHGVLRRQDSTGEQLRLALEIIKRANCPPESERA
FT                   LADAIRAGLATRLDQSPSGDDDRAAPTVRLEAHLRLLAHAPPRLAAAILWADRRRLMAY
FT                   IGRDSHTHGVNPGSRAAALAAFGRCLSRAAALNSINASAPAGADATGACGEGALFARAA
FT                   WHKILGVVSGASGEGGGIDPRVVAAAFNACALLLGPALDGCHPTLPRLLAAHGPTVSDF
FT                   GGYSGTVGVGDGGGGFERSENGDGGAAGGIATSADGDDPRGISCPLLATLRLEAACHLV
FT                   SRAAGVAAQANGLPLEMRAVAVGALISATCAALELPPPKEKDENKNPDDEDEDEDEDRA
FT                   RGAPAAPPNESALVRLRDAGRTALPDVSGGLVDDLPALWEMGLRAAHAIGEGTLRPTLG
FT                   SGPKELSYAAGIGLLALSGSLPQKAQPLDWASAACDALLTVYDAVPAVNGDAEWRELVA
FT                   SEAREASNPKPKGAAVDHSLSDHSSVQALPQGCGAGSAVAPMSKASISFAIANALPSMP
FT                   ISQPLQVIRQLVARCRHGLAERPDLRVAVLARVLSTHARMRTHPEAIIVMSPLGEIIAS
FT                   YLDDDDGPQRAAAAAAAAVKAAEETAANEKKEKTGYFGGSSKKPADDGGALDRLRAEAA
FT                   RAAAAADAVQFREEIVVCGVEAILSLRPTEEEASGWCTVALEAAASLHLVPFWRCNGRR
FT                   AAADAVLRLIARLCAVSKYQASLNKKPEAAGTHQAALRVLSALVEEATVASKGGRGARP
FT                   RLDDGTTAATAWLAARYLDFPTSGVAAMGAPGGPMGKLVGAMVSKMCAGGAGAASDDVA
FT                   NASAQQSLGTMRHPNDSSHYKNEAGYVASQAIAAVGVSCVDIMARRCPPLVPQLGAMLG
FT                   GLLTSPDGAPERMGHAAHARAKSLHKRFTAGIGEGGDASSSDRTAVQSPVPDAPPDLFP
FT                   PSVPPPPLMMSHLARLEVMDELAGRYFSRDRLGRAAAADEDWRLAAAAYRSLHGASAEP
FT                   VGFTNRADRSPASTKNEPGGTGSNKSMGPRPEADRAPLTGTSDPCWIEASHQAMPTSRT
FT                   LTVSLRCRPAPASNAPNAQGAAVASLAGTMTVGLHGAATFADGVGAVVAQLGSARLKSR
FT                   SHQTSGPTYRGRGHAVQTYGSGSEEETTVTVDVRVFKFDRVALRPVVAYDDGRSSLRAQ
FT                   AYEIPLTELLVPTKMSLPAFDRIWSALPATHSRAAKVHHHIHMGRKGGPQSHHRSHPLR
FT                   TAVRALWGELAPAVASLDDAFDSDLSRSRHVPLAHCGGYPLVAAGAACECFAACTWQGD
FT                   YLLLCAFAAVGGVRLEYRARDEETLRPIASNHADWLRWLTGDVLREVEDGDVGDDELFG
FT                   HEKALSESDMASGPSDAPHGLIRLDDSVLQEWRSLAA"
FT   CDS_pept        60587..63724
FT                   /codon_start=1
FT                   /gene_family="HOG000100094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630813"
FT                   /orf_name="MICPUN_59741"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64688.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG559360"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B3A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J2"
FT                   /transl_table=1
FT                   /translation="MFRYISGANGNSGDDALLSEDGGINVRSLPEDVQAVFADIDANGD
FT                   GVLDMEEFKTMLSTYAVLRRSNQEGSVSISTLPDKVQPALKVFDQDGDGTVDPKELMRA
FT                   AEMYQASKKSQRRMRKFIIGLVLFVVALIGINSAMTFMMVEIAKETKASPDGVMRVNAG
FT                   GGHQGAVVKTAANGEPSPLTSGLPDAAFAQLKQFQVDSPTGAHVSLVVQGWYRVPSPIA
FT                   TTGSVVKIMTAAGFIILDGTDMTFEETVGTVFSEAGFDVMGRKLLGMYEIVGIFNSIDD
FT                   WTGLGEEEKKPGFGKHDFYMEYSTLNKCVMEVGAEKSCVDMYNNTHGAYVQIDGEHYIK
FT                   IDSTILMDVDTNIAMESHYYAEFQATIEEMKSPTRRVKAQAIAYNVSLPDDDEESDMFY
FT                   CKEIHPGGDSSVWNVTSAAKVGETEDADGRTIREFVITTPLTSLQHDFITNFDANIPYT
FT                   GTTEVKYWDDKATGYPVKFSFGGKDFVVTKYVEDEIDLPEPDEWDVDEECFNMKPVDAL
FT                   HDKTLPTPVPANPYRFDNRRRLRDECEAVGGCYSSEDIDSQPYCVNGTCVNTTEIADIY
FT                   NSTAYDTYDTQGSGRKLLQTTGFLQHGDKVLIYNHRDGGGVLKVQHNQLLYSKIFTGQR
FT                   TLENAGTSNVPWLDHHWKVKDLGGGEVAFYNEYRKKYLRMHGSVCNGGQLTVEPNNQHS
FT                   YTNFPSNAVDWKFRLVPLKSPDTPRGLLKPEYNYFGIYNDNCGSFLRIDHTGRVRGHMW
FT                   DMEKLQDNDMPSRFAFKVLTRDGPTPRSGNCNKPETCRKDCSGGSCPGAGKTHSISFPP
FT                   EALKPRVQFGIEFWHRGCGVKGMSLSGSCGTATCEVGGTFDGPDVCCSNNKFCGPGGSV
FT                   YGIISQDLLELIKGNARADDIRKKLEEMNVSGSLSMILSYYKPAGRSGAITLAIVGEVE
FT                   ASFRRRQLLSIDSADEGDEGQVALTTSYGNHGRKVVWFKKTLKKAKKFAKKVTKAVKSA
FT                   AEAFVEQFGFTNGVFLTISGYAEYDFDSENLGVGATIEGQACLLNICGDFAVEVAS"
FT   CDS_pept        complement(63992..66583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630814"
FT                   /orf_name="MICPUN_59742"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="damaged DNA binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="maintenance of fidelity involved in
FT                   DNA-dependent DNA replication"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO65045.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="GO:0045005"
FT                   /db_xref="HOGENOM:HBG610419"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="UniParc:UPI000199B444"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J3"
FT                   /transl_table=1
FT                   /translation="MTAFAVTGAAHVSWMLRISSNAASGRRVSRPATSFRRGTGGRNRS
FT                   LGATLTDDVSRREQLEAEDDETREEEGEPTAEDLDAEARDLLQWPELSAQVRAFTATTL
FT                   GVRACTPTLPLGATPEESATLLAETTAAATLRDVHGGFPRDVFEGTKDVRPWIAGAARG
FT                   RVLSGSSLADVATTAAACAKVHALIHAPNDEALEPLRRLAAPLVGVPETLEREIRRCVM
FT                   IPGGNVLDDASDTLAAIRAERRETERELRALLQQKAQHMQKKNFAERAQIVIRLGRECI
FT                   PIKAGAQSEMDGVVLDSSSTGQTVFKEPAEAVPLNNRILELATEEDAEVERVLSALTAM
FT                   VVGDDGGASILNATEAMAALDLASARASHAMWLGARPAELVVVSSESGVCLESAVRLPG
FT                   MQHPLLLERHLPKLPRGGKVGEEETVRGFDEREEDGEEEEEEEEEGARFQSRADAREAV
FT                   VPVDFVVPPSTSLVAITGPNTGGKTASLKALGLALLMARAGLHIPAGGDGEPSRVPWTR
FT                   RVLADLGDAQSLDLDGGLSTFSAHLVRLRRILRACEDETCDGTRSVVVLLDEPGGGTDP
FT                   AEGAALAAAVLRAAQTRSLLTVATSHYEEVKALAESGSCPGAANAAVEFDAETLRPTYR
FT                   LLWGEFGQSNAISIAAGLGLAPELVEAAEKRWRRAQRAAAAATGDTSFDDADDIQELAD
FT                   ALERERETQERRAGEASLALDRAEDLHAEVVERGARLLDLRTRLAMEAAETRAKEGMEE
FT                   ALELINLVDEREELDEVVRGLMPPGWTLDERGDAVPADEGEGTEDDPDGGPGRLRSRRR
FT                   WTPTVGETVVVRQLGGAEAEVVEIDGADVTVRLGGLVTRTPLAGVSPTSKF"
FT   CDS_pept        join(66854..67057,67200..68069)
FT                   /codon_start=1
FT                   /gene_family="HOG000078831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630815"
FT                   /orf_name="MICPUN_101276"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64689.1"
FT                   /db_xref="HOGENOM:HBG561918"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniParc:UPI000199B445"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J4"
FT                   /transl_table=1
FT                   /translation="MRSAEPHNFVAEAGPGCIIAHVADPPWALGSERIDIRDYPKGTQF
FT                   PDLAVDPGSGTLSVVNAQTEHRVCYVTVYDNAVLDRDGTPFPAGRTTDNDGETRECVTF
FT                   ILLVPPMTIVHAATLTDASSEIDSDVQDWCRHPAPDDEHPLVIGFPLGVSEGKPGPWLC
FT                   TQGEGGSLTHFFSGNLHAVDFRCDEGTELLAVGAGTVVEVSQDNTLTGVAVSNLFKWNS
FT                   VMIQLDTEGDGAGPAGGPADAGDLEAGSRGSEDARGGDLFVEYVHIKAGSVRVKVGDRV
FT                   ALGDVVCESGGVGFSPEPHLHFCAFRSKEPTAPTTRVRFRAASGGEPYVPIAGNYYDES
FT                   GAVPAPPSAIGGTGGQG"
FT   CDS_pept        complement(68196..68642)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630816"
FT                   /orf_name="MICPUN_59744"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65046.1"
FT                   /db_xref="InterPro:IPR009500"
FT                   /db_xref="UniParc:UPI000199B446"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J5"
FT                   /transl_table=1
FT                   /translation="MASMTSSLVGQRLVVKANKAVRARNVQVKAMASKPKVITKAADLR
FT                   LIGKAVTAAEELGLLGIADGISLASIEKAGLLSTAEKVIYDRGSPGTISTLGFLLAVAG
FT                   AGAVYAIPDETTTEVVLQAVLASACAVGFGVSLTASSLLRKLQN"
FT   CDS_pept        join(69014..70357,70517..72073)
FT                   /codon_start=1
FT                   /gene_family="HOG000201079" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630817"
FT                   /orf_name="MICPUN_101277"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO64690.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG561933"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B447"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J6"
FT                   /transl_table=1
FT                   /translation="MGGGNTVVFVRNLPYSTTDASLTEAFSNEFGPVKEAFIVAEKGPG
FT                   GKSKGYGFVYFALAEDAASAVAKSKSFKVDGRAVTIDTANRKAPVIKGFTGKSRLSGGG
FT                   GDGETADEKASRAALAVLRGEAPPPGDSDSDAPKEEFKLTGPVHGDFLAKPKQPRPARR
FT                   SAPASHPALAADRAPRTVALAGLRLAGEPEGIDPDAALDAARACGDVEEVTSPAPKDVV
FT                   DAAHLRHDGATRGVLLITYASEDVARTAVTRLHNTMPGVGKRKAQRVKAQLKEGGVAAA
FT                   NAANRGRAGAGPDAGDTRAVELLWARQLGHCEGARPKSWRVIIRNLAFKATEEDIRTAM
FT                   SKAGFVWDLTVPRDFHNKPKGFAFAAFTAKSDAERAVKEVNMTNIAGRPVAVDWALSKT
FT                   KYAEAQQKAEEGAATGTGTGSEDDDDDSDDEDEEMDVDSEDGSDVDSDDENPAEATGTK
FT                   VKHANRREAREAARAERIAKAKEAAGKRDAKKGRARAEHSDSGSDSGSDGDEDDDDDEP
FT                   PPPRFAKKTDAAAEGCSVFIRDVPTECNKQMLFERMSKFGKVRSCRMVMDKASGRPKGT
FT                   AFVDFVKPDAAKTAVEAAGKVEGGGVKVAGRRVTLALAVSASEAASLATQRTKDAAPGK
FT                   GKRDGPRDNRNLYLASEGQIHEEGPAAQGVSQADIMKRRRAKEEQALKLKNPNFFISRT
FT                   RLQVRNVPPEVDQKELKKIFLEAVKKRATQANPRVMHAKLLYDPTRPDAEGKPRSRGIG
FT                   FVEFAEHEHALAALRALNNNPEVFNKARRPIIEFAVEDARAVKKLERRRDGLKQKQNQY
FT                   DADRKAKANAEAAATAAKGAQKPLAKKNGKGANGKTADGKDGDANGAAGEAKPKPKNPN
FT                   KKPKVGSKKRRAEREAKLAALGSGPGAGSGAKLEKSEGGKSGESEARAAKRPKVAAAAP
FT                   QADTGLSRRGNKKGESRGNDKRDRFDELADRYMSNR"
FT   CDS_pept        complement(<72348..>72782)
FT                   /codon_start=1
FT                   /gene_family="HOG000241907" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630818"
FT                   /orf_name="MICPUN_72125"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65047.1"
FT                   /db_xref="HOGENOM:HBG444053"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="UniParc:UPI000199B448"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J7"
FT                   /transl_table=1
FT                   /translation="VCVNVYDLSEVNEYTRPLGFGIFHSGLVVHGREFSFGGHDYASSG
FT                   IFETAPKAAPAPAIFREMVYVGTTEMNPGEVSNLVGDMDDDFHGNTYHLLERNCNHFVE
FT                   ALCFELTGKMPPGWINRLARTAVVANSCAPCILPVSIRAVA"
FT   CDS_pept        73104..73541
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630819"
FT                   /orf_name="MICPUN_83744"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /protein_id="ACO64691.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199B449"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J8"
FT                   /transl_table=1
FT                   /translation="MTVRFVLLVNKQGQTRLAHYNEIVPKAERRQIEGEMVRKCLTRSD
FT                   KQCSIVEHRGMKVIYRRYASLFFIVGVDEHENELAVHEFIHCVVETLDRHFGNVCELDI
FT                   MFHLEKAHYILEEMVTNGQIVETNKSIVLGQTVMYDPPPEK"
FT   CDS_pept        complement(73823..75415)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630820"
FT                   /orf_name="MICPUN_101279"
FT                   /product="Predicted protein"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65048.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199B44A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9J9"
FT                   /transl_table=1
FT                   /translation="MMRRRIALVAALVAVLVASLAPECAAASAIAPSAIHLSESDFDDR
FT                   IAMTRADEHCLLEFFAPWCPHCQNFGPTYERIAAFYNKGENWANPTEGHERPQPHVTAM
FT                   SVDCVANGHLCEHFDVRGYPTVLFGRCGQFAREHKSRHSEKIEKIAANRDAEEMVKRVN
FT                   DALNAEHELLPQADDQKPPIEDNEGEKKDVKVEDEAPHADLEDIEHATVLAYEQMTSAA
FT                   LLRPTNRDPFVSFVRLMADAHPVAVCKDGAKALMDKIDKTWPERSKPDKDAFDKIRTRL
FT                   SVHKVCGDGHVGPLVWRQCEGSVEGKRGYTCGLWLLFHSLAARSVVPSSQKNDYAGATW
FT                   LATVSRWVEHFFPCEDCRVHFITMVNAKDGVGTVATKTDGVLWSWRAHNEVNKRLAEQE
FT                   RRGEAVGSGDPKFPKTQWPTPALCPGCRKEDGEWDEDATAKFLVTYFHGLGAPRPRRGS
FT                   DGRKGGKGYGTPRVGAGKRGDEASGQPGSAVETVVAFALFGGVGLFGYRATAVPGSAGF
FT                   RLRRQLARHLRVI"
FT   CDS_pept        75821..77491
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630821"
FT                   /orf_name="MICPUN_83355"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO64692.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B44B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K0"
FT                   /transl_table=1
FT                   /translation="MLAKQRAVTGVLASNPASTDVKIEKFSVTVAGQPLLDDATLELNV
FT                   GTRYGFIGQNGSGKTNVLNAIALREIPVPDHIDMYHLHAEAEPTERTAVEAVVDHVTEE
FT                   IARLEAAQDLIIETSGVEDERLEAISDRLAELDPDTFEFEARKILAGLGFSNKTVPMER
FT                   ATKDMSGGWRMRVSLAKALFAAPTLLLLDEPTNHLDLESCVWLEEHLSHYKKCLLVVSH
FT                   SQDFLNTVCNKIVWLHDRDLKYYGGNYATFCTQVEAEEKIQLKLYEKQQADMAKLADYV
FT                   EANHANGKAKSAASKDKVLTKIKSEAVAKPKLRENTFTFEFPDCDKLPSPVLPFDGVCF
FT                   AYSGERADYLYEDLDIGVDCDSRIALVGPNGCGKSTLLKLMAGELRPTKGDVKPHPSLL
FT                   IGRYNQHSAEQLDPEKTVFGFFKSAYPNSPTFKRTDEFWRAWLDRFGLTTKMQNTKIGC
FT                   LSDGQKSRIVFAMINMRNPNLLLLDEPTNHLDVEAIDGLANAIKKFNGGVVLVSHDFRL
FT                   IDQVADQIWVCENKKVTVWKGTIREYKTKLAKAMGYSHI"
FT   CDS_pept        complement(77606..79381)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630822"
FT                   /orf_name="MICPUN_59750"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO65049.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561963"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B44C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K1"
FT                   /transl_table=1
FT                   /translation="MAGLKRVGSSLSLASPHKVVTPLDWPCVLAIQCTSMISILSTTYV
FT                   FSTAVFMVRAWGATDEAKAAAHAGLMIAAKPAFSAISSYWWGSAGDRLGFRGTLLASSA
FT                   VTAWLTASLGLVTSFPAAIFVRALSGLFDGVMTLTRSSMAKISDKTNSAKAFSTFGVTY
FT                   GLGSTVGPTLSAVLAYPCGADPNARDPSKGLVFPTRCPSRFMREYPFALSSGWVLAAAA
FT                   FLWAYAYAFLRVDRHAGGGEPLGVEDADVEKASYPGGTPGDVEMTPTRGGDGVRGGVSV
FT                   GRTERDGDGETLLPERDGGGAEASGGESVARVRSVRPKVEEEEEEEEEEEEEEAGPTPV
FT                   RGGYARVYDGDGAGDASSASSWRRDPVIRRAVINQVGCTFVVIVGAEATPIWMATSRTY
FT                   GGLGFTSVDIGAFGSVMGVTILVFAATLFAFLADRFGVTRSVMWACAANGFIFAAHPLA
FT                   YFAQERSHALTWFLVSVFAVGRGCMGPVVMGGVSLILNNSAPRRQLGKVNGFAGTFSNL
FT                   ARAGAPIVGGALIAGMVHATRETVHKEDDGGVEFDIARTLPPTWWPFVVIAAGFFVLAW
FT                   QTSSLPRSLDSPRTS"
FT   CDS_pept        complement(79655..80671)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630823"
FT                   /orf_name="MICPUN_59751"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65050.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B44D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K2"
FT                   /transl_table=1
FT                   /translation="MVSPGAIIFAFYVGRAVVEGVHAYFEREGDTIRACLARFRLPSGP
FT                   KLTLEQALRDVSDANRALADASVAPDTPRPGWRYKATLSYRPGVAQAAFFRALKVGPRV
FT                   AALVGRVDVDLEEVPTARDAPSNIRGDGDEGVSLEELATRDGIREGADDDGSDDDDDFE
FT                   HLSVCRRATLAEFYTLIRPALAQIAVNNVPGSVHLTPVSRAPRANDGNGDGDGDGEDET
FT                   CSICMDAAIDTVTRCGHAFCGECYARWLCRSRDCPLCRQHLAHHGGAYELVRPEELAED
FT                   EDGGAEAGTVAAEPAMDIGWLRGRLASLPIVSEPRRRAWEASMIRKLMEGRSNASEA"
FT   CDS_pept        80848..81747
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630824"
FT                   /orf_name="MICPUN_59752"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64693.1"
FT                   /db_xref="InterPro:IPR021503"
FT                   /db_xref="UniParc:UPI000199B44E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K3"
FT                   /transl_table=1
FT                   /translation="MSAPTALASTMSASRTIAPTRSIAFRRRARLRRASPTSVRRSRVV
FT                   AHAGGDSSDVVTPWWHSLPVVHILVFSPETEDEAVYTTSRRDGDTAANSFVAFEDLRDA
FT                   TRASVAVSDQLDGCEMPTVDSVDPRVMIFLADSCGYGVEVVPAGGEFEPPATVIDDFRR
FT                   SYEAEGGAEAERSRSRDGTDELAISTVDLQRYLSDGGALPVLPPEDDDARSSEAALEAE
FT                   DGARTLEARRAAAEAVRSALAGSVANLSGSVRLAAGVGGKVKSMLTPMRRVQRSMRGAS
FT                   AMYEALMGIAERRKGEEK"
FT   CDS_pept        join(complement(84387..84455),complement(81802..84243))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630825"
FT                   /orf_name="MICPUN_59753"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65051.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199B44F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K4"
FT                   /transl_table=1
FT                   /translation="MKLFLDPGSTVSLAAAITGNVSEAALVWLRRVSFLALGYRLGKRT
FT                   ERAKAAKKRLIARRTLTPLLLDHKHADTLVDAGGLAAIVGDLPQWCKKPDHETTAWLNG
FT                   LLAELWPQLSAALSEKIGTAVGKKLARISPLGLNLSFKEFGLGNEAISLLSVRKVGRAK
FT                   DTNEVILDFDMRWCGDPTIVLNASVLGLPLMVRLDELQLIGPLRLCFADFDNNLPCFHM
FT                   LKIAFVERPDINFKLKLVGGDIDMVMGLKEKITEVIGNGLGKALVWPKYIRVPIANKNR
FT                   PGAQDVKVGVDKADAAGVLEVTLVSGSNLRNMRAIGRSDPYVTFSLTNSGRNEVKSSVI
FT                   KHDLNPRWNEHFKIVLDDLDSHELQFVVADYSAMAEDAGVKKIEKCFTKMDVACCGWWR
FT                   RRTGAKGARDAKSRAKELEGAMFQTVMGTGSVKVSELKPFQEVTKQVPLSKDAMSVFAD
FT                   PTRRKKVSAGFVTLRMRVIPLTSTATRTAKNLESAGLKVKKALVKKREEHGVAVPKKTF
FT                   MERFGRPPTAEELEEEARRASEKPVDFDRSAKEAVELMLNTVLGGNLDRSDPRQAEQVE
FT                   LLKPHLNGLLYITLVKGEGLVAKDVGNTSDPYFKIKLKSQSWRSPVVYKTLNPVYDAST
FT                   EFIVSPADLLSPGVVIKCECWDKDIVGKEFMGECDVELRDVVKRSLQAVGGWVYRRVEL
FT                   RGVEHGSVHVKFRFQPADVGMREKTPEARERYLARHKSRMRRKAERRSVDGKGDGLKRY
FT                   PDTATDDGDEGPEKVVHFDAGDVGQEDYFDFGSDDEPSSEDEEDAELRSHPSSSPTRLK
FT                   VTDDEGGPSPPPSPPRRGLFGRKK"
FT   CDS_pept        84623..85222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630826"
FT                   /orf_name="MICPUN_59754"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64694.1"
FT                   /db_xref="UniParc:UPI000199B450"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K5"
FT                   /transl_table=1
FT                   /translation="MAPPALDVSKDDPGDSPRGPLSVASDTSHSMESPSAAEDVDDDFT
FT                   FDSPRASSPAFSPSSVSGNGTDGSFDRDYVWGVSPASVTKRDDGETGTAREPRPTGRER
FT                   RDRAASSAAVVEAVVGAIASRPFQSSLGAGKHHPAGLRPTPPVDLGPETKAPISPRAAK
FT                   AIGGWRVVRRPRPPAERSERSSRGSPRAKGRRLVFA"
FT   CDS_pept        join(complement(87025..>87255),complement(86287..86442),
FT                   complement(<85801..86136))
FT                   /codon_start=1
FT                   /gene_family="HOG000200827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630827"
FT                   /orf_name="MICPUN_69569"
FT                   /product="Predicted protein"
FT                   /function="arginyltransferase activity"
FT                   /biological_process="protein arginylation"
FT                   /protein_id="ACO65052.1"
FT                   /db_xref="GO:0004057"
FT                   /db_xref="GO:0016598"
FT                   /db_xref="HOGENOM:HBG396111"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B510"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K6"
FT                   /transl_table=1
FT                   /translation="YQHLIDRGWRRSGNWMYQPVLDRTCCPPYTIRLDVHRFAPTKSQK
FT                   KVERRLRAYLEGRIDEKGAPTNDDARDQPSTAVKTLTVTTRPSAFDEEEYRLWRRYQTR
FT                   VHGDDPNENNELGYGRFLVDTPLRRRWVASPPSGFGSFHQQYRIDGKLVAVGVVDVLPY
FT                   CLSSKYFFWDPDYAALSLGKLGVLREIEWVREASAHCPTLRYYYMGYYIHDCPKMRYKG
FT                   EYKPSELRCAATGAWCDLD"
FT   CDS_pept        87779..91486
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630828"
FT                   /orf_name="MICPUN_59756"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64695.1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199B511"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K7"
FT                   /transl_table=1
FT                   /translation="MDQEPPPRIVAEKPAPVPAWRDGFALLIDPGDPDFAPPPPPPEDR
FT                   SKLSTDELRRAGMSELSTSASTAMSALALAGERATAAAKGFRTAFANQRLAAARARSTN
FT                   EDEDEDEDEGDGARERPMEARIVHACFREAMRPKLRGRSAKAAARNAISRALARWRKGH
FT                   HACFDAWREFALAAGHMKRRGEDAKRHEHALDAPAHSRTDEETEGLYELVNGSCDLFGE
FT                   CARYEAVELCRRARLERFSAGQTLLNPGDPDDKVFIPIAGSVSAWIDADVDGRGDGDDE
FT                   EDEEEDEFKGERGRRRRRRVAKTFVPGRSFGVPARAAAPPHRHAFVADVDAWCVTISPG
FT                   DCGGTEWEPFDVTVRKRVDFLCRIPGLFDATLVELEALARHAEERRYEPGLALVNQGQE
FT                   CRGAYFILSGTVAIIRRIRIDNRKTTGRQPEEERIDEPDAPVPDHLRSALPDAAKANDR
FT                   RRVVRARVGAAMLTRDGDRGDGSGDSPGGDSPGGDSDVVDVQLRVVGSLGVVGGGDYFD
FT                   RPAPCACFAVARGAKPVAALFIACKHLAKIFSPKAMERFRRGCHPAPADDALRKSLAAK
FT                   EASEAANRAAWTGPDGTAIEGVEPVDPHEELRRNPLAYSDSDSDIEGDVDERRPDRPTL
FT                   VPSSRRSLRPFLRQRGARDSDARDEAKENGRLVVGWPFHRDVYDPRSDSHRVGPSFGGG
FT                   FSPCADKAKRGVQRRTTSTDPDASKLAEIRDVGLVAAKSKVITSPKNPTERKGSYYRKF
FT                   LDDVASFDPRVTFAFDPSTASPEWKSHQEWTAFATRPRMLTKLEFQNQRVVRDRRASDA
FT                   RVERTRDDANRRGGVKKTAAVTIDGAMNDDSYDDDDATANAAKRWLGYRDDARPDGVRV
FT                   FRPSDRTAVLDARDGVTVLAFRLACRSTLRRLQKRIDGRVSFEFGGYDIGKTHDADEAC
FT                   STARSAAGVGRCVDDWREGKGDAGGDVGSDGAAVPSRSTSSCVCVCRLSDASRTCATTR
FT                   DDLCALASKLCVESGVLSCVRWSGDSLLLFGDCDDPYVDDEEEIEYVSRHALNTALELR
FT                   AFLVNYHVGKAKAQANGPPPGGWNDDDGDDMERQGDIAVGISIGSAFTVRRANSLHAVD
FT                   GEVRDDACRLCDLASDDGGGVRCDAKMYPACKDTHTLVHAGAGTGIEETGHDRRRSAAF
FT                   AGYRVVGDPFRGLGPKSGAGETAPRRHTARVPASVPYFNWREGASEARAPKSRGKVGGA
FT                   AGRVLSEYLG"
FT   CDS_pept        complement(91604..92293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630829"
FT                   /orf_name="MICPUN_59757"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO65053.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B512"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K8"
FT                   /transl_table=1
FT                   /translation="MQAARFAGGSVPFAGRTRREFCASHRRALRSFATSPRADIAGLTL
FT                   RRGNEGDANTIRLAILREKMNPLGLDPRRFVVAEEDGRVVGFGQLKPWETLSNRPKGDF
FT                   VGNVVRMLNLQPNWRGQLLELASLVVMPEHRGRGVGTALLNRLIEDSINAKDPETLLKQ
FT                   ETTVCLLTLKSTVGFYERAGFSVITSEQYVPRPLQAELAAGKVVAAVVADDECVAMKLE
FT                   SLDIEEM"
FT   CDS_pept        92833..93168
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630830"
FT                   /orf_name="MICPUN_59758"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64696.1"
FT                   /db_xref="UniParc:UPI000199B513"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9K9"
FT                   /transl_table=1
FT                   /translation="MPTPTVASRRVRTAEGSVLRASIDPTAASSDGTGSSAGSLITAGD
FT                   MWRLAQQKRSAAVALSRFAAMSVNFATFAQLSAAHTVEEAWREVEEAEEAARAFRAKQT
FT                   AGQTPDV"
FT   CDS_pept        complement(93311..94402)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630831"
FT                   /orf_name="MICPUN_108537"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65054.1"
FT                   /db_xref="UniParc:UPI000199B514"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L0"
FT                   /transl_table=1
FT                   /translation="MQRSSAVLRSKLEAQQQREQARAARRRREELEAAELRRREEEARA
FT                   SAGAAARPPPAPPFVQRNRSEPLPEEDFCSPEYHPMRRDASWSSDGHTSREPEIDAHGS
FT                   NPNANQNNNTTTAGATSDEDGHPQPIAPEDDVADVAREELRNNLKAFLPKVHVPREGLT
FT                   PAQLRLGPGPGELCVPGFCSAMCVASAAVGFVQYASPGTAPVDPGNVPGIIKSLRKIAI
FT                   RNHPDRNSVAKVGENQAAKAKVITAQATNMESLLDEFEHVNVRVHVDVPTGPGEGPSSA
FT                   TSFVLNRLHLGASTEQLMDLVLEERPELRSRRDGLAISFASAPGRPEMRLPIDASTLRS
FT                   WEVSRASVFRVWVPAPDWMAFES"
FT   CDS_pept        95047..96639
FT                   /codon_start=1
FT                   /gene_family="HOG000148137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630832"
FT                   /orf_name="MICPUN_59760"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64697.1"
FT                   /db_xref="HOGENOM:HBG285161"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniParc:UPI000199B515"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L1"
FT                   /transl_table=1
FT                   /translation="MASMTSLRVAHLNGELAQLRSSRRSGRRRTAVRSPVASAAIAEDW
FT                   REKSKPIAPGGNYPAKEHCSQCGLCDTYYIAHVKDACAFLGDGMSRIETLEPTVHGRGR
FT                   DLGNDEMRLGVVDEVFYAKRNRPVEGAQWTGIVTSIAIEMLKSGKVEGVVCVASDPDNA
FT                   MHPRPILATTVEEILSSKGVKPALSPNLSVLAEVEARGLKRVLFIGVGCAVQALRSVEK
FT                   YLGLEKLYVMGTNCTDNGRKETLSKFLENASEDPATVVHYEFMQDYQVHLKHTDGSFEK
FT                   VPYFCLPANKLKDVIAPSCYSCFDYVNGLADIVVGYMGVPYYHTDMTRHPQYVTVRNER
FT                   GKEMFDMIRGDCDVTPSVSSGERKPFVMQTVISDDEATLGRGPEEPAPLPVGKAIAWLL
FT                   EKIGPKGKEFGMYSLDYHTIRNYLYVKRTFGEERATRHVPDYARLVVDEYNVYGAVDER
FT                   LKLTGTPPVGEALPRPAPSGRTPAPGVGPDAGVGGAGEGAELPEFLKGADPGVVGGVVG
FT                   FLLFTTLATKLMS"
FT   CDS_pept        complement(96727..109578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630833"
FT                   /orf_name="MICPUN_59761"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="ACO65055.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI000199D583"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L2"
FT                   /transl_table=1
FT                   /translation="MAPSGQNRPREGGRGRGRDASGRGGRGRGERGRNPGRGDGSIGGA
FT                   AAAARCRPPPAGEIPDFDGGFVFVARETIAKEAFDKRLIGMGEDGAFILENDVASTNTA
FT                   VFICTVNDDGADHRVMLDVFKPKRRAGAPEGAVFSRAANSEPIDPTAFTRSQRGMPAQI
FT                   KVRPWPMGSSRGAVRGAVRGADATTLGLHRYLPARLFGRYLGARLAARLVDEGADEMPV
FT                   VLDAAEARELAWALVQATGRDASRATDRATGGATAVPATGPGEIAVKVRQREKRDHPEV
FT                   GGGTAGGRTVTVARDGRLVQVPVLRIAPAQLSQQKVTTDLDIALDIKRDDAARIAALKA
FT                   VGVACQGAGGPGMFRDGYDWDANFVSETKFEKLAKGLRSLEHDRVREIRTLAPAVLGTA
FT                   ACAYIRGYAAAHSYKYHSDRLSVPHGKSLFPMSGKVKPPNPSDKKAWKRFVDEEYTPAR
FT                   NAVWERERRVREGEIPGDSTTFRDFDMQFFEIMFVTIAEPVDTGSGPAECRDAEEMKME
FT                   VEQKEFAIEAVCACLAPLMDAILDAKVAVDVDGDDASIVRHSNMLHILWQRIPPLLESC
FT                   VSMLNDPHVDEDMLLPMFRLFSILTRDLTIKSLFLDDVSARWTEEGSLPAGDTSKTFPS
FT                   MRINVAAKEFDLPWRHRHAVTFEDFVDAIVPLACCHRRDGSRGFNCWVEACELLSKFKH
FT                   KWNRPTSTQRAHHRKLLHRLMQYCIEPDELQYGCTAIDPDPIAVAHCFRSCMGDICETA
FT                   WEEATSLAYALMSHAVRLKIYNEIECSEDREILYRRSNRWLVSSSRATCQAINRCYPDY
FT                   DVFWGIFIMLGSLLVRLLNGSGCSGDKLAQLEKATLKEKQTAMKTVADKWEFLQGQCVE
FT                   VANSFVYHTFPSFINSYCGTNEMDSPETHVQTIYASLEGMLACLRFHNPDLENIDLDSE
FT                   PELPFHLGEGVFRTVRWVSQSNDPETALCGKMAYLEAAKSSNVAVRFIVSRASRILFES
FT                   DLALIKTSLEKKNTRTSIAVIEALVRAVDLDLDVFLCLWNGSGGTKIDHRVRSEIARLL
FT                   YSRLAPGELLHDRLAPEQIIKSHPVLKPLIDKFITLKWKIDLFDTAEFDFDSKAEALLL
FT                   PALDPDTADGKTLTALRTLLEDKASAKVYMHKSEKIFDKVRELAEECKDPEVRIAAAEL
FT                   LVDPVIIPPDDWNAEVRIIWNVHRTALRCIGDKVKMVRDKWAAALPGLSLAAAWRTGKN
FT                   LCDTPQWVTSFALAARRANFQSADLKSILDALMSKDMTKVAPATIRKMLDRAVKVAPPP
FT                   TRQDPVAASLTSVGGTLLNAAAADRAEMRGAVETPAVRISEPAPMDVDSEKDSDSSIDL
FT                   NAISINDDAVMWWAVQETARQCVSARLRTHYGNASETLSVIEQSLREVRHAKTPTVAGA
FT                   KNVPRTNAHSMTGTWLLLEFVQALERQMYNAYEGTLSLPPPGKSAASFFRLNKQICVDW
FT                   LRRIKEASLGAAKSCGNVAVGANIALSRVQGAFKTLERRVEKAARRRAEAPARHLELKN
FT                   ALSEANVRLGKAHKRHGLVAARLERARQLVSERMNANRSRQEIDKAREKVDELREEVKD
FT                   TKEDREKLYREKSEAQDKLKNFERKSAGEETDSEKDAVAFVFRAISDAVSLLVSFGEPD
FT                   LLIGLADWCEPRLRSAGLDGWLPTSHDTTSDDAFSKKAEGLLDWVRAAALEADGRHEEA
FT                   AERYRQLLKTPVKIESASVRAVAKRLTHAYASVCDWDGLDDWRKDLRNIQQDADKAGSN
FT                   ELTSALKDVDVKPELLGAWANFDRYQFASDCKSLLNVPIRISEKPPASPMEVVDVLNHA
FT                   TQRHLEELFVRNPLRDPPERIADTRKQLQTAMKKMQEPMRLSNLMGSPGVTETLHLELA
FT                   TADLVCAAKLDQYQRLFGASPKSHGAVQRQAAWIKLCRVLNSLSLKNGDDWSRTALLQI
FT                   PFASTDDSPSARLLMEILSCAEKRGNSKVVCKILCQIEGSRDPQSSAQLDLESAWLRSY
FT                   PLEKLFDDSEFIEHVFKKHSLSSKFEDIKKASFSRTRSHDLYESLVKQSAVDLDAQLAR
FT                   HEKILKDIQGRTDTDRLRHHIQVMKDLIPLKRREDEIDRERARILHNPEEHLPAGLRQN
FT                   VEPRRGALLKKVADWDLFGDRHDENAKVWLEYARFFDDFYRRDIDDPNDPNNPNDPNDP
FT                   NDPAPWGPKRRDRHPISAAGVEDIDGVCGEPTPIDRGADVKEVTHLLEVANAYAQYLVR
FT                   NKSLDRDTELDRHHAMVRLLDLATSQQIGERDEMTKIFQEIPTLTFGDFIPELINLLHS
FT                   DVRTVRENVTAVLVRVAKEIPRALSYAIAVEAAAADDEADAANELAMSTEDIPEALAAV
FT                   RERFASASRALEAIGRIKSVLNIRHPRLFADVTLMVSELGRLAVLHDEELLTSLQELHG
FT                   DVTRRIASIPESSETLGDSPETLELVMRPAVVELDRLVREALSGTGFVTPHVKSFARKY
FT                   RDGLLDAADQFRRSIASDPSAGWRAVKEQMVHLARGLERKRELRLKNLSPSLAKLGTRA
FT                   GGFTAPMPVGYGVDIVSVGSDVTVLPTKSRPKRITLLGSDGDLRMFLLKGNEDLRLDAR
FT                   LMRFGEIVNAALFSDEEARRRRLRYSTYSVTPLAGNSGLIQWVQNATPMSAVFAGWQRR
FT                   ARAASALPPPGAVPTDWRPADPPEASKTKPLDLFYTRVSAALRAAGVTTAAKRREWPAD
FT                   VLRDTVERMRAEVPQDFLHRELWCGAPTSAAWLLKSMRHARSVATASVVGHLVGLGDRH
FT                   LDNVLVNLATGDVVHIDYNVSFDRGLTLPVPEVVPFRLTPVSVAAFGPTETHGPFRCAA
FT                   ETALAALRRPPARQALLGALELLTREPLTDWIDDGAGAGPTARGPGRKHARRGDLAREH
FT                   QALDIAAGLESFAAKIRESALAPQAGSVCGFPSEFFELAREVDGILAELRGRAAEDGAA
FT                   VIAAAEAAEAAEAARLDARDAAAEAAQASDAEEFSTAGVSVSNLDDAIRNLSEHAADAR
FT                   SWSDRHGRALDRLAPAAKVLSELRNRTTTTANDGGAPMLRAAALTASLALSNELQEAAS
FT                   KIDVEGVGLLAARDEATDAAAAALERYNAWVTSNLPPSYPESDRRAVWAKALEEARDVS
FT                   VRGPSGLCPGSIRDAVETFRRLIDGASAPDESGAISWARYCAATGAWHERESRTLPALR
FT                   YQAVIAAKECKRHAAAGARRWDQSFGQTVDRVFREMRSDEMEGTRERPALSWLVEYASR
FT                   APVRAGRADDSRMAVTHRAVTHRATEPPPGSSEPSAEPRASFALSSSLGFFGDMGGDGE
FT                   ELGGLSDGDDDGSLENEMSNLRVEEDLDIEELMRDGGDSQAPEPRTDRYDDRYDDDDAS
FT                   VGTLEERIAAMPRRERSAVLAAAVYGAFNSDDYRKIIRSQPASYHELPPAAFIDSVMDA
FT                   ATLPHRVMKHVLPVVLDPRAVDPMRSMRIVEAARAAQALERRAFDPNDGAPRLIDERMA
FT                   LRRECGQLAVELRALVKSLAEDAPMLSEALLTHVCRDTLLFPGGKTEFGSPENAHPMYS
FT                   VKALSKLVTRVLAAHGAHVSGDLREENIVNGEHDIGGKQEIVVATVLKEAEEAADVIDT
FT                   WIVQESLEETVARVTYDLVNSTDGVFIETPKPEQERVYEATKDEDAMATAMLDAALKAM
FT                   CEIRRSRAEADLARCELTHAASDAAISRAEWLLESRLERGSMGRWGVEADPARSRRWRS
FT                   KHLDDVATAGAELTSADIAVRDWSRRAAAVERSVVEFFQFGSTDADRMDTFNRVLEDRV
FT                   RALRDSDQRAATCRQLCEGVESFERCREPEREAAAESDLLPEGFLDFSFDAALDEDDVT
FT                   GDVVERGDDLPKLAASGIARNPFKRRGDEKREIVPEERERKPERSKKSNRDVAGGRWEK
FT                   TYELAIEEVILACEEVLETAELTSAAGPEAEEAAVARAEAKAKAERARELARLADEKSR
FT                   AVVDDVGVVAFVEPRSRTRELLEELREAMIRYRSCRGIDVGEEFEMLQFVAETGQHLEG
FT                   LNAVFAKAPADLAEACDVENAEHFAGAASDLLREFEDRLAEMDALAKKARQVADEALRG
FT                   AKPGKLVAKPGKLVEHSPQFVDAVRWLALAGADVKRGEALRDTATALRDTLTRAQETAR
FT                   NVSIAIKEHTGLGLTAMSTRDDDAEKPTRKMKQPVDSSDDDDDVASATTTTVTTTVTTT
FT                   TTIAANERRRGSAPRRWRGGRHPTAVRLISVVAAKLAGRPKLVEALRRNALASVPPTVP
FT                   SPPGGEDALAAAAIAETPLTAKEDVDRLVAQATDPRALASMYEGWCPWL"
FT   CDS_pept        109817..110620
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630834"
FT                   /orf_name="MICPUN_59762"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64698.1"
FT                   /db_xref="UniParc:UPI000199B516"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L3"
FT                   /transl_table=1
FT                   /translation="MLCGQARALVPRSLPRGGGDIAETSRAGSSARALPVVAKRSAKKR
FT                   QARKLEKRDDARTMEKLAEERAARLAAAEKYRPPPPPPPTDPNDAKDRIARRERDFQAA
FT                   LARVGEAKAAARESEDWDPSRGYKPFDDVQDAVYDLALAKTAVYESHLELALSLLTVAK
FT                   GDEPSSLDRFDWVYERGVSDGNVRCLSFMLAAMTKANVVSGVCEVLWVANECGVTGAVD
FT                   PKAMKGALGMLADLEEMGLLDGTDVDAYNQTKEVLAEEESAQAVS"
FT   CDS_pept        110783..113278
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630835"
FT                   /orf_name="MICPUN_59763"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /protein_id="ACO64699.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B517"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L4"
FT                   /transl_table=1
FT                   /translation="MQPAMLVALHRGAFAISSPSHRVRPSARASARGATITRAAGGFRV
FT                   IEYGDGTTPESRGESRRRDDGFDDRGEYDRARPRGGRGGRGGRAFGGRGRGPPRRDRYD
FT                   DDDEEDDWNERRDRGGRGSLRQKGRGGRGIDAQRGFGGDRDGGNWGERVRRDDRGYDGR
FT                   YEEPRRYDRAPPRRDYDRGGYSFPDDASSPRAPGYGGERGSYGGGRERGSYGGGRERGS
FT                   YGGGRERGSYGMTALPDSDFVTIQSMGQEGRVIGKGGAMVNELQQRFGCRVNVRRDLGV
FT                   IEVSGGDVAAAEDEIRGIVDRGVQSDLQRDTGGGKPPLSRELDRSRGARDGGYAPPPDA
FT                   AAADDDDGFWNDDDDDDDWVLEGLEDELNDAAQWSQGKGAKGRYVPTQMSKYVDDDFEP
FT                   MVYTREPDDEDEYNFFSGARFAQLGASDGVTEALKEMGIERPSHIQSLSYRALTEEDSN
FT                   DHVLLADQAGSGKTLAYLLPLLQRLAETERTEGRAKPTRPRMLVLVPTSELAVQVLGVI
FT                   RTLSRGGLRCRSLAVTGGDKNSRTQIETIREGCDVVVGTPGRVGWLVQQKKLDPGDLQA
FT                   VVMDECDVLLGDSFEFAEQVAPLRDAVPNATRFVLVTATIPEDVLKQLRAFFDGALRVV
FT                   QGPGLHRPAAGLLERLVDCSGGDVVDDQSGFWRKFAALEQLLAAEKEKGTDGRSKRMLL
FT                   FCNKIETCRKIENLLIRADKDGQDLVPLPYHAALTPDRRKSSLEEFLKPHKRGDAPKML
FT                   VCTDRASRGLDAAGVTHVVLFDFPRDPSEYVRRVGRTARGALGKGEVSVLVLGRQVRLA
FT                   REIMRRNTRGDPVESTPQY"
FT   CDS_pept        join(complement(113851..113939),complement(113572..113716))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630836"
FT                   /orf_name="MICPUN_59764"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65056.1"
FT                   /db_xref="UniParc:UPI000199B518"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L5"
FT                   /transl_table=1
FT                   /translation="MNMLDDDDEEVIGPTIWEAAAEEEIQENFWEYHCRKNRNEGKGDA
FT                   VYNNLAYLPVCNCMPVCRKGCRNPIWMWTKKK"
FT   CDS_pept        join(complement(114593..117696),complement(114138..114456))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630837"
FT                   /orf_name="MICPUN_59765"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65057.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B519"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L6"
FT                   /transl_table=1
FT                   /translation="MGSRGSGEMNNIMMEEDDPMDLGKPMSADEFHDRFDEGRDPGLGF
FT                   YRHDYDSVHQLDNLEEVIAQALPRDRGAMERDTEREGMPLETVIPYDFDPMRDTIIIDI
FT                   PRGYGAASGKTMEIKCHKFKPGAAVAIPVPKFTAAGGVAQGSAIGSASDSRTMGTTSEA
FT                   EPAPSTTGTTGTAGTGSDDGDNATAGKSVLALRAKSATRTTTVSQLCTHGNSAFDDVDH
FT                   TTEELTEFKAEVTLMDELGRLIDGGGDSDGSGDGAGAVSGEPPGGGESAQSGRRSARED
FT                   SSADGIWFTDKKVDADRRRDRERGTEGGTERGTEKVDFGGDAAAVTAARGDASTPGTDE
FT                   RSVSETRSKSRADMDEMGVPLEDLEGWVVDSPAKKDGLKKKKKEKKKKKLTWFFGKSSG
FT                   WGFFGSGKKGDLDPQGLHLNESALEKMQKSGRGDTPSSRRASIDEPRRNSFDGYGRRSG
FT                   EWRGPDPWSGMMPRAGQPPVKRSSGKSIVSHGSSGSIESLKEALAARQNSFGLVQRADS
FT                   MTVPNGTGGHAFKVVACQGLTVQDDHAWNGRARPRSPDRVARPSQVDSNGRRRSSLDSE
FT                   SGEESEPVVMPRSNYVQRMERKERRETSAGGDGSAMRRRTGRAVDKKNVPGVLYLDDMP
FT                   FAEGGFAKVYRGAFNNDGLSIAVAIKQMTYSLPEGETPTSLKFSRDLVTSRDERTPGDR
FT                   ARDKLRGMGRSATREVEISKLCTHRNVVSHIMDHTGPSTDPADIAEGATIREDGEAEHE
FT                   PLLGKTSRWKTYIITEFCIGGSLRDILRQPELVAATKQVRSSAAQLCVLKQVVEGMKYL
FT                   HSIGVVHNDLKASNVLLHPSGETNCRWSAKIGDFGIARRIPPGAARVPLDIMNGTVSHM
FT                   APELLNDKFMSRATDVYSFGVLLWEIAAQGETPFSGIDAVDVVAAVVKHDLRPKFAENA
FT                   FWPLVQLATRCWHADPHERPSFERIGVDLSAWEPLVTFQRVENVSYMPIREGTEGMSGA
FT                   DATLTEGIDDNDSKNPSQASSEMPLSTASVESLEAHARELRIAGGEMVMGVALIGLNGM
FT                   DTLSSPRIALAEAGSLRFRFPVSPHLSRVNLALPTSSFVFGLQTASAVSGTLGSRFSPS
FT                   SRSFSRTGEFERLSIAFSLALGGTPAFIACTGC"
FT   CDS_pept        118269..119426
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630838"
FT                   /orf_name="MICPUN_108538"
FT                   /product="Predicted protein"
FT                   /biological_process="protein targeting to mitochondrion "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO64700.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006626"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="UniParc:UPI000199B51A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L7"
FT                   /transl_table=1
FT                   /translation="MSSSETPELILHRWPGRWNLPSLSPECIAVETYLRLAGLRFAVED
FT                   CRTHYASPSGALPALDQNLDVVGGAVPGDTNRDPTGALARHRIVEHLRRKVRDVDAHLG
FT                   PDDRAQLAAYVALVEHKLATTTAWYQWIDKDRFAKHTRLAYGAAFPAPLSHVLPWMWRR
FT                   TQLAGASAVESNDDRVRDGLRDAYASLAAKLASTGGPYLLGAKPTSVDALLFAHLAYHA
FT                   RAPCMDVARGIMKDFPALIKYVEAVERSTFPTPDGGNPGRGGSAPGALDSSSWREPPSA
FT                   NVRGRRNWWGRRESGFGGDGEEKPLSAKERRFRRRSRWSVLVAVGAIATYLFAGDVVTI
FT                   AMEGIEQGDEPSPGDDDDDDDDDDDGVEPNHDEDDDEGSEEVLEE"
FT   CDS_pept        120105..121172
FT                   /codon_start=1
FT                   /gene_family="HOG000064311" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22630839"
FT                   /orf_name="MICPUN_59767"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="ACO64701.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG308892"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniParc:UPI000199B51B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L8"
FT                   /transl_table=1
FT                   /translation="MDERASRRVTTLASHLAGHRDVRLNPTAGSGSFGRSWGRKRGADA
FT                   VLGSVQLAPDVAEAVRRRGPVVALESTIISHGMPYPDNLSMAREVEAIVRANGATPATI
FT                   AIVDGVPRVGLTDDQLARLAKLGPSALKVSRRDVASCIARGATGATTVSATMLLAHRAG
FT                   VEIFVTGGVGGVHRDGQNTMDVSADLTELGKTPVCVVCAGAKSVLDIPRTLEYLETQGA
FT                   CVLGYGVDEFPAFFTRKSGCAAPGRVDTAREAAAVVKAGRRLGLGGTVLAVPIPAEHEA
FT                   DGATSERAIERALAEAKEAGISGNASTPFLLKRIRELTGGKSLESNVALVKNNARVGAR
FT                   VAVELAGLDARNEDR"
FT   CDS_pept        complement(121246..124092)
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630840"
FT                   /orf_name="MICPUN_59768"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65058.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI000199B5D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9L9"
FT                   /transl_table=1
FT                   /translation="MSAATVVDTLAATRGVPAPSSRRAPAARAASSPAAMFHARPGQIR
FT                   RGLGSTKAPSTTGRGRRLARVRAGKDKDIEAESAAAIGDFDPLGLASESEAVDADAPAR
FT                   DARSENPGDEDEKTGDAEETAAPDASGSASGEETPSRNKTSSEKKNASDAEGKDSDASN
FT                   AGSPNPFAKLVPKGVRDWFTSIPANAQARHVDQLYEAADASPGNFVKQDTLMRELYASK
FT                   RYDDVIKRFEERDFASGPGSVVAYLNSMAKLGKLEQFDVQMPPKSQISMMSVEVMKDKN
FT                   LRLSGDEAVERVMESVATAAADKSELPIFLRDLSVRSKGKPEVAKLPAGRSAAAPLHVV
FT                   ISDGAGGVARGAGAKAGDNGLVNFLFYCTLGLCAWGGMGAVRQYAGKVSASKGASTSLM
FT                   TSSQTANRQGGLLPGDAKPSLPAAQKKESSFDPKEYNKEALSEKSVKTFNDVKGCDEAK
FT                   QELQEIVEYLKNPDLFTRLGGKLPKGVLLSGPPGTGKTLLARAVAGEAGVPFFYRAGSE
FT                   FEEMFVGVGSKRVRQLFSAAKKKTPCIVFIDEIDAVGTSRKAFETQSRKTLNQLLTEMD
FT                   GFEQNEGIIVIAATNIPEQLDPALTRPGRFDRLIHVPNPDIGGRREILAHYLSDKPVEA
FT                   DVDVESLARGTSGFSGAELFNLVNMACVQAAVTGETTITSELLDWAKDRIVMGVERKSA
FT                   VLTEESKRLTAYHEAGHAIVALRTPGAMPVHKATIVPRGSALGMVTQLPDKDETSITRK
FT                   QLLARLDVCMGGRVAEELIFGKDEVTTGALSDLQQATRLATYMVGEVGLSSLVGPVHVD
FT                   SMSKGGRRATEALVDKEVVQLLRDSHARVTKLLTKHTADLHTLSAEMLRQETLTGDEIR
FT                   AVLGMEPAIKPAPPPPKHKPKIAGGDEAALKEAEASNNPGETEKDGEETIDILLPEVVE
FT                   PVEAIGDKSEAKESEVPA"
FT   CDS_pept        join(124461..124880,124992..125139,125255..126528)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630841"
FT                   /orf_name="MICPUN_59769"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO64702.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="UniParc:UPI000199B5D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M0"
FT                   /transl_table=1
FT                   /translation="MAHESETGVSTRPERYGASIVDERRDALRDKLKYFESKIDASDPA
FT                   QVAALEEMREQTAEVERISGVWHTRGLPGVTREWNDPFYCPKQIAPPSSQETLMEYKRM
FT                   KLEEAKFRAEGPYFSKGKLPPPPALQGLEEEEKPKPSRGREGGGIFVAMMKLSFGMKAK
FT                   RQKFATQLADDEEDEEEKELKRLKSEPVKEPEDPEVKRAADKLAAFVAARGRAAEEGAR
FT                   AKNPGGDTPFRFLHDKTCNDYRYYESKIAEAVGGEKSGAGASTAPAPAQPAAPAAMTPP
FT                   AGIPPPPPPDDAIASQPRRRSRWGMAPGEQNPPEAPAQRPNSGWDAGPAPQRQTPGAAP
FT                   DSERTAAASGVVGGAPIASSNATTSSPDRPRPRRDERRFYHDPRAQGPAGITAASRSGF
FT                   ADGTPDGTPDGTPTPGAQLSGGVVGFDKDAAARDPLRAMEFFAQRAAREEKWREDKRAE
FT                   RERVERQRSERKGFSDPIPGAQLDGSTPAEAEARRMGVNRPIRHEEIDAKYDALGRRGH
FT                   HMDQFVPEHERVRMMAAAGDPAAQAAQAKQAIEARLNGGGGGGGLGYNPLERKGLGASD
FT                   PTAPSSQDDIYEQYKKRMSTGYRYRPNPLGNPRKQYY"
FT   CDS_pept        complement(126616..128430)
FT                   /codon_start=1
FT                   /gene_family="HOG000150110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630842"
FT                   /gene_name="PDS1"
FT                   /orf_name="MICPUN_104873"
FT                   /product="Phytoene desaturase"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="plastid"
FT                   /protein_id="ACO65059.1"
FT                   /db_xref="GO:0009536"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG286164"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="UniParc:UPI000199B5D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M1"
FT                   /transl_table=1
FT                   /translation="MSALSSRAAVGQRVRARVAVPSATSPSSRRPLRVVAEDFPQPAQI
FT                   KNTDNYRDGEALSKKFKELKGMGEKKKVVIVGGGLSGLACAKYLVDAGHEPIVLEGRDV
FT                   LGGKVSAWKDKDGDWIETGLHIFFGAYPNMMNLFAELDIEDRLQWKVHKMIFAMQELPG
FT                   EFTTFDFVKGIPAPLNFGLAILLNQKMLTLGEKLQTAPPLIPMLIEGQDFIDEQDELSV
FT                   LDFMRKYGMPDRINEEVFISMAKALDFIDPDKLSMTVVLTAMNRFLNETDGLQMAFLDG
FT                   NQPDRLCAPMVDHIKAGGGDVKLKQRVKEFVLNDDGSVKCLKMVSGEEIVADEYVSAVP
FT                   VDIMKRMMPKQWGTMPFFHQIQELEGIPVINIHLWFDRKLKNVDHLCFSRSPLLSVYAD
FT                   MSTTCKEYYDEEKSMLELVFAPCSPLAGGKTNWIAKSNEEIVEATMKELERLFPLEIGP
FT                   KSPDGVGAKLLKHAVVKTPRSVYAAIPGRNKYRPSQATPISNFTLAGDWTSQKFLGSME
FT                   GAVLAGKLAAEVVTDKAVYGAPTKGLKKIVPDVIAEARKLQEKEPVGVTGESEVSFGGG
FT                   CVMEDADEKELAVLDPEQMVKLEGAPAR"
FT   CDS_pept        128865..131831
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630843"
FT                   /orf_name="MICPUN_101294"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64703.1"
FT                   /db_xref="HOGENOM:HBG607385"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniParc:UPI000199B5D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M2"
FT                   /transl_table=1
FT                   /translation="MDLSAVARQKARGGRAEPASPSATASMEADDHDSEGSDDDQPDPE
FT                   SAKQYVKQFVKNSLDGVRGGRRAQYYEVLEALDGLASATPSGDPDKLLMLEVLGENVSS
FT                   LDERLHEELLRRVMGTSLWLCHEDIARLVVQFCVNLMSTHTGSMLATCLDMLVEAFLPP
FT                   RGYPEGRLEDELDAYMRTGQSPSPGADASRGDGEDMDDDESDPKGPPPRSAAETTAMIV
FT                   GAITQILTLVPLSATVLGGILLQRIPHKTAVKARQCQYLRAAFALVETPAGRPLRDGLL
FT                   RGVVRHLLDVDVEIRWQDIAPDGDLSDDDETEVEDEEDDGKENGAGGIFELEDIEKTIE
FT                   QELVRQAAAWERGESGAGGARQGSIRSPMHHGGGRDEIEEQIDMIDSMMTLVLAHIDRR
FT                   IDSGDAAALNECLLKVFVSTLLPAHESKFTQFLVFHACAREAAAKATSPGASLGANGGP
FT                   HVANALTGEFDGTAQMLSARIVDQLIGRVTDPIARPAPRLASAAYLASFLARAAWLRPP
FT                   FLAATLRRLAHWCWATVESATSGAGVTSVARVKSEGLSRGFGSSFQINENGENGDTAGG
FT                   DNNTNTNNNTNNNNNSNEATGTEQVEFANASAATLAVFDSACQTLMYVLCYRMDDITRH
FT                   GGEPAETLRSMPLRQILYSRLQPLHTCVSEVVIEFLVRAAAAGMEGFDQALIERHKRED
FT                   KERKDRADGGGAGGGGSFTVEDVAAQAVGEGGSRAGSHNGAAGIRRTQSVATLGREVAE
FT                   AVRHRRPLRMFFPFDPYLLRRSSALLRLPQSYVTWRGNARDDDDDGFSDDDDDDDDVAT
FT                   LDSELGSEDVGESSSDDDTDPGGAGRRDSLSSRGAKPGSGGSLPNSLGYPNSLNPRPRK
FT                   LTRGLRGPQPLFGGVGSVGGVGSPSPTNGKGSTPPGANPFARASVGAGTSPDAVVTGFG
FT                   VPTGVETTHARAWAAAAGVPTGVPTGVGFGRGGSVSPTRKSPSPLGTSPLPPRPPRPS"
FT   CDS_pept        complement(131932..133155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630844"
FT                   /orf_name="MICPUN_50858"
FT                   /product="Copper type II ascorbate-dependent monooxygenase "
FT                   /function="copper ion binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="ACO65060.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="InterPro:IPR000323"
FT                   /db_xref="InterPro:IPR008977"
FT                   /db_xref="InterPro:IPR014784"
FT                   /db_xref="UniParc:UPI000199B5D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M3"
FT                   /transl_table=1
FT                   /translation="MAHVHAIDAETERWSMLLPAISADHRVFGKPRGNGKRAGPDQRLG
FT                   FACHRRAIPRALDEPLSIVGFEPVTTRPEATHHITAFGCDAGAESLPETFFGATCAVWA
FT                   FAVNKENAGPGGKKAPCRVMIYAYDKGASGFRTPEGTAVKVGKGTGITHVVYQVHYLVP
FT                   MEEAVPINPWADSSGIVFEIARGEAHRSRPKSLGVMAAMHTRMQLPTGEAKLPFSYTVG
FT                   PFRDRLAPDFEAGAGEVTLVAAHLHGHHMLKRYETGLIRGGKQEPFGVIPAYRGYGPDQ
FT                   SFHPLPLGVDNAGASVTMGPDDVMYITCTFDTSDAGGDWVDYGVAHGAEMCGQILYYHP
FT                   FASKAEAGGDGGAGRLVRPEPTSGEDRDNDLYNVFFNQTDILTEGVEQDMVEGAAHALA
FT                   GASQFIVN"
FT   CDS_pept        complement(133730..134341)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630845"
FT                   /orf_name="MICPUN_108542"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO65061.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000199B5D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M4"
FT                   /transl_table=1
FT                   /translation="MVALAPFLAIFGIKRVSKFRRRWTERKRLVIQSSWAALLSAHGND
FT                   RMATGSKIFRKLFTGDTAVLRLFPFRHQARTLFVSAPFKLHAKLFVDTMTELIANLHDL
FT                   EKVERDVRELGKRHLTYGVQPAHFDAMGEALIAVLDESCHHPSDEVTLDKEERDAWLGF
FT                   WGFIAKETQRGRKGIIASNPGSRRASEDGKPRAKGGMSAA"
FT   CDS_pept        join(<134661..135101,135162..135824,135879..>135977)
FT                   /codon_start=1
FT                   /gene_family="HOG000159894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630846"
FT                   /orf_name="MICPUN_67311"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="regulation of transcription factor
FT                   activity"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64704.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="GO:0051090"
FT                   /db_xref="HOGENOM:HBG320214"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B5D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M5"
FT                   /transl_table=1
FT                   /translation="VPDASIKVIAQHVGIESLADEVARALAPDVEYRLREVIQDACKFM
FT                   RHSKRTELSTDDINSSLVMRRCEPLYGFPAGAGPIPFHEVPGHPELYIPENKILDLKDI
FT                   LAAKLPRPPIAVNVVPHWLAVEGVQPLIPENPAPRPELDRTPGPPPGATGAVKPEEGTG
FT                   AVVQPVVAHELSKELQLYFDRITAVVRGGGGERGAEAPVLRAALESLATDSGLHQLLPY
FT                   FTQFVQDEVATSLRNMPRLKALVGTIEALCSNPEIHVELYLHQLMPTLITCMVAKRLSA
FT                   DPTDDHWTLRRYSAEVMSGICARFGKDYPTIQPRITRTLLRAMLDPRKPFSTHFGAIAG
FT                   LAALGPRVTRLLIVPNLKAYLEVLEPHLTREHAKRRVTSSEARRVHDALKEAIGACLHA
FT                   AL"
FT   CDS_pept        complement(136572..137147)
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22630847"
FT                   /orf_name="MICPUN_83378"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65062.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000199B5D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M6"
FT                   /transl_table=1
FT                   /translation="MGVLMSRVMAAFGDKEARILVLGLDNAGKTTILYRLQVGAVVSTI
FT                   PTIGFNVETVTFKNVKFQVWDLGGQTSIRPYWRCYYPNTTAIVYVVDSCDKERIPTSKE
FT                   ELQGILEEDELRNCIIMIFANKQDLPEAATEVEITEGLGLNGVKDRQWAIFKTSALKGE
FT                   GLWEGMEWLSQQLKAREGKSSFWSMFGY"
FT   CDS_pept        138106..138990
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630848"
FT                   /orf_name="MICPUN_108543"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64705.1"
FT                   /db_xref="UniParc:UPI000199B5DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M7"
FT                   /transl_table=1
FT                   /translation="MSACARTGGSPGAARAARASAGPSPRCIVAPSRGRRAVPGGRRAL
FT                   PARRRASSAEDASIPSLAETSPSSPSSPSSSTRVPGVPVPSSPFFSPVTRSLDLDVDAP
FT                   HADPNARVWYLPNFLDADAFAAVSAGCTKLRKRMKSDHSFATGRLSAVVPPTSEAYAAF
FT                   CNARALRKLRDASGAEGLVLGDYPVEARLYRPGSSMAWHQDVVLYERPQVELIYTVVND
FT                   SDGRTEWVGSDGLVRGLAPPANSALVFEAGAAWHRVAAASEGTRTIVKALYVEDFAKTE
FT                   AFAEVMEEAPWRR"
FT   CDS_pept        complement(139087..139797)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630849"
FT                   /orf_name="MICPUN_59777"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65063.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B5DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M8"
FT                   /transl_table=1
FT                   /translation="MSTIWHPPFVSGVPIVVKEEPDDHHHQPPAVNVEPPADEEDEKSE
FT                   DLAGKMSTIWRPNLDRLYASVAEMEGSESEEEDKDVTKKGVKRKRAPRTKGPCEHGVKP
FT                   RSRCKVCSACPHGKWRRRCKECGGASICEHGRRRHSCKECGGASICQHGRRRSQCKECG
FT                   GSQICVHDRIRAYCKECGGSQICKHARQRSHCKECGGSAFCEHDRIRSRCKECGGSDVC
FT                   EHDRIRSTCKECKK"
FT   CDS_pept        140007..141353
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630850"
FT                   /orf_name="MICPUN_59778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64706.1"
FT                   /db_xref="UniParc:UPI000199B5DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9M9"
FT                   /transl_table=1
FT                   /translation="MAPPRKSARAPRARLALRLLLPLALLASLRGARADAGGAPGVVVA
FT                   PRGDTTVGDSLRSRVELLADRYRRYSSDAAARYATSMDPASLREWVEDARAAAAKVASP
FT                   ERRRAMNDMYRPVFYPDERDEDRAAYGYDDDGYDDDGYDDDGYDDGYYDDDGYYDGDGY
FT                   YDGDDTAGGDDDDTAGDASFFQRWAPRRIFRRRPDDDAAENVVGETILDAMRLAARGAK
FT                   LAAPSAASAVGDAAGSARDAGFAAASAAAAANEGGFLRLDVTGEYRNAPTHPAAFATGG
FT                   EGGTVHRSFPLSDKHDDGSDWEVSAVNALRAGERAAAAARALYEDNVSEEHRVEAEAFA
FT                   RRFVSEALQRTVEMQARAPTWSVPVDPTGVASVRASAFLDNLRVARQIALERTSAKVGG
FT                   NEDARGTTGAMMGVRDVDAASFERAVVSELRALEAVEAVEAVAKGEEES"
FT   CDS_pept        join(141714..141984,142322..146745)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630851"
FT                   /orf_name="MICPUN_59779"
FT                   /product="Camta-like transcriptional regulator "
FT                   /function="calmodulin binding"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64707.1"
FT                   /db_xref="GO:0005516"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005559"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B69E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N0"
FT                   /transl_table=1
FT                   /translation="MYQPRVSPSYNAGGSDSPATGSDGGFGGVSATALIMPEAEGPDGS
FT                   TRAHVIEMLNQSRTRWLKNTEVCDMLLNYRSYGFALSKTAPVRPPAGTIFLFDRKAVRF
FT                   FRKDGHDWQKKKDGKTVRETHEKLKVGNVELLNCYYAHAAENDRFQRRCYWLLDSDEGV
FT                   VLVHYLDTTMVVGGRGGAKGAGLGLAPGGSAPGSNSGTTDGEDQNGFRNLFRYASGMSQ
FT                   YSGSGYEEVASMGGMSGGSPMMQSPARPGQYHPEVYQQYSQQQQAVGGQYGHHGYGAPP
FT                   THHYPHGDSDPHALYHAAQEQFNGVAESESWFNSVLASEDEAGEESGPGGPGRMSGVHR
FT                   RASATLVDAAGRAVPFRQPSSGRAVPFREGSNRSILSIGSGPPLDHGYFEMGQDESSNG
FT                   PHFDLLKEFAVDQIAEAQGIKVEGMPVESAAAAAAAAAAAGPNIGTAFPGEYRSDIADG
FT                   VTSMAELESKIASLKETLVRVASVNADASPEQVDRLEQDMAALERGAAAMRPAAGSVGG
FT                   GGGGAKPGHRRGSSFGSGTRARPPRARPVIWDGDDKDEDDADREDDGDDDDDDGDDNEE
FT                   TAEGALSPLAKAAAATRRPRGADGGRGAHRAAALAAQQQQRMAGFPRVPSHPSEGSEMD
FT                   AEMNNSDGDNGDISPRAPSPALRAAQMRAAAEASHARYNRARQPFIPPAQQGSPILWAI
FT                   DDFSPEWDTETGGGKVLVTGTPRPGLPEGLYLCCVFGDVEVPAEQVSPGVLRCRAPPMN
FT                   AGRVPFYISCLGSGKRPASDIRTFEYREAGAGGARDKRAAEIRLTSGVTERDFQLRLVH
FT                   LLIGADRSSKASGGGGPGGPGGPGGGGGGGGGGSTASGNGPSDGKGSGGSGGNTSSPDN
FT                   RNGGGSSESRDVHGSPASPGRSGSQSGGLGGGAGAGFTRRAVAALNLGADPALDPNMSN
FT                   LSDEDVGKVFKTALEARLRHAIAAEAKHHRARAEGIVPNPTYVQPKSAYARVDAGGMGL
FT                   IHCVAALGMKWAIPAMTKCGCDVNQPDRRNRTALHWAAAKGHEDTVATLLASGANIRAM
FT                   ARWGAGGYTAADLAAALGHGGIAAYISETSLAASLSNISLYGGAQGPATGRSLRSASFD
FT                   RKRQQQQQQVQGLTTPLMSGAGVTPPGVTPGAGPTANRTGRAQRDRVKAVPMRSLLLAT
FT                   ETEVTATDAVTSQTEVETEAEFMEGGGTSTERREAVAAGMIQLAFRKHSVRRRKARKKG
FT                   GELNTVTEGVETGAAPRTGADRDVKKDVKKVVKKAEKAAQKITDSLRSLKVSKTATGAA
FT                   PELGKRRLGERSGGGLHHSTIPESEAMDVSVEEAAGSPPEGAEGADFAMRSTSGGEEAL
FT                   AALRRRIAQLQERAVALQGEIRAADYRGRQDRLQTLMPGGHHQRRRAADIMQLISAGVG
FT                   GGGGGGGGGEDGAAAARVVDWERAMLERANSSKDSLDEVYRSGGGASNRLVKSATLRGR
FT                   RQSHKSHSDDGNDSNKRSTSDTNNNDDDSDDDEEEENVQQAVARIQAITRSREARDQYL
FT                   RLRMVTQSMQERRDAIARGEAVKREEDEDGLDDVDVEEDEEEDE"
FT   CDS_pept        complement(146900..147670)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630852"
FT                   /orf_name="MICPUN_101301"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65064.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B69F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N1"
FT                   /transl_table=1
FT                   /translation="MSTIWHPDLLSRDPVVVKEEPDDDHHQPPAVNVEPPTDDHGEDEK
FT                   SEDLAGKGTTIWRPNLDRLYASVAEMEGSESEVEEKDVTKKGVKRKRAPPTKGPCEHGV
FT                   KYRSNCKVCRACPHGKWRRFCKECGGSQICEHGRYRSKCKECGGSQICEHGRQRSQCKE
FT                   CGGGSICEHGRRRSQCKECGGSQICEHGRQRSKCKECGGGSICEHDRRRSQCKECGGSQ
FT                   ICQHNHIRSTCKECGGGSICEHDRIRSSCKECKK"
FT   CDS_pept        join(147837..147867,147982..148547)
FT                   /codon_start=1
FT                   /gene_family="HOG000241616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22630853"
FT                   /gene_name="APC10"
FT                   /orf_name="MICPUN_59781"
FT                   /product="Predicted protein"
FT                   /biological_process="regulation of mitotic
FT                   metaphase/anaphase transition"
FT                   /cellular_component="anaphase-promoting complex "
FT                   /protein_id="ACO64708.1"
FT                   /db_xref="GO:0005680"
FT                   /db_xref="GO:0030071"
FT                   /db_xref="HOGENOM:HBG435437"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI000199B6A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N2"
FT                   /transl_table=1
FT                   /translation="MSNNPEATTSGADGADPSRRGDVSEIGKLAVWSVTSAKPGNGVEL
FT                   LRDNSLDTYWQSDGAQPHLVNVQFQKKVRVRELCIYADYRLDESYTPNKISVRAGNSFH
FT                   DLREIKTVDLDEPSGWTRVSLVKDENEPGALNGGDGECLRTYFLQIAVLSNHQNGRDTH
FT                   VRQVKIYGPRTSPEAMIGQGMQFTTPEYGQFATVR"
FT   CDS_pept        complement(148707..150077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631146"
FT                   /orf_name="MICPUN_59782"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65065.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199B6A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N3"
FT                   /transl_table=1
FT                   /translation="MSAMRGASFKDKLAVLEATTPDGSIPNEPGALKPRYDDLKKSLCL
FT                   DALVAGCPDAFVDFYYLCTSGDGVGDDNLTADEMERALINPDDYEEFEEVPMDKMPFVK
FT                   DALVAAESALRGDALGGPNDDPAVAVQDAYGALAEYFLGTDDRAKAAYFYDKCVAAAVA
FT                   ARRPELEMAACARVGKTHEAAGNLETAVASFERQLRLADDLSAAAPMDADLKNALGDAR
FT                   GNCVRTYFAIAERSADADDKERSVAYLTSCLRVCVEAAEDAADTSDDAEGGGLDDLEKG
FT                   TEGKANHRLGLAQLAAGRAEEAARYQERYLELSERDGDDVGVGCALRALGEAHLARGAV
FT                   DEAVAALERFAAMESTGAGARARAHCSLGRILLKRRDYARSVGHFERFHELARGLGDAR
FT                   LLDVARVNLGVARGVASEGGFIAKVAAAGPASEAAAAHVESLVTWKDSRTPIEGVHS"
FT   CDS_pept        150203..151684
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631147"
FT                   /orf_name="MICPUN_59783"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64709.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199B6A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N4"
FT                   /transl_table=1
FT                   /translation="MASDDWSLTPATLARVAELPTPDVPDPDALGSDALAALERGARLG
FT                   VDSCGVCGAPETTTGDDDDDAGDAPPSVECARCRAIVYCGEAHMAADARDHARVCDLLA
FT                   FDADLADVDVPDADARAAAAVKATVAKLKLLGRRTTATLLGPRGYGDEGDDENEAAARA
FT                   ARDEATKPRWRALFKLARTDDAKPKDDDDDADANAKTAATLRRHAELLSAPLSLVAASW
FT                   LFPVVKYALMLGVGGEGRAEEDETAAADKELTPAVVHVVHGSGGDWCDAAADAMWLVGY
FT                   GAALEKPGVEVTVVAPDLPEGWHGVKRSVGGDDRGTRSVSFHRGRYDDFAAAAGGTKGD
FT                   DDASRDSPGPCLVFALDLCEALDECEVSEEDEEGNEGGGGGGGWMRSVRAAGCPVLTAN
FT                   RNQFELAAERERMEDELGYVLVGMARCPFPCPVPRQSPASANEVHRRNEWLAAYVPASL
FT                   AAHPASDELEPTRGVAPGKRSGGDDESGGEKRARR"
FT   CDS_pept        join(complement(152245..152288),complement(151805..152099))
FT                   /codon_start=1
FT                   /gene_family="HOG000193319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631148"
FT                   /orf_name="MICPUN_59784"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65066.1"
FT                   /db_xref="HOGENOM:HBG562185"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000199B6A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N5"
FT                   /transl_table=1
FT                   /translation="MSALSNHTRVTRLYRHSLKTMLSWAVQRDIFYTERDRIRAQFEAN
FT                   AGLNQPGQIAKAIAAGEAKLAEYSHPDPYTVPTAYGGSKYARNPPVPGEMEVVSDFGRE
FT                   SYVVPGKY"
FT   CDS_pept        152509..153333
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631149"
FT                   /orf_name="MICPUN_59785"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64710.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B6A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N6"
FT                   /transl_table=1
FT                   /translation="MTTIWHPDLLSRDPIVVKEEPDDDHHQPPAVNVEPPADDNEEDEK
FT                   TEDLAGKGTTIWRPNLDRLYASVAEMEGSESEEDQKDARKKGVKRKRAPPTKGPCEHGV
FT                   KWRSNCKVCRACPHGKRRAHCKECSGASFCKHGRRRSRCKECGGSQICVHARERSKCKE
FT                   CGGGSICEHGRQRSQCKECGGGSICEHSRDRSKCKECGGGSICVHARERSYCKECGGGS
FT                   ICEHDRIRSRCKECGGGAICEHGRRRYQCKECGGSGICEHGRRRSKCKECKK"
FT   CDS_pept        join(complement(155934..156053),complement(153427..155868))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631150"
FT                   /orf_name="MICPUN_59786"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65067.1"
FT                   /db_xref="UniParc:UPI000199B6A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N7"
FT                   /transl_table=1
FT                   /translation="MAQVPERGVRDVRDSWGVEALFGGFDKPEQVHARLVIPPKVAQSN
FT                   YGYGGGPNGGINPLELSWDEQRFLAQLASERVMVSDRARAHELSARASSGIRAGGVPSF
FT                   VDVASPAKPVVARGVAASASAEFARPSSAVAWHERERTAARGASSSSSSPVASSSSPAR
FT                   SSRPRPSTAGPPASSSSRASGGTFGGPIPSASPIRPALKKKPRSSSATARSSSQSPARR
FT                   SVRWEPEVTESGIVETQSRVVVGNGNDPRVRPTPAGTHASPSVHARRNLKFGGPGGGGG
FT                   APGGPRASWPGPRGGGVETLSYAKARILGSERATDDLDDARLSRDEREFLKSMASQRRM
FT                   VSDRAALAASVAELGLLPRGTAPITTQPGSDVSEPGSSMSARPTGLAAGGPKQVSAVDY
FT                   LHSGAPVAPVRASWNPDASPSREEAAFDPARSLRESLERTRPRTATGVPGSRRLDENDP
FT                   DPNNPNNPWVDRNAALRAAVRNRLRPSSARSQVSSLGDLDRLEQTVDALRRSYRRADPP
FT                   ARGRGGGGGGVGGGVGALDDAADAAARKVADREARDWEWQSSWQWEWQQELDVETRGRR
FT                   AMTPPAPARSPAKVHPSPEKRPAVGTFELQTSSATTTPTKAAATTPTKAAATTPTKAVA
FT                   TTPTKGVAATPVRTPPGARSAAKPPRSPAFVGSPAPTAAARRSPFKEPTAAAPVAVSSP
FT                   APAAASPESEPEPKVKFGRRARGDVEASRDPRTVPPSPPMPSPPTLTERSPPTGRPGAS
FT                   SSSYAERREAYRESRAAVAPPAGEVGGDDGGPARPSVPNRFDSDDSDAPYVGEDIETLP
FT                   DELSSGGEDSDIEVVELVEIDGGAGGGNEEAMWRPASSKYV"
FT   CDS_pept        join(156216..156897,156945..156964)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631151"
FT                   /orf_name="MICPUN_59787"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64711.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B6A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N8"
FT                   /transl_table=1
FT                   /translation="MTTIWHPPFVSGVPIVVKEEPDDDHHQPPAVNVEPPADDHGEDEK
FT                   SEDLAGKGTTIWRPNLDRLRASVAEMEGSESEEEQKDATKKGVKRKRAPRTKGPCEHGV
FT                   KWRSQCKVCSACPHGKRRSRCKECGGTSICVHARERSKCKECGGSEICEHGRRRPQCKE
FT                   CGGASICEHGRQRSQCKECGGSQICQHGRHRQYCKECGGSQICVHARVRSKCKECGGSQ
FT                   ICQHNPRPSAL"
FT   CDS_pept        complement(157035..158546)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631152"
FT                   /orf_name="MICPUN_59788"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65068.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199B6A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9N9"
FT                   /transl_table=1
FT                   /translation="MVASAVGVAWSTAHALLAASAGATPRARAPALHPRVVSHRGPTPL
FT                   AAVEPAASPSLGGGTGGLGHRHRQSGSFPFASSRDMGKKARLRCASCGTEYKQRTDKSR
FT                   FCSVRCAAVTGPSTGVGVAKPFKDMVPGAGGESKYGDVPPAFAGASVVAAASGYAGSGY
FT                   GSDVSASSSSDFQWDGFGTGKGSKGGKGNRKRKKRAKKGAGGESLRPVEEDPRCTAVLQ
FT                   LLDRQCVVISGPGPAMDEAVARCAACDVVAVDCEGVNMSRVGAITLLQVAAGDSAYLFD
FT                   VQAMGRACFEMVSDASVTNGRNLKSVLEDPKVVKLMFDCRVDSDALFHQHGVSLTNVFD
FT                   VQLADVAARRANHHAVSLLSGMPKCAGRWLPKGPNQAEAALAAQGPDRAPIRSDSDAPP
FT                   DAASVARVTEHLKRKVKEQYASNLGGDGELWAKRPLAEDVRRYAALDAWLLKEIYAAME
FT                   HANVLDEDWRARVVKESERRVGEYRDLEEPIMQFRCQERAQAPDL"
FT   CDS_pept        159253..160161
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631153"
FT                   /orf_name="MICPUN_59789"
FT                   /product="RNA binding domain-containing protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64712.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000199B6A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P0"
FT                   /transl_table=1
FT                   /translation="MSYGPTRGRRGGSGRHDPYGRGGSRGGDYEEEVIEISTNRLYVHN
FT                   LSWRVSWQDLKDHFRQAGEVVHTKILTEGGPGGRSKGCGIVEMATIDEAARAVEMLSDT
FT                   NLDGRNILIREDREDRANGGGFDRPGPGGRGGNPARPDDICNKCGGRGHWAGDCPSQVS
FT                   VGRGRAAPRSREPERRKFRDDHDRREKPKRERREPGPDDKCNRCGETGHWARDCPLPRD
FT                   ENAPVRERGPRQPKPDDVCKKCGQTGHWARDCPSGDGAKAADADGDANMDASALDNDLD
FT                   AYKAEGAAADEAGAAEEMVDA"
FT   CDS_pept        complement(<160360..>160968)
FT                   /codon_start=1
FT                   /gene_family="HOG000012760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631154"
FT                   /orf_name="MICPUN_72181"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /protein_id="ACO65069.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG595564"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI000199B6A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P1"
FT                   /transl_table=1
FT                   /translation="RLVTPEELRRHDGIQEPTLWLAILGEVFDVTKGERHYGAQGGYAG
FT                   FVAKDGTRAFHTGRFDTAEGLTPDVSGLPDAALLALREWADFYARDYARVGRLAPGHYH
FT                   DERGEPTPARLDFDAAVERARTEKASAAANDERFPACRARWSQDTGGEVWCERDAGYPR
FT                   KELTHGSNGKPRVRCACFPDEGFSDNRQLYPGCASNARRC"
FT   CDS_pept        join(161331..161665,162026..162095)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631155"
FT                   /orf_name="MICPUN_108544"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64713.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B6AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P2"
FT                   /transl_table=1
FT                   /translation="MTATWWPNLEDILELRVADPLLTLPGEDDGEERATKRKRGASDGR
FT                   CEHGSRWRSKCKTCSACPHGRHRYLCVECGGIAVCEHDRERESCAECGGSGICTHGRRR
FT                   STCVDCGGKGICAHGRHRSRCQECRAGVAA"
FT   CDS_pept        join(<163482..163627,163865..>164052)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631156"
FT                   /orf_name="MICPUN_74444"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64714.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG604530"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B6AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P3"
FT                   /transl_table=1
FT                   /translation="AHLDVKPDNILVKNGVYKLGDWGRAAPVDGVGYQSFGSNGESRGR
FT                   SASVLPGDFVGLDRADIFSLGATAFELARGAPLPSHGDEYQALRQGKVPALNGFSVSFQ
FT                   QMIAGMM"
FT   CDS_pept        join(complement(168459..168558),complement(167885..168327),
FT                   complement(164297..167824))
FT                   /codon_start=1
FT                   /gene_family="HOG000191197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631157"
FT                   /orf_name="MICPUN_83794"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="xanthine dehydrogenase activity"
FT                   /function="xanthine oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65070.1"
FT                   /db_xref="GO:0004854"
FT                   /db_xref="GO:0004855"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG386245"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016208"
FT                   /db_xref="UniParc:UPI000199B762"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P4"
FT                   /transl_table=1
FT                   /translation="MEGQDASPILYVNGKRHVMPEGKAEQTLLAYLRGLGLSGTKLGCG
FT                   EGGCGACTVMVSNYDRAKGEVQHRAVNACLTPLYACEGTHVITVEGLGTKRGGLHPVQT
FT                   ALAHAHGSQCGFCTPGFVMSMYALLRSKKTKPTELEIEEALGGNLCRCTGYRPILEGFR
FT                   TFARNAPDSAYSGETINGSDSTPICPSTGQPCTNGCGDTPAAKALGAAEDDPVTAVREP
FT                   IFPPELKRRVPTPLALPGAIATWHRPTTLAGLLALKKAHPDARLVCGNTEVGVEVKFKN
FT                   MKYPVIVAPTHVPELTEVTIAEDSLVLGASVTLTTLLNTCETLTLTLGPVRTSGLVAIK
FT                   EQLRWFAGPQVRNVSSVGGNVCTASPISDLNPLWIACGATFEIESLDRGARRVAARDFF
FT                   KGYRSTDLKPDEVLTAVALPLTEKGEYVREFKQSHRREDDIAIVTAGMRAKFDVVDNVP
FT                   TVAEIAFGFGGMSFKTVSCPKTSAALAGKPWTDETLKLALATLPKDLPMSPDVPGGMCE
FT                   FRRSLANSFMFKFYVDCCRRLEADGLVTDAVYSAAGLDEADLSAADRFHRPFPRGAQYT
FT                   QVRDGSTVGQPTMHQSAEVQVTGEAEYADDIAKPAGMLHAALVLSTVPHGKILDIDPAA
FT                   ALATPGVHGFFSAKDVPNNVIGPAVLDEEVFASEYVTCVGHPVGIVVADTQDIALEASR
FT                   LVRVKYEELPAILNIDEAIAADSYHTWPGFTDHGIEDGDVDAAMAECEAAGRVVEGDAR
FT                   CGGQEHFYLEPMVSLVWCGDNDDLITISSTQAPQKHQKLISSALKIPCNRVVCKTKRLG
FT                   GGFGGKETRAAFLNVCAAIPAFHMRKPISLVLDRHVDMAITGQRHAFLGKYKVGYSPEG
FT                   KILALDMMLYNNAGNSLDLSAAIMDRAIFHSDGAYKIPNVRVHGRCCKTNLPSNTAFRG
FT                   FGGPQGVIFAEMWMDRVARKLGQPAEKIRHVNLYEEGETCHFGQVMESSQLRACWDEAV
FT                   AKADVDSRRAAADAFNAANKHRKRGIAATPVKFGISFTALFMNQAGALVHCYLDGTVLV
FT                   THGGVEMGQGLHTKVAQICAAELGIETDSVYIAETSTDKVPNASPTAASASSDLYGAAV
FT                   TDACRQLNERLAPVKAQLGPEKSKDFKEVCTAAYFARIDLSAHGWYTTPDLVWQWDGTK
FT                   GRPFNYFCFGAAVSEVEIDTLSGDVNLLRTDIVMDCGDSINPALDVGQVEGGFVQGMGW
FT                   VALEELKYGDPDHKWIRPGTLFTAGPGTYKIPTANDIPLEFNVTLLHNAPNPRAVASSK
FT                   AVGEPPFLLANSVFFAIKDAVCAARAGNGLDTDITMDSPATPERVRMACGGPISDVFYD
FT                   STNAPVYRAKLTC"
FT   CDS_pept        171715..172218
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631158"
FT                   /orf_name="MICPUN_108545"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64715.1"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014797"
FT                   /db_xref="UniParc:UPI000199B763"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P5"
FT                   /transl_table=1
FT                   /translation="MGALVAAGITGTRGKDKDTARDRTGDLRMDPRLFKAAPPLSNKKL
FT                   VRNALRHVCLAGAAMRTQLDEALTALDAVAPDVATVFVILFRENTSPHKYRALYALVSG
FT                   DGGVDDADGVLVKIHGTGGPARVGLQWVDATMKYDSGQREFKPLATSGRLTPLTAAVTL
FT                   VSKK"
FT   CDS_pept        complement(172300..173070)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631159"
FT                   /orf_name="MICPUN_59795"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65071.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B764"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P6"
FT                   /transl_table=1
FT                   /translation="MNTIWHPDLLNRDPVVVKEEPDDDHHTPPAVNVEPPADDHGEDEK
FT                   SEDLAGKMSTIWRPNLGRLYASVAEMEGSESEEEEKDVTKKGVKRKRGPPTKGPCEHGV
FT                   KYRSNCKVCGACPHGKRRRQCKECGGSQICEHGRQRNYCKECGGSQMCEHGRRRSQCKE
FT                   CGGSQICVHDRVRSKCKECGGASICEHGRQRSQCKECGGTSICEHGRQRSHCKECGGTS
FT                   ICVHNRQRRYCKECGGSQICEHDRIRSRCKECKK"
FT   CDS_pept        join(173179..174761,175045..175357,175428..175498,
FT                   175687..175870)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631160"
FT                   /orf_name="MICPUN_59796"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64716.1"
FT                   /db_xref="UniParc:UPI000199B765"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P7"
FT                   /transl_table=1
FT                   /translation="MRAGALLALLLASAADVAAGVRAPGGVHPAWHPAVLHPGSSVPAA
FT                   GSPERDRPADAPATATDDDGAPSPASMPGRYPTAGYSPHNGSSAALRTRELPGCSLHVF
FT                   RHVSKAAGTTVRFIFDKQVAMGDFEFLPMCHYGFREKDWREVVKRFKDAAVDPARIESG
FT                   EGPRIIVEIRNEWGATRAFEDVVMRDLRELRATHSHLGCEISSSMLFRDPTAQYRSFYE
FT                   YYIRKEQEKPNGPDQGAAAWGDSFAQWARAVPDLQLREALGDRCVPALRMPIFHTDPAT
FT                   GERKSERILDEACKVTLGDRARFERIVKDVDVVGVASEFDAFWLALADVVGFQHLEYVR
FT                   SNTKERHGAGRRTLAADVDAGVDADVDAGGTDVGTDDDDDAAVVAATAPNDVWAHDLVR
FT                   RTQAATWAGCDDGDPTAGAIGAGSSAGVGGLGEGRGTTGREDGGYGCELRRRVNALRAA
FT                   SVEAKDGRTRVGGSPPLSVYMFARANPGRDDNPVRAEHRARPGFYTSEPICKGFGTDLS
FT                   ALVRKDDARYKGVNQGSEASRTLFPESDLVPNESQSAPPRNGVSDFAALPSFLRIFLHF
FT                   CAFLLGSSPPSVVSRDAASVPASVSRGPYSGGPRRAMEGAHDLLNDFQGEAKLNGMGLF
FT                   TGIGGIELSLKRWIHWIMYCEIDTFCVEVLKGEISLPSPTFRAPPRPVEPPRNLHAAPS
FT                   ARPSTRTNRTQPRVRSNAPSPG"
FT   CDS_pept        175923..176444
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631161"
FT                   /orf_name="MICPUN_59797"
FT                   /product="DNA methyltransferase"
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="DNA methylation"
FT                   /protein_id="ACO64717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006306"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="UniParc:UPI000199B766"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P8"
FT                   /transl_table=1
FT                   /translation="MHSGHLPTAPIWDDVRTLTAWDIPGSSPIDIIAAGFPCPDVSDLG
FT                   TGRGLEGEQSRLFFEVVRLAQETRATYVLLENVADILHRGVERVVQALHQAGYDCRWMC
FT                   VAAADVGAPHERRRWFCLARRRAARYRDESDDEADPRPDVADDDEAGREPPEEREDARG
FT                   GKRGGSGEEL"
FT   CDS_pept        176506..181638
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631162"
FT                   /orf_name="MICPUN_59798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64718.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B767"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9P9"
FT                   /transl_table=1
FT                   /translation="MDLLEEEAERVDDRPGTTRTTDDPFDVPRPNATRETRLVNSTINS
FT                   PQLGEESGDDLDDPRLRNTHDDDDDDDDDDDDDDDDDTTISGRFDDEDPEASLFPTLPR
FT                   ERPTRRRERWPTPRAVDGNEMETSVALPLSVHVAVRELRALHGDVAPARPRQPRGRGYA
FT                   EPTEPRLHLNPAFSEWLMGLPGGWTCLDGDVIDVAAHLRPHDRWSSWRGGDDDDDDDGG
FT                   GDGGGGGGWSAGSQVALGVARQMDRCRTVGNSVVPTCVGVAWRVLTGLRHAVNPRTDPA
FT                   PRPARSKHRLDPTRRVPVPIPDPRVRTEWGGDGMGRDGEGGGDERSGRWKPWSVPWPTF
FT                   FAPIDSNPLEGRRNKRKSGGPGPTDESAPETEDARGGSTSTSAREKLEPWGDAEEARGA
FT                   SRRAKFTRERSGSPGMRRPSVQGLTRSKSSQNREGAVAARDSRRDRINALTASPDVRNG
FT                   ASALLRQLWESMLSARAEYGRVAEALRSHARRNPGESARVDWISPSPLPRLFRSPAEVR
FT                   ERRETTHQSARVTGGRVHAESDRKIGTREPKLRAKTPFGVSVDGIDWPQPPPFRPSQPA
FT                   PPSGPGVGGPVRLRGGSSSRPFGGRFVFACCAVAELTDDERDAIAGAVDPDEVDSLRRA
FT                   MFPHDDDTVNDDESVNDDQTRRTPRCFEVACLRGLDDARLLAAALIRPAPGEGILGRYV
FT                   EMPFIVTLPHARGRGLWRELTRELIAWTVRRAAWRATALIVKVKRGGGGGGGGVKRKRD
FT                   KERGDRHWQETMWRDGAGAVRVDGGWGGARRGASNARERIEAILERLGSNTGGGRGGRR
FT                   PGSDGGGGVGAKTSAAGSLHPIPDRDLLLIRMLPPPDEGSDAAASPLAPSASSRRVPSF
FT                   ADLDEMRGRRLAQGGPGSPAAGLDSREHASLLDFVTRVVNGRRGCSLSLFGYYEPTAGG
FT                   SGQPQGVPAALRLRVRDLDDELVGSGGGPGTFLACAHASLLRETISKLLPGCVVDWGAW
FT                   SDVVSQGNFPAAVEEFLARRRRLAAAQNGAGNQPRGPDRPPPPTAPALALAPQPPPPPP
FT                   PPPPGETRASESYAAMNVRDRCARLLSLLRVAVELDLGGVRSAAAAAARTTSGKGGKRL
FT                   REELVPTRYPYASRQETGARPLALTPVCRERRVDGTVWTYRVVPASLDTGRSFAFFLAA
FT                   APADGASEPLGLDDDGDARWRRVAAAYGPDGTRALARVLRGIAAASTPRDSRDDDDSHD
FT                   DDDDDDDSRDDRPGESRRTRRSRPPSPLLPAPGRVACVGTGERAACAAAASLLGRYASH
FT                   AETKGTDAATALSDADVAVLLGESPFSPNHVFFAGPRDGSEDTPGACGDGVETPWGTVA
FT                   WNEDAPPEPPTLAAAADDVAPRWLEPSEVPADIAPERPKRRGEHRAESVLLRVASGVGS
FT                   DRGTTLGLMEAHVDATYTREIGAVRLIRGRPGLSTIGFVDGADDRPECPVSGAEFVHLG
FT                   SDGTKLVAQRRWMRHVEVVQGPPVADADADAVPLEDWLATRGEALGGDELAGTRALIWW
FT                   PADGACYPCTVECFRNVGGNVGHHGAHAVRYDDGQRETVHLALQTFAALEPAPLDEPDG
FT                   RPDDDEPEETEGADEGADGVADGGAETSPPKVFDRVCWFAPRGGETAAGWRREHRRRAR
FT                   RRACGVDVNVNNVNVNVGQGPREPPTGSLDDDVGEDEEGSIGPGEVPGSTGNLRKRNRE
FT                   SSDEIEDGKEPPD"
FT   CDS_pept        complement(<182160..>182537)
FT                   /codon_start=1
FT                   /gene_family="HOG000021204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631163"
FT                   /orf_name="MICPUN_73390"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65072.1"
FT                   /db_xref="HOGENOM:HBG610426"
FT                   /db_xref="InterPro:IPR019537"
FT                   /db_xref="UniParc:UPI000199B768"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q0"
FT                   /transl_table=1
FT                   /translation="ATPVSRDVLMAVFMAQAIPFVGFGFMDNMIMIAAGEYIERSIGAT
FT                   LALSTMAAAGLGNLLSDIVGVATSNKIEAYAEKAGFKSPVLTAAQEATRGPRMAKVMGA
FT                   IIGISVGCLLGMFPLMFFDADE"
FT   CDS_pept        join(complement(184953..185014),complement(183380..184832))
FT                   /codon_start=1
FT                   /gene_family="HOG000100095" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631164"
FT                   /orf_name="MICPUN_59800"
FT                   /product="Heat shock transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65073.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG558842"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199B769"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q1"
FT                   /transl_table=1
FT                   /translation="MATDVDGRRHFGLAPRFLRKVYMFLEEERYRNIISWSDDGKHFTV
FT                   HDVNRFTTDVMPEHFSHTNFSSFVRQLNSYVSPAPIRPDPRPERPRISLRLVVGIVTAS
FT                   RSPTPPRGLAHDRPPPPISAFPMVFVVNQRARGATRLVFIWVSSQHVLLTSPPHLTSQG
FT                   FRKVDQASWSFANPGFFKGGAENLKFIERKGLEGGRGGRGGRGNTRGYAGAGAYGRLGR
FT                   MAGTRGLGLNVGGGAMDGHLLQDNPQDTFEAIVTQQLQLSRIEMANLMHRLTSVEKVQE
FT                   QLLGILINQQTTMLNGASAPTAATPIPATSSTSTSLPASVFSGHTGAAAAMAVGSGTHG
FT                   SILPAHLQQHLQQHLQQRHMNQQHAQQLHLNQQQLQQLQSQQPQQLDLGGITIREAPLM
FT                   QSQNASALAPKPEPAPPPPVKPNDPALQTLASISGLSNQLAGVSPILGLGLDSAGTGLD
FT                   PGSGAGGGAGLAGVGGSLANGAGLNLGGLGAGLAAQPGLLHPRQYP"
FT   CDS_pept        complement(185753..189829)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631165"
FT                   /orf_name="MICPUN_59801"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65074.1"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199B76A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q2"
FT                   /transl_table=1
FT                   /translation="MFGRDAPRRSARLSPPGAGAPSGAAVAKGDIAPVAKEPDFRTPGK
FT                   SLANRAPWRSPGAALRDRDRENNYVSARKKAVRKLSARSPATAAMASGAKRNGRPRFTP
FT                   AEMRTPSVTPSKNPSTEDDDDHDDREDDTKTTTTEEPRQERTPLADLASVPITTVLLTP
FT                   PSTRSRSRAAEADNAKAAAASQADAKAAMPPPPPKPRVSPLANVTTNPFLDDEATMKVP
FT                   ALAPYNAAFEALQMGTASQAFTRDDDEHDDDDDDDDDDDDAEAEEPAGQRDAEPSASPA
FT                   LSLFAPTEVGDDSVLIADDDANGSFFGGDRSMDDQSMNLENGDDDLPTPTTTSAFDAAL
FT                   DIAAATVAIPAFSAVTPGEPASKTPARTPSRDILNPNRGEISANEISTGFLGPAALVAA
FT                   GSTLKEMLAEAAELAAPDDDAEEDPTLGPTLGQPAADPDAESSRLGGGQSESPGGRVPA
FT                   GAVLDAIAHPHTHQPPSSESAAVFAASPIAALSPPTLEPAPAPMEEDDASFAKNAFDES
FT                   PPRSQPAATPSPVRRSPRLAAMRTASVFTPASPAVVETDAAPTAAERRAAELQALVERQ
FT                   AVELLEQREALERQRMMMRSEASRQAAQLEAQREAMMNQKRQMENEAALAFQRAEAAAR
FT                   EQARMRAEFQAQLEARRAEEDATRARLAAMASEAAAAKEEAARAARAAAEAAEAARRQP
FT                   PAASPLPLGAVKSVEDELRACREELARRSAESAAVSQRMQTLQREETELFNRAAELQRR
FT                   MLEMVIKGNPKISPAAAAALAQPLISSVSSGAASGASAMPPPPARMMDMDLSLARPVEV
FT                   VDTIAAAAEMMLQPRQPMTSMNNSPAMVSMDSLAAAAATPGTRGPAPSLAPLASMSAGV
FT                   ARAMEAAVAPSVVDEDGFIVMDYAAAGASMPIADAAKIGNDGNGVFMTPAITPPAARAL
FT                   EMAAAAADTCPALVMTPTSASKRGGSVGNPAAAGIATRRNALQILELRKEVVNLQFLGG
FT                   HESGTSAGMLMAATKDGAVRLFAPGSRRAAAMIRGPKQGLAAAVAVGTEAFIAAAGRDA
FT                   HVARHDLATGRELGILLPSIDDGISSGGSGPELTCIRGGGATGGPVVVAAGEGGDVYLW
FT                   DVRAAPRVASRRASGVGGAATPAMTMHVPGASRTLSLSLSDALGGGAHGTAPASLALVA
FT                   SNGGRVFDLRAPGRPARLAPAEAGQRWVACAHAGRSDDVLTLSSQGDLATWRPMGGGSG
FT                   GFNYRIAGPVLREVASANSARAVLSTSGPIGGVDVDGVMALTTTGETGDGFRVFDASTG
FT                   DVVAEWGGDGERTDAGVGATAGFGRGWRRSERDEPRPSITAAGWGCGALDGAFGGSSFA
FT                   VGTSDGVVRVYGPGA"
FT   CDS_pept        join(complement(191791..191844),complement(190151..191644))
FT                   /codon_start=1
FT                   /gene_family="HOG000264120" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631166"
FT                   /gene_name="RECA"
FT                   /orf_name="MICPUN_59802"
FT                   /product="RecA DNA recombinase"
FT                   /function="ATP binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /function="damaged DNA binding"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="SOS response"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65075.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="GO:0009432"
FT                   /db_xref="HOGENOM:HBG339889"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199B82D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q3"
FT                   /transl_table=1
FT                   /translation="MTGISLTAGFANGALAKQGLRVANRAIHRRTPAAIVASTANNGTG
FT                   DDSSLIGGSASFSTSSSAGAPKSSVAARLLAQSAAKTVATKGSSTKAAAKKPAVKAKAS
FT                   AEPKASKADDPKPAMTPEEIAVRDAKKKALDRVLGEIDANFGKGSIMKLGEASQAKVAT
FT                   FPSGAMTLDIALGGGMPRGRIVEVYGPESSGKTTLALHAMAEMQKLGGTVALIDAEHAF
FT                   DPEYSQRLGLDVDDVVVCQPETGEMALEVVDTLVRSSAVDLIVVDSVAALVPRSEIEGE
FT                   IGMVQVGAHARLMSQALRKINVNAAKAGVTIIFLNQLRSKVGVIYGNPEITTGGNALKF
FT                   YASVRLDIRRKEVIRGKAGADDEGVRVKVKVAKNKIAPPYKTAEFDMLFGRGISRDGCM
FT                   LDAADELGVITRRGAWYSYGEERLGQGREKAAEFLDANPEIKKQVEEDVRRVVAERLAG
FT                   AYGAKPNSPSAARAEPVLGAFAGSRTSELFNEDAGDDDLREGLEGIVDFDEDDVAAR"
FT   CDS_pept        191343..191828
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631167"
FT                   /orf_name="MICPUN_101315"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64719.1"
FT                   /db_xref="UniParc:UPI000199B82E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q4"
FT                   /transl_table=1
FT                   /translation="MAGLGSSALDALGSAEALALTAGFLAAALVDDPLVATVFAADCAR
FT                   SLAATEDLGAPAEEEVLKLADPPMRDESSPVPLLAVDATIAAGVRRWIARLATLRPWII
FT                   GNGAGGRGGWSARGGDTSRGYFFKDRRKSALSGGDLTGRAGYGGAPAWRARRWRSRR"
FT   CDS_pept        192107..192397
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631168"
FT                   /orf_name="MICPUN_59803"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64720.1"
FT                   /db_xref="UniParc:UPI000199B82F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q5"
FT                   /transl_table=1
FT                   /translation="MDWSTKAMLQETLRCLQKTETDLGVNLDTVRKHVSAAIMEFDKTV
FT                   GRCERCRGRGVCRCVLCGGVGELQYPKHQKCTRCLGTALEQCAECCGYGIS"
FT   CDS_pept        join(complement(194117..194281),complement(192666..193739))
FT                   /codon_start=1
FT                   /gene_family="HOG000239380" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631169"
FT                   /gene_name="GCST"
FT                   /orf_name="MICPUN_59804"
FT                   /product="Glycine cleavage system t-protein "
FT                   /function="aminomethyltransferase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65076.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="HOGENOM:HBG299834"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI000199B830"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q6"
FT                   /transl_table=1
FT                   /translation="MALRHAAQRLAQRAAPLAGQAARPLLIPFYRHMASDANLLKTALY
FT                   DFHLEMGGKMVPFAGHSMPIQYKDSIMEATQHCRSKASIFDVSHMLGSSMRGKDAIEFV
FT                   ESIVVGDIRGLKNGTGTLSVVTNDKGGIIDDTVVTKVNDEDVYIVLNGACSEKDQAHIN
FT                   KHLKAFKAKGKDCEFIVHGDRSLLAFQGPKAVDVLQPLTDIDLSKLYFGMFTETSIAGK
FT                   PVWLTRTGYTGEDGFEISLKKTDTVALTKKLLENPDARMCGLGARDSLRLEAGLCLYGN
FT                   DLNEDIGPIEAGLTWTIGKSRREKCDFVGGDVIKAQLETPASVTKRRIGLKVGKGAPAR
FT                   AGSKILAPDGAEVGEVTSGGFSPVLQENIAMGYVLKSHAKAGTELQVETRGRKSEAVAT
FT                   KMPFVTCHYHRPA"
FT   CDS_pept        194555..195406
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631170"
FT                   /orf_name="MICPUN_59805"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64721.1"
FT                   /db_xref="InterPro:IPR014923"
FT                   /db_xref="UniParc:UPI000199B831"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q7"
FT                   /transl_table=1
FT                   /translation="MAACVAASALRLRPAPPRAGCRVDNPTHRATRRVHVARASAAEKA
FT                   DPAAFVCDDRGACASVDEMKEKELNAVETRRALKEWGAVVHALAEGDQTVIFRKGGLKD
FT                   GKGGFKLESRQFGLFPTVYHPKELNGTVSTEASKKFVDAKVPDMKRGEEVPISVVAEVT
FT                   GAWVTHDASVLDALSDHHVWSRDVLESRLSWKPDTPITVLELRAKKLPAPRVHALPPDL
FT                   EKYGGCKSWIDLPFSVPVKGEEPAPALTDEAFGERQRALRSALAAVDHAGFSVASFGAV
FT                   DV"
FT   CDS_pept        join(complement(197565..197615),complement(195607..197415))
FT                   /codon_start=1
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631171"
FT                   /orf_name="MICPUN_59806"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="ACO65077.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG288114"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="UniParc:UPI000199B832"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q8"
FT                   /transl_table=1
FT                   /translation="MSMFGEDKESEYGHVKKVSGPVVVADNMYGAAMYELVRVGGDQLI
FT                   GEIIRLEGETATIQCYEETSGLTVGDPVQRSRQPLSVDLGPGVMGNIFDGIQRPLKTIA
FT                   DVCGDCFIPRGINVPALDLKRAWEFNHPTGKNGAFKVGDLISGGDIFGIVPENNLIEHR
FT                   IMLPPNARGRITYIAPPGEYDLRDKVIELEFNGVKKSYTMLQQWPVRAARPTAEKLPAN
FT                   HPLLTGQRVLDVMFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDGIVYVGCGERGNE
FT                   MAEVLAEFPELTMTLPDGSEESIMKRTTLVANTSNMPVAAREASIYTGITLAEYFRDQG
FT                   YNISMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVRCLGSPGR
FT                   EGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYNN
FT                   ALEPFYEKTDPEFLSLRAKAREVLQKEDELNEIVQLVGKDSLAESDKITLETAKFLKED
FT                   FLQQNSFTAYDKYCPFYKSAGMLRNIVRFHDLANAAVEKTANADGAKITYNVVRARMGD
FT                   LMYRIASQKFEDPATGEEAVTHRLDELGRDLAAAFRQLEDEFR"
FT   CDS_pept        join(197863..198081,198246..201182)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631172"
FT                   /orf_name="MICPUN_59807"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64722.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B833"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Q9"
FT                   /transl_table=1
FT                   /translation="MSFGGVPPWAKVTGKDPRLERRRNLIVVSEERKVRLGNAEERQRE
FT                   RSAKAYEKAAKDKIEAAHMPFTTAPAVEDVTPVRLDRYGNFKRPEGAPILKGSPPSGVP
FT                   PRVRPPHPDQPWSKDAAREKIREERRRVAEAKAEQERIARAVEAAAKREASRTKRRRGG
FT                   KKERHAHFVDGDENAIVGDENHLERPGTPPLLEPPVPSPRKTPTRKAHVPVYSVAGRKV
FT                   SLFDLLREKILASGEGDARAAARAFKLAADKSGKIDSVAIAAVMRRFNVSATDDAVAAV
FT                   MTRLDPGGRGLVDYRTFLDAVMEESSSTHDEGDVRLRSIPGSLHGKPKPARDVATYDGD
FT                   VAAMRELIVDKIAQKFEGGSAALRRAFNSFDADGDGAVNESEFRAVLANFLIVPPADVL
FT                   SALFAANADPATGRMTFAGFVAGFVPEDIRVGIDPDTEAKIRDGFSAKFSGPGEALAAA
FT                   AASKGGTLLFADARDVLGPDADPELVRRIRELSDECREGLIPAESLRDAVIEHQKYLSD
FT                   AAVQKAKRDFIDGFGRELKERYTKGKAPPVAAPKTVSADDAEEILREKLAAKSAGGAKE
FT                   QRKAFQIFDKQNKGFIDRDAMVEALHHFHLVLRPEDVDSLMAKYDSSGGGKISFQDFIA
FT                   KVLPADYPTASAKKARVVDAKIAGFTMELTGLLNEVEEMGGTPGSVARSEATRAAEQAA
FT                   KEARVRLPPSAAHHAADAASIGDHLSEHPRVEPTKYIQSIVSIVRAAEEGAIEAAAEKE
FT                   GVSEKFGDNSYVAPAELASAGFARRMSTNELLAVVHEKFSAKVPHGKSATWYYSRLLDA
FT                   GKDGLVGLDGFQNALKSVGLGAVDPADAEELFAEMAEGAETVTVAQFTRKLTPGPAKRP
FT                   DADALRRSFESLDASQVGALSEEDIRGVLTACDVEVDQAAISRALSLCVADPDLRGPDA
FT                   KGKIDYERFARAIGEADLGGVNKTVAPTLESFGKEEVDVNVEEDGDGVKVSVRVKTVMS
FT                   YSPDTLKAMNVGCDSPPRSVELGSDIEEPEEPRSPDSLPEPSPGHIEVKQWDGPVVKRI
FT                   NQL"
FT   CDS_pept        complement(201294..205631)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631173"
FT                   /orf_name="MICPUN_59808"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="helicase activity"
FT                   /protein_id="ACO65078.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B834"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R0"
FT                   /transl_table=1
FT                   /translation="MASLAEFGFGVPKRRASAEGGGDGRRASAEGDRRASGDRAGPPRT
FT                   APDSARGGGNKRNSGGGNGGEGRGRNSVGFAPPPFDGARVGAELASAKSLLLWFHEDRA
FT                   DCIDRALGEGLWDDFLEPLEREGRWHVRQCSYEDLQEERRRRRDPARRDDQSSVPRPPV
FT                   KAAIDSVAAMKCSLGTRKDGRHGVVVAWELQFDDTARAIAGYEKIAKCLYDAGVVDQSV
FT                   PPFARNCHLKEWIPFPTRMALTTPKVLASDEEVDDAMRKIPSRLKRALFPFQEAGVRFG
FT                   LKRRGRCLIGDQMGVGKTLQALALGSCYLDEGPLLVIAPKSMRLTWARELERWLPDLRP
FT                   KNLLVCDSQNQATAPLRLMARAMRIRDELRRSRIDDDGDDEDDVGGSTDAIARMEAAQA
FT                   AREILDQPRVVVVAYKMCQLLSAHIRSIRWGAVIVDESHTLRTTPSLSGGDGCESEQTA
FT                   TILRMIRGSKPEYARVDPPETRGWRPISDRVVLCSGTPSLTKPFDMYNQIDALRLGLLG
FT                   DKKTFMHAYCDFHQNRFGHHNVRGGKRFAEYQVLLRNVMIRRLKSDVANDLPAKRRDKV
FT                   YVDVTKDDMSAAWRHIGEQGRVNLEDDGVDCEGEPNSAGSIAKMQAIGLAKARGASEWI
FT                   KDFLGIETGGDISERDWRELGLDEDQRRAYTDSLKEMPKTVIFAHHRLVMDYVEDKVLR
FT                   KMPRDWDDANLPYIRFDGSTPGQERDAGCDRFKNDDNCRVALVSVTAGGVGIDFSRGSV
FT                   VIFVELPLAHLVEQAEDRVHRQGVADPVTVYYLVARGAGEWHDRKRLESIDVSLDTTRR
FT                   ALGDHDAADARGLDVRNRKSARGAGPGGESPPGESPPGESPPGESPPGESPGRDDLSAE
FT                   TETRLDWFNASSRERRCGEDEERSYATPPPPDDLWFEYSGATQRVHLHGAADGSAPLGQ
FT                   SFDPNDVCRTERRLRAELDQTVPADVKRKRWTRPLDVRLSDAAADDGLIGGDKSSGFSR
FT                   SHAPRLWGRVDAVFAAAAYVHELEALKAEDKNTIARVHACVRGSIKDYIHGAIGSSIDS
FT                   SGNSSKNAGAGSASTTRHGSGRREPLPEHAEWRPVLIANVRGRGEPREAKEPVSLGWED
FT                   VSADGTKKKTVPVGTPLCLKCMKPRDGANPLGDGAPDLDLDSMVHVRAFTQAIASGPRT
FT                   VASTADLFCSEECAVLDSQTRSAAALRRACFERDRGVCATCGLDCDDLVRRIRVMRCQD
FT                   DRRDAVLAAWPAMGHRGNGGRLSKLAQTAASGHAWECDHVRAVYDGGGECTVDNCQTLC
FT                   VLCHKARTAAQAKERAERRKAEKEKKEKKGQGTIQAGFAVAHLANCVDLTALEGLDVEV
FT                   PESQELEAVDWRTARVVRDDDAREEEDEGEEENEDEADSDSAVPETDDDEADENIAPTQ
FT                   SPPRVLPAKRKKASLGVSQPDPQHVAPEYSDWEEEHVSPEYVD"
FT   CDS_pept        207495..208859
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631174"
FT                   /orf_name="MICPUN_108548"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64723.1"
FT                   /db_xref="UniParc:UPI000199B835"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R1"
FT                   /transl_table=1
FT                   /translation="MTSSGLNGGGSGRPRGVAPPPRDLAGEDAQCAVHDLYTSAAELAV
FT                   SALGAVATATAEPFHGELPQSVLEDALQRVIEWERDPTLTYLTSLILQDDQCWATFSYI
FT                   YSLTRGPAQVWLAFPLAPSVDATMRCLGWSGADGGGAAGGDDGESIGGEVSNAAQGLGD
FT                   HNPSDYCQEVASFRSRASRLQETWGFRPLVSQTPWNTRGLMQFEDPAVEAAFLRFADGK
FT                   TTVAVNAGILVLCLLTSACMVLNGNFALLRGYLGCKPEAVDATTLAVRFFPMLAALTLG
FT                   LVSAWCARLSNPLRVRMGCISVFRLMLAAVTLRSGGAVFHGENVAFDSAGLAIVPNAER
FT                   SVFDPGAFADQFGVKTCAFFVLTTIVLPYLLPLRFGDHVVTSFLCGLVSWARFGSFFGV
FT                   GGMGRMFRSEKDLAVRCALFAAAQVPMYVREYHMRFKFLMNKFGPGNRLEKEKVI"
FT   CDS_pept        join(complement(209991..210962),complement(208992..209876))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631175"
FT                   /orf_name="MICPUN_59810"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65079.1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199B836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R2"
FT                   /transl_table=1
FT                   /translation="MIVPLLAAAIALAAPSPGAARTPAGVDPRAQVAHFDPRQDGAVDC
FT                   RVFVFAGIAGACNTDAQGTPERCCAALGTAEDARCFCDEGVVRAVRDVIGERGLDFFRS
FT                   FASARCGRALTEGNACGNDASPSLGEREVNILQQQQQQQQQPGAFPPFPPAPAFPRAPN
FT                   SPPRVGAGAPGNFPPSPASEQFIVDLPPLPSFPELPDAPATPLAPLTPPPPAPKPPPPI
FT                   GTPGAAPQLSIPPPAPQTIAQYVGAPPSPSDPVRRKPPGLPTVWDKLNDDVADFQFGFF
FT                   ADAIVAVGLKGLFQSAGPFTVFAPTNRAWYSALVSLGVTKEASDVFEDPSLTEVIMHHV
FT                   HRGEVFSESMFFGKKIPTMHMSAPNVARSVRAALQSGADPVAVRAMMTEGLEIETFQTM
FT                   FRKMYYVDGCDLRRHSMDVVASNGVIHAVDCVLFPPSPQPLPSGRTVAQVIVERFELSI
FT                   FEQALTGGGLLRAVNQASAENPLTVFAPTNTAFVKFMASSPSFFIDTEAERVVNPGYPG
FT                   LQETLLYHFVPARLTSGQLSTHNARTLRTFEGKELFVESFGWSGRRHANYLNHVLGQKL
FT                   YVNGCRLRQVDFVCVDGVVHTIDCVLQPNFRDDEDKWFGDTE"
FT   CDS_pept        join(complement(211963..212004),complement(211171..211821))
FT                   /codon_start=1
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631176"
FT                   /orf_name="MICPUN_59811"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65080.1"
FT                   /db_xref="HOGENOM:HBG382530"
FT                   /db_xref="UniParc:UPI000199B837"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R3"
FT                   /transl_table=1
FT                   /translation="MSVPSGAWEELRREARKLETEIDGKLATLQRAVSTAGVDVSDALL
FT                   AGDSLDAQTADLDALLQRLADVSTAMAGAVKGGVGDTRAHTLARHKDILAEYQHELRRA
FT                   KNAVQQSRESAELLGGGRAGGGLSSSDHFGDSSAGSQLMRERGTIMSGTSKVDDVIGQA
FT                   QATAAALVNQREIFQNVNRNLDAIGSRFPMVNNLLQAIRRKRSKDTMVLATVVAICTAF
FT                   TLIYWLSK"
FT   CDS_pept        212402..213802
FT                   /codon_start=1
FT                   /gene_family="HOG000222137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631177"
FT                   /orf_name="MICPUN_59812"
FT                   /product="Predicted protein"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64724.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG286021"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000199B905"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R4"
FT                   /transl_table=1
FT                   /translation="MTAVNAAAVVSSSSSAAADDALFLGLDFGTSGARATVVDNAGDVV
FT                   TETTARYPPIVDGGKGGDGVPEGGWAEAWRGALWSLLDQLDAGVRARVAAVAVDGTSGT
FT                   VLIVDRKSGEPVYPPMLYNEKRGDAMDFVCAVAPEGHTVRSPTSALCKLHSWWVSNGER
FT                   GEGEYALLHHADWVASLLHGVPHGETDQNNALKLGFDPGLGPNGDYPAWMKSLPYAPML
FT                   PGNVRAPGTKVADVKTERARSVLTNPSGCVVVAGTTDSIAAFVAARCTTPGDAVTSLGS
FT                   SLALKLVSTVRVDDSAKGVYSHRLCGSWLVGGSSNLGGWLLRSNFSDDELVALTDKIDL
FT                   EDVGKESSVPDYYPGVLMGFGMTVKEATDALSPRPDADEDFLRAILGSVAGVEARSYRE
FT                   MASMGASNVARVFTAGGGAKNPKWSTIRSRAMGGIPVAASEFAEASYGSALLARMGHYE
FT                   LPTYVPEE"
FT   CDS_pept        join(complement(213965..214694),complement(213872..213924))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631178"
FT                   /orf_name="MICPUN_59813"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65081.1"
FT                   /db_xref="UniParc:UPI000199B906"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R5"
FT                   /transl_table=1
FT                   /translation="MAGTLSFFHATCRRPHDAVADTPDTMLAMTTTIVPARAPVRAPRA
FT                   AALSSRVAAPLAPRSLSGPNPGRTPTLVTAAGPEEFSSAPAPSLDAAPTPGGMSKTQAA
FT                   KLAAKQAKKAAKKPKQAQMQKPKRRKAPSGEKKVEMPPTEAELAASAKYDAMLEEGAIV
FT                   YECFIRAKGPNQWFPVGPMAVKQDWMIVPEMWKAEDAMKKAGFKMYPALMRAPCFGNVE
FT                   YGYRARDDEKKVTEEQIREAKDPRTGARDRRARGSWIG"
FT   CDS_pept        join(complement(215275..215351),complement(215052..215151))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631179"
FT                   /orf_name="MICPUN_59814"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65082.1"
FT                   /db_xref="UniParc:UPI000199B907"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R6"
FT                   /transl_table=1
FT                   /translation="MPIKNAPVKKDKLTDAEKKKIKQDNKAKANPGKAADKKAKNDAKR
FT                   EGRKESGSQKTFA"
FT   CDS_pept        join(complement(219535..219558),complement(219289..219365),
FT                   complement(218489..219134),complement(217547..218401),
FT                   complement(216474..217459),complement(215672..216428))
FT                   /codon_start=1
FT                   /gene_family="HOG000007241" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631180"
FT                   /orf_name="MICPUN_97627"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65083.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG318519"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199B908"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R7"
FT                   /transl_table=1
FT                   /translation="MAYNYVVTAQKPTSVTHSLVGNFTHDNELNLIVAKCTRIEIHMLT
FT                   PDGLQPMHDVPVYGRIAVMKLYRPAGEKRQLLYVATERLMFCVLAYDQTSGAIATRAMG
FT                   DLSNTIGRPCEHGLIGEVDPECRLIGSQAYDGLFKVVPMDRAGQLREAFDVRLEELNVV
FT                   DVKFMHGCATPTICVLYEDTKEARHVKTYEVDVKEKTLRDGPWSQSDVEGGSSLIIPVP
FT                   APLGGAIVVGESVIVYLNKDGGNGAGGAIATKSVNVMAHGVVDADGSRYLLSDSTGMLH
FT                   LLVLVHDRRRVHALKLESLGQTSIASTLSYLDNGVVYVGSAYGDSQLVRLHAQPVRCAA
FT                   DQVPATPDGLTYVECLESFTNLGPIVDFAVVDLDRHGQGQVVTCSGVNKDGSLRVVRNG
FT                   VGIHERAAIELPGVKGCWSLRRGDASTHPSDTHLVVSFAGETRILAIDDDDELAECEFR
FT                   GFSANEQTLCVCNVDGGFVVQCVASGVRLVNAADGEPRATWSPPGGATVSVASANRTQA
FT                   LVATTGGSLYSLALGSAALIRETASASLDGKEIACLDCTPLSDPGDAAARLCAVGTWTA
FT                   EVFLLTMPDLRLVTTSPLGGGGGGVIPRAVLLCSFEGTPHLLAGLGDGALHTFGVDPEA
FT                   GTLRDGKSLSLGTQPITLRTFRSKGATHVFAGSDRPTVIYGNNGKLIYSNVNLREVLHA
FT                   CPFNCDAFPDSLALASESDLTIGGIDDIQKLHIRTVPLGEQPRRIAHQPETRTYAALTE
FT                   NFDENGYFVRLFDDVTFETLCKFRLEPDEQDSSVISCAFADDPRVYYVVGTGYSLPEEP
FT                   EPTRGRILVFRAEDGKLQLVAEKEVKGAVYNLNAFNGKLLAGINSKVELFRGGDPVGAD
FT                   GAGGSTYELAKECSHHGHIVALYVAVRGEFIVVGDLMKSVSLLAYKPEESVIEERARDY
FT                   NANWMTAVDILDDDTYLGAENNFNLFTLRRQSDAATDEERSRLEVVGEYHVGEFVNRFR
FT                   RGSLVMRLPDQENADVPTLLFGTVSGVIGVLATLPREQFEFLSALQAALNKTVSGVGGL
FT                   SHDAWRSFQNEHRHRAKDGARGFVDGDLIESFLDLRPEKAREVAAAVKLSVDELTRRVE
FT                   DLQRLTH"
FT   CDS_pept        219904..222045
FT                   /codon_start=1
FT                   /gene_family="HOG000231705" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631181"
FT                   /gene_name="ODA9"
FT                   /orf_name="MICPUN_83829"
FT                   /product="Dynein, 78 kDa intermediate chain, flagellar
FT                   outer arm"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64725.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG522655"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B909"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R8"
FT                   /transl_table=1
FT                   /translation="MRVSVWATKKPPSHPRLTRELTTPASSDPSAQAPEKDGAKPKAKK
FT                   DKGEKKPSAPAADFDAFEEAKTVIIVPANQLELTQKEMDEEITKQLTANNPNAPANIAR
FT                   YNTKEREYKFEPMIDQLVMHFASDGYLLHRDSDAAKQQLQLEAMEAEAIEEYERAVAGL
FT                   PKKRAPGEEGEGGEGGDDGGDAADDDDDDAAREPVDDSKALRNQFNFSERAAQTVNNPT
FT                   RERQSATEPPPSQQFTASATQWEMYDAYMEDQLRVAIQRDMMKKQKQREKEAEEAEEAG
FT                   EPPPKKKEEPKPPPKEKKPEMMAGVPMTRAVKVMERMVNQNSYDDIAQDFKYWEDQSDR
FT                   FREGEGTLLPLWKFYNERAKRRHVTAIAWNPTYHDLFAVGYGSFDFVKQMSGLICCYSL
FT                   KNPSHPEYTFTTDSGVMCLDFHPHHPSLLAVGLYDGSVMVYDVRNKVNRPIRQCTVKTG
FT                   KHTDPVWQVKWQDQDLSERSLNFCSVSSDGRVTTWTMSKSELVHEDLMELKLVTADADD
FT                   DADALGSLAGGCCFDFNKAQDHLFVVGTEEGHVHKCSKAYNSQYLETYVGHNMAVYSVQ
FT                   WNPFHQKAFLSASADWSVKLWEHNSSRPLMSFDLNNAVGDVAWSPLNSTSFAAVTSDGK
FT                   VHVYDLDVNKHEPICEQKIVRKAKLTKVAFNPEHPVLLVGDDRGCVTCLKLSPNLRKGG
FT                   AEPERMETLVDTALKGEQA"
FT   CDS_pept        join(complement(222976..223221),complement(222288..222797))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631182"
FT                   /orf_name="MICPUN_59817"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65084.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199B90A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9R9"
FT                   /transl_table=1
FT                   /translation="MHGIAVVSNAVAPAAGAGRARADGGAKLARGASGTPRNVSPACTA
FT                   RKDSVALGDRRFFGKARALRTVSVGPTNSGRASRNLTTRAMGGRVDTKSDPWWTKNNAS
FT                   NMTEAHSMDELLQVLQANADKLVVVDYYARWCAACRALHPKLCKIAEENAHDVVVVKIE
FT                   FDDNKDLCRGMGVRVLPFFQLYRGARGKVSAFSASISKVARIREGIAEHRPGGAYDTDP
FT                   DAGAGWPVAEKSGSEDEEPAGEREPAPAR"
FT   CDS_pept        223589..225088
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631183"
FT                   /orf_name="MICPUN_59818"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO64726.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B90B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S0"
FT                   /transl_table=1
FT                   /translation="MGGGGDDACGATSQPPVWSTRWDSGGRIDSHRISVAPMLECTDTH
FT                   FRRVCRLVSRRAHLWTEMVNQDAVVHSWRSKPEMLAYGDEEHPLTVQLGGASPERLALA
FT                   ATVCDAEYRYDEINLNCGCPSNRVVNKKDVATCFGAALMRDPTHVGECLRRMREAVDVP
FT                   VTVKHRLGVRPTEKSPDDSMDSYAFVSEFVDVVNQASGVKHFIVHARAAVLSGLSTTGN
FT                   RTVPPLRHAEVHALADDFPSLGFTLNGGIETMDQAAEHLESGKLRGVMLGRAVYRNPAV
FT                   LAEVDARFYGDEPREAFRERYAGEARVAGRWDSDGFDDFTNRFGGGGGDSGGNRTTEDD
FT                   RLGSRGSFFALGGTDSAACVTRRDVLERYAAYGDAVCAMNLDHMVKFPNALLTPRRLAK
FT                   AALGLGHGARGGGAFRRACEREFGEWTRRLKGGEPPERLSFSDLVRDASSEMHADDLDA
FT                   PLAASCAPARAHGEARYGRGAGGGGGRDDGADEGDVHARER"
FT   CDS_pept        225486..226475
FT                   /codon_start=1
FT                   /gene_family="HOG000204332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631184"
FT                   /orf_name="MICPUN_59819"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64727.1"
FT                   /db_xref="HOGENOM:HBG523770"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B90C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S1"
FT                   /transl_table=1
FT                   /translation="MGRFKTQHNGYSLAFSPFVEGRVAVTTSQNFGIIGNGVQYVLEQR
FT                   GGPGAPLVEVARFDAADGLYDCCWSEENESVLVSASGDGSVKVWDVAAPPQANPLRSLE
FT                   EHTHEVYAVHWNQVRKDCFLSASWDDTVKLWSLAGPPASLRTFAEHSYCVYAAVWSPQH
FT                   ADIFATASGDCTLKVFDARTQFSTLTIPAHEYEILCCDWNKYNDCVVATGSVDKTVKLW
FT                   DIRSPRRELACIAGHQYAVRRVRCDPWNESIVYTCSYDMTVAMWDYKTQSMGGTVGGGI
FT                   AAPLRRWGHHSEFAVGLDASVLAEGVVGSCGWDEQVAVWHRDTDPAMM"
FT   CDS_pept        complement(226671..227681)
FT                   /codon_start=1
FT                   /gene_family="HOG000172419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631185"
FT                   /orf_name="MICPUN_59820"
FT                   /product="Predicted protein"
FT                   /function="adenosine kinase activity"
FT                   /biological_process="purine ribonucleoside salvage "
FT                   /protein_id="ACO65085.1"
FT                   /db_xref="GO:0004001"
FT                   /db_xref="GO:0006166"
FT                   /db_xref="HOGENOM:HBG314716"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199B90D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S2"
FT                   /transl_table=1
FT                   /translation="MGNPLLDISAVVPTEFLDKYDLKLNNAVLAEEKHAPMYDDMVKNF
FT                   DVEYIAGGATQNSIRVAQWMLGAPKSAAYMGCVGKDAFADEMVKCCEAEGVHVNYMVDE
FT                   ATPTGTCGVLVNGGERSLCAALNAANNYKIAHLERPENWKLVEDAKFYYSAGFFLTVSP
FT                   DSMLKVAKHAAESGKTYTMNLSAPFLMEVPPFKSAMMECMPYVDVLFGNESEAATFAKS
FT                   EGWDTTDVKEIACKASELPKAEGAKPGRLVVFTQGMDPTIVAKDGKVLGEFPVIPLAPE
FT                   KLVDTNGAGDAFVGGFLSQYVKGAELEKCVRAGNYGANAIIQQSGCKFPPVCDFA"
FT   CDS_pept        join(complement(229535..229636),complement(228171..229454))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631186"
FT                   /orf_name="MICPUN_101327"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65086.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015465"
FT                   /db_xref="UniParc:UPI000199B90E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S3"
FT                   /transl_table=1
FT                   /translation="MSGNRIMVGNLPYEADERAISDALGHLGHITDCKVITDRETGRSR
FT                   GFGFVTFADASAAAAAVQTMHGADIMGRACRIDFSEDRRGGGGGGGGRGPPGPPGGYAP
FT                   SGGGGGYDRDRSGGYDRDRGGGYDRGGRDSRGGGGYDGGGRPPPPTDQPPPPPDSSAYG
FT                   GYAGPVVEAGAGARGVCNDFLRGACKWGDRCRYSHVGGASQAAPPPSDRRDDGPKVELG
FT                   GDWNCDGCGNSNFSWRKTCKKCNAPKSQALKDAEKAATGGWLTAGLSDTSNRIFVKGFD
FT                   PEKVNEDDLKELFGGIGIIARVRQRHGFPDQWPHAVKIYKDEAGKPKDEAVIKYDDPMA
FT                   AQSAPGFYDGFELKGSKLSVSIATSKERPEDEGGGGGGGGGYGGRGGGYGGGRGGGRGG
FT                   GGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGGGGGYGGGGDRGGYRGGGGGGYDRH
FT                   RPY"
FT   CDS_pept        join(complement(234200..234302),complement(229875..234016))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631187"
FT                   /orf_name="MICPUN_59822"
FT                   /product="Response regulator receiver/WD40 domain fusion
FT                   protein"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO65087.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B90F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S4"
FT                   /transl_table=1
FT                   /translation="MASSSPADVHVLLVDDDRVCRTLVAGMLKKCNYQVTTASSGEEAM
FT                   ALLERGTQFNLLLTDVMMPDVDGPTLLHYVRNNPFYQEMPVVMMSSNEHADTVMNCIRL
FT                   GAEDYLLKPVTKKAVKHMWAHVWRRKQRYQMVPQFENGHEVVEDDYAAGIGAHELEDGH
FT                   HRGFEDHMEPQVPENEEYSSDGEEMDGDRAAAAGTAGGEYYERIADDDEAWAQARRRAA
FT                   AQYMDDAGMDTDGGGGCPFGGGGGGGGGRGGVKGPTAKRVGFQLTPDGACPFSGKKMEN
FT                   VDEGDEAHARREEAERAARASTDPMVVTCPVTGAKRRLASVPPIQGFEHGHHMTLRQWL
FT                   DDQNARGQIVDKRDSLHVIGKCAALLARQHEGGMVLGHMLPSRLVISPQGDVSLAPPTP
FT                   PLSPERAARGNGGEGVGVDEGVSGGEGMSAGKGGRRATRAATMRNRRASREYDEDGSED
FT                   GSETIEADDEDSDDDDDDEADADDEIKPGRPSRASPPVCPNEFLYDSPEMRLASGDPRA
FT                   VDIRRHECFGLGVLMVELCWPEVAAGAMGDVAKLLGATLRPDGVGAAALDADPNESAVA
FT                   RQLLQPVPTNRPSAKQVTELIKRAAEIAEAEADAKENADVLHRENGWPTRREMGLATER
FT                   RLTELATLRTFLIAHKEARLREVQGHKVRSALLAHALRQLGEQTEVGADDGIGQRGGSA
FT                   GNLRQTSFGNLRQTSFNRGQSPLRRPSFDGSQPIRRGASLDIPRQQSFNRGHAQQTPAP
FT                   VGGVPDHLSKLQPMKKRRQSLDVTEISQGQVGDQPGTRGVVRHPSFTSEGAAPSPRTSV
FT                   DGRPSVDSQRRSIERKRSFDGRGVAGAGSPRAAAAANPGPFAVRRDSSRTSMDTAGSND
FT                   SDRQRRPSLRSASFNRSFNRSFSTGDLVRLGGGLRPDAAAAVAKSHRVAKELDEAEFEA
FT                   LEENFFDACARAIAPIARNYTKAQAAIANAVGSSGEGSPNAGSPERGVPESGEPEEGEP
FT                   APPSEKDAQRALVEKRRQGAIAETAAAASQALGQALHAFGQDLSQATRKTTLRTIADVS
FT                   LGDVHSFGEMICCTGWDRDAEYIATAGISKRLRIFEVDPLINSGAAVHCPVAEMKASAK
FT                   LSSMTWNPYIKHTVATADYEGVVSLWDVNRGEVGSAFHEHKKRVWSTSWSKLDPTRLVS
FT                   GSDDGTCRVWSINQRESTAVIQNRANICCVHFSPVSANVVAFGSADYSIKAYDLRHTLR
FT                   PLVSLTGHKKAVSYVRWLDGDLIASASTDNTLKLWDVKRGILGAMAGPTQLAVSDPSST
FT                   LWAGDKSGDGNPACLRTFRGHVNRKNFVGMSASSAGHIAVGSEDNTVCVYAKAVPAPIA
FT                   RHSLAVTAAFSNHGAGAGGAQSTTATAGGGGGDGDKPGLFVSSVTWSPSGRMLVAANSC
FT                   GAVKIMELTAPP"
FT   CDS_pept        join(235071..235106,235330..235380,235516..235582,
FT                   235742..236721)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631188"
FT                   /gene_name="GAPA"
FT                   /orf_name="MICPUN_104876"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase a
FT                   chloroplast"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64728.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000199B910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S5"
FT                   /transl_table=1
FT                   /translation="MAAFATTTPSLKAEFRGQTAGLKRGKAVKAAAVNTVTEAKVKVAI
FT                   NGFGRIGRNFLRCWHGRASSNLEVVAINDSGGVKQASHLVKYDSILGTFNADVKIVDDT
FT                   HISIDGKSIEIVSSRDPLQLPWKKLGVQLVIEGTGVFIDTPGASKHLEAGAEKVLITAP
FT                   AKGDDIPTYVMGVNADQYTHADKIISNASCTTNGLAPFAKVLDDKFGIVKGLMTTTHSY
FT                   TGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVS
FT                   VVDMCIQTEKKCTAEEINAAFREAAEGPMKGILAVADEPLVSIDFRCSDVSTTIDAALT
FT                   MVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKWGK"
FT   CDS_pept        complement(237107..238282)
FT                   /codon_start=1
FT                   /gene_family="HOG000014371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631189"
FT                   /orf_name="MICPUN_97632"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO65088.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG285135"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199ADB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S6"
FT                   /transl_table=1
FT                   /translation="MILGGDGYCGWATALHLSNRGYEVAIVDNMCRRTFDDQLGFNSLT
FT                   PIKGIHERVRVWEEVSGKRIQLYVGDICDYEFLSAAFQAFEPTACVHFGEQRSAPYSMM
FT                   DRSRAVFTQTNNVMGTINVCYAIKEFAPECHLIKLGTMGEYGTPNIDIEEGYITIEHNG
FT                   RTDTLPYPKQGNSFYHLSKCHDSANMLMCTKTWKMRTTDLNQGVVYGVATPETMMDDRL
FT                   VNRLDYDAVFGTALNRFAIQAAVGHPMTVYGKGGQTRGFLNITDTCKCIQIACDNPAPP
FT                   GEMKIYNQFTEQFSVNELAALITEAGQKLGLDPQVINVPNPRTEMEEHYYNAKHSKLQD
FT                   LGLEPNLMKESILESLLTTVVKYKDNVDQRLILPGVNWTESASVGKTIAKV"
FT   CDS_pept        239391..240326
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631190"
FT                   /orf_name="MICPUN_101331"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64729.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ADB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S7"
FT                   /transl_table=1
FT                   /translation="MSGAALLGARGGMQSIWRPNVRVSLDEDGEVEDTEQEGEEVTKKG
FT                   VKRKRAPYTKGPCEHGVKYRSKCKVCSACPHGRKRRYCKDCGGSGICEHGSRRSECKEC
FT                   GGSRICEHGRRRSTCTECGGSQICEHGRRRSMCTECGGSGICEHGRQRYHCTECGGSGI
FT                   CDHGRQRSQCKECGGGSICEHGRIRYRCKECGGSQICEHGRRRSQCKECGGSQICEHGR
FT                   QRSMCTECGGSGICEHGRRRSMCKDCGGSGICEHGRERRYCKDCGGSGICEHGSRRSEC
FT                   KECGGSRICEHGRRRSTCKDCGGPRISTPP"
FT   CDS_pept        complement(240467..241042)
FT                   /codon_start=1
FT                   /gene_family="HOG000100096" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631191"
FT                   /orf_name="MICPUN_59826"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO65089.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG302451"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniParc:UPI000199ADB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S8"
FT                   /transl_table=1
FT                   /translation="MAAPKIAKDGGEKVYPEECRVEVGGLQYRRCAAALVFNPNGDVLL
FT                   GERSDRPGSWGMPQGGIEIGESQSAAATRELYEEVGMRPGDTAGLSLVAEVPADENFCY
FT                   AAGGWLAEKGLAGQRLEFTLFHLATTDDPTPLCNLEGMAGESREFTRVRWASWDEAVSA
FT                   VWESKRGPYVRARELAVPVIEKYLAGEK"
FT   CDS_pept        join(241522..241761,241894..242433)
FT                   /codon_start=1
FT                   /gene_family="HOG000261975" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631192"
FT                   /orf_name="MICPUN_59827"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64730.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG741910"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000199ADBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9S9"
FT                   /transl_table=1
FT                   /translation="MATRAAFAPSAGRVRPKPRRVPTRAASDRADGGGGGAPRVEPSFQ
FT                   RSVPPGDARERDVCTTCGFVDYRNPKVVVGSVAVWVDPGSPKGFPPTEKILLCKRGIEP
FT                   RIGKWGLPQGFMELGETSREGAAREAFEESGASITPGVLLSVYNLPGQVQLLYVATIAG
FT                   GTMDDATGEHVPPALTTDGTESLDAGYFTYEEIERMDDDDFAFPTVRWAIDYWRANYSW
FT                   VAGFTYTGRVVQPQQRVKRWPPVEGEPGFVDEVDYTY"
FT   CDS_pept        join(complement(245496..245546),complement(242518..245340))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631193"
FT                   /orf_name="MICPUN_59828"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65090.1"
FT                   /db_xref="InterPro:IPR021777"
FT                   /db_xref="UniParc:UPI000199ADBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T0"
FT                   /transl_table=1
FT                   /translation="MAPERPTGGRRNDPRFAVTSSARPEGFAQSATLVARPSAARVRSR
FT                   GASNDAARAHGRGETFELPGSSMSRSGPVGTASAAAKGGSSTLGEATAKLRSATAASLA
FT                   RRSGAKIVPGGGRFYGTDDATNGGASSSKKTGFGGSSSPSSRAGPASTPSSGRTSESPK
FT                   PSQTPSADRGRPPPGCVVVHVLDEARNERRDFTCDLKTLLGQMRYFKQHLAADVETRPE
FT                   ASAELSVHCDIPTFEWLVDHVEGRDPRVTNRNCVALMISSDFLRMASLTDKCADYVAAN
FT                   AHQVCALGADLANLPRGLLEKIGQRMSDESLESLLATSDEDGVHAAPSGGHPEVRERPN
FT                   DSTDSKRALAATLYRVKTEALIASRRADAGVTIARCAACGLLFSEKHRFGLRCPRARRH
FT                   VDYHGDVIARHAPMKDFDVHAHIERLITARGHAWRDVYWHVWGVTHVIDRCGRCGAVVP
FT                   ASELTQCEYHPRPATFDDDADPSVGTFACCGSRAPRFDPTGGISAGGCEGRDHVFPTLD
FT                   TDEPRFLEGRRALETARRRRGLACEPFSARPAATAPPRPVDDDGDDQSEMDAWRATRPA
FT                   NDLADNGIHAFGDHHSPGGVDVTWEAAAAIDEGTDKGETEKAESGRSDTDSDREILPFD
FT                   HDYDTEAEMEGRRERWGYNPAYVPMPGQEKPPKGTPAERNPPAEKPTKQQTNASTRGTR
FT                   TKSDDSDSSRLDSDLSDDSDSDSLDGSRRKASDNKVSYKAPVGQRYKRGTLEAARLGTN
FT                   ADERAASRRNARRNAHRKKPSPVGRPGSSPAPPPIESHRAELVYGLPRATYESLPKGYQ
FT                   RGVRTEWRDEEEARRVAKIKVRMARRAAKRVGVSGPTQVSGPTQVSGFQQVSGFQPRSV
FT                   REAAERFGLDVGLGAKPDRASWLALADMGLLDLRAMKIAAERDEEEREKRGDGSVARGG
FT                   GGGGRKRGGGGAAVGAGPASSGGRWVG"
FT   CDS_pept        245697..246170
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631194"
FT                   /orf_name="MICPUN_59829"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64731.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199ADBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T1"
FT                   /transl_table=1
FT                   /translation="MDLRYPETLKEYGKPGAKKDGDGGAEDGEEKEHPAIARVRCMMGR
FT                   EIRVKVVDGRVFVGRFECYDKQGNILMEDAMSTTLDDPEGTEPHTYRGMIIIQKQHRVE
FT                   TQLIVRDGECDPTAPDFDPYKELEEQELLYQAEAEAQADGGADPIDDHEPPVL"
FT   CDS_pept        join(246303..246794,246846..247019,247170..247380,
FT                   247459..>247956)
FT                   /codon_start=1
FT                   /gene_family="HOG000200828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631195"
FT                   /orf_name="MICPUN_68288"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64732.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG318428"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniParc:UPI000199ADBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T2"
FT                   /transl_table=1
FT                   /translation="MGSAFVGFLSDMSSRQINHLYQSPWACLSVLRSLPSLAKHYVMRL
FT                   LYVDEGIAREEMDAWVRPGKEHRDRHARSMLALKRLRVLVPAGDQEYVADGKELVRLNR
FT                   RFVKGVRAQIETCFAPEGDEVEATVAPDDAMGGKRPSPEKIEEFAKGRWEALLMTLTGR
FT                   DRRKGPGLDVAALFRGAGLVAEKSNKSNGWGITEKGFRFLLSTAREQIWTLLTEYVRQY
FT                   SAPGDRTLVAPAVIGFMLRLTFQAVGQPYRVDDLPSAQRAIAEDLAHLGLLYLFAGPGK
FT                   EGYYVPTQLTAGKDVADGDASLGGDPGGHIIAETNFRVYAYTFSDVECEILRLFTRPDY
FT                   RLPNLYVGMLTREAVHEALDTGVAAEQIIKYIKSHAHPNARKTTNGSGIPPNVADQIML
FT                   WAMERRRVRSAECVLYCDFPTGTDEYAAAVKAASDAGVLLWENREQMKLAVAKSGHERM
FT                   "
FT   CDS_pept        complement(248230..249303)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631196"
FT                   /orf_name="MICPUN_59831"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65091.1"
FT                   /db_xref="UniParc:UPI000199ADBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T3"
FT                   /transl_table=1
FT                   /translation="MSLSPVVRAVRDAGEKLTGSSNLTREEFLGCVRDLDTALRSPGDD
FT                   GDAACAEFCAGPPGAPHRAALAWFAGKLRKGVVADDVGDPMRKREDVFTTAAALQVLVS
FT                   ASGGDHRATFGHTSRDGSHERWPKRGYALCHARWAPTVLAPTGILPPLLALTRAKTAGP
FT                   QVWMRALQLAGSIARCDDAVAHEMARTGWPRVCAEVVKAIPDQAWDEARAREFIVEREV
FT                   WQWLDSRFAACAQTHTDKPRNTLRSFTVVERLGPEGGAEGGAEGGAVGGCATSDAPSLS
FT                   DTEWYGKLVRVDGTNGTSLLGFAVAAFDDADVAVFLADDGGGGRVVSAGVGHVSLVHDR
FT                   LRPLREPLQEASTSDGR"
FT   CDS_pept        249519..250772
FT                   /codon_start=1
FT                   /gene_family="HOG000100089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631197"
FT                   /orf_name="MICPUN_59832"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64733.1"
FT                   /db_xref="HOGENOM:HBG557137"
FT                   /db_xref="UniParc:UPI000199ADBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T4"
FT                   /transl_table=1
FT                   /translation="MHLLRRALGLPYKSGYYYDHPRASPERGDGTFTVDNGNVMFTPEP
FT                   KDGSRRLPPAEHVLSSVKSGKVNCDSSRFPEFAGLDERPKFQGGVVHTADRQIFKETFA
FT                   AEGDEGALSVSLAEDVWYLLTEELSIWAVLRLEIALEVLLIVAFALALTVVSVVEHGAR
FT                   DGVLRDKFLLSLTSVRLSTDSIFGWQARSASSGYEVFVLAIQGWTHWLLLSVAGAVIVA
FT                   RALRPLQQVVFNPDCILTDEEVNVRLQIIRPAKVDLLNVTINLQVFVTGGRVHQLSLTN
FT                   GIEGYGAWFGFAPMNIRHKIDENSPLRDDYPGGKQGVYFIRVSLSATDSNGNPVNAFAT
FT                   YYHPDSFFMGMSDFRAAWAQRGIMPPRILRGVRWKDQMRRIRDRSTGKGTEGAGLPTWL
FT                   VNVDNTEGFEPIPGDSPV"
FT   CDS_pept        join(complement(252179..252238),complement(250964..251860))
FT                   /codon_start=1
FT                   /gene_family="HOG000210449" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631198"
FT                   /orf_name="MICPUN_83316"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /protein_id="ACO65092.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI000199ADC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T5"
FT                   /transl_table=1
FT                   /translation="MPHRERLKVFSGSAHPELSNEIANYLGMDLGDRVIKKFADGEVYV
FT                   QIKESIRGCDVFLVQPTCPPNVNDNLMELLIMIDACRRASCRSITCVIPYYGYARADRR
FT                   TSGRESIAAKLAANLLTQAGATRIVMLDIHSLQTIGYFDIPVDHIYGETVILDYLTSKD
FT                   FSPKDLVVVSPDVGGVPRARAFAKKLCDAPMAIIDKRRTGHNKAEVMNLIGEVEGKVAI
FT                   MLDDMIDTGGTLVAGAKLLRDQGAKDIYACATHAIFSPPAVERLGSGVFTEVIVTNSIP
FT                   HTPERDFPQLTVLSVGNLLGETIWRVHNDNPVSFNKL"
FT   CDS_pept        252934..254565
FT                   /codon_start=1
FT                   /gene_family="HOG000223742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631199"
FT                   /orf_name="MICPUN_83264"
FT                   /product="Predicted protein"
FT                   /function="glutaminyl-tRNA synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO64734.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0050567"
FT                   /db_xref="HOGENOM:HBG395951"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniParc:UPI000199ADC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T6"
FT                   /transl_table=1
FT                   /translation="MIRAGGPSPSPRGRRAGPIRLPRRAPSSTPTRAKTEEKASADASS
FT                   RTGADAEVQFEAVIGIETHVQLNCRTKAFCRCAAVYGDEPNTHCCPTCMGYPGTYPVLS
FT                   EAVVRKAVQLGLGLNARVRRRSKFDRKQYFYPDLPKGYQISQFDEPIAEGGYIDVVIPV
FT                   EDGGGVRRIGITRAHVEEDAGKLTHYPAKGDTPGYALADYNRAGVALVEIVSEPDMRTG
FT                   REVAAYGAELRRLVRYLDVGDGNLSEGSMRCDVNVSVRPVGREAFGTKVEVKNMNSFNA
FT                   MSRAIDFEIDRQTALIRAGKGDEIVQETRTWDEGRQCTVSMRKKEGLADYRYFPEPDLP
FT                   PLVFDEAFVEKCASAMPELPGAIRARYADLGLPPADVQVLVEDKELVEYFDAALAAGAP
FT                   AKQCANWLTGDVMAWLKNAKDVAVSSMPLSATQLAEFCTLIEDGVISGKIGKDILPDLL
FT                   EGKEGNKSVGDIVEERGLKQISDPKEIEAIVDRVLEANPGQLEQYRGGKDKLKGFFVGA
FT                   VLRESGGRANPALSNEILMRKLNEGR"
FT   CDS_pept        join(254944..254995,255078..255120,255281..258152)
FT                   /codon_start=1
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631200"
FT                   /gene_name="GCSP"
FT                   /orf_name="MICPUN_104877"
FT                   /product="Glycine cleavage system p-protein "
FT                   /function="glycine dehydrogenase (decarboxylating) activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glycine decarboxylation via glycine
FT                   cleavage system"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64735.1"
FT                   /db_xref="GO:0004375"
FT                   /db_xref="GO:0019464"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG286723"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniParc:UPI000199ADC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T7"
FT                   /transl_table=1
FT                   /translation="MTRQPSNSKRPFTPCPAAVRTIAVEALKPLDSFERRHNSATKKEE
FT                   AEMAKYVGFDSMDALVDATVPSDIRRAGSMDMGKWTQPLSESEFLSTFKSMASKNKVFK
FT                   SYQGTGYYGTHVPTVILRNVLENPGWYTQYTPYQAEIAQGRLESLLNYQTMISDLTALP
FT                   MANASLLDEGTAAAEAMTMCSAVNRGKKPKFLISDKCHPQTIEVCRTRADGLGLTVVVG
FT                   DENSFDYSGNDVCGVLLQYPATDGAVIDYSPVVKSAHAAGAKVVAAADLLALTSLVPPG
FT                   EWGADICIGSAQRFGVPMGFGGPHAGYLATSHDYKRLMPGRIIGVSIDATGAPALRMAM
FT                   QTREQHIRRDKATSNICTAQALLANMAGLYAVYHGPKGLKAIADKTHGLASIFAEGAGK
FT                   MGFAKPAAPFFDTVALGCPSGADKAVADCQKAGINIRKIDANTVSLSFDETTTMGDVDA
FT                   LFAALNGGSAPAFTAEALAPSVNASDFLARKSRFLTHPVFNAYHSEHEMLRYLARLEAK
FT                   DLSLVHSMIALGSCTMKLNSTTEMIPITWPELANMHPFAPKEQTAGYREMFQELEKQLC
FT                   EITAFDAMSLQPNSGASGEYAGLMAIRAYHQSRGDHHRDVCIIPVSAHGTNPASAAMVG
FT                   YKIVVVGTDAQGNINIPELKAAAEKHSANLAALMVTYPSTHGVYEDGIKDVCDTIHKHG
FT                   GQVYMDGANMNAQVGLTAPGIIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFM
FT                   PDHPSAELDGATPAGGETPFGVVSAAPYGSALILPISFAYISMMGSEGLTNASKRAILN
FT                   ANYMKKRLEDHFPILFTGKNGTCAHEFIIDLRPMTDKTGIGPEDVAKRLQDYGYHAPTM
FT                   SWPVSGTLMIEPTESESKQELDRFCNAMIAIREEIRDIENGAIDKENNPLKHAPHTAAV
FT                   VLSDKWDRPYSRETAAFPAEWVRQSKFWPTTSRIDNVYGDRNLVTTHAQVEVAAEETA"
FT   CDS_pept        259408..261852
FT                   /codon_start=1
FT                   /gene_family="HOG000251916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631201"
FT                   /gene_name="PUL1"
FT                   /orf_name="MICPUN_97635"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="cation binding"
FT                   /function="pullulanase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO64736.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0051060"
FT                   /db_xref="HOGENOM:HBG449693"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199ADC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T8"
FT                   /transl_table=1
FT                   /translation="MLKCQLAVTAHDADGRLRDATSVQSHGALDDVFGGYEGELGCVVD
FT                   GAAGNVRVSLWAPNARRVTLLLHRGPRGGDDECVRVEMREGERDGVWRASVGAEWVGGY
FT                   YRYEIETYHPWGGGAPDGGLGSIVTSVVTDPYSRSLSADGERTHVCDVRNAPELKPAGW
FT                   DSLRKPKPPGGGDVFEPTDMAIYELHVRDFSALDESTPAHARGKYVAFTCEGTTPVRHL
FT                   EKLAKAGLTHVHLLPSYDFGSVPERVENQANVDHGWLASLPSNSDEQQAAISSIANDDA
FT                   FNWGYDPVHYGVPEGSYATDPDGGARIVEYRAMVAGLAKMGLRTVCDVVYNHTLSAGPH
FT                   DGRSVLDKCVPGYYHRRNLDGFYENSTCCNNTASENSMMERLIVDDLVHWAVDYKIDGF
FT                   RFDLMGHIMLRTILRARDALAALTVEKEGVDGRSIYLYGEGWDYAEVERNRVGKNASQL
FT                   NLAGTGVGSFNDRLREGIMGGSPFGDPRVQGVLTGLYFAPNGFIDQGTADNQRNRVMED
FT                   CEKVIAAMAGNLKEYRFVNRKGFSTPGKDAAWVGSNVGYAAEPRETVNYVSAHDNETLF
FT                   DGIMLRSAPDVPLAVRCRLNRIAVAVVAFSQGVPFFHAGDEILRSKSLDRDSYNSGDWF
FT                   NRLDYTGETHNFGIGLPGRDKNGDRYGYIGHLLGDLSLRPGVDEISRSDAHMRECLAIR
FT                   RSSPLFRLRTAADVDRRVTFYNVGPTQEPGVIAMMVRDAPGGHPEQLCERFQKVLVCVN
FT                   VTGHAVTVKDEQLGLDIYGCSLETHPLQGMVCPDEYLASATCVGGAPTVPPHSVVVFVE
FT                   RR"
FT   CDS_pept        261987..263993
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631202"
FT                   /orf_name="MICPUN_59837"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64737.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG675854"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199AE85"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9T9"
FT                   /transl_table=1
FT                   /translation="MRCAAVSRAPLTAARITPGPRERRSRGRCARVSAARWVDVPSGPG
FT                   TRRSLVGHTHACHAPSRPGRLNQRSLGGSAASRRATSNPHRSRRPSARRFHRTRASGDT
FT                   DGEAVSTSRAKDDDGARESDEGSLDAAIFALALPAVASLLLDPVLGVVDTAFVGRIRGE
FT                   GAAEALGGLAVATAVFNFSFKLFNFLAEVTGPLVASQIAAAEAEATALDDAGTTTTNTT
FT                   TNTTTTTRAEAAETVRGAMTLAVALGIFACVGLELGADSVLRWSGADGVSSGVANSGVD
FT                   GGNMLRQAEAYLRVRALSAPAALIGTVAVGAYRGLLDTKTPLLVSGAANAVNLVMDPVL
FT                   IFGFGPVPAFGVAGAAAATTTAEWIAAVVFWKMLVDEGLLPGMDGETRRRDQSQSQSTT
FT                   EISGTLKGRTNDTGATDNLIGSPGSSIAGWFGALKPLAAGSASQLVRTLILQAVLLRAT
FT                   AEAAGAGAAAPHQICVQVWWVTLFALDALAVAAQSLVASSLGAGDMVSARQAADRCLRW
FT                   ALATGTAVGVGIYAAGPALPGVFTEDPSLIESTRGPLALVASLQPLNAAVFVGDGVLQG
FT                   AADFDYLAMAMAASAAPAIVMLGAVGVGAETGVAQGAAAEVVSATALQGVWRAMAALQL
FT                   GRAGTLSWRYWFDGRSPVASRERADEAGKENGE"
FT   CDS_pept        join(264104..264407,264484..265385)
FT                   /codon_start=1
FT                   /gene_family="HOG000223772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631203"
FT                   /orf_name="MICPUN_59838"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64738.1"
FT                   /db_xref="HOGENOM:HBG296084"
FT                   /db_xref="InterPro:IPR014086"
FT                   /db_xref="UniParc:UPI000199AE86"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U0"
FT                   /transl_table=1
FT                   /translation="MVLDKPVAVVAVVDTAHPGDTGPLERWMDANPLADILCVLGKTEG
FT                   NGCVNDFTRGYATSAIQAALGRVRSRRMGATANDDERNRQSSFTADPAIIMSGGTEGVL
FT                   CPHFIVFANSWDEADADENHDDDDDDDAAFELHVTRTRDFKPEEVGTPVMARATRRAIE
FT                   EYLGYGGNAPNWDDMFVQIKCPLLTPERIAEAAARGETCATTDCYESMALSRGASSLGA
FT                   MVAVESALGRYSAPDDARVDDAVYAKTCEDYSVFSDHVSSSAGVELMHCEILMMLTRRR
FT                   EPSSKTPRSKFRMARGRMDDAIDLAGVTRCVDAARGSRGTNTIVTAIVKADPAASVRGR
FT                   RTTMLSDSDIHATRHARAAVGGVVAAAVGDCRVYVSGGAEHQGPDGGGPVCVISRVGGA
FT                   RG"
FT   CDS_pept        266224..267507
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631204"
FT                   /orf_name="MICPUN_50884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64739.1"
FT                   /db_xref="UniParc:UPI000199AE87"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U1"
FT                   /transl_table=1
FT                   /translation="MEMERMMALSAYQGQGEFELEPADGNPSQSGRPQLGRNNDRPVSQ
FT                   TGIGGGPPNPARAAAATESPAVVLMRVNCRLTLLLREMVFIERGLRPVTEVVSQTEQDE
FT                   EDAELLAEAEEELERMKREAAGEDVVEYVNNSIDDSNSIEADDEDDDEYSSGILDPQTA
FT                   PQLALEWCRVRRTRARNVAARALTAYVSALTSHPVGLRAFAAAVVDGYVAGIPARDVTA
FT                   SLAPEEFDVEGSRRGMFGSAADATRFFSLFVTTAYVVAEQDACEQDADECRNGFDPDGY
FT                   AWAPAPGEFRSKGGGNVDANARRTVAGMRSSVKAWMEMDRAELRAQVASQLSMDEDDGG
FT                   MAGDPSGAGAGLTGAMIKPAGNTPPGDLPWERDEHLPGNSITVACLTLQRMVVSFTLRE
FT                   LARRREAYVARGSDFDNKPEYGNDFGGA"
FT   CDS_pept        complement(267628..269055)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631205"
FT                   /orf_name="MICPUN_59840"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65093.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG608075"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="UniParc:UPI000199AE88"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U2"
FT                   /transl_table=1
FT                   /translation="MIPATRPAPTPTRALDTRAHRSERAPSRRRLVRAVAAARSDREAD
FT                   ESPKLDRPCASSRRDVLVRGFTSALILPRSRAALADDLFCGYYSQNSAVVPQWARETPW
FT                   SEGYVDTSAAVGLEGAKTFVRILGDQKKAESAGLTPVLCLHGGPGLGFKYMDGLEVLAS
FT                   EKREVASYDQIGCARSPYAPTKKNQNQNQIQTAAAALSPPPGTYTPALFGRELTEVRRA
FT                   TGLGRVHVVAHGWGGMLALDHILGGNGVDGGAAIGGSSPSMSIASLTLVSVPPSYARLI
FT                   ADRREALARMPGEYAQVLLDGDEGGAGGGNLSDAGRKLYAIALDEWTRLFVSKRAAGAC
FT                   YRGLKTAGAGGGFGARANDPPDAVGVVSARAVARDMTGGCLFNEAGALSGWDADDGGRL
FT                   AMLAAAVPGGVRFVRGTDDALSDEGAREVYDAVARVEMKPTNVTFESFPDSGSCVHLDK
FT                   SADFLESTAAYVAARDA"
FT   CDS_pept        269357..270994
FT                   /codon_start=1
FT                   /gene_family="HOG000100098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631206"
FT                   /orf_name="MICPUN_50885"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO64740.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG561821"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199AE89"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U3"
FT                   /transl_table=1
FT                   /translation="MAASSPSSSPLPGGGDDARGDTYDEQLAIVRALKSSGAGAERMRV
FT                   ATARLAELKRAGWVPRFTPSRKFAMHSTAAGGSGATGDDAHRDGDDTTAVGEKKRKASR
FT                   RGGPTVTCPACRQLVKASHPDQFREHLRKCAPDAVSAVAKDQWRDVAAAVDAVEAHEAT
FT                   LLEDARRLSFRDGRTREEVAIALGVSPDRVRSTLRRASRAVPLVADPTPLDVIHEDDDV
FT                   LVVNKPPGLRFHPVHRFEGNSLLSRAIGHVRRSGRDDDRLDGDAAGDGHAHVPHVVHRL
FT                   DMDTSGVCVLVKRPELVDGFARQFRGDAGERRAVKEYLAIGVGAAPPGVTGCVVKADWK
FT                   PPEASGNEQTTAAEFIGVEFTVDAHVGPHASIPEARAVHRPPPTPERIPKRNGSGGDPD
FT                   APKPARTDVRIVSSSRVPIDVNDDGDVMQSLTAVLARVRLHTGRTHQIRVHMAHADLPI
FT                   LSDPLYGPHIRWDGASPCADASTSAILPPGVDADVWGGPRWLGRQALHAARLTLRHPET
FT                   NEEMTFEARAPEDMRGACVALGLDPDAW"
FT   CDS_pept        271200..271925
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631207"
FT                   /orf_name="MICPUN_50886"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64741.1"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199AE8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U4"
FT                   /transl_table=1
FT                   /translation="MPALASPAPLLARAPPRARRHARLARCTASGESTSASVRVFKGGS
FT                   AEVLFGAKQNLLGCIERGDDDGVELALKELAGLNPTPAPARSEKLLGSWQLAWSRQASS
FT                   SNPFQRAFAKWSTKNLQILTADGLENYIELGPMTVSARAPIRAVSDERTEVSISTIDIA
FT                   LFGNVVKTMEMTPKPGRGAGWVEQTFLDDEMRISVGNKGSVFVHVREGERDGDGDGDGD
FT                   GDGAAESTSGGESTALARR"
FT   CDS_pept        complement(272071..272850)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631208"
FT                   /orf_name="MICPUN_59843"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65094.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG710425"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199AE8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U5"
FT                   /transl_table=1
FT                   /translation="MFALAASPAAARVQPRASIDQRRIVPSTISIRGSLPRANRAASLR
FT                   APRAAERDPTQPETPPPAPPPPSPPEDPASGGKALAGAGFALGVALFAATSLGGAPTLA
FT                   SLERDAIPLDAALANGRPTVVEFYADWCEVCKESAPNVYDVEREFGERVNFVMLNIDNT
FT                   KWGGEMDQYGVDGIPHIVFLDKRGKSEGQVVGRFPKQALRANVQALSVGETKLPFAKLE
FT                   DGDATPVQSSGIADAPGSAVDDPRGGAVSSADPRFHG"
FT   CDS_pept        273304..273888
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631209"
FT                   /orf_name="MICPUN_101342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64742.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199AE8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U6"
FT                   /transl_table=1
FT                   /translation="MERSESEEEQKDATKKGVKRKRAPRTKGPCDHGVKPRSNCKVCSG
FT                   CPHGKWRRFCKECGGSQVCEHGRQRSHCKECGGSAICVHARERSKCKECGGGGICVHGR
FT                   RRSVCKECGGGSICEHARIRFYCKECGGSQICQHGRVRSYCKECGGASICVHARERSKC
FT                   KECGGGSICEHDRVRSSCKECKRNRSTPPQR"
FT   CDS_pept        join(complement(279742..279805),complement(279456..279583),
FT                   complement(274070..279316))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631210"
FT                   /orf_name="MICPUN_59845"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of nuclear pore "
FT                   /biological_process="nucleocytoplasmic transport "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO65095.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006913"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG561824"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="UniParc:UPI000199AE8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U7"
FT                   /transl_table=1
FT                   /translation="MYAPQDVGLVARPIEGGEVQSSAAEQMQDAARLVTNLQTESDGVD
FT                   LVTLLRETPREAYSFQQLGWPSEIAATRTSELPAVVLERYSTRQSVCFCGVLPEINRAW
FT                   ATVDNALFLWRLDRPDDVPVEYSGEEQAIVAVGLAKPKQGVFLRTIDYVLAVATTVEVV
FT                   LVGCAFGDGREGSTLDDELTLHALNYSCTTDDVVAKDIASTDGGRIFFAGDDEALYEIE
FT                   YSSSDTWRQRRCRKVCHHSALPRMLPSILRLRAPDPLRQVLVDEHRCALYTRSESGVVS
FT                   VFDLGANCADPPRKVAEVRDVAAAAQMARGGGGLFNQYGGYGGGGSYGVGGGSYGGGGY
FT                   GGAYGGGAQAQKDGQSQAQKGRRLAHISVVSPSESSVVTLVAVCADGRRVYFTTLPAEG
FT                   SRALGYGGSSYGSQNGSGTRRGGGVKEHRSVPAACRLAVVQSREPLPQGSAQRGMSSAQ
FT                   ALRATTTVRPLEVEAAFYRDGLMLLCDAADRDEDARLFMASRDLALPPHLQMDAHPIGQ
FT                   VGGSPAPSIHGGLHSPSARRDGGLGSDLDRGNPYGSPLNIGRGGGNGGVPQGGGTHGLM
FT                   ASPGSMASGGAYQGVGAGAQSASAIRSLREIVTPQPLQGRAASAVGSVGEVPPPLGVLR
FT                   DLDPPYPPGAPRELSSRPAPLRSELATQHVAPRRKFVVVTNAGVVTVEKSRPLDALAKI
FT                   LASDVHESLVHFFKSYGQAEAATMCLAVAVGALGSGASDLDRQQHQAGHHNGGTPGGTP
FT                   GGRVEFGGSPRVPPSVLGTPQGAFGGGAGAGVDGYGGSLFHGAGLADRARRALEDPRLT
FT                   GEPRVDEDLNGFGVDAAGGGGQFDMGRAIVQPQLHYSGVHRALYTYAARLLAPTWERPL
FT                   WVAVTHPNKNDSSGGVRGMGKNGGKNGVAPNQPPGKGLGLGLGPNQPPLRDAVVAGAAD
FT                   GGGVAGAAAAAAGWLGGILRPDPTAAAPVACTIPADVLASLERRLAPLEEFLSRRRPRV
FT                   APSERSRRAQNGSHLLGPPARQRRRIDGPAGALRAEERSIAALRGLVRRAREAAALLRC
FT                   LHEEDFERDVGAWLGVEIRQHMCGLTLRSFVSTPEGAATASRLVEALMARRTRADSSSL
FT                   DALATKLQAAAPLFFDGDARTFYRARELLQGARDARDARDFRACAETTAASLEMLLGVP
FT                   LAGDPTAVMAELADLRCFHGLAALPLAAAAAAADAAAAGDGVGSLGAMDAGGPVNASPR
FT                   TFGATNSGVHSGALDGSLGNIMRNGANGATDPEECFEYVCVAIRALATGVADPGSPPGS
FT                   LGAVCASLPPDERASGLAALLKRCAQASSPAAASAAAAAVKAAAANAAAAAAAAAAASP
FT                   QARQTHGALIAPSPSVAAVAAATPAEVAGASAAGDGAFIRRVYAELVALGRDEDLLELP
FT                   AGPLEQHLAERGAFETARQGGALTRDESRHLELLARLYARRERHGLAAQVFFALAERVA
FT                   GADCAVSLDERAALLDLALRHAKSPGAHAELAGGAADAQVETLEGKIKVLEFQRRLHAT
FT                   FSERARRGGADADRDARLAAELERELRPLSDMYNDFAKPCDMHDVCLEMLHFSRYRDAD
FT                   GAVARGLWDALLSSAASSVRVSSPQDDRAALFAACNAARALGPKLFPSDVAFPVAHVAL
FT                   KLELMAGGLWGGVNAAVVGSEDVGAVADAMLAATGDSPEAIHAAYDSLLATPASRAQHG
FT                   SIRLVQSEQLQTPALRLRLLRSALRVLRRWDEKIRSDAGLAGGFGGGGAGNGAANGGGF
FT                   GAFGAGQGAHVRAALGDVCVGYAGEARRLLQVPTSAQGAAEALAEEFDALGKRLIG"
FT   CDS_pept        join(280304..280329,280462..280595,280758..280999)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631211"
FT                   /orf_name="MICPUN_59846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64743.1"
FT                   /db_xref="UniParc:UPI000199AE8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U8"
FT                   /transl_table=1
FT                   /translation="MSLANIGQDRELPKTGKAIFHSQEGNSVKNMLYGGYDADPSPPTL
FT                   PSGRKAFHGNQRTALPFATYDENENVHGNQYRSPRLHKKNSKFDVGAAKVGAGNHDAVS
FT                   QQYEYERMQAQAAAMKARNQYGDGNIFGQ"
FT   CDS_pept        complement(281371..282714)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631212"
FT                   /orf_name="MICPUN_59847"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65096.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG561826"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AE8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9U9"
FT                   /transl_table=1
FT                   /translation="MATPQGNDTVYVAGLPDTVSERDIAAHFGSIGQLKQDKKRRCEKI
FT                   WLYRDRDTGLPKGDATVSYMDPHAAEAAVNWFNNTQFMGRTLSVSLAERKGGGESLNLP
FT                   ASHFADPLGRNANADNAAHPDPTSAPNDDDDDAHARGNAAHAPGAPKETRDGDWPCPNP
FT                   ACGNVNFAFRGRCHRCAEPRPGGGTAGSGGGGTAGVVPPGRKQPVPKQGRDGDWPCPNA
FT                   SCGNVNFAYRGQCNRCGAARPPGAGAGGVGKNDKPNGIFGPDDWTCSNCFNVNWARRAK
FT                   CNECGAPKEGKAKEKREGRGGGHKEIDDEDERRETERRRRENEEREIYDDFGNLKKQFR
FT                   ASAANDRGRDRDRDRDRDRDRDRDRDRDRDRDRGRDHPYRRDDRDRDRRRDRSRSRDRG
FT                   RDGRDRSRDRGGDRRRRSRSRSKSPPRESSKPDLKTDWRGNPIKSTRY"
FT   CDS_pept        282928..284187
FT                   /codon_start=1
FT                   /gene_family="HOG000237274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631213"
FT                   /orf_name="MICPUN_59848"
FT                   /product="Predicted protein"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64744.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG590734"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniParc:UPI000199AE90"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V0"
FT                   /transl_table=1
FT                   /translation="MSAPADDDGDAVHGVDRLPGDAENAARAMDEIVADSDEDGGDTDE
FT                   DVPDQPEDDYESDGDDQEWALGFCERAPAETLQRQFFPSKVGGRPAWLDPVDVPTAAQL
FT                   KCLYTREPLDFLLQVYASVDDEPTAFHRAVFLFVSPHGGDLHRPGAVRAFRSQLPRINP
FT                   FYPDEPCEQGDPLQELTDAQHAAYELRHDRWSDDALRGAIAHRPRMFPERELVVEPEEF
FT                   LEDDEVTASIAGAENAARVAAAMTPAEEGSDEWKEQVRRARESLPEALRGVGDDVSEAE
FT                   VRSLERAQDKNQVRLSQFHLRLRRTDPTQVLRYCFDEGAKPLWPSVSDAPEQNERTVPP
FT                   CPRCGSPRRFEFQVLPTIVNHLDVDSELNSAVDFGSIAVYTCARSCAPPTHDGTRGVAA
FT                   DGKSEAYAEECVLVHPPLNA"
FT   CDS_pept        join(complement(286699..286832),c
FT                   omplement(<286288..286549))
FT                   /codon_start=1
FT                   /gene_family="HOG000238704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631214"
FT                   /orf_name="MICPUN_83790"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65097.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG750380"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199AE91"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V1"
FT                   /transl_table=1
FT                   /translation="MLGESEPSSPYGTREVPQKRYLKTKGGGLKIKGGWTPEEDAHLLR
FT                   LVEEHGTKEWSKIARLLHMRAGKQCRERWHNHLQPNIKRGPWTEEEERALIAAHEKLGN
FT                   RWADIAAEIPGRTENAVKNHWNATNRRR"
FT   CDS_pept        join(complement(302929..303072),complement(287983..302760))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631215"
FT                   /orf_name="MICPUN_59850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65098.1"
FT                   /db_xref="HOGENOM:HBG561827"
FT                   /db_xref="InterPro:IPR001298"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniParc:UPI000199D584"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V2"
FT                   /transl_table=1
FT                   /translation="MVLGMLRSVAGWKADKYRFDVTVHNAYNVLPGTKALQVVWKRGNK
FT                   HAQTQTTRSQRGEAQWEEQLSLACTMFVNPKSGTYEPKPALFVLREIDDDGTGAGRTYA
FT                   EATVDLLEFAMRPGAAIRRTLPLTRGATQLSTHLIFTIRATPLTEGVALSDVSSDVSVA
FT                   DLADVAEGAVEGAIEDEDATRPYRAHREAARVRAESDRPHATEEEDRVAQNEDGPPRGG
FT                   ARTMEEGMRALRTALEPSDREDENAPARPMGREMEIAPTGGRSRAATLQPQSGRYAPPV
FT                   LYDDEVFRDAGYTVGLTKARDPLLDATAGGAFDGLVPGIDHLRLIVGRTCKINVRANDA
FT                   FGNARSTGGDAVEGLLLGPLGEEGEVKVRDHGDGTYGLEFVCTSQGVWRLRLRFNGRAS
FT                   ASEHELVVSYGPLVAGDLSVKPPKPPFVCGAYTDVVVEVAEPELGRVMTGAEAFSVRVV
FT                   SPSAMSMSVPLELAPGSTRAVATVCWPEVGAHVLSVTLDGVNLPRSPMNVDVAPEDICL
FT                   AACQIQGAGTHRAVAGERASFVVEAHDARGNRLVSGEAPLSVIVRTLRGNQGGNPVNGE
FT                   KREEDVTRGQILDYGNGAYEASYVVRTAGPYEVALVLMGEELVMKGTCEPGPAVVPGCV
FT                   LLGDAVLDLEVGAKGVFTIERRDAYGNVAPSRQGQVKLRCVADGPGDVDAHVVDCAEGR
FT                   SEVYAVAKVAGRYFITVVGGDDQVPVPGSPFELVAYPGAAAASASVTSVYGAQLASPDA
FT                   DVLAAVAGDEITLTVSPRDKFGNKTVFGPGTKVKVCAVVDGDERLEFEDRGGPRAEATL
FT                   RGALTAAGSYLLRATIGDEPLAGYPRILQIVPGATDPRRCVLFGDALAGVDCGAQSSLT
FT                   MHAADRFGNLRATGGDVVDLSMLAPDGKTVVAASVSDHADGTYGAAFKLDQAGAWGLQL
FT                   IVNGRGGRTDVAEVTANFGPCRAQDCTFAGFGMDGLEGVTTLSSSQIRVFPIAYESANR
FT                   RMSGKESLSVRVLTPSGGISAVDLRFDRGQYFGTYRWTQPGLHTVSVSLEQEAVVGSPF
FT                   TVEALAALPEIRELENMSVGDINAILVKMTPDASSQALASLPPEQAAEALAGHSGAAAA
FT                   RMMNGMFPSATAQVLSGMPAAAAAAAVGAMSEEKVADVLGAMAPADGAKLMAATSPEET
FT                   AAKADVFASALGRMSDEESAAALRAMAAASAEAGSADGVAAVMNKMPPAAVANALASMS
FT                   PEDNVRLVGAMGADEAAAAIGAMDDARVGEVLSAMGAEELAGLTDGLGAAYEDDKRLPA
FT                   AERQKMRDAAAERAKQLAPALASVPPAKLADSLKDADPSQIAGTLNALVHEGKAAPNLL
FT                   RAMPKAAQKKATARMLESCPEGTAGAILGDFTGDECAALMAGLSPDEHAKALAELCREN
FT                   PKAACAMLGAMSPEEASRAMSLVVDAANNGTGRVRLSDAQRTDLFKCCPPDVLKGVQPA
FT                   TALGSMCASTMSASEAAAVLGKLEPNAAAACLEGMSGEEVRQVLEASAVNGNRDTPLVA
FT                   AMVPYMASLDAAGAAAMIEALPPDMAVGVMMNTPDDRAREVLAHTKNRSLKERVANRAT
FT                   MALEACDVDLRDESGANFRAIAGERFTFKVISRESGGTRINHGGAHLTAIIHPPGVPGK
FT                   SRKVTGHASADQCQVLDLGNGVYEVTGVSTVSGKCAVALQSGSQQRDVAVFVEAAEPMV
FT                   AATTFDRSGLDQWRAGEPGVLKLILRDRYNNEVRPSGALFTFEGRASGPGGVAVEQRAS
FT                   LDENGVLFEFKSTVAGIYKVGVVCVDTGELIPGLPIDATLSAGKISHVGCTALLQTITG
FT                   AGKGPGASASAFGVAVAMAGEEITALVDARDRFGNATAWSGESATVVAHGPADDPVDRS
FT                   FDVVDVRGGRAGLRGVLPRAGSYTVAVCVDDIPCACSPLVLHVYPGPCETSRATIRGDA
FT                   LSGVLRGAPATVVVQTEDKFGNNCHGGGDQVDLVLQGPTGSRASAVDVVDHGDGSYGCV
FT                   FVCPMAGRWIVQAVVNGRVAKESTQEVIATYGPLRANDCVLRAGPGMGERVTCGSTRDV
FT                   YLQALEYDSTGRGMSGQEAVSVHLVTPSGASHTLTAGFAERGSRYRAAVRWWEIGRHEI
FT                   VATINGEPVVGSPLVVEVDAQEVSLPMCRLSGAGLAGAVAGERAMILVEARDARGNRLF
FT                   QGGAVIGVAVRVGGETLRGRVHDCGDGTYEASYVVEKAGPFEVSLFLGTEATTFRATCE
FT                   AGRVDYTRCRVDGALHNRWIAGTPLAMTVTRMDRFGNRVPRREGLASLAGHGTGPGDVT
FT                   CETLELGNGSCELRYAASVAGVYSLGVFVDEEPVAFVDTEERSETLGGDRRGGAGSATN
FT                   LGSSLAPGEKNLEKQSGSLARMEPTRIGGLFGGRTMFPLPGGVFDLTLESGVAEPTMCD
FT                   VAVVGAGKQGDTWVVAAGDEILVKVIARDRFGNQTHWNDGQSVGVEARGPEYIAFSVTG
FT                   AAGVKADYLARMVRAGTFELRVMVDSLAVCWRAVQVVAGPTFAPRCKISMEGLQGLRTG
FT                   DTCRLTLKAADQYGNLRLDGDDAVQLALEGPGGFAARAVSVVDHHDGTYALEFITPVAG
FT                   RWNLGCRVNGKPCVEGGVSFVVAFGTLTAEEAVVRLSPTAEETGGVYECGQTAELIIAG
FT                   QNFESSGRLMTGLEAVTVRLRHPSGAQEALPVVLAKDMTHYAAPIRWLHPGDHAVSVLL
FT                   DGVQVAGTPLRARAEGMEVSLSSCTFVGDGRERCIAGERATFKMEAKDYSGNRIHRGGA
FT                   PLLIETRVPGEDPAPGDVVDVGDGTYELSYVVEKAGAMEVAVILAKQSPTVRALPVTCL
FT                   AGPMEPSECRVDAGKLTLHWPAGEPGVCRVTRRDRFGNQTRDAGVLNRLAAEVTGPGPC
FT                   DCEAVELGDGTCELRLRAAAAGSYDVSVIALAVPGPGGPVEVGHFQAEVTSGPTFPSAC
FT                   VARMALLVNDPSDPTGGGLVEESLGEPDGDITLPATVMAGDRILVYVLPRDSSGNKTRW
FT                   SGGERIAVSARGPAETTFDPLDAVGAFAATLQTSGAYSVAALVGDCSAAGWPRVLQVVA
FT                   GPCDPDRCVLSGDALGACATGRKLSLQLQASDRYGNPRSMGGDMVEVFAKPRDSRGGGR
FT                   VEAEVVDNADGTYAVALVLEEAAIHDVHVNVNGLSDSRSRYFLAPTLAPLTAADCTVRG
FT                   VAGDEPSLCDVTSLYVQPANPIREMSGREAVVVTVHTPSGLAFNNPVKFEKGNRRFASP
FT                   VYWVEPGAHSVAVTLSGKTLPGCPFLVEVRDPHGEELDAMGKPGKPGQSGKSKTGKSGM
FT                   GGKGDDANDGDEDTAAGAAAAAAAAAAAAAAAADPDADKRFAFGGGGLKPSKAASERAA
FT                   RSLAGMSSKVAAQAISDMRPAAAGAVMASMEVSAAAAAAEAMEPALAAAAMCSMEVHEA
FT                   IACIVEMPKESRKAILESMTPEQLGALLSAMTPEDASDIIRILDTKWSILAVDNMVPGP
FT                   AAAAMQMLPEERLVEVLVGISPKKAGAPLLEALEETEPGHRLAADAVTTLTNRHADRAA
FT                   AHIAAMVDVAMAGTERGVPGSGYAVARLFSDLPLTCQGLTIIRMTAKQAAYLMSWLGAD
FT                   GAAKAAAAAAKAAGANGAGFCAAAAEELDAMGFASDDEKASSGAAAGKGAGAGKGAVAG
FT                   KGKSGRGAAASLLAAMAKDDPDAASQALGALDSSLAAAALSQLGPQAAADLASGVSDPT
FT                   VGAALLEQMPVEKRAAMMVRMEPAAAAAAAGAMHPEAAAEAMEAVQASAAAAAAASGGE
FT                   SGGGEVAKRLAAMVSQMDPFAAAQACSAMSKEAAAAMTASLPPDRAGAIIASGGIPAED
FT                   AGSMLDALPLDAADKVMAALPPDIADKAAAHVTSDEIRERAAARAVVHLPSSTLEGDGA
FT                   ERCVAGVEASFRLESANPGGGRIGRGGAIISCVMHALEPAEFDTDADDDTAGESGATKM
FT                   TTRKRLGFPFPVEAQCEDLGDGTYEFYYELQRAGEYQCSLQTAGHEHCFYVLCVPGPLD
FT                   PNSCTVEEPAFVGLDRWTAGVPLEVRVNCHDMFGNPIKPPGSASNGSNPALNPLVIVAD
FT                   GEGPGMVEAEVVADESDPNATWQIARFRATECGEYELRVFATETQRQWWGGMPRNNLPG
FT                   APLRLTLTPAPADPARSVVKLSGLKERPGGMLVGMAGRDASVTVTAVDKYDNPAEFGDL
FT                   KLRVDAMGPADVTFRKESDDGSSCRFFGSPERSGSYTLRVTLAGRTVAGFPRNLQVVAA
FT                   RTDPTRCVVRGDALEGIRVGESAKASVVAHDSFGNSCLEGGDQVMVRLLGPAGSVDADV
FT                   VDYGDGTYGLSFSVPRAGTWRAHLAVNGGENPRPVAEFVASQGVLAANQVALRTVHAGD
FT                   DDFNGVRGNLGNSAGNSQPPRAGTETIVHVQALDYDVSGREVSGAEPVCLRMLSPSGVS
FT                   ANVPLRLAKDGARFHARVRWPEVGRHVLVASINGDAVVGSPTHVDVVAADVHLPSCKVT
FT                   GPGCTGCVAGERTRFVVEARDSRGNRLCAGGASLSLRVQTPGSEPTRGSVLDQGDGTYA
FT                   ASYAVDKAGPYVLVLSASAGGSRLALEGVCAPGATDVTKCIVDASGLAQLTAGSRGVVK
FT                   IVRRDKFGNAVEAGPDMLPFRVEATGVGPVAVETVESGDGGCEIRFEAKVAGRYALHVW
FT                   SGYKRDAVAGSPFDVVVLPGQASASSCVAQLVGTHTHAVGGPGVVAAVAGETLSVRMQA
FT                   RDRFGNATAWKRWQTLSVAASGPQDVVFKERLEDNGVLDEDANGVRQLSTAVGDMAASG
FT                   RGVFSAVLHRAGAYVVWCTVGGQAVVGWPRVIQVVPNTAAADASEWRAEAETMALTSEI
FT                   ASNAPFDRSTGVVSNTRDTRRGAFGEAARARAEADSLRARLAKYEEAAAVVMEAAEATG
FT                   ITLKQHARAAAMAKEARIREVGDVEVSDTVGGGATGGAASEAFDARATRQLGIRELTAE
FT                   EENDWTAGTPRQRGGRRSGGATTRAPDADRL"
FT   CDS_pept        303560..304237
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631216"
FT                   /orf_name="MICPUN_50887"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64745.1"
FT                   /db_xref="UniParc:UPI000199AF39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V3"
FT                   /transl_table=1
FT                   /translation="MTHPVKDAASGLLRLTGTVLRGAGKITAGVVDAALVCSAVGALRR
FT                   SKMRGVVKAAVKSAQKAVGEMIENIMRAKSDGKDCDSLGEVLVKCFIVIPVMTPVFVVV
FT                   GNMAFVCELGAGTMAVAGPPGLVAFAGMRYLRSKDSPLGRREVNKLDKLMTLARLVGIA
FT                   APCAVLFDGKGMNRLFDEVAAEIDEEEREEARRAREEEARERESEEERGESGARGEGAE
FT                   AAV"
FT   CDS_pept        join(complement(304967..305008),complement(304769..304863),
FT                   complement(304417..304642))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631217"
FT                   /orf_name="MICPUN_59852"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65099.1"
FT                   /db_xref="UniParc:UPI000199AF3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V4"
FT                   /transl_table=1
FT                   /translation="MDAQTTLKICGVANGVYAAQMLGAPQWANDFYFKEGHKSNKNWQN
FT                   WFGLAIAGQATAQILASNESAPNKAVLGATVINNVAATLLMLKQKDDFKPEQLAINGAF
FT                   VAGLGALAFKAYNDSK"
FT   CDS_pept        305291..306376
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631218"
FT                   /orf_name="MICPUN_101350"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64746.1"
FT                   /db_xref="UniParc:UPI000199AF3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V5"
FT                   /transl_table=1
FT                   /translation="MACRPGKPPAIALSRPGVLRVARGALARAGWYFWGVPAAWSLEAH
FT                   ERDFARWGSEVLDESPVTARDLVETMDDDVFGARFDALYDALQAAGAARMKHAKRGASF
FT                   GDHLVEVARWLRIFRGEECSLVLAGLGHTCYGSELFPAPLASLTDRVDVRRTLGADTER
FT                   LMFLYATTSQARWYREVLRCNRRGLQHFGEDRETRPNAGRYRHEASWPIAVNFYTGETC
FT                   RLHGAECAALTLMHAADIYSVLARPVKSNPNVHGGGRYDGRRQSEARALVLFMVQEAEE
FT                   MVRALAESPEMSHRANTRHHLMCRELSERLGRWRADEVNGWRRDFGFDDGDWRHLRNAL
FT                   ERLRARKLDASFVGHATGALR"
FT   CDS_pept        complement(306470..308140)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631219"
FT                   /orf_name="MICPUN_101351"
FT                   /product="Predicted protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65100.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG599263"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniParc:UPI000199AF3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V6"
FT                   /transl_table=1
FT                   /translation="MVFMGVRGVWAALWCVLVLAARVDATSRGSLAPVTHRRLADDESA
FT                   KATGGDAKGSWSEWRYRSNEELANAMDALHAGPCAGISKLTTIGTSVRGVEMRAMEVST
FT                   QPGVEQTKPGIMLVGNMHGDEPVGRELIIRFARLLCIAHERRQRSAGGDGTGEGEGGLD
FT                   KDPLDEASAKLLDEAAVVARRARVFLVPTMNPDGFSAKRRNNAASVDLNRDFPDQFNEP
FT                   GLPARFDARQPETAAMMRFSEGVNATAALNFHEGALVANYPYDAISGSNRKAGYSKSPD
FT                   DAAFRRLAKVYARAHPTMATAANEEFPEGITNGARWYPLWGGMQDWHYLKTQTMDVTVE
FT                   VNERKWPDESSLVRLWTEHAPAMIAYATAVATTSTTGKVTDSLTGEPVRGAVLAVAGVD
FT                   GVRFTPSTRTGYYARFLPPGRHEVTASAPGYYPQTRTADAGARLDISLRRMEDAADADD
FT                   VAGDGDHGAAAVVGNGDARPGPNPKPGSAGFGGDTAGGAVVGLGGGDTAGGELVRVGEL
FT                   AAAVAAAVAWLAWRWRRRKRARLAALREGTQLSGVRIDG"
FT   CDS_pept        <310190..>311131
FT                   /codon_start=1
FT                   /gene_family="HOG000008150" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631220"
FT                   /orf_name="MICPUN_67779"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64747.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG746318"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AF3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V7"
FT                   /transl_table=1
FT                   /translation="KVAEEKKKSRPRVRENSEMVVVRGVKYLKLECVGQGGTCKVYKVL
FT                   CPKRKTYALKRIRLQGREKETIAGFMDEIRLLQSLRGKDNIIQLVDAEVCKTEGLIYVV
FT                   LEYGEIDLARLLSKREKQARAKGKGGANGQSNAGMIDDNFLRLYFEQMVEAVGTIHELK
FT                   IVHSDLKPANFLFVEGALKLIDFGIAKQDTSKTDTTNIVRDHQVGTVNYMSPEAILNGQ
FT                   PSALGGPLKVGRASDIWSLGCILYQMVYGQTPFARITGMIPKLHAITDPKHEIPMPPVA
FT                   NPHLTALISACLERHPHRRITIAEILKHPFLRP"
FT   CDS_pept        complement(311608..312267)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631221"
FT                   /orf_name="MICPUN_59856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65101.1"
FT                   /db_xref="UniParc:UPI000199AF3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V8"
FT                   /transl_table=1
FT                   /translation="MVWTTFWRGEMSLAARVVALVPTRSRAARPNATRHRRDIVVMASA
FT                   TSTDASFVGRWTRDGSRSVNAEAYLASHGLDVAKAAERAAAPYEQEWRETGAEEGEFLV
FT                   LTDPGTGRGVRSLVYPIGEWEEEFKGSSELFGAEPGVVYRNTTYNEIPHLGPVHLTESA
FT                   TPLGWETTQRTLSKDGNEMVVDRSFTPRMPDGSAGEKISSKEYFTRVMVFRPLDAS"
FT   CDS_pept        join(312356..312424,312619..313161)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631222"
FT                   /orf_name="MICPUN_105804"
FT                   /product="Predicted protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO64748.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199AF3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9V9"
FT                   /transl_table=1
FT                   /translation="MSAFTLSASHAVAKTAGLRAKTQAGSAVRRAVTTKAAVKVGDKAP
FT                   DFALMGEGFEVTKLSDLKGSKVVLAFFPAAFSGDADGGCQCQLQALQSIAKTDGVKVLG
FT                   ICKDQPFAMGAWKQVQGIDCLSDWSLKTCEAYVGTLDFGEFLDGLDVSTDFKGYMASRR
FT                   GCVVLDEDQKVIYSWNGMPDQLPDTTEIQAALGIGKTDFA"
FT   CDS_pept        complement(313343..315061)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631223"
FT                   /orf_name="MICPUN_59858"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65102.1"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI000199AF40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W0"
FT                   /transl_table=1
FT                   /translation="MGVIRLLALAAFVAYSRGDLWDVTGHDSARETAADEHYRGDLRIA
FT                   FGSCNRHDRAQDLWPAVRSLSADAWVWLGDAIYADGKVDNVRRYGGRAFHRDAYATQNE
FT                   HPEYAALRAETRILGTWDDHDYGFNNAGAEWREKEFAQRLFLDFLGEPLGSPRRTRAGV
FT                   YEAYTFRGLGASQTGSARLILLDARFHASAKDGTLLGDEQWEWFERLMLGRRTGAEGAE
FT                   GGAEGAEDYYDGDDEGRPSSEPRGGCVVFDGAEMNENTDCDPVDVTIVGSSVQVHAHTQ
FT                   ELLAKMGIGMDIESWNDYPAERRRLFDLVAAANVRTRAVVLSGDVHHSEIGGSPAGCDL
FT                   PSELVEITSSGMTHGVLEELPTKFLRRLARHSTWGMEYLPPWLFPDVGNLRRRRYVGYN
FT                   FGEVVVDFGVDWDGDAEGGAEGGVDDDAFDAAVDASPPANRSPASERDFLRDDVSSSSS
FT                   SSSSSSRVGRAPRAAAREPTVSLRIRGVDGGVKLSKTVPFSALEGEWAEYGARGASVSR
FT                   SRAECRGESSLTAAQTWRLPVMLVGVALAGPAGTSLALWWLWREVGRVRRKRKAD"
FT   CDS_pept        join(315627..315731,316038..316130,316266..316325,
FT                   316498..316572)
FT                   /codon_start=1
FT                   /gene_family="HOG000216660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631224"
FT                   /orf_name="MICPUN_91199"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64749.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG505448"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="UniParc:UPI000199AF41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W1"
FT                   /transl_table=1
FT                   /translation="MGKTQDVVTREYTINLAKAVHGLTFKKRAPRAVQAVKKFAQKVMK
FT                   TSDVRVDVKLNKAIWSKGIRNVPRKIRVQISRKRNDDEDATEDLYSYVTVVDGPTNEGT
FT                   KVVDDV"
FT   CDS_pept        <317132..>317611
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631225"
FT                   /orf_name="MICPUN_73476"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64750.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199AF42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W2"
FT                   /transl_table=1
FT                   /translation="RVVIELFDDKAPLAVENFKALCTGEKGMSKNCAVPYHYKGVKFHR
FT                   VVKGFMMQGGDFAMQNGSGGESIWGKKFKDEKDGLKGRHDARGVVAMGNTGKNSNGSQF
FT                   FITFAPCKQLDGKHVVFGKVVEGMNVIDKVEAVAVSPGGVTEEPTVPVVIADCGAL"
FT   CDS_pept        complement(317817..319361)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631226"
FT                   /orf_name="MICPUN_59861"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65103.1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI000199AF43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W3"
FT                   /transl_table=1
FT                   /translation="MTAEGAFAILLWTKVGDCFSVAACVRRSTKAICRPISRNGCGILH
FT                   KSALGGRDASLRSAHSSVTPTATATAVEVHPRPPTTTTTSLTTTTDIDNTHMALFASPF
FT                   HAFDTIFSDAFSHPFHRPRSRRRVWGPDPFRVAHRDPFVRFVLTDDAMDTDDVPNFDPE
FT                   VSETDEGYLVSATCPGVRPEDLAIVAKPERGLLTVRSEKHPHVRADLRLPTGGAVDASN
FT                   ISASCIDGVLRIIVPKVAPKSELIRVDSAPATAMLEDAKDAEDAKDAEDAKDAHDDGDT
FT                   IVINVPGFSRHDISISRKRPAETLLVEGASRALGGRKFRRVLRLADAEATVRAWCVDGL
FT                   LTIRVVNPRATGVNVPVSATPLGLPAPGDDAADAGGPNKNADDVDGDVITLIQRAVPGV
FT                   SAADFTVEIDRKNTLTARADASTRFGRRRYSFSVALPENVDKATVAAEVVNGVLTVCAA
FT                   KPAAPERITVAVRGDVPASLPSAADKNKDDADANDGAVPVVEVDGMVEDVTEEDGR"
FT   CDS_pept        319461..320399
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631227"
FT                   /orf_name="MICPUN_59862"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64751.1"
FT                   /db_xref="UniParc:UPI000199AF44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W4"
FT                   /transl_table=1
FT                   /translation="MGCVARVASMLAAPPHATIPIRCRSSRPAPRVCRAERARGGPSSS
FT                   EEDADGAAPRHWSRKLRGAGSDVTRDDLRYMSAKVAPSGNDAGGLGATLIGVKRDRDNV
FT                   TLVEDERLVVPFLAEALGVTQPEAEDALAQLCAILPPVRRRGAIRKMGAPTIARLCRDL
FT                   PGLSRRLLELKRVFPACDVAEMAVVSSHLLTESMEDVIEPSLAALRETFPEAGVDGKPG
FT                   VDRMVFAVPQLLDADFAKKAVAAVSSSFGVDLEAATRAVHKDPRLALRVESGAVRSRYS
FT                   ASFDQANVVANRVVKERAREDYYRPGRAREP"
FT   CDS_pept        complement(320592..321881)
FT                   /codon_start=1
FT                   /gene_family="HOG000131102" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631228"
FT                   /orf_name="MICPUN_59863"
FT                   /product="Serine-pyruvate aminotransferase and/or alanine
FT                   glyoxylate transaminase"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO65104.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG284301"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199AF45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W5"
FT                   /transl_table=1
FT                   /translation="MRVSFLVIVAAIATLAIAAPSVLAEASGSCPYHANGDGAIAPEKW
FT                   HRRAMPDDYSGGLKEFSVVYTDRALNHMSAPFIEVMNDLNTLLKGVYNAAATVILPGSG
FT                   TYGMEAVARQFARGEKALVVRNGYFSYRWTDIFEQTEIASEVVVLKATLDTEGTDASRP
FT                   HVKPLPVHAIVSAIEKEKPKVVFAPHVETSTGVMFPDDHVKQIADAAHRVGAVFVLDCI
FT                   ASGTYWVDMKALGIDVVITAPQKGWSGHACAGVVMLSARAEALVRDESATKSDSMTLNL
FT                   RKWLGVMDTYVAGGFSYYTTMPTDCLRLFRDAAFETRDYGFAKIKDDFVAMGARVRDVM
FT                   EAAGLTIVAAPGYRAPGVAVAYVGDKSVAAKFKAAGFQIAAGVPYMLETQPEMGTFRFG
FT                   LFGLDKVRDPDGTVRAIEGAIAKALDGVER"
FT   CDS_pept        322241..323608
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631229"
FT                   /orf_name="MICPUN_59864"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64752.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199AF46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W6"
FT                   /transl_table=1
FT                   /translation="MAPSLEEWVADLASGHDARLTKAAVRQSAHGKGLFASEPVKRGDV
FT                   VASVPKKLTLWVQEGNALALPGDGAWPRVRAGASAAAPDSGKGWEFILARAIVDAVAGD
FT                   GGAFWEAYGGMMPGPETLAHPFLLSDATLRELQDDDMARRARDERELIKALMPDLTTPQ
FT                   HAMDDDPHVTVGAWALALVRSRAMRVGVGAHAVVPFLDCANHASVPSVDYRCDSVETPA
FT                   SSGLPPQASEAMADVELVALTDADVGDELRLAYTKGQLTSTEHFEQYGFVPTGGSPADR
FT                   VRGLPRVNKGKRAARLGRALRRAIGATLRGVWNEVEDAESARSGSGVEAFDARAVVVAA
FT                   GASIAATLGDGDDDAGGGGREEGVLEEGVLEDAASSSEDMTSEEESAHLAALRRAAAEL
FT                   EASYETTLEADEAAFGGATESGDERLANVMHLRVCRKRLARRVREVLDGIELEESY"
FT   CDS_pept        join(complement(325540..325753),complement(323731..325346))
FT                   /codon_start=1
FT                   /gene_family="HOG000214672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631230"
FT                   /orf_name="MICPUN_59865"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65105.1"
FT                   /db_xref="HOGENOM:HBG395553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AF47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W7"
FT                   /transl_table=1
FT                   /translation="MDLLAQYSDASGEGGAGDGDTDDDVATTAAMLRAKHAVPDLAPRV
FT                   NDAGLAVAGEGGDARLVSLASTRDMHDPARKKIYYNVKYDDLHEPIAGPAHPFNPAGAS
FT                   RQMRNHATGHVEWAHVNKHAFDEQFQTFNALGYAVAPDGSAYVGDAAAIAAHAGETVFT
FT                   STAAKRRKVRDEVLAAAVAADPGAGGGPGVAALARDRSAWAPARDATKPLTVDELTEEA
FT                   KEYVLWHAARREANLRRKGRLKDEEGGAGGGEDEDGAGVGGGGGGGGAGPAGEKSFFHG
FT                   KEERNYAGESWLAPPKDRKKENDHCYAPKRLIHTWSGHTKGVQAIRFFPRHGHLILSAG
FT                   MDSKIKIWDVHNTGKCMRTYLGHDKAVKDINFTSDGARFVSSSHDKKIKLWDTETGKVI
FT                   STFTSGKMAYAAVLHPEKQNILMAAQSDKKIVQYDMNTGDVVQEYDQHLGAVNTVTFVD
FT                   EGRRFVTTSDDKSMRVWEFGIPVVMKYIADPSMHSMPAVTLSPNQQWLACQSLDNQIMI
FT                   YSAKDRFRLNTKKRFVGHANGGYACQPNFSPDGRFLMSGDADGKCIFWDWKSRRIFKTL
FT                   KAHDKVTIGCEWHPLETSKVATCSWDGTIKYWD"
FT   CDS_pept        326184..329738
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631231"
FT                   /orf_name="MICPUN_59866"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64753.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG610387"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199AFF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W8"
FT                   /transl_table=1
FT                   /translation="MSATRAMLAAGAATGAGARQASIAHRPANGTARGPVAPAAVPLRR
FT                   GARAWGARPRARRSRAFIAAATDGSDDGSDDAARVDPASFGRTARRMTIVERGVDSGSS
FT                   IRRTAQAAVVAAAAMFGGVGVAHAAASSSAADASRGGATSSVVGPSHHRGAADRDAELF
FT                   QIADADDDKEAAARAKKLAEVRRIKQARKEKMEAAKKKNKGEDDDKGGKKGGKGGKATA
FT                   EDKELAKELAERKRQYRIEAAKKKAFAAALERERAAVADELDSELPIDESAYASEETYE
FT                   EDVVEEGKGKEGMFKKSKKDEDASGEERRGLSVGGISLPTFGLSAEERAERAHERAYRE
FT                   ALKLDNVDRVMLGDEPELTVKQKITKFLDENIPVGRFTRNVNLTYLRDPFAVKGTKWAP
FT                   CEMSYTGFYDLCEVGRVKRVEYMPNMNTVKFFLYDTDEVFYANLPYDPTLYKLLIEKKI
FT                   DVISKQHSPLELFFRGLAHAGAPMILLWFIFVIWQDMKEDTTEGTTLMNTGTAKTYSST
FT                   PEFGMNMDDIAGIDVIRQEMDELISYLRDYQRYVRAGASIPMGVLLCGPPGTGKTLLAR
FT                   CLAGEAGVPFFACAGTEFMEMFVGVGAARIRNLFNQARKCRPCIIFIDEFDSVAVRRKD
FT                   AAAMEGNDEQVATINQLLTEMDGFGGNSGVMVFAATNRPHVIDPALIRPGRFDRVIEMP
FT                   LPNREARMDIIDLHCSYQVFEGMIDPDLDVALIARQCAGFTGADLENLVRTAAQRNSAT
FT                   LKRDRKPAGDRVFLDVIDEIRRSNVFKATGQGTVGETDDTTENALIQQMNPYIRDVICT
FT                   YYAAQTLVSMMVPGFDEVAKVRVFAAGEESGQVVYVPDEVGSSGASNVKRKAWYEAKIA
FT                   VLVAGQMAERYLYGPDKVSQFGNLDMREATALACEMVMMHGWSDIGPICVLRADSTEEK
FT                   YLKGGVNKGSQTGGMDSGRTRGKLWGIPPGKDGTLAEGRKAKYKEEPGLELQMELSDEL
FT                   DMLIANEVRKIFIKACQRAVMIMHDPKGTEMLFTLREALGTAKEVNGPNLRAVFKKFGL
FT                   HKPPNFDLWDINWGKNDELYWDEFTEYIWADDASSTTFWKLVSDQWRRTVADPTASVVA
FT                   GDGSNSVPPDVPEWAKEFVRSLPVGGQEEMLMYAPKEVQDRVRDGKPAVYTGPGFGTRD
FT                   ARVLRGELDDTIPAKPTE"
FT   CDS_pept        complement(329875..330537)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631232"
FT                   /orf_name="MICPUN_50894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65106.1"
FT                   /db_xref="UniParc:UPI000199AFF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9W9"
FT                   /transl_table=1
FT                   /translation="MLDQSPRSSPPRGTTCRHSATSGMGLVADYESDSSDDEDEEYPDA
FT                   GGKVVLLADVDDAGEERGTKRGRATGEDEIEETVEFPQHKSSIVTASAADIARETGAEL
FT                   EYIAGKFDAMARVRGIVARLVIRGTDAQVAAARRETQARLDANAANLERVVGEDGERAY
FT                   VFDKRKARAGSDGHDANGKRKGPRIKPEFDWRHSGAGWDNGGLVGSEGALGSHCTWR"
FT   CDS_pept        join(330653..330957,331256..335564)
FT                   /codon_start=1
FT                   /gene_family="HOG000239037" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631233"
FT                   /orf_name="MICPUN_59868"
FT                   /product="Predicted protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64754.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG561839"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI000199AFF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X0"
FT                   /transl_table=1
FT                   /translation="MTAETTETAMLKARRFAGILSSESSGVMATMRQNSRWALSGMASY
FT                   GYGEPEEPADDPMLEEFKAMRRRLFTWRNWDEVSPIAYLAPFLQVVRSVETSGPITGMA
FT                   LSAVHKVLKHGLISEHNPDAAEAMHCIADAVTLCRFEATDPDHDDVVLSKILHVLLESV
FT                   RCPTGALLSDDDVCNIVQACYRIGHQSGKESALLRNLSRHTLREIVQSVFRRLPRLSDA
FT                   VEHRGHHIDAPAPPRVSTEGAEGAVDGNAQGAEGAVDGNAEEAESTNEPEVISPRAVAE
FT                   DATELTPHGEPFGLACVLEIFRFACSFISLDDPADENAETMCAFGLQLVLSSLETAGDD
FT                   FARHPALLTLVQDDLSRAVLAVAPAGNPPVLAATAATVLQMYMVMHHDLKLQLEAFLRV
FT                   VLLPLAEGPGLSRAPGAKADASDTSAESQRIALECIVDLCRQPEFVPDLYVNYDCDLER
FT                   PNLFEEVCALLSRSAFPGEGRALGQTNLLCLEGLLAIVAGIADRSADAPPVDGFLVDGE
FT                   VDFTAPSSGGVSDESDPREVWAAIDGGSSAASMPGGVQRAHRLRRNRDVKRRLISCAEH
FT                   FNKSPKKGLAYMQEIGLLPEPLEANAVARFFKHAPGLDKETLGEYLGDPKDFMVEVLKE
FT                   YCATFDFHGVTLDKALRSFLDGFKLPGEAQKISRILEVFAARYHEANPGAVADADSAYV
FT                   LSYSIIMLNTDQHNPQVKRKMTLEQFIRNNRGTNGGEDWPRETLEYIFEAIATDEIKLE
FT                   STDTSPALSQSRWNDIVRGCATGKGRMMTAVATDEACMYDGELFGIVWSPTVSAIAVVF
FT                   DHPVDDSVLKEALDGFLGVARVAGHHRLTDVMDSLVGTLCKFASPSYASSGGAQGGGEK
FT                   IKPSVLFGNDDRARTAAVTAFTVASRYGDNIRHGWRHILDLTLRLHRMDLLSEKVCESL
FT                   APDERDGGTMRTLDGAEASTSFRRRERERLAKKNSGSNSILRGFSQLLSLDTDSWGGSG
FT                   GEAPLGEDEKEAEARAVRCVDACRVDEVFADSKFLETDSLQHMVRALVTAAGGKPEGPG
FT                   GAEGGAEGGAIVDAPRDVDEDAAVFCLDVLVGVTLRNRDRVRTCLPLVYGLLRQLVQTA
FT                   KTPSALAERAIFEVLRLCRRLLPHKEDLADELLDSLRLMFALEPAVADAFLERIVRELG
FT                   HLVAECGGHVRGAKGWETVCKLLMASARHPDAAAHGFAALRAIVEGAPTDDGSSAKPAV
FT                   VAEKTSTAAADANGNGHHADDDDDDARTPSTPGTAHGGAHHLRPWNIRACVEAVGAFID
FT                   AHEGGDDRSVAAVGLISSATAATERWCSGNADGGAMAVAAARVMRWPNHPSAGNSPVEA
FT                   INALRAETIAGAWTDCVSKLVAVAREETRAAVRDDAILTLQRVLLASDGLNAPATHWVR
FT                   VCSGVLMPLLEAMGERTRAAPRGDAKASAERTARLGVSCVAKAFLQYLPAMLTAATPAQ
FT                   FAAAWTEVLDRNAEVLKHARSEELREAVPEAVKNMLLVMSAQGVLAPGAPEGIWETTWK
FT                   KAAAIDAGLTPAIVGAK"
FT   CDS_pept        complement(337459..339465)
FT                   /codon_start=1
FT                   /gene_family="HOG000239731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631234"
FT                   /gene_name="TIC55-4"
FT                   /orf_name="MICPUN_59870"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="chlorophyllide a oxygenase [overall] activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65107.1"
FT                   /db_xref="GO:0010277"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748445"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199AFF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X1"
FT                   /transl_table=1
FT                   /translation="MTALVITGPSALAQRRGTFAKGRASGARPVRAARLASTPRTRSRW
FT                   TRASASGGTTIGAEEMAKDASAAEPLIGINPDRVPMVEAVNRGETSGTFNWTKQWYPVA
FT                   VIDLLDTSKPHPTQLLGKDIVVWKDGAGKWNVFEDKCPHRLAPLSEGRVEDDGTLLCAY
FT                   HAWRFDGDGACTDMPQASSKEEADRVRANPRSCAFTRPCMEAQGLVWAWGEGGKEAELE
FT                   ARMTPPLLVPEIEGVGKNGEAPGGGYRNHWQVRDMPYGWAAFFENAIDPAHAVVSHHTL
FT                   VGSRYDDPAGFNCVVERPMTAEAGFRCAIDPAVPPFNTIGKYDAETSYDFQPPCLLKID
FT                   WRHEEARFLTSHYCVPTRPGWCRHFVATVCQRGEGEKVRQHRWFKLNLFTLTSPAWMTH
FT                   VLGPTFLHQDMVLLHQQEKIIAQGDGQDIANKWKDQVFIPTGADKMTVMFYQWFGRNGP
FT                   IPWAGRDGDAMPPIERDQSKLFDTWEMHTKYCTHCQGALRNTEALKVVAIAAAAWKAVW
FT                   ATCLLAFGASAAGAAAGAGVAPSLRDVIAAVDPSLAGEAFSALSLAGTAYGLHGFAGMF
FT                   RSYPFSHAEEDIVMEGTAKIGLSNDGPSLYIDVVDNALFGGNKHAGKKDAVGCECGECS
FT                   PFHDGIRSGPLASFRKKQEEKARAAKEAGTPAR"
FT   CDS_pept        339773..341752
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631235"
FT                   /orf_name="MICPUN_59871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64755.1"
FT                   /db_xref="UniParc:UPI000199AFFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X2"
FT                   /transl_table=1
FT                   /translation="MSEGAPPADAPAAEGEGEAPKPKLSGLARFKKAVGGVKAANAFTP
FT                   GGLSKLPKKEPSPTPSAAPSEAGDAPKKNPLAKLKSAVTKISAASAFAKAAPNMAKKPP
FT                   SAAPSRAGSVMNEPPPSVASLGAFKKPTSSKPPSRAVSVMGDENDDPAKTIGKSVKGSS
FT                   RATTPGGKDGTAAGSRPVSPAKSVKSGVTKPPDQPHDLPEVRGAPPPPMDAINARIAAL
FT                   EDLARHSLGAAAVDGADGLAHLGAGTGNGGIPYKNYSEQRRMREELEDMRYRMRNMEEF
FT                   GAPAQATMREPRETAAERAERAERAERAERAERADRLMMMMMGSMSGTMSRHAGALAAN
FT                   ATDPRGPAQPLQPPHYGESPSVMHALEEARAAAAAAMTAADQARHQVARERRERQAVED
FT                   ELTDIRDALAEEQRRRERAEHAAAVSFDDAEYARELLHEHAVASASAKVQSVRPNGEGP
FT                   NVVGGGSGATAPRDPPSGVASAAQATLQAAAEAASLLEELKGGLRATLEQQRHLQQAQR
FT                   EVAAAMPQAPPRVAPARPASPVERFQSKPSAVPPSRGPGRVPRPSSAQLASPGMPSGHT
FT                   YYRDFGVVPSASKHTPGLRRAKDHVTLRDDGVGTHGAAFSVAPEHVTHNALEAARREYA
FT                   ADKRMALERRRQRMMMDEYGQLAH"
FT   CDS_pept        join(<344074..344886,344950..>345624)
FT                   /codon_start=1
FT                   /gene_family="HOG000214640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631236"
FT                   /orf_name="MICPUN_67033"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64756.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG595388"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199AFFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X3"
FT                   /transl_table=1
FT                   /translation="LGPSGAGKSTLLDFLAGRTPRGQVAHGTVRLDGEVVSAREVRHAS
FT                   GYVQQTDVLPGTSTVWEHLMFNAALRLPPDTARSEMYRVVAGWMRELGLVKVAESLIGD
FT                   EFTRGLSGGEKRRVSIATELLTSPGIMFLDEPTTGLDSTNAAKVVDILSGLSRAGVTVL
FT                   LSIHQPRPDIFRLLDRVLVLSGQGAVVYGGPSHRAESHFAAMPYAAAPDRTLHIADFML
FT                   DTVLRASDEDVRRMIDDYRRSDILRDDEERVASLVREAEERATNERGRGSRERYHAPFW
FT                   RQMRLLCGRLLRNMYRHPFLLTVHFTAAFVVALGVGAVFWQVGSNQGGIQNRMGGLFFV
FT                   LLYLTLMSLSSLPVWREDRLLFLRERANGVYGVNAYFASMLLFDLLPMRVLPPFFFGLM
FT                   TYQMVGLNEGTEYCLAWFVATLIATNVCASCMCMAVGAAARSVAAANVIASLCFLAAIL
FT                   FGGFLLNKDQIPAYASWVNNLSFINYGYEALVANEFAD"
FT   CDS_pept        346606..>347256
FT                   /codon_start=1
FT                   /gene_family="HOG000198843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631237"
FT                   /orf_name="MICPUN_83467"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO64757.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199AFFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X4"
FT                   /transl_table=1
FT                   /translation="MPNLHHAHVTHASADLFAILGPSGAGKTTLIDILAGRPSVGHEVA
FT                   GELRVNGRAMTSAEMRAVSGYVTQDDVLPGTSTVWEHLTFHGALRLPGNVERARLKAVI
FT                   WQTMQDLGISKIAHSFIGDEFTRGLSGGEKRRVSIATELLTSPGIMFLDEPTTGLDSTN
FT                   AAKVVDILSGLGSIGVTVVLSIHQPRPDIFRLLDRVLVMSSTGGVIYSGPSATA"
FT   CDS_pept        complement(348814..349692)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631238"
FT                   /orf_name="MICPUN_108560"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65108.1"
FT                   /db_xref="HOGENOM:HBG607339"
FT                   /db_xref="UniParc:UPI000199AFFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X5"
FT                   /transl_table=1
FT                   /translation="MERLSEYVTAVEAYKSLCATQVPNTVSDLLSQYVQVSTLDPGADG
FT                   YDKAVEFLNLDFSDDDEERDPEEVEAIQRMAKNFGRAGTGDKGAGDEEPGFTPKEVDDI
FT                   IRLLGEMGELRGSDGDDDDSDDELDEEELMRNFLGGFLDNPGTLHLAQDVEGNWRWLED
FT                   DLGRPLATKPEGEFNVKVMSHEEMVQLGLNVNSLHEEVDPAELIDFSGCKSWDEAIRVG
FT                   REVEAALDHMRADGWEVDTRSWCNEGEHLMVVKELTPLRTMSFVEGVKGKSNAKSKRKA
FT                   GKKSKKTEGKA"
FT   CDS_pept        complement(351008..351805)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631239"
FT                   /orf_name="MICPUN_108561"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65109.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG607338"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199AFFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X6"
FT                   /transl_table=1
FT                   /translation="MLARAPIASKFAVAGASRVDLRARGRAPAVVPRASAPGQGSTGRT
FT                   GPTSSRTDVASPDDVRALMPRTVDRARLVAQVSAKAAPAPPAESPPSAFVLWCRGNWGY
FT                   FAALQTVALIGASYNGRLARKRRLEIADINDKLRAMMAKYEGKLGSVDDDDVGPASEAL
FT                   AAAKAALVAGDFDAAAGKFSEAKAIAQKHGDSSAVLSGAKGTATALMRAGQLRAAVAEL
FT                   ESVVDLAVSEGDSSVYGMLGDAHTDLAELGKAGAYYDKCLAMD"
FT   CDS_pept        complement(351945..353780)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631240"
FT                   /orf_name="MICPUN_59875"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65110.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AFFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X7"
FT                   /transl_table=1
FT                   /translation="MGKKRFERVANSTRPAAKLGGGGGWNIDGARGIVDGDAASLPAYP
FT                   TPLSRRRVADKGRVDLTVAASDAHERTRAGDEGETNASSSAAAAGASASTSHSAPRVYK
FT                   KVFSGVGWRAAAPGFGNPEDKRDDAPRRPIILVGNLPTDVHPGELVDIIEAHCESLDYD
FT                   GELTRTQMAVFGPARPKLKRDRGRLHRGFALLTFDTVAAALSCAALLDGADLRTPSKKT
FT                   EGGLRPMKCTTEVGDAMDDRFMDGTQGEDAPPPPPPPVPDDPSAAPFSLSELRRFPMRS
FT                   NCLSTHATLADLDPALRDRLARYFRDACEGLPEFASVFARAERLAGKYTRVKEIVESVE
FT                   AFKVVVSFVATCERTGARRVRKFFDLACGHGLVGIMLAYAYPDRTVMACDRKRRESFEA
FT                   FAEAFAHYASREENSPATFHDDEVEPEVEPGAAGSSRRSRRLPNLTFVEGELDVLAPNV
FT                   DSNSLVLALHGCNEANKDSMRMATSASALWCVMPCCIRANLYLPNCTVSKMTDDQRYAF
FT                   MCGVMACEYGAQMARCIDRRITNRAVVLCGGCEDGDEEEGDKADGDGEGGGSVGPFGTS
FT                   TKLRFYSDHKHLVTRARRRKDGESAVAFVSNPSSR"
FT   CDS_pept        complement(354003..355826)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631241"
FT                   /orf_name="MICPUN_50899"
FT                   /product="Predicted protein"
FT                   /biological_process="cell death"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65111.1"
FT                   /db_xref="GO:0008219"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004326"
FT                   /db_xref="UniParc:UPI000199B0B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X8"
FT                   /transl_table=1
FT                   /translation="MGVGKGFDAADSWNVALLFLIYAVLSVGIEHGVHWIKTKVKGKKT
FT                   LMLVIHKAEEELFLLGTVSFLLLVFEESIINNSCVDSSIFDGDNWALCHKAKYGYYGSG
FT                   TNSTGSSYSGRRRLHGAVGGGDGICPDGEEPFFSAALLHHVHIFIFLLAISHVLYTAAT
FT                   LTLARWRLKVMMSRRTEHLRVTMERVAKVMGKDAHEINADMERRRMEEVRQFRRADEGL
FT                   SRKSSLRDKGGGGAPPESLQSSADMKAYRLKIADATTAALKGDIVHEQELLGDIAAKSA
FT                   PKKSVSFAWRQRTTAAREDGQEYRNLWTRFLHGIAWEVPNSSLLCFELLFLRTHNIHSY
FT                   KFDFSSYVMQCIESNSSETLGMSPARWLIATVLILLWGPFREMNLAVSVVSFASLIASA
FT                   ALLSRRVEALLHIERVVGQVTDDVFLFRRPQLLEEVMVAIMYQQAFHIASWLFGWWNVG
FT                   SAWDGYSCYYGEGWGLAVSVVVVAASLAIGGYVILPLQALTSQMTPSKLKGDLLGPHVK
FT                   GALDFMLRKKRRVKKFPTETDAVVHIQRCFRKRRQRNLEMAGRMAMINEVSRGNRKYGM
FT                   TWVNSGGGSADGTPRSESPSVAGDSFIDVDV"
FT   CDS_pept        356003..356866
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631242"
FT                   /orf_name="MICPUN_59877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64758.1"
FT                   /db_xref="HOGENOM:HBG561843"
FT                   /db_xref="UniParc:UPI000199B0B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9X9"
FT                   /transl_table=1
FT                   /translation="MATFVEIRDGVRLETRRYGDPTSSRALVVWGHGLCNSMAGEDEDM
FT                   LWNFWHDDDGAVAMDAHVVRYSARGHGESSPSTAPEDCAWDTLGGDMLSLARACRRDAS
FT                   QRLVLGGASMGAASAIHAAVRVARERERDGSNPETIAGLVLVIVPTFHETRRRRRSQIL
FT                   AAAERGFGAFLKSKKPRPIFVGTDREDEPPRLVGVREDSFGDVMAASADSDLPPPDVIA
FT                   NALRDVPILALCWDCGDKTHPLSSAIAIETQLAPHADVRVAKTLEETGGWSEAVRAFVC
FT                   GLGAGE"
FT   CDS_pept        357811..358359
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631243"
FT                   /orf_name="MICPUN_108562"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64759.1"
FT                   /db_xref="InterPro:IPR006769"
FT                   /db_xref="UniParc:UPI000199B0B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y0"
FT                   /transl_table=1
FT                   /translation="MTDRGVRGDEAQDETLATLQKAGVIIKLDDVVYTNPGQLTRDVLA
FT                   VLPRVPSYVYGVSDAELVSLEADLAAQEAEVTAAAERARWRSNVVVGSGLALMCTQLVV
FT                   FMRLTYVELSWDVMEPISYFVGVFNAILVYIYFMVYKRDFSFNDWTSRMQTSYTKSAVS
FT                   KKGIDWERYKKIARKLRKA"
FT   CDS_pept        join(358661..358758,358932..359421)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631244"
FT                   /orf_name="MICPUN_101369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64760.1"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniParc:UPI000199B0B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y1"
FT                   /transl_table=1
FT                   /translation="MAPDERRRAPAAVATAAAAIVASTVMSPLAAHSADLISEFNASGI
FT                   VFKDAVQVEALRDPLVDGVTIYLSDFKRSFSAKAQSGDFFSEPSQTALACVRSESAAGV
FT                   TIKGDIAGFQGQEVFSERKNLNLLNNKTLRVRRIYDQGNNALVYVSYSTRTASTSNDGG
FT                   PSAGQYHTNICTVPLRPGEAPGAAAGAAGAAP"
FT   CDS_pept        359754..360383
FT                   /codon_start=1
FT                   /gene_family="HOG000085250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631245"
FT                   /orf_name="MICPUN_108563"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64761.1"
FT                   /db_xref="HOGENOM:HBG561846"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B0BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y2"
FT                   /transl_table=1
FT                   /translation="MLTRKIESFCAERLQMKEGYAYELYKKWGTCLRGMQQEGILNCPE
FT                   LLEEYLEYSHDIPLHEHIGPDPQLRAMLQSLDPSIPRWVFTASIEPHARRCLELLGVSD
FT                   LFEGIIDVRAVDWVTKHDADAYAAAMRIAGVDDPNACLFLDDSTSNVRAAKKVGWRTVL
FT                   VGTHARDCGSKIECAEADVIVDTVHRLVDVAPGLFVGDVAPAGAGV"
FT   CDS_pept        join(360534..361514,361635..362126)
FT                   /codon_start=1
FT                   /gene_family="HOG000255772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631246"
FT                   /orf_name="MICPUN_83519"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, NADH or NADPH as one donor, and incorporation of
FT                   one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="ACO64762.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016709"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG464401"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="UniParc:UPI000199B0BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y3"
FT                   /transl_table=1
FT                   /translation="MTWLARRILAGTRRPIARAFSATSSSSSSPSNPDAAEPVDVCIVG
FT                   GGIVGTALACSIRANPLTAHLTVSLADRAPPPSSAWLDDPPPTPEPRVSALTPASVALL
FT                   RDVGAWDRVEASRRACAFRAMQVWDAESVGHVRYDASEVGATELGHVVENRVVHTALHE
FT                   AATRLGVRTSPPAAAVALDLPADGGGDLATIKFRREGGDGDGDEDGSPEIAEVRARLVV
FT                   GADGPSSKVRTLAGLRAAGWRYGLKAAVGTVTTDEPHVTAWQRFLPSGPLALLPVTEDG
FT                   RVSNVVWTTTPEEADRLCALGDEAFAAEVDAALRGEGRYSHGGQGEAAIRAVANGFGGT
FT                   AGGDDAPPAFEHPPRVVAAAGPRGAFPLATSLAGRYALRRLALVGDAAHQVHPLGGQGV
FT                   NLGMRDVVLLTNALAGACANGGDVGSMLVLRKYADEAKAANVPMMAALDGLQRLFASDQ
FT                   PLVAWARGAGLAGVNALGPIRRRIARYAMGGA"
FT   CDS_pept        complement(362213..363166)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631247"
FT                   /orf_name="MICPUN_50902"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65112.1"
FT                   /db_xref="UniParc:UPI000199B0BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y4"
FT                   /transl_table=1
FT                   /translation="MTLGGSGIVIVRYKSAVQVCNECGTDYYYNGSLCVSCPFGSSSPP
FT                   GATTSCKCPKDYHRKVDGGVYSCAACAKGSTRPAGDTVPGGDATTCSAGSSSPSSSPSS
FT                   SPSAAPSAQDKKAAAEKTRDAILGDIKDARLKKKAKLLADAAIAGVKVQRLTAKLTAAD
FT                   EDTACSTAFTKAGMSSSDGACVATVASSGKRRRLSATAYDVELMFSSSTVSDDALTAAA
FT                   NELKANGVEGVTSQASVDPIAELKTVPGVDTSKLQTFETEAAAAVAETESQNPPPPPPP
FT                   PSPPPNLVQDDDDAGTRVRALASALLASALALAALM"
FT   CDS_pept        365715..367256
FT                   /codon_start=1
FT                   /gene_family="HOG000220065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631248"
FT                   /orf_name="MICPUN_59883"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64763.1"
FT                   /db_xref="HOGENOM:HBG364447"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="UniParc:UPI000199B0BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y5"
FT                   /transl_table=1
FT                   /translation="MGVMDLPGGRRTYAQEMEFLERVTPTQWRVREGFVPNMRVPGVFY
FT                   VNKHLETLMFDELRQHVDRGDVGGFLPAVKQLANVACLPGIVSKSIALPDVHSGYGFAI
FT                   GNVAAFDMSDPNAVVSPGGVGFDINCGVRVVRTNLHERDVTDIKEKLAQSLFDHIPVGV
FT                   GSQGIIPTSPAGLEAALEMGMDWSLREGYAWAEDKEHCEEYGRMLNADPNKVSARAKKR
FT                   GLPQMGTLGAGNHYAEIQVVDEIFDKHAADKMGIERLGQVMVMIHSGSRGLGHQVATDA
FT                   LTEMERAMARDGILVNDRQLACAKISSPEGQNYLSAMSCAANYAWVNRSSMTFLCRQAF
FT                   AKMFDQTPDDLDMHVVYDVSHNIAKIEEHVVDGELKTLLVHRKGSTRAFPPHHPLIPVD
FT                   YQYTGQPVLIGGTMGTCSYILTGTEKGMEETFGSTCHGAGRARSRNNSRNKLDYTEVLE
FT                   KLKTKGIAIRVASPKLVMEEAPESYKDVTEVVNTCHDAGISKKAVKLRPIAVVKG"
FT   CDS_pept        complement(367353..367973)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631249"
FT                   /orf_name="MICPUN_59884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65113.1"
FT                   /db_xref="InterPro:IPR019280"
FT                   /db_xref="UniParc:UPI000199B0BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y6"
FT                   /transl_table=1
FT                   /translation="MGSVTERVDSLIAAGDLDSVAGVCDEFEIVAGGAGNVPEWPHATH
FT                   VLSRMLAGDLERARCVLERAPEHLRERDPELRAVHAVLAAMLDRDQPAVHAAAAAHAWS
FT                   PRCAPLAASLIERYRAATLDLLSRAYTTASCAHVAACLGVSVEEAAAQGVGMGWSLGED
FT                   GMFGVVRRKVDDEAEALGMDAVEKLSALMVHVTDIAGPDEDEE"
FT   CDS_pept        complement(368109..368951)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631250"
FT                   /orf_name="MICPUN_59885"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65114.1"
FT                   /db_xref="UniParc:UPI000199B0BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y7"
FT                   /transl_table=1
FT                   /translation="MDDLDALLEDLDAAGIGGGGAAKGGGGTAAPPVSRTSSVPAPGRT
FT                   STVTDGPARSSGDTAARDGVNGAKPTGNLDELDDLLGELDAVMGSGVSPLTERPKPASS
FT                   SATTTTSQKSNAPSSSSSSAPRVAAFDPSRVRTGDPSDPRGGAHLAPNPRGGGTGGGAR
FT                   CAPCAIVGGSDAKLGRASFMSPDAPCDALRCVSCDFDVVSFDGVAWCSGEGGVKGPGVD
FT                   YMFFRNNYPDASAMGARATERTGWRAYCCQCSWRSLGVGGREKVDGVGGELRWVCGGH"
FT   CDS_pept        join(complement(370749..370771),complement(369301..370402))
FT                   /codon_start=1
FT                   /gene_family="HOG000172162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631251"
FT                   /orf_name="MICPUN_59886"
FT                   /product="Predicted protein"
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="proteasomal ubiquitin-dependent
FT                   protein catabolic process"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65115.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0043161"
FT                   /db_xref="HOGENOM:HBG738030"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199B0C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y8"
FT                   /transl_table=1
FT                   /translation="MKVAFKTLTNQKFEEDFADDASIGDVRAKLSETQKIPAPEMVLIH
FT                   KGKVLTDDATLAAAGVTEASFIVMMHQKPKAPKPAPPPPVPKPAAAAPAPAPATTPEAP
FT                   AAATPETPAATPSTEPAPAGTPTDSSLVTGAALQETINNMMSMGFERDACVRALRAAFN
FT                   NPDRAVEYLLTGIPENLMPPAAPAAPAAAAPAAAAPAAAAAAAATAPGGPGPNTQPLNL
FT                   FPEGGVPGGGGGGGGEGSGILDFLRENPQFQAIRAMVQGNPQILQPMLAELQRQNPQLY
FT                   QLIAGNQEEFLRLLNEPAPEGALENLAAGLGDGGGFGGDDGEGQIEISEDEKAAIDRLA
FT                   ALGFEFERAAEAFFACGKNEELAANFLFDNAGQD"
FT   CDS_pept        371022..374372
FT                   /codon_start=1
FT                   /gene_family="HOG000100099" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631252"
FT                   /orf_name="MICPUN_101373"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64764.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561851"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B0C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Y9"
FT                   /transl_table=1
FT                   /translation="MGWKKEPNIAELTPTAVIVALERDLLLSSLSRPVGSVRGIPSPAA
FT                   VPAKAGPDARAAAEVIALIRRGAFVEALTCASAKNALIVPAAIEGQAAPSPDVDGVTAL
FT                   YASVEAAVESAGAAAAARGTLAKAGHELCILALGVAALNAFIQANVTGPDCRDAPHCPL
FT                   TPSAPAADLAASADAWNKWATRSLARDGEDVVGRCFLPQYLYLAKVLLADRCAPRAEEA
FT                   FGGADVDVATATLAETRARAAKMQAKMAARATPGRVVLWPDEDIPPPSLTWWASRTHIA
FT                   HQRLLSGRSPTLRRLLLGCHSLTLAWFAPGNAAPGFPTPAAIVRAATARESDGSPTPAA
FT                   ANAATAGLASSMSLLETALMEHEYGHVDSARALLRAAGEPIGATHEVVGEMGFRTIHQT
FT                   DAKAQMVLRAECTGLCVFKRPGVTSVDEEAASDDETDEAVAEEVATQLAKKAEAEAERD
FT                   ATGRVVNTKSAAMNRIAIELDGLSADGAQVLIAPRLGVTRADRDDGEKAAYGAPMPAAH
FT                   QALVLATAVTVRKSMADDGTRSWSVAPYHECVQTQRRSRPVLRAAAAVLSARHERERAR
FT                   TRERALLVMEDLVKSLESPAPSAAARIRYAYSTWFPPGAMLRKELGDHLVSLGMVGAAL
FT                   ELFEEIELWDSLIVCLTLLGKKQAAADTIRRRLEVDPTDPKLWCALGDALDLEEHFLKA
FT                   LEVSEGKNARAMRSLARRAALREDWKSAAEYWSKAMKTNPLFPDGWFSCGYALLKADRE
FT                   EEALGAFVRCTQVDPENGQAWNNVAALNIRRQKFAAAHVALREAVKQVATSWQTWENLA
FT                   MVSAKIGRFQQSARALVKVMDLTGGAKLHVATLSTLVERCKEARSGKDLDWLRKEADAE
FT                   AAEAKDEQKKLAVLGGIADLALNGDDDDDDDDDVEVWEGVGGAAATGGGDAGDFADDFL
FT                   DAFASDSDDETAKETAKEAHAAASESVQAEVLSRETVRLEAAVDEVLRRALGASSGERA
FT                   VKDTADLWSLSADLKEARGEFLVANEARLKRVRALETSGWRKDAAAFAEYAAASLDMCR
FT                   GWVRAAERAAGGTEMADARRQLAQARMHMNGVCKASAAGKFDESMGEVHEELMACMDEV
FT                   TKAEEAAAR"
FT   CDS_pept        join(374548..374659,374820..375610)
FT                   /codon_start=1
FT                   /gene_family="HOG000174258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631253"
FT                   /orf_name="MICPUN_94652"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64765.1"
FT                   /db_xref="HOGENOM:HBG523150"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B0C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z0"
FT                   /transl_table=1
FT                   /translation="MATSNAPLVCHGHSRPINHLEYSRITDDGVFLISSSKDGQPMLRN
FT                   AETGDWIGTFEGHKGCVWSATLNAPATHAATASADFSARLWNAITGDELHVFQHKHICK
FT                   SVSFSDDCQKLLTGGSEKLLRIYDLGNVDAEPYVMQGSPSQIRTAQFTAEDTLIMSSCA
FT                   DDKGIRVWDVRTNTIVTTLGTDSPVTSIEITDDGRYITTADGKTVTFFDAMTFTPVWKR
FT                   TMGYEVESASVCIKNDVFVAGGTDMWVHAHSMSTGEEVDCGKGHHGPVHSVRFAPDGKS
FT                   YASGSEDGTIRIWRTLPGK"
FT   CDS_pept        complement(376048..377502)
FT                   /codon_start=1
FT                   /gene_family="HOG000241252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631254"
FT                   /gene_name="GLPX"
FT                   /orf_name="MICPUN_59889"
FT                   /product="Bacterial-like fructose-1,6-bisphosphatase "
FT                   /biological_process="glycerol metabolic process "
FT                   /protein_id="ACO65116.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="HOGENOM:HBG284837"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniParc:UPI000199B0C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z1"
FT                   /transl_table=1
FT                   /translation="MRATSTALTPYRAAVDPLRRADHRAARLRRVAPAPRVVAKGLESF
FT                   GGSNAASSGGSLGRRNARRAHPKIVPISNARRTVAKNVVLQANDVEDGEELTALDANKP
FT                   YTPPHALPGDPSSPTHDKSSRHHQDLVSNHIVHQISTEPSTGTLASCNRNLALEMVRVT
FT                   ESAAVAAARWLGKGDKMAADGAAVRAMRQALMHVDFSGRVVIGEGEKDDAPMLHNGELV
FT                   GTGVEPVAEIAVDPIDGTTLVAGGRNGAVSVIAIAERGALFDPGPAFYMDKLVVGPAAV
FT                   GHVDITRSPTVNVHAIARALKKPVSEVTCVVLDRDRHVGLVEELRMAGARIKLISDGDV
FT                   EAAIAVCDPESGVDALFGIGGTPEGVIAAAAIRCMGGEIQGQLWVRSPEEAAACRAAGA
FT                   DPMRVLRTNDLCGGEEVFFTVTGISDGDLLDGVNFHDFGATTHSYIMRAPSGTIRYMKT
FT                   YHRWKDRMAQTNKLQDSLTGGGAFKL"
FT   CDS_pept        377901..378914
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631255"
FT                   /orf_name="MICPUN_59890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64766.1"
FT                   /db_xref="UniParc:UPI000199B0C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z2"
FT                   /transl_table=1
FT                   /translation="MSSALVARLRHLESQVASLETTCAARVDVLARACETLREENEALR
FT                   FEVARHREVDQTLLEGLLDDLAPVSSHDRVGDDGVDAGRATATATAPSPAAPSARAERL
FT                   GAFLHGWDEDEGRKRPRDEGERPRDERAAPSVKIEPSLGSEARLPSAAAAEADGEAFGG
FT                   ESESKYVANEDEDEDDGATCQPVPRMYETAANGRQFLLCKHALKKAWCPECQVVPRKPK
FT                   GRPNRRPAGSVCEHGTRRATCKTCKGASICVHGKRKTICRLCGGGSICVHDRYRYRCVL
FT                   CKGGAVCRHNRRKYQCTLCFAERACEHGLDAKECADCVLLKVELAEFGSEDTFEDV"
FT   CDS_pept        complement(379006..380934)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631256"
FT                   /orf_name="MICPUN_59891"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65117.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniParc:UPI000199B176"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z3"
FT                   /transl_table=1
FT                   /translation="MVVFDVVVEVPMDADEYLRVKDSAAYKAFHCEKNGTLNEYISDEV
FT                   VDGERRTVTKTIPNIAIPWALRRAILGNRRVEFIDRRRWRDGAHLTAPFTQHFHTTNNI
FT                   SDRCVVNGTVTVERHGPNRCRIIARGECVVDVKGLGGKIEQLIVNNLRGSYEKVPAVVA
FT                   EWLAISARRPSTLDEAPAAAQPAASEFTSLDLGPPTPPDMYDDARSTTDDVEAGRVNGV
FT                   GSLPRQRSYAFDRDEERFQTPRAGKYHSSSDSSTSFLHPTPAPHARFTPARGRSLLSSR
FT                   KPGAGIRGRRGGRGFRRSTSPAVFFAAAAAFWVFAAWYYLFGSSSSSRSAATSLVGADD
FT                   VGDAWREAAIAREMAAGRLARDRAYGLHRERHEAAAVGAAAAGATAKASGERADVAGAG
FT                   TEEGGGIVGCVDARREECEGWACDGECESNPAFMLDRCACACEEARRRSESLAPGGVNK
FT                   AFETDVTRGVALGLDWLDVKTGKRKVARVRVRLDPADAPEAVAAVRAAAASGKCAPGVP
FT                   GRCPERACHFHRAERTYGLVQGTLAGLEKAGGSFEDGRTEGTARWGRGTVGYIPGGPNL
FT                   LVATRDHDEWDASFTAFGKVVGEEDMAAIDDLLDLPTTPFVHPEYKTTMAMLVTKVRFT
FT                   LEGATDV"
FT   CDS_pept        join(complement(382108..382147),complement(381135..381988))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631257"
FT                   /orf_name="MICPUN_105810"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65118.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199B177"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z4"
FT                   /transl_table=1
FT                   /translation="MSIAGVGLTTFVAGHSPFAKQPRARSASFANARRTSPGRHVARRT
FT                   AYSSSSSSSRGSPTRLARRRVARLAASGQDASQTRSDAAPKKMSPLAYVNESTKFIVSG
FT                   ACLAVLLTHPNVPVCWCLSGSVFNSLNSKLLKRLINESRPEGATKLDPGMPSSHAVSLS
FT                   YLSTYAACALLLRGGGYPDVPGAWPVHPSLVRPGACALVALGVFLTWLRVRLGYHNNAQ
FT                   VCVGYGIGAVTSLGWLWCGENVVGPALATDPNAIKYVQGLVGFASAIFLPVSARWFGEA
FT                   REWFARRREARAAKRE"
FT   CDS_pept        382486..385752
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631258"
FT                   /orf_name="MICPUN_101378"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64767.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI000199B178"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z5"
FT                   /transl_table=1
FT                   /translation="MMNSATGGANGLPALPPRNGVRGGPSSRSAKNESSNGRAINNEPA
FT                   STTADVESGEKEAKEINLEEMHDKARTYFSLMADDVNGPIYNGGAMHGHGHGAPGANKG
FT                   PTIPDVVTRFQAVTQRFPALRKLIAKSTALQELLATPGALRKFLLAATNGGRGVDAMIL
FT                   AGGQRGGEDWRDIVERAGTNSWEELQAMVEARDEMEMFAKGPTWTPGSAPLPPEPDEFE
FT                   SQQYLAEAAGESKMERSVMTTYFSAYGQNSDVLAPFIIFGVGAFMAMYAPVYLWLPAWF
FT                   AVIGLALQAARASAQLPGSRQGPKNLFGAAMVHALIVYCGLQFALVYVPAQWSTHAGWC
FT                   VVGLVSFITTPALLIRTYYLGPGFVPLATDGRDQWVGNMRRVSRAAVAEKALKREREAS
FT                   SAAGVAASEADTRKYEHDFAVTFPQEVVDDLVNSGKFCNTCHSARPLRSKHCPVCNRCV
FT                   HRMDHHCPIAGTCIGVRNQRHFLGGLWDMFVGQCVFVWFSYLHLAATYEAGGVAMRDTT
FT                   LEGDSVSTVSTGGPVTKTFHVLRHAPWAVILYVIQCFCAIYCLVLAGRMTLAVIANLTV
FT                   NEMENSHRYEHFHSEDGTKFFNRFDRGWHNNCIEFWRGHQERIDWDAMKIAVDRGDAAP
FT                   PPRGSYSWFQNSRAPRWLKRACQIAKPPGIGSKATRGGGGGHGHSHGGVPCEHGHGAPG
FT                   PDTSSPAIFAAGNLTKGLPAAAAAAAAAAAAADHAHHGHGHSHGGVSCDGDHGGGDPLP
FT                   VSGAATAVAAAAAAAAAGPAAAVGTVVAAAAAASNASDAHRGHSHAHGEGAGHSHGGSA
FT                   EVSGGIQKSPEDGSGLPESAPPASLEELQAEAKAAMAAAMAKQAEHHGCTVEELERRGE
FT                   EQKKRMFEMQAQSRGMTVEEFQKMAEDQMAQRMKQMADANGITVEEVKARQELQQAAMM
FT                   QQQLRLAEMRKQHFQNGAGEGDGEGGEEAREEERDPLKDLTDDEVKAKAEAALDEVMAA
FT                   QGKMMGKTMEEMKKQNDFMKEQQKAQMAKMNGLSVEQMEEMQDKQLAQMAKQNGMSVDR
FT                   MKHVMMLQQAQQAQMRIAMMARMNQEGGQPGHGPGHGHSH"
FT   CDS_pept        join(complement(386418..386527),complement(385817..386282))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631259"
FT                   /orf_name="MICPUN_59894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65119.1"
FT                   /db_xref="UniParc:UPI000199B179"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z6"
FT                   /transl_table=1
FT                   /translation="MRTRSAPLLIALLLGCLLGARAQATVSFSPISAFPNRYARNVCSL
FT                   IASQAESDGACQLDSYYGTTRGRVSMAFGETDCVVTLTGCVPGVCYSFRDATSTIERDD
FT                   VPRPGTAGAPAASLFKDVSAVEGASSSSFTNDGFSFKASSSTVKIAYSVHSCADYYSYR
FT                   GSVGVQECRGSFAAITEVGAGMPNSLSC"
FT   CDS_pept        join(386703..386758,386888..387053)
FT                   /codon_start=1
FT                   /gene_family="HOG000234933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631260"
FT                   /orf_name="MICPUN_83845"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64768.1"
FT                   /db_xref="HOGENOM:HBG326946"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199B17A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z7"
FT                   /transl_table=1
FT                   /translation="MIEVVLNDRLGKKIRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQ
FT                   KWYNVYKDHITLEDYEIHDGMGLEMYYN"
FT   CDS_pept        387283..387942
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631261"
FT                   /orf_name="MICPUN_59896"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO64769.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG559207"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI000199B17B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z8"
FT                   /transl_table=1
FT                   /translation="MKAVGAKYAAESSFASNGSSTSAIEFDVSDAVSGRWESAEKVGAA
FT                   RKWKFDLDYEGSDSEAHLKLGDGRFGGVKYLRGVTKALSLGVDAFWLAEQSSVGFAARY
FT                   TDKRSVATAQLASVGLLCLTYTKVDMKVKINEQLKQVMLASDFMWNWHTRKAHMSVGYD
FT                   LIDGKNRWRGRINSAGTASSFYERHVSATCSIWTSNDINLPNRNWKFGVGITAQAM"
FT   CDS_pept        complement(388044..389531)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631262"
FT                   /orf_name="MICPUN_59897"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO65120.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="UniParc:UPI000199B17C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E9Z9"
FT                   /transl_table=1
FT                   /translation="MFRAPEPSRQTGASAAKGGRRLSGRPCWNFAKGQCAFGDACAYLH
FT                   DDVASDSRGPARCRSDETTSTSDRDGAVDEPRVPLRYFTHKSRAQLGADPGRSLLARVL
FT                   ERDGVFEPTRDVSSCALFWGCASPTGPLLANLPPDAFVNHFPGTTAITHKHTLAMMLRR
FT                   HPEGDAVAPRTFVLPAEANEFAAFDDADDCEKGGAGWIVKRAVGGEGRGTIVARTAREA
FT                   LERTRGADRGYRACSRHAETWVAQRYVRDPLTLAPRSGSDRRKVDLRAYALLTRWDPND
FT                   GTTRAYVHRDGLVRFAAAPWDPSDSSSLAVHLTNNAAATARTHEGGAEGGAEGGADDRV
FT                   TWDPDAHFKRNWSFETLASELDAELGVGSYERLWEGVRRCARAALASLPRRGDWGDLGG
FT                   NESLSVGDDGRNLRRFELLGLDLLVDERLRVWLLEVNSAPTLAAGTKLGGRVSGTHHRV
FT                   KAGLLADAMNLLGVGLEDAGGAEEEVERAALGGFQLL"
FT   CDS_pept        complement(389619..392171)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631263"
FT                   /orf_name="MICPUN_59898"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO65121.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000199B17D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA00"
FT                   /transl_table=1
FT                   /translation="MRAHARTVVARLVGGAQEYARRSIAFDVSGARVSPEAVAGAVAEL
FT                   RERGVEVVDSVDSEDAARRVALASRDFYWYSPKLKRELRGMKGDALVVARSEEDVVNAA
FT                   GVAARRGVPLTPRGAGTGNYGQAVPMRGGLVLDLSPMDQIVSFDARDGIVRAHAGINLA
FT                   TLEETTRAEGWELRQHPSTRRTATLGGFVAGGSTGVGAVTHGGLAEDGAVLGLRVVTAE
FT                   PSPRILELRGRDVFPVVHAYGTNGVVTEVEVPLARAQPWWDGVYRFPTLRHAAKFALEL
FT                   GEAPAIVAREVSVHQSPTFARELAHTALGGMLRDAGAGDAHVVLAQMAKPSLGPALRLA
FT                   RDNDGDACFEPSRSEDLALGIPLYEYAWNHTTLHALKRDKSVTYLQAAMMPGEALDLVT
FT                   AVEQRYGADELVQHLEVVRFGGRIGFASLALLRPGTDAAVAVDKVEEVMRWHEANGVPV
FT                   FNPHTHVLEDGGMKQTDWAQLGFKSGADPNGVLNPGKMRAWEEGKATTEASDPRGSFSA
FT                   AYRLAQSDGASVANKDPNKKPNPNSKEDIMANRANRANEESNAPPPTTTRERKMSRLWS
FT                   EWTTEDFATADLSDAVAVLPLGATEAHGPHLPLGVDSMHNAALLARALELVRHDVRVLA
FT                   LPPLDIGVSCEHGGFAGTVGIAPETAAKQWEEIGACVARAGIRKLILYNSHGGNHALAE
FT                   VVARRLRLRHRMIAALALNLAMDDDGCAGALFPTDELRFGIHGGSLETSVMMHLRPELV
FT                   DASKAAHFASSAAQMGGKTLQRHALGFGVKTGWASQDLNPHGVVGDASDATDSKGAKLV
FT                   ESSARGLARLIEEMHATCADEWTGTAPLYPPQGTDEEI"
FT   CDS_pept        392311..392961
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631264"
FT                   /orf_name="MICPUN_108567"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64770.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000199B17E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA01"
FT                   /transl_table=1
FT                   /translation="MRPPRALVGASFAAFSRVSRPGYCARALGLAPWPVVDALRLDPLL
FT                   GARRHSTTDSSSGPFAAGRGIHATSASMSAPVTRAVAVDPDVLAPPFARYSHGCEVSFP
FT                   PERKTRMVFVSGQLGVRPDGKCATDAYAQAVQCLKNVKAVLHASGMGVENIVRLNAYVK
FT                   HDSHLKDYMRARDEWLEGADTQWPDGPPASTLMIVSGFARPEFKVEVEATAAK"
FT   CDS_pept        complement(393051..393977)
FT                   /codon_start=1
FT                   /gene_family="HOG000160812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631265"
FT                   /orf_name="MICPUN_83748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65122.1"
FT                   /db_xref="HOGENOM:HBG735623"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniParc:UPI000199B17F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA02"
FT                   /transl_table=1
FT                   /translation="MGERKVLNKYIPPDFDPSKIPRGTRKGGKRNEMKVRMMLPMSICC
FT                   NTCGNYISKGTKFNSRKEDALGEDYLGIQIFRFFFRCNRCSAEITMKTDPKNSDYTVES
FT                   GASRNYEPWRDKATQEEEAEREREEEEEGDAMKALENRTKESKREMDIMAALDEMRSLN
FT                   ARNAKVSLNDALGAIHGKIDAERRRAEEAEEAQAKAVFAEAQKAAAGFVRRLESDSDSD
FT                   GAGAKRPRLGEGDVLGGGSNLPKVAKPAFLAAAPKPKPKPKLVVRPKAVPKPAEKTKPA
FT                   ESEDGEDSGGGGLGLLGDYGSSGDDSR"
FT   CDS_pept        complement(394113..395192)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631266"
FT                   /orf_name="MICPUN_59901"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65123.1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199B180"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA03"
FT                   /transl_table=1
FT                   /translation="MATQVKFAVIGDAFVDISVGPLDALPSPGADVEVETVSQGPGGSA
FT                   LNTAWHLAAQGVPATLHAAVGQDRMAQVLTAALKNESKVTDPAKSLAVLKYQATATCVA
FT                   MHGPRVDRTFVSTYGAAKTATLNQLLPGGNADALDATHVHIGGFYVCRGVHGGLAACVK
FT                   RLKARGIKVSMDPNFDATGEWTPPAMMTAVRGPAAVDVLMPSEVEACEITGKDTAEEAL
FT                   EVLVGGTNTAGGGPTESSFDGVGLVVIKRGARGVLAGDSSGRRWAVPACTVSRVVDTNG
FT                   AGDAFNAGFLRVWSQGLDVGAALMAGCAAAAIAAQHSGAVGAWAPDRKIVDAQSEAEYG
FT                   DKPWWQKGILACMAPRRPV"
FT   CDS_pept        395565..401393
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631267"
FT                   /orf_name="MICPUN_59902"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64771.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015006"
FT                   /db_xref="UniParc:UPI000199B229"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA04"
FT                   /transl_table=1
FT                   /translation="MAFSWDAQSLRAAIDDPQRSLAALQVANQGSGRHELTGAEAVAFF
FT                   TGSGLPQETLSSIWMASTKGAPEMGPQMFLEALKLAYAALHGGNPSSSSGAASASRGGP
FT                   ASFSSHGGGGGGPTPEERQKYAAHYGTLPGANVGQVSTADAADFLSKAKIKRELIQDIL
FT                   ARNARGAAKVTLDAFVQSMHETYEARKLKKEKKGLKSAAKAAMASGAFAAAGSTSWRSA
FT                   PVPPPLEPTNASTNASAGPGESVPSAFASFDAPPLPPSGGGGDGGGGGGGGGAWGGAGA
FT                   DGAAGGGFADFGSPPTGGAGFASFGTDFGSIADAPAAGPTGSTNDVAAQGGFASFDADF
FT                   GTAVAQPAAQLSDAFATNTSGEDPAPAVSSFGRTDSFGGGSFGAAGVTGDSFGGGSFGD
FT                   AGVTGGSAAGSAALDEDMFSGAQYSSPPKAPGFGGLDASSSFGGDPSVVGFEGFGGGGG
FT                   GSSAPTPPAGPASQPPTVGGDFASFDAPAPAPTVGGDFASFDAPAPAPTGDDFASFDAP
FT                   APAPAGGDDAFATFAAAKPPLPPPVPPSGFGAFDEPAPPAVPPPTVPPPAVPPPPIDEA
FT                   AEAEAAAASAAADREKERARVAAADLAAAEAAVALAKRRKAQAETDAARAEADAVRAEA
FT                   DLETARKERETAEEDAGRVGERKRLAIARAERAASEAAEIRARTSRLKADQSDVAARLE
FT                   ADAAAAEEALERVKSHAKASRANIEKAMAQSKKRADDAKAQAEEIRTNASNNAKASKLR
FT                   AETEIAEAKEQLEAAKAERDRIKRETQVAKIERDAELERLRLEHDLVSREILDARQAHE
FT                   HDHNVAAEPLETLRAQIAVVKSEIRRTQDETAAASKRATDALVEASLQLQECEEAAAEA
FT                   RLEREITAESEDKEVEKVRVALEETRRALEEAIERNDELSRRHVAEITELTETIEATRI
FT                   ATEEAHSEARAAAESHAERVEALHEQLRAAYRAKDEAEAESLRVTKETAAVVAEKTAAA
FT                   EKAEAAAAEAREKAEAAKADAAAKRAAAEQRLEGAEEALRRDLEELGKAKKEQTTAANL
FT                   ERDRLAEIKATREAERSSYETEVATAKDEIAETRASIAAEEAKLEAERNKREIEKEEDE
FT                   RLIAEAKEKLRADQLALAKKKAEADEAKAQAELASVARKSILAHVEEEAAELRRKVAEE
FT                   QRRVDTESTQIENDLAMREASLAAEQTKLAAALERLRFQRPRESAAAKQVQALRETLAK
FT                   AEVERDDAEKREAEARAEVEKNLAQLKSLATAVAKANGAAAAARASAMEAERLAATNAA
FT                   AAEHGAAHSQMDRVRATAEKKAAERIRAARAEAARVIAARSPRNLAFTSPRLSSSAATT
FT                   PRSGSAGGFGSAFTTPVSKPVSKPVPAATQPRAFAEKPEPSSERTPGLVQPVTSSPKTS
FT                   PRTSRSVRKSETSNKSMDDALRIDADLDMDLGGFDDPFSPGGSEVKKSPRSSSSGGAKP
FT                   KSPKFQQSPKSPRTSEASEAAGSPKFAAFEARFSEGEPGFKADFSAFEPPAAHGEFGGF
FT                   GAFEPAKFEASFDNPLAKPDDGEIQPATAPTPAPPVARKSEGELEIADFTDDDDDDDEE
FT                   EEDQGPKDIAVKKLQGFTIKPGATKPTGPSYFDDPVPAKTSGLFDNSPPAAQTFDAKFD
FT                   AKFDDPPPAAGVPTKTDSQDEFATDDEKEEPTRTGPRTDDVARLGVSRMSDADVDEFFD
FT                   AFARATGSAAEAMSGGTLVAVTRDTGLEQGDLSTIWQLVAAPGASSLTREDFALFMHLT
FT                   RHVVAGGEMPESMDDAERVRVMGPEHGPRRAPPPPPPPPPPPPPADHPVVVVVESFANI
FT                   KDGKNFKNANVSVVLVDGEGEPLCPVATTPMGSGIARSDGSIVFNAPVRLDATYDAIPR
FT                   GAGVVLELRHFKEKEKKMSVKCWAYVAAESVGRGGSAATATLQKPTDRSGRRRKNFNKG
FT                   EPDVRVSFR"
FT   CDS_pept        complement(401566..402240)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631268"
FT                   /orf_name="MICPUN_59903"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65124.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B22A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA05"
FT                   /transl_table=1
FT                   /translation="MELPVNQYPVLLVDYILSWRRGRVSGAALLGAREGMPSIWRPNVR
FT                   VTLDEDDEVEDTERGGEELTKRGTKRKRAPPTKGPCEHGVKWRSQCKVCRGCPHGKRRS
FT                   QCKECGGASICEHGRQRSTCKECGGASICEHDRIRSTCKECGGSQICEHGRRRDRCKEC
FT                   GGSQICEHGLERSYCKECGGGSICEHGRQRYQCKECGGSGICEHGRVRSKCKECRAVKT
FT                   ET"
FT   CDS_pept        402283..403224
FT                   /codon_start=1
FT                   /gene_family="HOG000100100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631269"
FT                   /orf_name="MICPUN_108568"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64772.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG607307"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199B22B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA06"
FT                   /transl_table=1
FT                   /translation="MSAIPLTVGASAAVAPLARARVASPRAAMIRASLPDRLSSTGRVA
FT                   TSGGRISRIASSPRGRSSRAGKDDLPGPLDGLADGPDLTAVRAAVNNGDGEEVDVLEVE
FT                   NVPPMQFLASSCAFYALMGVGSQVAASYLGVHPDILDAMRDVNIDQGSLWSLPLLASLA
FT                   FAITQADRFEFLGEVRDIFKVGVLPSLAPLGLPGVMALSLGAGVGEEAFFRGFLMPFAD
FT                   GQLAQVGVPEQLASTAVLAATSVFFGALHAITPAYFYWATGAGFLFGLEYLNEGLGTAA
FT                   FTHTMYDFLAFGFILIAWPIEGYEKEAPFSSK"
FT   CDS_pept        join(complement(406572..406628),complement(403263..406406))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631270"
FT                   /orf_name="MICPUN_101382"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65125.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013591"
FT                   /db_xref="UniParc:UPI000199B22C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA07"
FT                   /transl_table=1
FT                   /translation="MGTQARGGEAGPSVSTLAEARTALRRGANLLKLCRNAKPHVAYFQ
FT                   LSKDETKLEWVGKGARVKAVRMGLVLQVIAGRETPAFKSSKQPSPPDQCLSLMYREGVG
FT                   KKPRSLDLVCEDAGQARMWRLGLDAVRERGGAGVTAEAFSSDDEDVVPASSPVRDAKLD
FT                   EMAADFGVAMKVNSAASKFMKLKSPRGGAEQGDVGRGRRSLRSSAISDPRELFLWGRMP
FT                   SEFEPPPIDVGDPDAAAGVGPAVGGWREWSVPARAPGADGLDVVAVALGARHAVAVVRH
FT                   QGVYTWGDGAGGRLGRGVDQRGRGRPSKLSVVSGGEVSDRGAGFERIREVSCGGQYTVA
FT                   VNYGDGAAYAWGDASGGCHGALGMASPSKGIVAGVSLPTKVSVGFPVGTRVSRVSCGAF
FT                   HAAAVTAAGDLFCWGEGAFHALGHDGDKSTCQHPRRVRGLWDAGRRVSNVSCGVYHTAA
FT                   VAIDRTTTGCAGRGELWTWGDADGGKLGHGAEAAKEKAVVAPRRVSGLDENADVTTVSC
FT                   GQWHTLAACADGVVWVCGSVGKVAPAEPALTPERVPGIPGGAEAIASGEWHAVAIGRGG
FT                   EKMFSWGRGRRGALGHAGGRDEHAPRAVEALAGRRVHHVACGPESTAAVVSSRSMTVQE
FT                   RAGLTKKKDLALNFGTQPSRGAIEKGLRLTDSGVEADSAPGTPSRGGSRRGPSGGGGAH
FT                   HHALARVQPGRITAATADGATTAPGNIVGAGRVSHAEPTGNLNDLATRRARAEALSATR
FT                   ERDLLRLEVKALAAKLSRAKAPPQGSEVRSPGRAPVGRSTPAAASRRPASPRPLTPPAA
FT                   RSVPGGLTLERDRALAARETAEAAAALAAEEAANAVAELEAKAAVLEEKVVLAEFELET
FT                   LRSQVASQTVQSPPPPTRTPLSPVRTRSPTLAAEARAASKGGAQSFLKATAERIDVPSK
FT                   VSNENAGARARSSAPPALGTRPTSHAVEFRAEKEEPSGDVAYAHQAATPAPSVVVVPTR
FT                   TPDSAAAATREWVEEVEPGVFLTIATHGSSAAHVLRRVRFSKSKFSDGNAQAWWEQHRA
FT                   RIIRARGLKLVRPARSSS"
FT   CDS_pept        407106..409244
FT                   /codon_start=1
FT                   /gene_family="HOG000100101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631271"
FT                   /orf_name="MICPUN_59906"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64773.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG747052"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B22D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA08"
FT                   /transl_table=1
FT                   /translation="MDGDELEAGAPPDPPPAPPEDVLGWHNLRYVIHRGDRRRERTILS
FT                   GTSGIARPGRLLGVLGPSGSGKTSLMTVLAGKLRPAADGRRKGRGRRHATDGLVGDVTF
FT                   GGEPFHEGPHPASERVPLSYIEQDPRFFSNLTVRETLTLDANLHGGDASDVDDVVRRLG
FT                   LAACADTLVGGDTGGKEVRGISGGERRRLAIACETLSLRCSSRVAAPEKADATIGGAGA
FT                   RKAAGGVILADEPTTGLDAHAADKIVEKLAETAREERAVVVAVLHQPRSAIFQKLDDLL
FT                   LLAAGGRVAYCGPASGALAHFEKIDPSYHCPTHHNPAEFLIDLVAINCDGGEGAEAADV
FT                   ARVDAICHAWASTGECAAHESVPIGVRSNGGGDSPGGDSPGGDSPGGDSPGAGTVAAGG
FT                   SLPRQQPGPLRQFALLAGRAWRQTRREAWVRVTQLVASAALAAAFGVCNFKVGYGPKSV
FT                   KQRAAVLMQACINTSMLAICRSLNGFPRERATVSREMRRKRGGYTAGPYFFSKLLVETP
FT                   VDMIAPVVFGAVVGPMVGLRREGRGWFLATLALQTAASSTLGTSVGALSPSAEMALAIG
FT                   PCVMVLCIMLGDETGAFAEVPDGLAPLANASLIKWGFRGCLCSEFEGLKFDPLGDDRAK
FT                   KDAAKTAAKTAAKTAKAAIVARAKKKMDGPCPRTGEDVLEDMGLPLRGGAARAAKAQCV
FT                   VALANAALTYLVLRFRGA"
FT   CDS_pept        complement(409401..410480)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631272"
FT                   /orf_name="MICPUN_59907"
FT                   /product="Predicted protein"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO65126.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000199B22E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA09"
FT                   /transl_table=1
FT                   /translation="MRRRPAALALASTLAATWIAYALVTSVRFSSGLARPDPECSSAQE
FT                   VSICSHQLKGMSSLPLNTDGTDEATPPRDGSLAGMTAMWHEGITCFDVDGVLTSDGVML
FT                   ATHPKRFADATGGARPAEMTLARARDAGADEAGFPTLDDVIAHFASLVEATAPDARPYW
FT                   WRGDDSFAKITSVSPRRRGRRPAAPPLTGPVLCLDLKGDALAPAHAVRLVALADDLNLR
FT                   GRVLVYVYDGGKDDAVLAALATKRPSVAVGLGRRDENPAHRSVPALSRVSTGGTNEHDE
FT                   ASGGGIVRAIVPSVGFDARWYEAAVQTGLHVVSWVVDDEATLGAQLALGVSGVITNEPG
FT                   RMLRALHDTRIRCEQKKYW"
FT   CDS_pept        join(410830..411123,411248..412648)
FT                   /codon_start=1
FT                   /gene_family="HOG000100102" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631273"
FT                   /orf_name="MICPUN_59908"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO64774.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG561866"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015734"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199B22F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA10"
FT                   /transl_table=1
FT                   /translation="MGACMSSHGADPDRPRSRAKLREKNTLRGGVSSGEVSILAEASVG
FT                   NLEIGAEPGHPLEHYDVLDTLGTGGFAVVKRVRDKKTLETFAMKIINVEMLQNPDHGKT
FT                   DDERAKEIMTIKEVMSEIQTLRKLNHPSILHLKEYYVTEAENHVYVITEVLYGGAVLDA
FT                   ILKMKDERYTEAEAKVVVRQTLEGIDYMHSHLVVHRDLKLENLLLKQQDDLSSVVIADF
FT                   GLAKRCREKTTSSTTLVKDGEYLPHAKGVDDSAVGTPVYAAPEVVEQKSYGAAVDMWSL
FT                   GIIVYILVTGAMPRDLWKAALKYGKVTKEDFGFDCYEWDDVSAHARDFVVKTLVYNPKN
FT                   RMSARDALNHPWMKDVTNVRPAPLRIKSKLRDFAKGMKLPLRRYAPGEFLIKQGERASD
FT                   EVFLIKSGRVDIIVNDRETGEPVKVATREVGEFVGEIAAATALLEKSPSGKGKGPEDAA
FT                   AAGPRKSISEPDKEFLEGGRAKSTFAGAISARIAGKKWVGQRRTADVVAATKVECLVLG
FT                   KKEMQWAITHDEAIKSELEKDIRRRRMQTQMTLSKSIKHRDVVPEVN"
FT   CDS_pept        complement(412841..413278)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631274"
FT                   /orf_name="MICPUN_59909"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65127.1"
FT                   /db_xref="UniParc:UPI000199B230"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA11"
FT                   /transl_table=1
FT                   /translation="MSSPNAVASAAARHRGAVLKAYRDLVDVVRRSSPVAARDAMLEEA
FT                   RTEIRAHAAETDESKRLDLLRKLVARVGYLRIVTPKGGRHKREGGTFVVREGELVEDGG
FT                   ESKGKRVADGKISMQEAHEYHNRLMKRQYFGRKPPPQPPML"
FT   CDS_pept        413377..414597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631275"
FT                   /orf_name="MICPUN_59910"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64775.1"
FT                   /db_xref="UniParc:UPI000199B231"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA12"
FT                   /transl_table=1
FT                   /translation="MARGGSNVCGFSLPTVCFVLLTGLAVSVTRGGRWRVGLGESDVVE
FT                   VEPSPARPSPPSPARPHQGSTPPAPTDPTERGLNVGSHRARCLSGDLSRGDWVACDRAA
FT                   HAVAGCDPAGGGGGDRAWEFSPPARELCEASKIDRHEFASMLAGETVAVVGDSAARMVY
FT                   AAILRLAAKDADAWRLDTSQKHRDWTHQLASDGAVATFAWAPFAQNVTSRLRNLFEGDD
FT                   ARGQGRPPIALVMGAALWHELHVDDLGEYGAALAELADALASPNLAGKVMGAGESRRGG
FT                   AEGAEGALSGALSGAEGGFADESARRRTVAFWLTPSRTVSAKFTDDRKRERMTPENGDA
FT                   YARVATESPLFERVAPTGRTFVVPVDLGTITASCGAGCTEDGIHYAPASYDAAVQIIAN
FT                   ALRAAWT"
FT   CDS_pept        complement(414688..415260)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631276"
FT                   /orf_name="MICPUN_59911"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65128.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG743217"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI000199B232"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA13"
FT                   /transl_table=1
FT                   /translation="MGLIAWGTELATRWGWVREASREERPRTCVFCEKIGRQRAGVDDG
FT                   TFVHEDDELVVFRDWRPAARRHYLVCPRAHVASASALRPADAALARRMLELGKECVARD
FT                   FPDEPDLETRFGYHIPPFNSVDHLHMHAFALPFTPPWKERKYSVEPWARFAFKPAEELA
FT                   AELEAAAAAGAGGEGQDGADGDNTSRL"
FT   CDS_pept        join(415846..415966,416082..416650)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631277"
FT                   /orf_name="MICPUN_59912"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64776.1"
FT                   /db_xref="UniParc:UPI000199B233"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA14"
FT                   /transl_table=1
FT                   /translation="MAQPGDEDYIPRRKADLQEPRAITYPTWEYEGMNELKSEIMRCRA
FT                   DSAHPGSDADPSSRPFARAVVRRNIWYYRDRTGLPRGPMDINVLRKAYIGGIIDGNTLM
FT                   WGNGLGHWVPLRNIRGMDGNLTNPKVLFLKWIHDTFIITKAQRRERRNELYRQGLAKSP
FT                   VMNHDEVREWKKTREEKLRSGEEALMLSLTLAMPLGKEIGSLGAKMKKAFRGKKAEKKE
FT                   EEGVISA"
FT   CDS_pept        complement(417032..417397)
FT                   /codon_start=1
FT                   /gene_family="HOG000100103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631278"
FT                   /orf_name="MICPUN_101387"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65129.1"
FT                   /db_xref="HOGENOM:HBG558379"
FT                   /db_xref="UniParc:UPI000199B234"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA15"
FT                   /transl_table=1
FT                   /translation="MSFLTPENYNNAVAFVMAAYALQFLFMPAKIITDHFKATTPAIAL
FT                   FVARGSAAPMLSMAYAMYKMQDLQYTVVSTIIVAFMYPLNAKYNIFQKLKVIYPMHYVP
FT                   EALMTTLTTTGIYLLAQ"
FT   CDS_pept        417685..421275
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631279"
FT                   /orf_name="MICPUN_59914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64777.1"
FT                   /db_xref="UniParc:UPI000199B2EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA16"
FT                   /transl_table=1
FT                   /translation="MVAGYRRRYIDPFDSRRSKASPDAVIGEALQRYMVSTDSVPRSAA
FT                   RHRKKSVVGGTGSRSSSSSSVASVTKAKSTSKASREDVAAIGGSVGSVHAVLAKRNAKR
FT                   LSYSTPTSSSRAPRDSRTEPESPPGASSAEEDVAAVDRPPKGPATPPADASETNISLET
FT                   DVLDVTEHPLSEQSLTGSPATEEEIDRELIHDLNLAPKSPPNIRHRRTRSSENAMATPV
FT                   GFGESDGEFGGVGSTPASPFGERDNNDKSCSPVTQFRRSLLALKGLGLQGADGVGGTNM
FT                   GVGMGAHTPISPVVRDIIESTEEQEAAQMRILLEERSRAREMVQRLERDKQMQAEQLRM
FT                   MEERMEQSEMTEEELRETEAALRRARREVETLAASKEALEKELDSQLSREEEWSRRLRD
FT                   AELAGMSSTEKAIKERDEYAAKVEALERELEATRAREVNQLIEEAKAAPPDRRPSRGTR
FT                   SKAAHTHTSKATGARAVDANLGGSFAAPELAPFVAAEVFEAEEREVETAATPPSRKPRA
FT                   PTSMSRGSLVAIVVAIVAVAAAVLLSPFATSISSVAVGIDASWWRTRAGAVLTTNALEN
FT                   APEVSPGFAAAPAPAGAPAAPVEATARKWRPSGESERGREDEANKGFDDDAVLEGSGEV
FT                   LERDAVLAAARAAKARDIAEARAKQEQKRREMEELKRKLAEAEKMKQELEAATAAKAKL
FT                   DAEVKAAAEAKAKAADEANAKVKAEIAAAKAANAKAKAEREAKAKADAEAEAKAAAEAK
FT                   AKSDEEAKAKADAEASLAKLYAEMKAKAEAKAKAKAEAEEAARTKAAAKAKAEAEAKAN
FT                   AEAEAKARAEAKAKAEAEAKAKAKAEAEAEAKAKAEAEAKAKAKAEAEAEAKAKAEAEA
FT                   KAKAKAEAEAEAKAKAKAEAEAKAEAKAKAEAEAKAKAEAEAKAKAEAEAKAKAEAKAE
FT                   AKAKAEAEAKANAEAKVKAEAAEAEAAQKYRDAQEAAGEEPAARAEIDADEAAITKAES
FT                   DAKAKADAEASAAEKVRAEAQAAAEAKAEAERLKAEAEAKAEAERLKAERLRAEAEEKR
FT                   ARKLREDASKRQEEADERERRNGADADEAEERSWEAVIKSGWDAWRKMGGSDRRARLKS
FT                   AARRAEGAVTSSRQGRQSWVAAEKRHGETVVALEGVDGGDAAEKQRLRLEAHEVEAEAS
FT                   GSKRKWDSLRQKAAGAVTALEAELRAIGHM"
FT   CDS_pept        421692..423950
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631280"
FT                   /orf_name="MICPUN_101389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64778.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B2EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA17"
FT                   /transl_table=1
FT                   /translation="MFAQIRARELDPTGRLGQAARGGDPSTSGRRADPSFGSRVAPQHD
FT                   PDASSLDRSLASWAEADSLSNCTATYSELRPAPRSTIAAAFSPDGRTLASTHGDHTVKL
FT                   IDCATGRCLATLAGHRRTPWVVRFHPTNPNVLASGSLDHEVRLWNARTSECVLRFDFGK
FT                   PIASLAFHPEGDILAVASGHKLYTWRYAAAMRADWEARIDGDVPRGDAMDANAVHASSR
FT                   EGGLREDTRDDAGGSRWTASAAYVGGFPSRSRGTVAGAMGAEGAEGADPDALAVPYISL
FT                   RTRRSLRAVHFHPHGAPMLLSAEVNETSEHDTAVPPLRAVTAPPPAGEWETAYAAASAA
FT                   AAAAMGGNGGGLGGGGGHGLPSRGAESGADGGGSRTTYIAARSSNPGSPTLSSRPSADA
FT                   DDLDELARLRVRSPANNAEAMDVDNQPGGEDTRGGGARRSRSSRGGRLPTTARQQLFQT
FT                   PGASTSTAAAAAATAAYQSAQNARGLRVLDPGAPTDQASRDAAAAAAAAASADRAVDQP
FT                   CTVKLKIWRYDKKNPLAPLSDARLVIPHAVLCSEMGAHFSPCGRLLAACVACVPKDAED
FT                   PAPGEPIPRLVYELRVYSLEEQNFGEVLAARSVRAAHCLTSIQFSPTSEHVLLAYGRRH
FT                   SSLLLLVADGGSCITVHTILEVYRIADMSLVRVLPSAEDEVNVACFHPAAGGGLAYGTK
FT                   EGRLRILRHDKPPPRSASKRPMAIGRCLEDELLEVLDWSGLDADADGLPNGNSGSDTD"
FT   CDS_pept        424170..425303
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631281"
FT                   /orf_name="MICPUN_101390"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64779.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B2ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA18"
FT                   /transl_table=1
FT                   /translation="MTFTYRLTPAWMNPPSPSPPPSPPEPRWWDRSGVVKGREEDLGSS
FT                   VLLWILLAIPALLLLHCCLVRGCFCYDDVESPRRTRGRLRARRRRLRRDDDDDDDDPED
FT                   PDDSDVSDGDSVEPVSPAAWDGPTRSHRSGALAPFDARAAHPATFTDDNIHEWRALAME
FT                   RARARAGAPTRPSPLRPTNGGTTRQARTRSHPNGHRRVSPRSRSENELADLSNPDEDDD
FT                   REPGPMSGRAMATLPRCFVGDARWRGLRGLAPVGQSNEGVEQGAAATTTDAAAAAAAEA
FT                   FEDVEMCLVCTDDCEPGDELIVLTCHHSFHADCIKRWLKVNAVCPACRARVTRVSGRER
FT                   AALWRSRWGLDDEGDWGGDGVGDRGGEGEEIVVNVVG"
FT   CDS_pept        427162..428157
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631282"
FT                   /orf_name="MICPUN_50916"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64780.1"
FT                   /db_xref="UniParc:UPI000199B2EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA19"
FT                   /transl_table=1
FT                   /translation="MSAHASFLTDRLLLSIVRDDGAFANVQRVCLAGCNRLTDSAVCRL
FT                   LDVCGENLECLELSDCTLISTSTIEHAARVCRSRKDGKSCLVFLDLAGCSNVDTLDALR
FT                   LTETNFEALREIRLMGTSRLNGRVPQDEFVELARELEARRARWRDGIGRRREDAVRRAE
FT                   ADDSPGTDVGNTVTAEDMMNMIDPSASCIDCACGDASRGEEIEPWILEGRENVPAWVTT
FT                   CCIQPALCVVDLPKRVKHWKTKLDIWEEGTAPIAACDHAMVMQGNMNDPGHQHQLNLLP
FT                   GCGHVLCVDCEQRSRVHMVRRHLDNEYVYPCPLCGMDMPNPGGFEITLNP"
FT   CDS_pept        join(complement(430114..430245),complement(428486..429559))
FT                   /codon_start=1
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631283"
FT                   /gene_name="FBAII"
FT                   /orf_name="MICPUN_104879"
FT                   /product="Fructose-bisphosphate aldolase, class II "
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO65130.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327581"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B2EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA20"
FT                   /transl_table=1
FT                   /translation="MAFAVSTQALAAKVALSGKTLNVRKNAAKAVRNTSVRAAVSAPAG
FT                   LKAGVVTGDDYKAVVDHAIKNGYAIPAVNCTMSTVTNACLEAAKKANSPMIIQFSNGGG
FT                   AYNAGKGWKNEKDQKAAIMGCVAGALHVRALAEFYGVPIILHTDHCAKSLLPWFDGLLE
FT                   ANEEYFAKHGEPLFTSHMLDLSEESIEENMEISKKYLERMAKINCFLEVEIGITGGEED
FT                   GVDNTDVAQEDLYSKPEEIHQVYTELNKVAPGMFSVAAAFGNVHGVYSPGNVKLTPSIL
FT                   GAAQKYIKEKEGLDTDKPVNFVFHGGSGSSREDIREAIGYGVMKMNIDTDTQWSMWDGV
FT                   REYVEKYEPYLQGQIGNPEGPEKPNKKYYDPRMWTRAAEESTVARLLSAYEDLNAMDAL
FT                   SK"
FT   CDS_pept        430724..431452
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631284"
FT                   /orf_name="MICPUN_59919"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64781.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B2F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA21"
FT                   /transl_table=1
FT                   /translation="MPTCEARNITLYCLSWPFLLSSLLASSSGAGAAERGGAWKKMSGP
FT                   SPLDPYAALELKPGASDEEVKAAFRRLAHVYHPDKASSAAGRAEARFNFNRITAARNRL
FT                   LGDGGPGGQTRGWTAHNTGMSAAHMGNARRAGRISNAAFAAVLALPLCLIGVVSNWAFP
FT                   SEQSRLVAGTGAGGGEGHMGRVNGFLEPPVNPWLRDDVVEEGRRRGMHRKSVYERVGAR
FT                   VFSLAGGGKESAAADATRGG"
FT   CDS_pept        join(complement(432242..432331),complement(431601..432107))
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631285"
FT                   /orf_name="MICPUN_106992"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65131.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199B2F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA22"
FT                   /transl_table=1
FT                   /translation="MQKKLLILSALMVALACAHAGETPPEITNKVYFDVSIGGQPAGRI
FT                   TMGLYGTAVPKTVENFRALCTGEKGVGNRGKPLHYKGSIFHRIIPQFMLQGGDFTDGNG
FT                   RGGESIYGEKFADESFAIKHSGAGDLSMANAGPNTNGSQFFITTIKTAWLDGRHVVFGK
FT                   VLEGMDVVYKVEAVGSQSGKPSKEVVITDSGELEM"
FT   CDS_pept        join(432525..432531,432666..432797,432946..433766)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631286"
FT                   /orf_name="MICPUN_59921"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64782.1"
FT                   /db_xref="UniParc:UPI000199B2F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA23"
FT                   /transl_table=1
FT                   /translation="MSGAPPPPKPWERAAATGESVSASTPAAPGDAPKPWDVPGAGSAP
FT                   SAPVPTASNPTGTTPPPPARYREQGTAVTNPASTATAGAGTYTAGAGTYGRAGYGGYGS
FT                   AYGSTAYGGGGYGGYGGYGGVGSYGGYGGYGSTYGGMGGYGGYGGYGSSYGGMGGYGGY
FT                   GGYGGMYGGGMYGQRYGMGGMMGPGMGMGPMGPNDPNGPTPPPTAWQRILRSLSGVVMF
FT                   AGKMSWLVDENAQAMHFFMTAMLQLLDRAGLLYGELARFVLRLLGYKVPPRPKWLPGVG
FT                   PGGMMGAPPGMGGMMGPGMGGGMEGAWDGAGDADGGGD"
FT   CDS_pept        complement(433901..434221)
FT                   /codon_start=1
FT                   /gene_family="HOG000218057" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631287"
FT                   /orf_name="MICPUN_59922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65132.1"
FT                   /db_xref="HOGENOM:HBG297920"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199B2F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA24"
FT                   /transl_table=1
FT                   /translation="MPVETIENVATLTAKANVYFDGKCISHGFVTADGQKQSVGVVLAA
FT                   ELTFTTGAAEVMTCVGGSCEYRLKGTEAWVKQEAGDAFSIEGNSSFDIKVADQYHYICS
FT                   YA"
FT   CDS_pept        434414..435877
FT                   /codon_start=1
FT                   /gene_family="HOG000100104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631288"
FT                   /orf_name="MICPUN_59923"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64783.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG610394"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019345"
FT                   /db_xref="UniParc:UPI000199B2F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA25"
FT                   /transl_table=1
FT                   /translation="MRLVLLFAFALLAGGVARGVDAAGKDLYKVLGIDRGADDRTVKKM
FT                   YRKLALEHHPDKGGDQDKFAEISHAYDVLSDPEKRKIYDDYGEDGVRQAEAGQDPRANP
FT                   FAGMGGGFPGGFGGFPGGGGGGRQQFTFQFNSGGGGMGGARDPFDIFNQMFGGEDPFAG
FT                   MGGGGGGGRRRAGGGRQGFGGGGHQQQEQPKDNLYGKDSAVKNLRRNKFPGTDAKHVWL
FT                   VEFYAPWCGHCRQLKPTWERLAQELKGFVKVGAVNCEKEKGLCGMESVGSYPTIKVKKG
FT                   GVSTAYEGERDLASLKQWALEQLPASIANLRKPESLDKFLAGDCVNAKYAKDGACVILF
FT                   SDQVETPAWLKVASYTAKGRVAFAEARARNEALALRFDLGQFPALIAVCGGDADHTVAY
FT                   TGEVSHGMLPDKVLAWLDAFKDGAACRGAKRNPKSGAKLDPGADYGKMKVSKLRAILSA
FT                   HDIPCKLCAEKSDFVRAIREAIAAKAGEL"
FT   CDS_pept        complement(435949..436728)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631289"
FT                   /orf_name="MICPUN_59924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65133.1"
FT                   /db_xref="UniParc:UPI000199B2F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA26"
FT                   /transl_table=1
FT                   /translation="MRTLACLLLLLASLTPVGANYGTSPYSHMHYPPYGTRRDPDLEPK
FT                   PKPKPKKPLDLKIIDTAKCKPLGFGEGIGPACSDCETLFEFVKDEDLASATQLVEECRE
FT                   CCFIDRDPNIKYDRCELLVDQMALMYGQHGGVREFIEDHAKPYLANGRLEIRFVNGQRT
FT                   EQPEMRFYDGDVEHPEERVMLWLAKQPGWGWESIQKYVEGKTKSGPEADKVRADYKAGI
FT                   KPKKARRKKRKAKAKAGGGTKKKKGGFSSIFSRKDEL"
FT   CDS_pept        join(436827..437093,437218..438210)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631585"
FT                   /orf_name="MICPUN_59925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64784.1"
FT                   /db_xref="UniParc:UPI000199B2F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA27"
FT                   /transl_table=1
FT                   /translation="MTDVETDAQERHLSFDNEASSPLDGDDGARGEAAAVAEPDENDTW
FT                   VDPRTGEVFHRLSPFERKVVSLVIGEGVERLKLLQELKVDPEEQAEELSKAQGETISAI
FT                   MNRQAELEERFQALLLEREEINRADLPMAHALARNKEESLRVAEQMRAVTEELCANLKG
FT                   TPDVNASILATQQAIARGMTVMCSIIEDVERDGTWPSLNAFNAEMDAAKAAEEAAVAEA
FT                   GEDEGEGESEGQEKSLEEKKAEMEAAEKETAATIEALKREIQAKLKSNAIELRFLEADL
FT                   KGKGDEESQLARQRISELERQVAEAEALIEEEQSVHKATCEFLQNRIDALNKQNEETQE
FT                   RHKRMKDEMERKVAAATQDREAAERELEEEKELYEKAKAAYDEWLLKKETEPVDREGGQ
FT                   EGKGGQEGKGGQEGEGGQEE"
FT   CDS_pept        complement(438271..439248)
FT                   /codon_start=1
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631586"
FT                   /orf_name="MICPUN_83839"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65134.1"
FT                   /db_xref="HOGENOM:HBG492692"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniParc:UPI000199B2F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA28"
FT                   /transl_table=1
FT                   /translation="MAPTKIGTHDGSFHCDEALGCYLLKQTKQFREAEIVRSRDPETLG
FT                   ACDIVIDVGAVYEPENNRFDHHQRGFEEIFGHGFVTKLSSAGLVYKHFGREIVATTLAL
FT                   PESDPIVEKIYLKVYKSFIEGVDGIDNGVNMYDTDAPAKYSDNTGLSARVGKLNPAWNE
FT                   DSSPATQMTQFTKAVALTGSEFDDAVKYYGLSWLPARKHVEQALDTAKEVHPSGEILKL
FT                   PCYCPWKDHLFELEAERGTSPLPKYALYEDDKGNWRIQAIPLMPSSFENRKPLPAAWRG
FT                   IRDSALDELSGIEGCIFVHAAGFIGGNKTYEGALAMATKALTMD"
FT   CDS_pept        439871..441286
FT                   /codon_start=1
FT                   /gene_family="HOG000061736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631587"
FT                   /gene_name="FUM-2"
FT                   /orf_name="MICPUN_96474"
FT                   /product="Fumarate hydratase"
FT                   /function="fumarate hydratase activity"
FT                   /biological_process="fumarate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="tricarboxylic acid cycle enzyme
FT                   complex"
FT                   /protein_id="ACO64785.1"
FT                   /db_xref="GO:0004333"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006106"
FT                   /db_xref="GO:0045239"
FT                   /db_xref="HOGENOM:HBG284369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI000199B2F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA29"
FT                   /transl_table=1
FT                   /translation="MGVVRVPADKYWGAQTQRSLQNFKIGGEKMPMEMLRALAIVKHAA
FT                   ATVNERLGKLDSRRAEAIRVAAREVIEGKLDDNFPLVVWQTGSGTQTNMNVNEVISNRA
FT                   IEMLGGVVGSKDPVHPNDHVNMSQSSNDTFPTAMSVATAYEVQEGLVPALRLLRDELDK
FT                   KSREWESIVKIGRTHLMDAVPITLGQEFGGYAQQLRNSLLRAKAAMVHLTELAIGGTAV
FT                   GTGLNSHPRYAELMAQEISVLTGLPFVSAPNKFESLAAHDAQAALSGMLKTMALSLLKI
FT                   SNDIRMLGSGPRAGLGELNLPENEPGSSIMPGKVNPTQCEAMMMVCAQVVGNDMGVTLG
FT                   GAAGSHFELNVAKPLIAFNNLQSIKLLSQASVSFAENCVRGIAPNLERIDELMRSSLML
FT                   VTALNPHIGYDKAAKIAKKAHKERTTLKEAGVSLGILTAAQFDEWVRPELMTSPEGEGA
FT                   GHAGLALASSSRL"
FT   CDS_pept        441369..441773
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631588"
FT                   /orf_name="MICPUN_59928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64786.1"
FT                   /db_xref="UniParc:UPI000199B2F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA30"
FT                   /transl_table=1
FT                   /translation="MTNELIPIRSLHDVRARCFGVRRIAHVVEQRKSRLTGSGGCRRRE
FT                   RKLPELRRQLLFCHVRATNADCIPALLPRRSNIRCTRSSSCRRRCRTISANFTRLFICN
FT                   DQIPNASVEFIFEKKKQSMKFTHSKPKSTR"
FT   CDS_pept        join(441898..441987,442120..442383,442736..447544)
FT                   /codon_start=1
FT                   /gene_family="HOG000222975" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631589"
FT                   /orf_name="MICPUN_94662"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /cellular_component="DNA-directed RNA polymerase II, core
FT                   complex"
FT                   /protein_id="ACO64787.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005665"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="HOGENOM:HBG499785"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="UniParc:UPI000199B3A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA31"
FT                   /transl_table=1
FT                   /translation="MSVIDRFPHSTAELRRVKAVQFGVLSPDEIRKMSVCEIETAETYE
FT                   KGRPKRGGLSDPRMGTMDRAMACETDGMNSTDTPGYFGHLELAKPVFHYGFIKNVVSVL
FT                   RCVGFSSSKLMIDKNEDPKFAQIMRIKNNKQRLRKFTDACKTKTICPATGTPQPQYRLE
FT                   GMKITAEFKKLEEDDYLPDGGERKQVITPERALNILKNISDEDCRILGFDPEHAHPSWF
FT                   VLQALPVPPHPVRPSVAFDSSTRSEDDLTVKLMEIVRTNKNLQRQEQNGAPQHVVQEFT
FT                   ELLQYHIMTFMDNTVAGQPRALTRSGRPIKSISERLKGKAGRIRGNLMGKRVDFSARTV
FT                   ITPDPNLMLDELGVPWSIALNMTYPETVTPYNIERLRKLVENGPHPPPGETGAKYIIRE
FT                   DGQRLDLRFMKRESDKRLEYGYKVERHMINGDCVLFNRQPSLHKMSIMGHRVRIMPYST
FT                   FRMNISVTPPYNADFDGDEMNMHLPQSMETRAEVQELMMVPKMIVSPQANKPVMAIVQD
FT                   TLLACRLITKRDTFITKDVFMNILMWHTNWDGKVPKPAIIKPEPLWTGKQVFSMFTPDV
FT                   NVIRTSAWARDADDMDFSVDDVGVRVERGELITGIMCKKSMGSGGGGLIHTIWEEWGPT
FT                   AARDFVSQVQWLLNYWLLHYGFTIGISDTIADDRTMQTINDTITKAKSDVKEVVAIYQR
FT                   GELEMQPGMTAQQSFEQKVNQILNKARDNAGNSAQTSLDDTNNVKMTVTAGSKGSFLNI
FT                   SQMIACVGQQNVEGKRIPFGFTDRSLPHFAKNDLGPEARGFVENSYLRGLTPQEFFFHA
FT                   MGGREGLIDTAVKTSETGYIQRRLVKAMEDIIVKYDGTVRNSAGDVIQFLYGEDGMDAT
FT                   YVESQKIDTLRDSREKFRKRFHMDPDEPGFGRGWMSEAQVNDLANSAEKRALLEEEWER
FT                   LLKDREELRRTMSTGDQNVHLPVNLKRIIWNAQNNYRKVKDASSGGSRGGEELQAVHVI
FT                   ESVKSMLNGLVVVPGRDALSVEAQRNATILFFALVRSTLSAKRVMSEFRLSPAAFNWVI
FT                   GEVESRFKVALAPPGDGIGTVAAQSIGEPATQMTLNTFHFAGVSAKNVTLGVPRLKELI
FT                   NIAKKIKTPSLTVALRKDLAGDRAMAKNVQSILEYTTLHSVAAASEVWYDPDPTDTVIE
FT                   EDKEFVRSYYEMPDEDVDPSRMSPWLLRIELNREMMVDKKLLMADIAERINQDFQEDLS
FT                   CIFNDDNSEKLILRIRLLDNEMGDKEAGPSTTEDEVFLKKLESQMLTNLALRGIPDIKK
FT                   VFIREANVMGLDPVTETFTKKSEWMLDTEGVNLLEVMNHEDVDFTRTTSNHLIEVIQVL
FT                   GIEAVRNTLLKELRGVIEFDGSYVNYRHLAILVEVMTYRGHLMSITRHGINRVETGPLM
FT                   RCSFEETVDILLEAAAFSERDGMNGLSENIMLGQFCPLGTGEFGLHLNEDMLKEAVDLD
FT                   LGLSEGGLGVGVTPGRGITPGREGAMSPSFLLSPTAHMSPFDDSMRFSPQGTDYGSHAG
FT                   GGQSPGYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPT
FT                   SPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPAYSPTSPA
FT                   YSPTSPAYSPTSPAYSPTSPAYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSLGLSD
FT                   ADAPTRSPTSPQYSPSTEADGDQ"
FT   CDS_pept        complement(447644..448462)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631590"
FT                   /orf_name="MICPUN_59930"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65135.1"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniParc:UPI000199B3A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA32"
FT                   /transl_table=1
FT                   /translation="MLGVGVRRIVSPVNANTAISEGAPPSVLPVGRLRRGFRSATCGGS
FT                   LIAAGIVTLTTLTLSRRSVAPSLRANRVSSMASSDGPDADRERELQGLWANAYDGWIDV
FT                   PGESGGAIYTRPVDAPGGVRTHVPFPPIVTASRLFALTGFNPMGEERPIAENRAANDKL
FT                   RADIEAMTPAPKAWWRAFGFAHDWREDGFVLAYEPRDGDAGEKATVDLAVKYGQGAIYA
FT                   YTAVNNAAGSLRRRTVPAAMGQTVEADVEVERCDRPGLKFADPALPDEEY"
FT   CDS_pept        448706..449383
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631591"
FT                   /orf_name="MICPUN_101399"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64788.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B3A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA33"
FT                   /transl_table=1
FT                   /translation="MPSIWRPNVRVTLDEYGEVEDTEMGGEELTKKGVKRKRAPRTKGP
FT                   CEHGVKWRSNCKVCSACPHGKWRSRCKECGGASICEHGRQRHRCKECGGSEVCEHGRQR
FT                   HRCKECGGSGICEHGRQRSTCKECGGGGICEHGRRRSRCKECGGSSICEHGRMRYQCKE
FT                   CGGGGICEHGRIRSECKACGGGSICEHGRRRSYCKECGGGSFCEHGRRRSQCKECRAVK
FT                   SET"
FT   CDS_pept        complement(<449576..>450451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631592"
FT                   /orf_name="MICPUN_75949"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65136.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="HOGENOM:HBG607317"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI000199B3A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA34"
FT                   /transl_table=1
FT                   /translation="WDRVLYRKQAFPDNHTDDTFLSGLVLNGRITPRVLSEVMLDAATV
FT                   SQQLAVVALKSTAVAHLLSGRVTARDLVAIDAALLATGALAVAAMHGPARAVRRCARVG
FT                   PAMLAAILALTPLFQTMTAAISDDTAVATAVCSLALHLLTHDYASLNSSSARLGSFVSL
FT                   GAAMFASAILTSRLPPAPDARSPLEPNAAVFADMTLAVALFVLLPSLRREAQRRGGPRT
FT                   AVRHVFATTCLHGAAMASVLALRGSMRDGNVTTLAVGYVAAVFGIVVVCPAWLVRMMGF
FT                   KEQINGPWDEA"
FT   CDS_pept        join(450587..450753,450907..453457)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631593"
FT                   /orf_name="MICPUN_59933"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO64789.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199B3A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA35"
FT                   /transl_table=1
FT                   /translation="MTWAQSWHLLAPHILGTAAEEEFKFEPRQRSHDRARRADSRRLSR
FT                   TDRPRPSRRRLDMLAAAQNAIQTSAQKKKRDELMFSPGRKKTGGGVDAAATARANRKIP
FT                   APVRDWPNLFPRESPGANAMLRTPPAATPRADRDTFAARTVGGTIALAGAQRKPRAPPS
FT                   GTVTGTPVGRRRDDANDENVTPAGHPGSTRPAGATRTPLGGASTIQRAAAPPAILRDPR
FT                   GGAATKPVARHPQTVARRMSFDGAGDDRRDDSLLPPAKKLRVTVAALEGLEDDGDDASR
FT                   QPPSTHRSATTTDGPAKCWLPRPKPGAGPPHPFRDAADDDDDVAPPALERPPANPFGNP
FT                   FAAAKAKAASAVARADAERAAAIAARPVPRTPGLRNLGNTCYLNAALQVLCGLEEFARA
FT                   AEAKPLADGGFDDGSVYSAVRGLVAARRASHERAIMRAAAAAAAESTPATSSLPAPRGP
FT                   SAVLSPAEVKTAVQRRHAHYAGNRQHDAHEFLCECLDALEEEVTAAYADGRLEAPEPKS
FT                   VVPLHATLCPTRRNFTTAVAATLTCESCGDACVRHETFRHLSVELPESSGADGSADVEL
FT                   ASLLDGFFTPETLERKCERDGCDGTSATLVRRIVRLPRVLVVHLKRFRYVRTTGGTKAA
FT                   ARGGGDDENARSDGNGNAPTQAEPAPAPAPFAMRMVKVTRPVKLPTRLTLEPFVGEDAS
FT                   ALRGPPPRSNHPVAAEVVRPVDSAPADATAVVPAGKARSKTLQQNGLLDENDDKTTTPA
FT                   VPRRLNLNLDLHEDDSKGAQGSSNPTPRGHPDSNDGGGFTPVDGGVAAAETTPEPRGAR
FT                   DEATAAVHVYPDDASPSGPDAKRQAGAYELRGVVSHVGSSLEFGHYVAHVFGPRRDGGV
FT                   GWTTFDDEAVDEVEEGRVLRDRTGCYVAVYALGD"
FT   CDS_pept        complement(453548..454642)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631594"
FT                   /orf_name="MICPUN_59934"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65137.1"
FT                   /db_xref="UniParc:UPI000199B3A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA36"
FT                   /transl_table=1
FT                   /translation="MLTPSVARAAARWGRRGLSAALASTARADFGLGTRSGSMRDDVRS
FT                   PPTLPAHLAPWTSPPGDAPASRRLASTKFGVKPARNRAPKPATEAARPNKSKGQSSTES
FT                   SVPLKDAMAKLVAKVHPDLFASGPAGAGETNDESLKAIQTVLDSVTRDKTTPNAGIKRL
FT                   KFFVHDDESPEGVRVVPFSFKTTGGDCRNLVARQLRDVMAKVGVPGDFRWDPGDWDVRD
FT                   SSGYVARRHNPWSNVKGVDYSNSDGGDNAAGGRKRGDLVAALKINDRLFEAIAAVPWIP
FT                   EPHGDDRVRAINEEIVPRLAKEGWALDRRVLERIWRGERDDASVMDGVDAASGLALQAI
FT                   VKHARAFDRAYGKPARERANFYPE"
FT   CDS_pept        complement(454929..460226)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631595"
FT                   /orf_name="MICPUN_114075"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO65138.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG557369"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000199B3A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA37"
FT                   /transl_table=1
FT                   /translation="MLGRWRLRARSRPRLPAAAFLLLAVVTSTFAPGVSDAAATDGVAR
FT                   LRHGVRPGELLLERRVVNVSSELAAERAGTKPAATQPAAAIERGRALAEGDGPHRRIGR
FT                   GSEDVRWRLLDDAAVNDDNDDHDGGRAWTDPGAFGANASRASVAQFIVATDGRDGIRSS
FT                   LASALRPFDGSFLAGVVPVASYIAVGGPAAAAAAAALPGVTWVGPLTPGDVAAAAWDRV
FT                   LNELPNAMASGNVSALLREHAVASDADSGRVLLEAVLPPTDDERGGVGGGNTAGGGGGV
FT                   GGAAGDDSFAAAAARAFERGVRSASGDADAFARVAGRGGKVIVGVLPSGLNATVHWLAS
FT                   SRATQWVAPRPAASTRGRPLRRLTNREASEVVQGAGLGASPFHEVGITGVGQIVGCGDT
FT                   GVDVRHCAFQQPGKFAMRRSISDDEIDTDGHGTHVAGSIAGALTDHDSFGPYDGVAKDA
FT                   GLAFTDIGSLAYDVCSKNSWETCLYIADTMGEDYYEHARVAGARIHSDSWGWSSKYYGQ
FT                   EVREIDEFAWRNPTFLPMFALGNDGRNAQGIQYGDGTVVYYADGRYTYGAPANAKNILG
FT                   VGATLSSNSGSVSLGYFEDTNTYEVDIGGPMGKHWEHFKIRGYGGLPDLSSPPGGSHAI
FT                   DQVALAVADPLDACDALANDVAGNILLIRNGTCDYAAKVQNAVDAGAVGVMIFGRYYLS
FT                   GPIRFMSGSSEDGTSAYRGNVPTIPVLSIPQRDGELLAAMTEEYERLTVGVRGPIPLSE
FT                   TRHENLASFTSGGPTLDGRIKPDVVAPGHNIISAYPLTDAQVASGDTCGAVKMSGTSMA
FT                   TPVAAGAMALLRQYFTDGYHPSGAANCHDGFEPSAALLRAVVINGAQTMTGFEQRYEWK
FT                   NGRYYAWYAQPIEPAPSPRQGWGRIDLAKSVPLPSALNPDASTTVANLVVLDGVDGLAF
FT                   TASNQARGVCVHVAEQTNDELRATLAWTDPPAAIVDGGALVNDLDLILYHLPEETDAEP
FT                   TQLWPLNGAWGTWDDTNNAERVVWSSPDAGRYWVEALAWSLDGGDQAFALAVSGRFERW
FT                   GGDELTREGCLTNERFPAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPPPP
FT                   PSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPP
FT                   PPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPP
FT                   PSPPPPSPPPPSPMPPPPSPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPASPPVTG
FT                   RAVDGYLARCPVFVDVDGDGLPGRDEPRATTDRLGGFAVPRTDSWRRGGSHAYVVVAAA
FT                   GDPDCVDSFTLAAPGMSRLTSAEPVDPTEHDDGGVVMVTPLTTVAAAIAKRRGTTTGDA
FT                   KAMVNDALSLDASIDVSRVDPVGAVADGDGHELVVATSLVANLVSALSALLTPACGGDA
FT                   GQAETFVLNAVADLIHDAGTTGGDFRGRRRILDGHVDLESTRTVSALANDSIEGAVAGG
FT                   VVGDAINAISAEAVAAVAEVSVGSARVLRAAAADGAGLHPDDPMAVVRSASAVAAVMQG
FT                   PGVRGAIAEVAASGGGSNLANCPGFAALTELSSPGKMAAAVTVAELSLPAIEVARAPPM
FT                   PPPPLMPPPPPLMPPPPPDERDSSVEASSRTSAMYESSDVVPESKKAPSFGVVVGVVVG
FT                   AVASVSCALAACRGRRTGREQRGAYRVDAKGRRVIGGGASSSFIAFDVDRATQLAAAGS
FT                   PREGFARRG"
FT   CDS_pept        complement(460572..462092)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631596"
FT                   /orf_name="MICPUN_108576"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65139.1"
FT                   /db_xref="HOGENOM:HBG318269"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniParc:UPI000199B3A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA38"
FT                   /transl_table=1
FT                   /translation="MFLSALAPAAASLFAPAATRDAPKATNVVRGGAHLTGGRRRVRAA
FT                   SVALSRPESLGVGSTLTAMYATHSTMASLSGRHAASFAPRRVRRGAVKVAAAKGSDSDS
FT                   SSNPKRPDPTFQGAPMSPGSGHGQMLAHVLDAEPQLFEAAVEATLDRMIDELDQQEQSE
FT                   GSIDVSQDEKDKGGMVLFRRIEQMRALERRSGVQDVMYANILQKFLSIGVDMLPPLDDE
FT                   DVLLRGVDLTKLTSGVHSVEALEMVKEHLMGMLGPQASNAYSNTLVRMSKLQCAQMYAA
FT                   SIMFGYFLRKADKRFKLDRAMGTLPMNPLDSAKALEELFNSASAMDSMDEADGAGVGGF
FT                   ANSEFPGASGVFDVDDKGNATEDASKPGAQNNLTLKQYIQSFDQNALAETARIVSMEGV
FT                   TLAERQTGALFGSIEDLAMEMQRALEEGGEPITSPDQLMSRVQDVVGGGKVKTLTLPVA
FT                   TQRRVVLEAVAFGTFLRDAETYVDTRDGRLLTPVSRGPEPPGLIGSGA"
FT   CDS_pept        462613..464163
FT                   /codon_start=1
FT                   /gene_family="HOG000264837" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631597"
FT                   /orf_name="MICPUN_59937"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64790.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561884"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199B451"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA39"
FT                   /transl_table=1
FT                   /translation="MSTTVAASVSMRAIVVTRGTPTRRGVASRATFRRGDSLATRQARP
FT                   HAGAWRRGIRNVDHVGEPSRLAARAGLFSPFRVEVPDAIDESPDDIIRKKKDTGKKLRL
FT                   RIDGVWYDCTGWARAHPGGALFITLMDGCDATDVFYALHSYGPNGDDTAARRLAMLPTC
FT                   LGPDEEPDEQFGSSEDKNSSGVPTAYGTLPDTGVHSNDNLPGDANPAFATLRKKFDDEG
FT                   WFRRDPLKEAAVLGTTLGLYAIGWFLANSHPILAACSIGLGMQQAGWLAHDYIHGRGKW
FT                   CSMMRGFGSLTNGFSTEWWQHKHNMHHSFTNIDGRDGDIKLEPLYFLQSPEVTGRPDNP
FT                   GFRRWQHWYGYPLYAFTYVLWRRHSLASAIQRKDKKELALLAVHYGWLFGCLPLSVAIS
FT                   SVLLGGFLVGALVTATHQTEEIMFEQAGEFVDIQFRSTREADVDGLERWLWGGMDTQLV
FT                   HHLFPTMPRYRHHAARPIIQRWAAEHGYDFRISTAKEIIEKNWTHLKEMAGVKIPAHI"
FT   CDS_pept        join(complement(465807..465866),complement(464317..465648))
FT                   /codon_start=1
FT                   /gene_family="HOG000246356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631598"
FT                   /orf_name="MICPUN_59938"
FT                   /product="Predicted protein"
FT                   /function="glutamate-5-semialdehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="ACO65140.1"
FT                   /db_xref="GO:0004350"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG318080"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniParc:UPI000199B452"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA40"
FT                   /transl_table=1
FT                   /translation="MGMSTRDQAVAARNASRQLQNLSSEDRAALLYAIADALEANEDAI
FT                   MRENEKDIAAAEAADTESHLLNRLKMKPGKIAQLAAGARQIADMEEPLGRQLSKMKVAD
FT                   GLTLEQVTAPLGVLLIIFESRPDALPQIASLAIRSGNGLLLKGGKEAAKTNAILHQIIV
FT                   DCMPAFGVDRECIVLVEGREAVSDILALHDVVDLVIPRGSNSLVSYISNNTKIPVLGHA
FT                   DGVCHMYLDPNADVKMAAKLAVDSKTDYPAACNALETLLVHKSLIGKGKDGYETVAAAL
FT                   VAAGCTLHGGARAEKALKLPACPAPRHEYGNLGLTVEIVDDMDQAIDYIHANGSGHTEC
FT                   IITNDKAAAEEFLRRVDSACVFHNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGL
FT                   LTTRWLCRGDGHFVEKDTGVKYTHQKLPLDANLAHKVASGLGWAVGIANAVHLGLMLWK
FT                   MATKK"
FT   CDS_pept        466028..467098
FT                   /codon_start=1
FT                   /gene_family="HOG000262433" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631599"
FT                   /orf_name="MICPUN_50930"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64791.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B453"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA41"
FT                   /transl_table=1
FT                   /translation="MSTSLTSLTSLRVSIGNRPERRSARAAVRGSGSGRVRPSTRSSST
FT                   LHVVRAESSSTPDAVDGGVSRAGRREAISGALAAITFASNASIASLALADDDVVAAPPA
FT                   APVSVPPKILVVGATGQTGQLVVDELRRRGGAGITAAVRSPEKASKLGIDRGGVELLPG
FT                   FDVTAPADVLAGPMKGTDVVVICTGFVPGNPFKMAQAAHAVDNEGVVHLVDAAKAAGVK
FT                   RVVLISSILTDGRAMGAADSPGFKITNAFGGVLDEKLVGEKHLQASGVEYVIVRPAGLR
FT                   GEPPKTQLVATPGNVMASGEVSRELVARVMAEAAFAPSAANKIVEIAEEGTFAPGYTPE
FT                   GVEGYLVGDDKSRWFP"
FT   CDS_pept        complement(467192..469456)
FT                   /codon_start=1
FT                   /gene_family="HOG000268796" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631600"
FT                   /orf_name="MICPUN_83331"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65141.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B454"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA42"
FT                   /transl_table=1
FT                   /translation="MNRDRRAIDDRVGKASDGDASAPAKRAEVRDGPPDESPRRTKIGL
FT                   GTLDSTLDSSSSFRLRAPNADSPHEARPVHPTQPLSLEELLKKRKEDAEAKAKPTFMSK
FT                   KEREEAALKRLAEQRAAAQARRDGAINGVDAGDWARERRREEERKREAERRRLRDEKAR
FT                   EAELTQLKEAYMGAEKVKKKVVKASDRFKFKFDWESAEDTSRDLNPLYDKKHDAALLFG
FT                   RGLRAGVDRREQKTQNAAHQMNLVSRSRADAGDAMTKAEVRRWDSRRRDEDEAYERAER
FT                   RMASKHWSDKALDEMNERDWRIFREDFNITTKGGRLPLPMRSWEESTMPEQVKRAIQKV
FT                   GYAKPSPIQMASIPIGLLKRDVIGIAETGSGKTCAFVVPMLAYIQELPPMTDEVAALGP
FT                   YALVMAPTRELAQQIEEETVKFAQFMNYRVASVVGGQSIEEQGFKLRRGCEIVIGTPGR
FT                   IIDVLERRYTVLQQCNYIVLDEADRMIDMGFEPQVISVMDSMSAESLKPEEEAEKIDEQ
FT                   GLEASLGTKYRMTYMFSATMPPSVEKLARKYMRNPAVVTIGSAGKTSDLIKQIVQWTTS
FT                   NQKPAQLELVLSQYPDTQAIIFVNTKRVVDHVSNLCFKMGYSVGAIHGGKSQDQREESL
FT                   RGFKQGEYDILVATDVAGRGIDVKGIDLVVNYEMPLVIENYTHRIGRTGRAGRQGTAVS
FT                   FLTSEDTDVMYELKELLTNSGNHVPGELANHQAAKVKPMRDAKGNKMTRDQYMGMQDII
FT                   H"
FT   CDS_pept        470025..470501
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631601"
FT                   /orf_name="MICPUN_59941"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64792.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B455"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA43"
FT                   /transl_table=1
FT                   /translation="MSTIWRPNLDRLYASVAEMEGSESEMEEKDATKKGVKRKRAPPTK
FT                   GPCEHGVKYRSNCKVCSGCPHGKWRRFCKECGGSQICEHGRERSKCKECGGGSICEHGR
FT                   QRSQCKECGGSQICQHGRRRTQCKECGGSQICEHGRQRSKCKECKSNRSTQRRQ"
FT   CDS_pept        complement(470647..473523)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631602"
FT                   /orf_name="MICPUN_101404"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65142.1"
FT                   /db_xref="UniParc:UPI000199B456"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA44"
FT                   /transl_table=1
FT                   /translation="MARVEPRVDDDRASLADAAASRCRARADVVRDALASAHREFTARG
FT                   TLDEPLVSAALDAFDGRIARAVAHDAPALGGFVDATEAQLLKRDHGAALSNLLAFARAT
FT                   AVARSRLAVDVASSSPHERARLHETTGEGGLEGGPGAALELMLLFPRAENARAALLAHY
FT                   SDELTRCLDGIDGASRAGDDAKTAVAVGAVFWLARRLDVRGTDAKPHAPSFDEIERVLT
FT                   PMVRARAATEAAAAFSPTAGAGGASSSSGIAELAAKLAAVAAAARAQLSCLSSLPERPG
FT                   GEFIARVYGAPAAAVVGEALDDVLDAMTRHPTGDDADGGGGGATGSVKNSLKTEEEDDE
FT                   DGKAAHRACVAGVRAWATVRAVADGFALVTLPAAVNDSLDANAWRPTLAIRDSLTARVA
FT                   FVLEAAFASRRETYECTLRRFAFPSAATLLKPLRRFDFPHGVRTPATTPAMKASEVWNA
FT                   CAGALREAAAVVSAIVASPPRDEGVVDVVRNGRNGRAGDRAAGVVATCVACLERVALVA
FT                   EYALRGDLNVTDDVTAQSFQMGFDDAWTVMSAASRARRLARGCEAAVTEGSPVGWSHGG
FT                   SDTGSDTGSAFTGSESRVVAAAKTAAALATKLDRVAGAAEARAIRALLRPATMTLEGAA
FT                   SQPWRWHRKPECMPNEPPWSPHVDAWATSVDAAAARLARVKSRDVSGARMIAALATLAA
FT                   AEAAGVYLRTTPSRAWRDRFAWDCRRVATAIRDVDVYVYDASSVDAQGRYPVGESDSLG
FT                   RSRRVAIAKALVTRAALLRADVHEVIELLPELAAHVGLGMAKVATGHGADDVASIARGH
FT                   PWGPGPSPEELWDEEELWDQEVDGGDGEDGDGDGDEKSAPGDPWRWLPRDAATRPRPTT
FT                   SAEVLELDASWRAAEDALARTAPIASVHAALWRRSELADDDQTPLDEAEAAGKEAVRAE
FT                   IERRGGGVAAAGADDGGFGGWGDGVEFY"
FT   CDS_pept        join(473868..474728,474761..474784)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631603"
FT                   /orf_name="MICPUN_59943"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64793.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199B457"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA45"
FT                   /transl_table=1
FT                   /translation="MSAPSPPPPRPPLPPPGVDQSAWPAPPKCPGSALCDASGADMRRQ
FT                   APKVFDVVFHTTTGDVRVRAWRDLAPAGADRLYNLARLGYYDSSPLYRILPGFVAQFGV
FT                   AADPSVSAVYDWRKNSPGAILPDEPTHASSSGNAKHWISYSASYDSITGTATNRTAELF
FT                   INLADNRDRLDAKGFAAFAKVIQGEGAVDEWFAGYGEMRGACDLHRDRGWVCDGPEETQ
FT                   LYARGVGYVNSDFPRLDRIGRCDVDVDPKGADVDDGIEHLSHLGSHSATSWLAIALVCV
FT                   CGAGAWGAAGLGG"
FT   CDS_pept        join(complement(475454..475529),complement(475018..475322))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631604"
FT                   /orf_name="MICPUN_101405"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65143.1"
FT                   /db_xref="HOGENOM:HBG607346"
FT                   /db_xref="UniParc:UPI000199B458"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA46"
FT                   /transl_table=1
FT                   /translation="MASKVAGQFAHMKNLAADFVRAKPNLFELAKQLPEYGVGARFART
FT                   RWEHRGAPDSYWTVSRMKPKPSGRAGRAWGTLTWKGEAKEGVRRIPGSMKAGIWRVLEE
FT                   PKTMSGPKLSKPEPSEEAAEGQ"
FT   CDS_pept        join(<476864..477147,477187..>477598)
FT                   /codon_start=1
FT                   /gene_family="HOG000032289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631605"
FT                   /orf_name="MICPUN_76186"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO64794.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG610406"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000199B459"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA47"
FT                   /transl_table=1
FT                   /translation="PKAESLAEPRKIKRLTRGEREKMGETYEWTAWVSTCGVVSIAITA
FT                   TYLRLLREVSDTGAFPWSELVAQLALIAGAAVGMEFYARYAHKYLWHDSLPIWLLHESH
FT                   HLPREGAFEANDIFAIANGVPAFALCAYGFLTPGLFGGLCFGAGLGITLFGIAYMYVHD
FT                   GLVHKRFPTGPLGKLPFLRKIAAGHTIHHTEAFDGVPWGLFLGIQELEQVPGGLAELEA
FT                   VMEAADRKSA"
FT   CDS_pept        478629..479075
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631606"
FT                   /orf_name="MICPUN_59946"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64795.1"
FT                   /db_xref="UniParc:UPI000199B45A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA48"
FT                   /transl_table=1
FT                   /translation="MSPAPALALTDEAKAALMAEARAKAAAQAQAQAPIAAAPPATSEQ
FT                   TSRFITAPELSDRDGIDARNLTRGDADADGFAAATYDAASAPSDASSEAAAAPPTATYV
FT                   APPPGALPEPENPENVNAGGGVFGLFQSGGGGSEEPQGKKFGLF"
FT   CDS_pept        join(479312..479330,479523..480166)
FT                   /codon_start=1
FT                   /gene_family="HOG000238746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631607"
FT                   /orf_name="MICPUN_59947"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64796.1"
FT                   /db_xref="HOGENOM:HBG561888"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniParc:UPI000199B45B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA49"
FT                   /transl_table=1
FT                   /translation="MSDLDWDDDEFEVAEIKKEEPKKASTFDDEEEEEEAPVKKAPASK
FT                   PKPAKKETVEYVDETLADPVAEKLRRQKLVEAADLAAAKELFGTDGEEIDLTTYAPKSE
FT                   KEFAKYGNLVATKYMTVVKDSAFYKETVKSFLKNALRNSSAAEVKEIEASIVAIRNDKV
FT                   KKEKADAALAQKAEQAEKAKAGKGKKKFLNQGVKGANSGLDDYKYDSYTPDDDYDFM"
FT   CDS_pept        complement(480305..483757)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631608"
FT                   /orf_name="MICPUN_59948"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65144.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B45C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA50"
FT                   /transl_table=1
FT                   /translation="MGKKTKSVNNKQSTGIDFIRAKKKVGRKIRKQANETNTEVRAKRI
FT                   NLSVQSLGTEGKGDQVTGRGLSMPELLNQCQHYSARVRKDALDGIKELLETHPTSLVPC
FT                   AATCVEKVAERLVDQEQIVRAAARGALRSGVLPALGPHGIAPFARRLVLHVGAALTHVA
FT                   PAVRRDAPAVLEALLDASPRLVGAHAPAATLRHLAELLRRGDDAASSSLVSGASDGSVQ
FT                   IVAGGLSAKFGDMTAARVGPTQPPARLGLLQSCRRFLEVLVGATTAALDFDTGEGYDKV
FT                   TAKGAIIAGGGHRWRWGDDDGDDLDGLDGLDGGPDGKENSRTRRAGRAEGAGVALHAAR
FT                   CARAPVSAARAVEEFFGSSSGGRRSGRVANGPGDGREGVAVAAAELAALLFAVWDEATP
FT                   TLKDAGGPNLTRVRVMAEAMSCMHLCLWLVDDDGDGGDGGGGGDGGGGGSGAAMAAALP
FT                   YLVARVLPMFPASAPPVGDVSVRGALVRLNAATARILSAASEGAAKVAAAAAEDAARAH
FT                   RALVTYSGEMMDLPSAPSAPSAPAHVAPTWRWNHAASVVDVDAADRATSAVADYLSAAL
FT                   RGCALDAGPCGEAEPTREGDYGDLLRMARSVLLRPALYGGGGELGGGVDSDGGVDERGT
FT                   DVGASDGDEETRDGDDETMWDGYPTGGTDAAGSRAALAHSVGAVWSEAVVSGPPEVRGA
FT                   CVGLLAAVLPRVAATTRGDGPGVCASVGADVAAGWLRPYARLLWELKHGDPGTTSRALR
FT                   TLHAVAARCSGEGGDSGDESPLAAALAAVETELAPFFARVPPPASTDQTAPRRRGKPGP
FT                   FSKLPAACQHVAIALLGQLPRLSPTTLRAAAHAALNEDADPNIAVRAAEAMTCNMRAAP
FT                   LALSVSFLSALLTGAGSWRGARRAAPAAARALVGVGDSASPWAGASLAWPAVNLAVVRA
FT                   ERAGDVEGARRARFGVLVLAALASEARRAQREAKEAGSKEASAPVEGAEERVSALDVDA
FT                   EAAVVAWACDGFATAPGGSDDGDDDLRGASARLARSDPGWARSALRRLRSTRVQPAFNP
FT                   RSTSATNEGGEAADTAGEEGDGGDASRCEAVVYAASALAALAGDVLPEETVRELAGEFI
FT                   ATMRTCEEAADACVRDELPGSARAARAVRAAKLALDGVVGGSA"
FT   CDS_pept        484184..484693
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631609"
FT                   /orf_name="MICPUN_59949"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64797.1"
FT                   /db_xref="HOGENOM:HBG607356"
FT                   /db_xref="UniParc:UPI000199B45D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA51"
FT                   /transl_table=1
FT                   /translation="MSSAVCATSARVVAPRAAVRARASSERRPVPAPNRRSMLASVPAL
FT                   LLATGARPAAAKAPPEYYDDTMEIIALTKSIISGSDLSEANIADFQAKRDVWYNNYQLH
FT                   HEKGVGYGYANTFNAQAKVGFQLRVCAEKGEPFDPDHTVYNKDYLLEILDRGKAALDEM
FT                   KAAGQL"
FT   CDS_pept        complement(484897..485607)
FT                   /codon_start=1
FT                   /gene_family="HOG000077684" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631610"
FT                   /orf_name="MICPUN_59950"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65145.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniParc:UPI000199B45E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA52"
FT                   /transl_table=1
FT                   /translation="MNHATLATAAAGITVRVTRGRALRGTRRPARARPLAPPRAAKDGD
FT                   RLDAPSSALNSSRRVALGGAALATLLATLPTRDDAVASDAGDWSSPGLAAEDPLPDVKY
FT                   VKTGDGLVYEQVNQGAGEPAKAGDVAVFHWIIRRANGYFIYGSIDCGIGCGNGDPSEYR
FT                   LGPDGNLIAGLDELLTGMRPGEKRRALVPPALGYVRKGMEPQPPEFGQKRQVEAHANEP
FT                   LVFEVKLIKTRTGA"
FT   CDS_pept        complement(485894..488695)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631611"
FT                   /orf_name="MICPUN_59951"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO65146.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI000199B51C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA53"
FT                   /transl_table=1
FT                   /translation="MAPTIERRVRKLYWEGKQYVDDYLAGVDHGELKNLGALCANWAAV
FT                   SVAVTTLICLFALGQAGKGVLTTWYLFVSAVALSSCVFTMTIFGYCRGYCKRTLEQLEA
FT                   RAKGGPNAADPKKLKVCGQCDAPFANQRTNPAGNRWICASCGMISRKPKLATREELDRS
FT                   KAAGERASSSSADRSPRDSEIAAQEAEERRQAVKQTKDLRRRHAREIKEAREAADREER
FT                   EEIARLIEEERHRVMTARAEEELERRRVEEEERAKREEEEEAAARCAAEEEMAAAKAKA
FT                   KAKAAEGTAERAAAMTRRHTSLTKIPAPRPINIPPPIPPPAKQQQQQQQQQQQQRAAVP
FT                   LVAAAKVGAAPVPARPPATPRSSAPATPSTPDFDPPLPPMRPMQPPAAAAAWGGAVAAG
FT                   GSPHAPVSPHASTSPTASFVAGRSPAERSPPPPPGGRSPPGFDPLLGVPESRRSWPGGA
FT                   LGGLGMGAAGIRGILDGEEEVAAVPVAPPPPPGPPPGYAVGGAPPLPAGPPPNTAQRVG
FT                   IAAPGQPPLPPMPHPSQIKAAAAAEKGGNPRAFLASLELAAYAPVFDRERITLADISLL
FT                   TEPDLERLGLPLGPRRRILAAIAGVNIGTPGGGTSRQYHLPEQPQPVVPPGMSAVVAPN
FT                   PFRVARTSSVDGDAAGAAGATVPAGGVSGWNGGGFGGGLFGGFAPSAPSAEQPLQAVGP
FT                   PGPTVPTVATAPTYNHSRQRSRSTDSDALAMDTLENDLMALTGGLNLDDDDDDDLGLPP
FT                   PIVEANTGDGVTIGTTDTTTAPAATDGSISPPPRESPPGTPPKPPSHSALDSLDANGVP
FT                   PTDAATNKHAHAQQHREATDPPKPPSEMMVKAAARLRAAAAAGHPIPNEFVDCITCEVM
FT                   VDPVIAWDGHTYERDPIARWLQRHSTSPMTGETLPDFTLRPNHSMRSQIINYGEKLARE
FT                   GGH"
FT   CDS_pept        complement(489128..491737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631612"
FT                   /orf_name="MICPUN_59952"
FT                   /product="Predicted protein"
FT                   /function="DNA photolyase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO65147.1"
FT                   /db_xref="GO:0003913"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="UniParc:UPI000199B51D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA54"
FT                   /transl_table=1
FT                   /translation="MACARLHAALMARAPPSAPSRACARDLGHRARTWSLRPHSRRRFA
FT                   SAAAAAADHDADDAAAAGARTIVLEAADAPRSPPEASAPRGAVVWFRQDLRLDDNQAFR
FT                   AAVRAANRRGGEVLCLFVWSPDEEGNDEGASWAPGEASRVWLHHSLDALDRDIRRRYGG
FT                   GGIRFAAGEHASAVAAAAADVNATAVFASARYEPAHVEGDARTRRALAEGGIELITLPG
FT                   HLLFDRDKIRIDMERERYFFGTLMPFVHAAEKFGGEPGAPSPAPPTAPIAHDGSGGAGG
FT                   VSTLASLGLIPPSDAARDWSAGLRAEWDMSESGASEAWAQFKRMGLAGYEATHGRCDLT
FT                   HKSSTSLLSPYLRFGQLSPRRVYSELRDARFGTAVDGVEGRRLSRTFWHRLYRREFAYW
FT                   QLGVFPQLAVTSWRSHYESRGDWRWPERDPAAAEDLRRWQKGETGFPVVDAGMRRLIRT
FT                   GWMHQTERMLAATFLVDYLHIHWSHGARWFHDYLVDADLAINSMMWQNAGKSGLDQWDV
FT                   FAGGLAPDGSARTHDPNGETIAQYVPELAGLPPGHLRHRPWEASAKTLANAGVTIGDTY
FT                   PARIVPDVDAARARMLTGVLEVRAREVAKAAAAAAEHAGSRSDDRSDDSYDETSRRTDV
FT                   LVDVFTGADYVVAPPGSTVAADGALFPLSTRKEFKRALAKAESGKLAAAMGAARDWALA
FT                   RLDVAATGAGARGAGGGRGCEPSADETGFARAADIGRKRSARAAAAGHSHSHSHSHGGH
FT                   SHSHSHGGHSHAPGEAIGHAHVGHTHGGGAAGRRSGSRSQGRKTPRSTGGIEHRSSSWA
FT                   KGGGSGRKAAKGLTAKEVERKKVKAGRREARELGRAWSSGLGVGDVEGYGDESSDWD"
FT   CDS_pept        492844..493401
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631613"
FT                   /orf_name="MICPUN_101412"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64798.1"
FT                   /db_xref="HOGENOM:HBG561891"
FT                   /db_xref="UniParc:UPI000199B51E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA55"
FT                   /transl_table=1
FT                   /translation="MRGKIVREAPGAYHAFLGTHLSSAKEDTATHRAGNVGVEHASVEN
FT                   LRNAVAGARRAACAGGSAGVSRREFSREDLERWGLCGPNSGAPDPRWSAFGGVGERRRL
FT                   VGEYLGVGECDAKQLVRQLNLFFTRAEAEAALSMLPGEGESVPRKMTDGRADRMAKLNE
FT                   DDEEEFDLYAYYPPGVAPPGFE"
FT   CDS_pept        join(complement(493784..494059),complement(493543..493635))
FT                   /codon_start=1
FT                   /gene_family="HOG000238234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631614"
FT                   /orf_name="MICPUN_59954"
FT                   /product="Predicted protein"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="ACO65148.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG318653"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniParc:UPI000199B51F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA56"
FT                   /transl_table=1
FT                   /translation="MSQYVARATGVAKQAAETFSKRVVPPAVDYYNATMARNAEYVVKD
FT                   PAAVDKLGRQLVFSNLAKLPGMVEGARAEVNIVKQKWAGRMDLPMAEVGTAALFAGEVY
FT                   AWFCVGEIIGRGGSLTGY"
FT   CDS_pept        join(494302..494361,494714..494971)
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631615"
FT                   /orf_name="MICPUN_59955"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO64799.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199B520"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA57"
FT                   /transl_table=1
FT                   /translation="MVKMIESAEEFATLKKGDKPVLVDFTASWCGPCKKIGPFFEELAA
FT                   KYPDVVFVKIDVDDLDDVAAECGISAMPTFQLYSNGVKVQEMTGADNDKLAAMAAAAND
FT                   M"
FT   CDS_pept        495122..496474
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631616"
FT                   /orf_name="MICPUN_59956"
FT                   /product="Predicted protein"
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="ACO64800.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI000199B521"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA58"
FT                   /transl_table=1
FT                   /translation="MFSACLPRREPLTADNFPSGPSAPESSRPAGAFDAPHACDASSSS
FT                   LDDDGPHDRVCVIVNVRAPGAKTAVKRLKRLHGVEVLVMDSKSQERLLRRLEELLVGSD
FT                   GNDARDKDDGHGRGGRIRFLAGGGDGTIAAAASLIALACERAGIAPELRAPVAPLPLGT
FT                   GNELSRICGWGALYAGAPLERIVRDVSRAYLAKLDMWTATIAPNETEPFGGGFDDVHDG
FT                   RRNESLSTQRTRERKFCCFFSVGFDAHISHRFTRRRERDPKSCATAWQNKAWYAYYGAA
FT                   EFVAGGGRLLGEDGKPSVELWVDGRRIHVGRDLNSVQVFNIHSSADGVDFWGTNRASVK
FT                   GELPDDAFAPPCVGDGMLEVVGTRGVSDLVAARGGFAHSRRLAQGRVVELRTSAAVAAQ
FT                   MDGETWVLPPSSVVITHAGSIPLCVGPGATRNLRPGLETSGGGGGGCLMRL"
FT   CDS_pept        496791..497273
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631617"
FT                   /orf_name="MICPUN_108582"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO64801.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR015604"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199B522"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA59"
FT                   /transl_table=1
FT                   /translation="MIHFALLFSRQGKVRLSKYYKPYSQKERAKMVKEVTTQILARPSK
FT                   LCNVVEHRNLKLVYRRYASLYFCLAVDDTENELIVLEIIQHYVEILDKYFGNVCELDLI
FT                   FNFHKAYYILDEVLVAGELQETSKKLIARLVADQDQLVEAAKIGAVEADGTPLQNP"
FT   CDS_pept        complement(497404..497997)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631618"
FT                   /orf_name="MICPUN_108583"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65149.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199B523"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA60"
FT                   /transl_table=1
FT                   /translation="MDDSDLGFVDTVAGKLKKRKAVETPEQIEAEKRRREEEARAKIER
FT                   EARLAAKLEKENVKWKQVWPEGDLLQCYACVRRSGVGLCEWVNSKHQKVPRQFHPIMRV
FT                   PMCDACYIHYHNQDFQVNWNEESGKMEHDTCRLCATEGHLVFCGNPECAQAFCQDCILR
FT                   MVGQEDLDEILERDPWVCFCCEPKPIEHLEVRWE"
FT   CDS_pept        join(501082..501283,501453..501550,501687..502565)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631619"
FT                   /orf_name="MICPUN_101415"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64802.1"
FT                   /db_xref="InterPro:IPR018851"
FT                   /db_xref="UniParc:UPI000199B524"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA61"
FT                   /transl_table=1
FT                   /translation="MPRATRARAAKGALREKTDGETNVVSPSPDAKAVGAVKAVAAAAT
FT                   DAAEAVEEEWSMEREFREIDEELDKRCGEIMKNAEDFVVMIRKQLKKEIVKIPKKIRSM
FT                   SLKEFFEKYGDDLGEEMLTDVKVRLGLLPPDAARCLAPPPASPAKPVGDGETNPAPMPP
FT                   PPPKTAPPPPASTAPKPHASMPPPLPVFNAKDAAGDAAVAATPAGKRAKTGGLSDDVGG
FT                   SFAVPSTPKGAGVAGITRTNAGGPKIAVAQTPGTKRRVKRGEMLYSANGSPLGAVDGGA
FT                   SDEESPVVGAAPPPSAVKKITMSVRKRAREEDAARGDGGTGGMGGGGEGVGGGEDFAGL
FT                   VIQTDDGSEIDLGALDADPDKEGAEKALGVLQNLQANVAAMMAKLQGKQQQE"
FT   CDS_pept        complement(502645..504087)
FT                   /codon_start=1
FT                   /gene_family="HOG000201080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631620"
FT                   /orf_name="MICPUN_59960"
FT                   /product="Predicted protein"
FT                   /function="imidazoleglycerol-phosphate dehydratase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="ACO65150.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004424"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199B525"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA62"
FT                   /transl_table=1
FT                   /translation="MASSAAPFAAPFAVRGTPATNPGRRPSRAGAHRRSRGSRAPRAAV
FT                   AAPAVSWPDGTGRAELGGVLAEASVVNLGKRGEIATGLPFLDHMIDQLTSHCQLGVSVV
FT                   VSKDGVPCVPCVDASGDDDETVAVAAGFALGRALAQMLAPGIDAVADGAVPSNAATAEF
FT                   ASPLDEAYSTCVISLTVPGQGALAFDLAPYGPGAGRERIGKYRTSLTEPFWRAVVEASG
FT                   LSVSLTKRRGDNAHHIVEATFKSFARCLRKCMDQVEGIDVTEMNERLDGVTRAAGKARS
FT                   TKETTIDVRLDLDGSAAASAVSTGIKTLDALLGSIANEGGVQLNVDATGDLWIDDHHTT
FT                   EDVAITVGQVLNESLGDKAGCNRMGRADASVLDGEDSADADAAVVEVVMDLSNRPFLAN
FT                   GLEFRDEFIGDLSAEMIDHMFMSIAANGQMTVHVVEHSKGRSDADLAEASARAFGRCLR
FT                   QCIAVDPRRAGQVASSKGTLSV"
FT   CDS_pept        504262..505146
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631621"
FT                   /orf_name="MICPUN_59961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64803.1"
FT                   /db_xref="UniParc:UPI000199B526"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA63"
FT                   /transl_table=1
FT                   /translation="MRGEASEPVVLANAAARVACGSLSMLFIFTMVAFTTLRVFGLKRV
FT                   LVPRSGMIGVGVFWTIASSTYAVIWHDDPTTIAPCQPLHALLVNLPQQAVFLLSLRMRR
FT                   LVTTWGAIRLFGTFAIGVVLLNVAHEFAHGERETIAGAPKKDGSVEVLDVTDATVNLFV
FT                   AFARAAAGLLLVQGSSEREGANSAPRKTTGSPQELCLASCWCVMLVLMSLPRFGNESPW
FT                   GDPLGGARARGAGGVKAGERAWVVWYGFKASLYVLAQWGGLLAVKLSPSRLLDKVNSER
FT                   DREKEKADAKKRN"
FT   CDS_pept        complement(505247..507085)
FT                   /codon_start=1
FT                   /gene_family="HOG000243131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631622"
FT                   /orf_name="MICPUN_59962"
FT                   /product="Aminopeptidase"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65151.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG520709"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniParc:UPI000199B527"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA64"
FT                   /transl_table=1
FT                   /translation="MATSSCPAFVSAPRAAVIGAASRAIVARRVAPTGAKRRVASTIVP
FT                   RASADAPPVPAVDIPDTNDEWEAVSPVDFAADVSAALAADKVVILGKRGALRSPGFVAS
FT                   LPESLRTVWLEAVAAVQAGDNGGKRSIMVPWDNGGRLKDVLIGVLPTAVSRHNCPAAAF
FT                   AVNALLAGCQPPAHGQTLGVITALTSTSDAVPIAVAVARHFPTYTAKSVRGGGRGGVER
FT                   GRIALRGRVLVAQTCASPLSCDLDAETRARVVAVSRAVRLASRVVDTPPAAMDPDALVG
FT                   EAAAVAAELAGPTHGLDVSWDALRYDALKACGFGGLVAVGDAAARDGREPALVHVKYRP
FT                   SGGAPGSRLRKIALVGKGITYDTGGLQIKGKSGMPGMKTDMGGAAATLGAFKALCQLRP
FT                   QHVELHLVLCIAENAVGPGAFRPDDVVTPLSGRTVEINNTDAEGRLVLADGVAYASGTL
FT                   GCDDVIDVATLTGAQMIATGKNFAGVLSDDEAMERACVDAGRASGDLAHPLPYAPEFFT
FT                   KEFGSKIADMKNSVKDRTNAQTSCAGQFIANHLDRGWNKADPDASGEEETEGRIRRRWL
FT                   HVDMAGPATNKDGRGTGYGVALLVHLISGELYADGK"
FT   CDS_pept        507422..508066
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631623"
FT                   /orf_name="MICPUN_59963"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64804.1"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniParc:UPI000199B528"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA65"
FT                   /transl_table=1
FT                   /translation="MHAILAPVRALAPASARRVTPTARSQRRRVAVGRTAANAGPIVAL
FT                   GASVSAGDANVVDAKHARAVSEVAARWRTEEEGAAPATRAGRVEELDSTEMDSTAVAAT
FT                   ALFAAFAFAFFAGVDPAVAADSLDAIDAPREVFSLAGGEVPFWANMVKYARFSISIMVG
FT                   FAFMFGRPVVAALKKPQTAILVLGGGYGAVRFFQWTIETMSGVNDPMTMTY"
FT   CDS_pept        508493..509773
FT                   /codon_start=1
FT                   /gene_family="HOG000164315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631624"
FT                   /orf_name="MICPUN_108584"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /protein_id="ACO64805.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG382024"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="UniParc:UPI000199B529"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA66"
FT                   /transl_table=1
FT                   /translation="MGAASRAARRAGSEALRRWEASYSSGRAGIASPSPVSRAPPAHRL
FT                   ADIFPKKLVDDIYRSSFKSQTGVSLKYMMDFGAQPIQRQLMVSAQFLHNELPVRFAHRV
FT                   AELENLPLGLSSKEQVQTVRDWYVESYDELKKFPPIANREDEAKFTTLIKRVMDRHANV
FT                   VPMIARGVLELKLELEREGGEGGARLGKRGVENKWMNDMPEIHQFLDGFYMSRIGIRML
FT                   MGQHVALEEAAATAPQENYIGLICTKVSPVAVARDAIEDARSICMRQYGDAPEVEVFGD
FT                   ESFTFAYVPGHLHQMLFELVKNSLRAVSDKYLDSDQMPPPIRVVIAEGAEDVTIKISDE
FT                   GGGIRRSGLQRIWTYLYTTANSPLLEMDADTGAGPAVLAGYGYGLPLSRLYARYFGGDL
FT                   QVLSMDGYGTDAYLHLNRLGNIAEPLP"
FT   CDS_pept        complement(509935..511428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631625"
FT                   /orf_name="MICPUN_59965"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65152.1"
FT                   /db_xref="UniParc:UPI000199B52A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA67"
FT                   /transl_table=1
FT                   /translation="MSAVAPAATPPPAVSGVSEGRAKRKISKPNRFTSPPPAKRARPNP
FT                   PAAGSKPAAAAKKSVASRSSKAGRSKPPAVPAPRPAARGKRPDASAPLSAIALAALSSP
FT                   GAAALIGQSPVPESAVVEAMAAAAAAREITSPGSGALAGLAMLLEATEESPTLARDLGV
FT                   AANMLPKGSRPRQNPAASPLRPVNLNVAGGDDGNRRHPMAPDAPAPDAPRSGWGDGKRR
FT                   RTGGGKAKTAEDEGAAPSRAARTNKSDPVVEALAAERARDQTARNKRPEMAKEFDATVH
FT                   AVATTQPRAVLGHALSWLNLLVGDLKGRSAALRRSRRRLQKVRGEATERAEAARSERGV
FT                   PAAKDEPPLLEEKEAGLLKDLERALAVEDKHLTALLKQAMQAQGVARGSDAGGKGEEGG
FT                   SSSRVGGSKGSEKKKSKPGKAKDVAAKGVAPAILGAPPEHDDPKLMTDYFANAMITSAA
FT                   AFLSTGLNVAVADGDGDGKAAAAVACPAGLVPTPHIAAA"
FT   CDS_pept        511795..512742
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631626"
FT                   /orf_name="MICPUN_59966"
FT                   /product="Predicted protein"
FT                   /biological_process="peroxisome fission"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="ACO64806.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016559"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniParc:UPI000199B5DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA68"
FT                   /transl_table=1
FT                   /translation="MGGPDALDHSVAFLKQRDGLDKTLKLMRYVSAIAAYNILADDPSS
FT                   VTGTKLRKLDKSTGITRKYLKLGKFLGNLKELRALLRAGEIASRQRIAPAGNRTPDAAL
FT                   ASAAAFANRLNIASQLAQLVYNFAEQLNWAAKIGLIRDARRRRKIERWTSVAELATYVF
FT                   TINVSMLTLWRCAQRETRARREYGDRGRRKKDDDAADAGGGVPSPLRLLRGLGLRGRHD
FT                   SEESTGSDASVNDDGSGRDDTIRTERDLARALEAIARERTSARLALVADLADVTVCFGD
FT                   VRDVRALTAPGTVNALGLVSASCGVVDKWRSTKV"
FT   CDS_pept        complement(512872..513228)
FT                   /codon_start=1
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631627"
FT                   /orf_name="MICPUN_59967"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO65153.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG705085"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniParc:UPI000199B5DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA69"
FT                   /transl_table=1
FT                   /translation="MFAQLRNALARNASVFQTARNASSGANGKAWAVDLMASEAGISKK
FT                   QAEIALKSLLAGIEGAVVAGERVTFQGFGSFESVARAARTGVNPQNPTQKIKIPASMAP
FT                   KFKAGSAFKSAVNK"
FT   CDS_pept        join(complement(518525..518974),complement(517755..518381))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631628"
FT                   /orf_name="MICPUN_108585"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65154.1"
FT                   /db_xref="HOGENOM:HBG561902"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199B5DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA70"
FT                   /transl_table=1
FT                   /translation="MAPVARRVAQARRRAPSSRNPRATVCMAGYDSVQARREAESLRVD
FT                   SRTKQIHSLAELDAAFTLAGDKLIMLAIESEEECMMSDDLWDRNNVAGTETNKEQCRQL
FT                   SASLARIAREADNVVFLRVEVLESGDTRQIAKELNITKFPTYQYWKNDDLMWQHVGAGA
FT                   GVAAELSEGVLYYGGQGAAGLNVRDYVTEINSRNDLGNFIESCAAPTGPLPGFDAGLDV
FT                   PCDKQLAIVDIGVDKDAPHGCLHIFPAVLSLARNTQGFTRWARMAIDKNAETADIAREF
FT                   GIDTVPSFVFLADGKVVDRYSGSDRVELMNHVLAFQKANGIRLPERGAKRRMSTAEAKE
FT                   IARAARDRAKAEGRQTGW"
FT   CDS_pept        519171..519941
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631629"
FT                   /orf_name="MICPUN_59970"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="ACO64807.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="UniParc:UPI000199B5E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA71"
FT                   /transl_table=1
FT                   /translation="MHAGPSGKSLQILFRPSRALDRDSRTRVCGLLSLWHFGCARRKGL
FT                   GEPSARGSRRRPRGGTSRRGRTRARRDTRSPREQRGIHRRNRAGVDSGDAPVMLGGIAR
FT                   RCLGQGIEGQSLLRRLAGDAAQRMGLSRTFGGATAAHSSQGLNSFLDGTRFGPKETADK
FT                   EPVGRAWETSELRLKSFEDLQGLWYVLLKEKHMLATEKYAARGSRVRMRAPHRIKMIRR
FT                   SMAKIKTVLTERVDEVAGDDPELRRKFMAVINAK"
FT   CDS_pept        complement(520040..520777)
FT                   /codon_start=1
FT                   /gene_family="HOG000241650" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631630"
FT                   /orf_name="MICPUN_59971"
FT                   /product="Predicted protein"
FT                   /function="adenosylhomocysteine nucleosidase activity "
FT                   /function="methylthioadenosine nucleosidase activity "
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="nucleoside catabolic process "
FT                   /protein_id="ACO65155.1"
FT                   /db_xref="GO:0008782"
FT                   /db_xref="GO:0008930"
FT                   /db_xref="GO:0009164"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="HOGENOM:HBG318824"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI000199B5E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA72"
FT                   /transl_table=1
FT                   /translation="MAPVKTIAVIIAMKAEAAPLVEHLGLKKAEPSPFPGPIPAEVFSG
FT                   AVGDATVHVCCNGEAKGFGVDSVGTVPAALTAYQICEHLKPDLLINAGTAGGFKAMGGA
FT                   IGDVYLATAFKNHDRRIPIPGFDAYGVGHADAAPCPALRLATGFKPGVVSTGNSLDAPD
FT                   VDVESLKKNEASVKEMEAAGIAHVCAMFDVPLLAVKAITDIVDGDKPTQDEFLENLGAA
FT                   AKALQGAVPKVIEFVAGKELGAL"
FT   CDS_pept        complement(521016..522773)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631631"
FT                   /orf_name="MICPUN_59972"
FT                   /product="Predicted protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65156.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG410766"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI000199B5E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA73"
FT                   /transl_table=1
FT                   /translation="MSFAHRSVLKEMREKKAKAAKAVERAVSRWRPWAESASSEPAPWP
FT                   AKFEKGGRGITRGVPQVPEDNRWRLGEYAVRADFDGGNLRRVEQNGADGAFQLWTRSDC
FT                   EGSDHATQHRTWFHFRIEGHSPGETLSFTVMNYVKQGKIFQHDYRPVYRQHPSGAKYAR
FT                   CNQSVSHWKTDQGQFRWTFRHKVETAEPTYFAFTFPFSHGDCVATLDAIDARFASDKTL
FT                   RERVYVRRQTLARSLEGRDVDVLTVTAPAGVSESEYDEAPVLSSRVAPPGRAPEDRPVF
FT                   IVSAGVHPGEKPGNHMMCGILEFLLRPDDPRASALRERFVFKLVPMLNPDGAFRGHFRQ
FT                   DTLGQNLNRFYDDPDRTKQPVIHAVVRLAMHYAHQRRGLGFYLDLHGHMNKRGVFAFGN
FT                   ALDGDDAAAGFAYARLCSLNTPHFDVHACNFTEKNMRTQDKNGQTKEGSGRVALHAKTG
FT                   LPHLYTVEASYVSSRLLSRVPPASGDDGRASPPSRTPVRSVKYTPEVLNDVGRALMIAA
FT                   LDLQGEGANPWSRLPGSEYGSLHGVLGWARSAARGDAGKNTRDVAREQDVSKKWRTVKS
FT                   KVMELRLSK"
FT   CDS_pept        join(complement(524630..524661),complement(522904..524476))
FT                   /codon_start=1
FT                   /gene_family="HOG000007414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631632"
FT                   /gene_name="ODA-DC"
FT                   /orf_name="MICPUN_59973"
FT                   /product="Outer dynein arm docking complex protein oda-dc "
FT                   /protein_id="ACO65157.1"
FT                   /db_xref="HOGENOM:HBG561695"
FT                   /db_xref="UniParc:UPI000199B5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA74"
FT                   /transl_table=1
FT                   /translation="MSTLNAIGGARTKGAKVGFDDDSKDLGAGKLIDNSVPSGPAGEIF
FT                   RLQTQADELTRRIELEKRRTKDVESGIERVRAKIIEQRREMGGVDAAQEKNTHIQRNLK
FT                   MLENRLDKALGKYNDALAHNKQLRGTIDNLRKERVLFDDIYKKLEHELAEKKNRMGEII
FT                   ERSDKAYEARDKAVSEMAKLKQQADKEQLAFEKEWRELTKLIEHDKKMRAFMKNKAKAQ
FT                   GAVEEARLAAEADEAERKQKKREMAGKWAQGKSKADAKKSHARVQSYREAFRQIQEATG
FT                   IGDVEELVTSFTQAEDENFRLFNYVNTLNAEIERLEEQISECKNEIEKYRGSGAASDSQ
FT                   RRKLLKDLEDRLARTEAKAKSYDGKYKIATETVGALREGIWKVYNKIGCNTPTNAELLG
FT                   ADGVTDGNMMQYLGVIEQRTNEILQMYAASMMAEGGADRAGDYDSFVQMTKTGPESSAG
FT                   PRELKIDAPSTEDPDDLDESDEDPEDRPLDREELRRRAAKQLARREIGDGATGTVADAR
FT                   SGAKKAGAGGKGAVKRR"
FT   CDS_pept        524892..527105
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631633"
FT                   /orf_name="MICPUN_59974"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64808.1"
FT                   /db_xref="UniParc:UPI000199B5E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA75"
FT                   /transl_table=1
FT                   /translation="MPARETRREVGLEWEPIPDNVLVPRRDRRDRFARPFPPDVQVVRR
FT                   RNVGVDAVDAADRRSVPRARGKRPRRAVVDDVHDAHDAAAPVAVAGLDDSLDPNAVLAA
FT                   HLSSGWSLGRKSDGDGRSLVPPGDGARGATTPANADRGTTSSELLVVRRAYGIEPPNAP
FT                   SRASAPSDAAFASLSSAVSCARLCAAVLRRRDWCASAVDAAHSAVGAFRREVASARRDG
FT                   TLRAPAVVRGRSVAAPEDEMAASVRRALAAAKVALEGAVGGRETRGGREKSGGDRGDGR
FT                   DDPFAAAMAAMGGDSPGGDSPDASEHSSNAILDAPVAVAVAVALDDAMYAMAYHHRSCG
FT                   WTSGDGSWWPNPAAYLTAVTASHGRCGADISTVSKFVSSVASAVKDDVLEGAREWEWLD
FT                   AIRRSRTAEATWLLTATGAVTAADVLAAGRRAAAEAKRKTRGRATTTGDGTPPPPPCPK
FT                   LVQLWRDGARVWPCRLFAFATPTRRALRALCDASVSWVEVGAGLGYWALAMESSFGMDV
FT                   VALDKTPNTEGFGGDSPGGGEWDEGAMNEYHGRAASFVKVREGGPRDLRRYKNRALFLC
FT                   YPPPGDDLAARSIREHGGDVVAVVGEWDGNTGDVAFARELRESWNLARRVSLPQWGDTA
FT                   HELTIWQRKKTDSTERGGTRGAQTRVSASAFAACHTCGSGDHDRVLRRCVYCRVVCFCS
FT                   EKCSRDVDATRAHSDEHALRDLAWTAPAYSDEASFRVFRPCGG"
FT   CDS_pept        complement(527213..>528046)
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631634"
FT                   /orf_name="MICPUN_75689"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO65158.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B5E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA76"
FT                   /transl_table=1
FT                   /translation="AGGAAGIIARTASAPLDRIKLLFQVQAMEGAGTSATAYTGVGQAF
FT                   LKIYREEGILAFWKGNGVNVIRVAPYAAAQLSSNDVYKKMLADENGRLGLKERLTAGAL
FT                   AGMTGTAITHPLDTIRLRLALPNHGYSGMTNAFVTVARHEGVGALYKGLLPTLAGIAPY
FT                   AAINFASYDMAKKSYYGEGGKQDPIANLFLGGASGTFSATVCYPLDTIRRRMQMKGKTY
FT                   NGMADAVVTIARKEGYRGFFKGWAANTLKVVPQNSIRFVSYEVIKSLLGVATQPI"
FT   CDS_pept        528640..530031
FT                   /codon_start=1
FT                   /gene_family="HOG000000822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631635"
FT                   /gene_name="MOT1"
FT                   /orf_name="MICPUN_101424"
FT                   /product="Sulfate permease family "
FT                   /protein_id="ACO64809.1"
FT                   /db_xref="HOGENOM:HBG561905"
FT                   /db_xref="UniParc:UPI000199B5E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA77"
FT                   /transl_table=1
FT                   /translation="MAGWLLRRAAELRRDFTWREAGGSLGDLGTFIPLLVGLTAECGLD
FT                   VGTTLVFTGLYNLATALAFDVPMPLQPMKTIAAVAMMDPPMDVPQIVAAGGFVALVVLV
FT                   LGCTGLMERFNAVTPFGVVRGMQLGLGMLLCAKGWTLAVWTDGTRQSMRGLWGPDGMAL
FT                   GALALAFVLAFAAPTKTAVAAREVIGDGAGIDADRTHTRARGAGSSDARVALVLVVVGA
FT                   VIAACRPGSLASLRAGPSTPTPAIPSATDVATGVLRAGLPQLPLTTLNSVVATCALAKD
FT                   LFPDKPEVRPTGVAVSVGAMNLCGLGLGAMPCCHGAGGLAAHYRFGARTGAATAFLGAG
FT                   KLFLGVAFGGSLLTLLGKFPAPLLGVLLAAASAELIRAGLDGAGEIGGYTGVDSWYDPG
FT                   WTDRYALIVTAATTVGSGSTGLGALFGFATHALGTARRRLLDTAGGEDLVDGREYREVE
FT                   MERGG"
FT   CDS_pept        complement(530198..530797)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631636"
FT                   /orf_name="MICPUN_108587"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65159.1"
FT                   /db_xref="UniParc:UPI000199B5E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA78"
FT                   /transl_table=1
FT                   /translation="MDRERVAAEAIERAEREAVEARRTRPKTAPPARRTEHAALETAAD
FT                   RYSAAEASRRGRDGSGWYGGVLDGDGQTLPKPKPRDEGEIPPWMPVTTTDGTGRRDPNA
FT                   TAGRPAGDSQPFATSESLESWSSHVAAVEARLMRLSVERDELEGELGRLPEGAGRTIDE
FT                   RRRKQHAERRLEELHRSMSQARNQLKQAQRVHLVGA"
FT   CDS_pept        complement(533961..534695)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631637"
FT                   /orf_name="MICPUN_101426"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65160.1"
FT                   /db_xref="UniParc:UPI000199B5E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA79"
FT                   /transl_table=1
FT                   /translation="MGAKRVMYWRQPAAQRTMKTYLALSEAVRAELNPTDSRVHRWSAE
FT                   VSARRKNVNAEEGMFVSLTAAGVADEVFTCTLVDHPETSKETSSAPTAQPNERQVVVLR
FT                   KEREVMEGTTRVKEYLARCKTHTVAHRSKVDGVGWWCGDYAVRIGRVENAQGTYAGLVC
FT                   EVEYAPVRDVNVADALLAEYAEAIGECLRRAAGESAGAGALVHVNTGECVGAYGLGNVA
FT                   FGDAHAAVAYVSTVMTMQSGGL"
FT   CDS_pept        535225..537885
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631638"
FT                   /orf_name="MICPUN_59979"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64810.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI000199B5E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA80"
FT                   /transl_table=1
FT                   /translation="MTLLVQPIGVRTTAGAGSRPGARHGGRLGAAPAPRACSRSEPRLG
FT                   AEATRARSVRARVFARRASPREIRPVHRLGDHARLVSPQHAARGPSAAHAASNRDDDKD
FT                   ASSSSPSGTSGVGEDAASGESASTGSGAGAKDDAKAEDDQSTETSAIGAEAAASGPPAS
FT                   KLRDDDKGKRGASKDLDKMGRPRDFATWFRLLFQPMRLFTVGMNTFLFFFAANLFHNHQ
FT                   DKAPGTHMVPVTYSRFLEDVKNDEVKYLKVDGAYLTWKPKTPYVIKQPGVGPMGMTENK
FT                   IEVAYSAARPEDARVPYEQLSKNKVEFGALDKRYQSQRNLNTFITVFIVGMAMVQFSRM
FT                   GQNRDGARGGGMGGGMMRGMGGGPNTSAGRMTGGKQRGALPPPSTTFNDVAGVDEAKEE
FT                   LQEIVDILKRPEHYTRLGARPPCGVLLVGAPGTGKTLLARAVAGEAGVPFISVSASEFV
FT                   ELYMGMGAARVRDVFARAREQAPAIVFIDEIDAVAKGRSDGRLRGMGNDEREQTLNQLL
FT                   TELDGFDDEHLVICLAATNRADTLDSALKRPGRFDRTVSVERPDKQGRKEILGVHIGAR
FT                   NLPMREGLDVDEIASMTAGFTGAELANLVNEAALLAGRTGATTVGKEDFESAVLRTVAG
FT                   IEKKRSILSAAEKVIVSAHEVGHAVVGTAVGNLIPGTSRPEQLSIVARSGGALGFTYIP
FT                   PGEEDRKLMFADELRGRLVTLMGGRAAEIVACSRVSTGALDDIQRATDLAYKSIAEYGL
FT                   SPTVGPVSVPTLSQGGREDIFGGGADASQVERQVEGEVKDALVSALYVAKEILVANRKV
FT                   LDDVTGELSEKEKVMGDELQAWLDDVKAVPTLERFLRGENVLPPEESPLWHMLPLPTVA
FT                   GKDKRGGNGPAAGAR"
FT   CDS_pept        538442..539428
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631639"
FT                   /orf_name="MICPUN_59980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64811.1"
FT                   /db_xref="UniParc:UPI000199B5EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA81"
FT                   /transl_table=1
FT                   /translation="MSYTVSSAIHHAGVAARAPTRGSRSASRPMPVVRTPARHSNVMRS
FT                   SRRSHVAHAQWFDAGFTQGGRGAIAMPYYSAATNGPTAGDEQPAIDVDAVDVSTGSEGG
FT                   PASPWPQSAASKNSDKWGNFVSFGYLFISAVIMNNILYTFFPNGLGAAMVKPAALKITE
FT                   LMIALSCAILAACDFGPQAAKQVRGGLRALDQVGGNRATARDFLGLVLLKIIFDVVGLG
FT                   AFAVPSALVPDFLPRSLGIAVTMFVRSAFVIHCDVTFDAEGVMRPIPGKMRELISSFDR
FT                   TLAFLACAVAMVTDVWVAGISAGLFTAGALYFSAENLFRFGASMKKK"
FT   CDS_pept        complement(539600..541615)
FT                   /codon_start=1
FT                   /gene_family="HOG000229983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631640"
FT                   /orf_name="MICPUN_59981"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65161.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199B6AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA82"
FT                   /transl_table=1
FT                   /translation="MLPAMLAATARRLASSGASTTVRARPNLARWVSSHGSLGADSPAR
FT                   CSFDSLGERLADVATERPAHVAVVSPRGVEVTYGTLLAHADALADSMRATFATMRDDGR
FT                   ESAAGDEVMAHEPPTADALRGARVAISAIPGPEFDVAMKATWMCGAIAVPIARNHTKAE
FT                   TTHVLRDSGASVFVHIPEQRDDDDPVASSMEETFDFLTSVGVRRMVSVARVGECDGAAR
FT                   GGELSRLAGVRGAVAFDEGPIDEGTMRVNAPGDGALIIYTSGTTGSPKGALHTHGSLAA
FT                   QCTALMNAWDWSHSDRMYHALPLHHIHGLVNGWACAAATGATVEFAGDLSFAPRAAWAR
FT                   LRDTNRAPVTVFMGVPTMYVMMLRALEGLKKRRNRADAMASAAAARSLRLTVSGSASLP
FT                   TPVARAWMTETGADVVPLERYGMTEIGMALSNPLRGERRAGTVGTPLPGVEVRTERVGH
FT                   DERIGYDERIGHDERVGYDERVGYDEQVGSDATAAVGGAGANEAGFEDVEEGPAELLVR
FT                   GPGVFVGYWNKPDVTASSFTPDGFFRTGDTAVRERGGYWRILGRTSVDIIKTGGFKVSA
FT                   LETEAKLLEHPAIAEVAVFGVPDDAYGEISVAVTALKEEEEEGADTSELARWARRNMAE
FT                   YKAPRVFQLVRKIPRNAMGKVNKKELRHMYLHGGLQ"
FT   CDS_pept        join(542132..542278,542604..543449)
FT                   /codon_start=1
FT                   /gene_family="HOG000165727" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631641"
FT                   /orf_name="MICPUN_108589"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO64812.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG610399"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B6AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA83"
FT                   /transl_table=1
FT                   /translation="MAGSFAAGGVETPMSRAVPATFTQQVTANFMAPAKKEFSMVAFLK
FT                   DLAVGGVSGSIAKTATAPIERVKLLIQTQDANPKIMSGEVPRYTGIVNCFTRVSAEQGF
FT                   GSFWRGNMANIVRYFPTQAFNFAFKDTIKELFPSYSPKTDFWPFFAVNMASGGLAGAGS
FT                   LLIVYPLDFARTRLAADVGSGKGREFNGLIDCLTKVAKRSGPMSLYQGFGVSVQGIIVY
FT                   RGAYFGLYDTGKGALLTKDSSIVAKFVVAQVATNAAGVLSYPFDTVRRRLMMTSGGKKL
FT                   YNGTLDAFVKIYSQEGAGAFFKGAFSNVLRGVGGALVLIMYDEIKALIA"
FT   CDS_pept        544027..544389
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631642"
FT                   /orf_name="MICPUN_59984"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64813.1"
FT                   /db_xref="UniParc:UPI000199B6AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA84"
FT                   /transl_table=1
FT                   /translation="MEGAHTGPSGRDPMGAPDPGEYASGAEVEYDDDIDRDDVDEADFD
FT                   DEYDEVEPDDDKVDEDGGGGSVLGLLSYLWMFIALALFAYLITTVQNQAGIIKVLKRRV
FT                   ATMESRLGLQPLSMDL"
FT   CDS_pept        complement(544505..547207)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631643"
FT                   /orf_name="MICPUN_101430"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO65162.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B6AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA85"
FT                   /transl_table=1
FT                   /translation="MKSPKVAELERRKKEQQAGRRRARGEGSVRGAATTTRGDPTATAP
FT                   RTNVAVVVDDDDDRSPRPSEDESDDTRAAPAGTSARAGTAAAPAPALSDGDASAHEGGG
FT                   RVRARGSGSGPTASSTDPPAVPRVGRTTSEGGTRERKPPGRYAAYETDAAIHGRAVSHR
FT                   PVTGRGAAGTTRARRDASRSRSRTRSPARRGRPGRVAELEGADGRARERGAQTRRAPSN
FT                   ERGPAPLAGPQSPPRTRSEQRRSWGAGGASASLPGGPGPGRVDVDPTLQWRRVVLYGYP
FT                   HDTFPNNVERLFTNHLRVNERAVERLQLIRGRRGDVTAFAQFATEGDARLVIDTLTRKA
FT                   DRGAPITFRDCALSASHLHDWPRQMDRPRWIPCVAAPGWTPDPRNDVRNGAEPAPVPPQ
FT                   RSGSPLNAVNDLGRWEKWGPRWWECHVDTRGHMGGVIGKSGATIKKLQAETGAKMRFNK
FT                   EAGGAAANEVVVWSNSEHVAVAGARAVCALIADLVESSRGGARGRRESLGTRGAARKAH
FT                   SSDPEDGEIHEGAVVLALGGGDDALDFTDVLPTTAAADGRNPRECVGRRLRVWWPGEGR
FT                   YFAGVVDRWDESRKLHVVRYDDGDVEAVDLARETWDWEKADEDREGEKGRVDESPPPPP
FT                   PSERRGAERTPDLPRAPEPEPAPRAEEPDVESEPTARVADPNAKQFTCDACGKGPYNAK
FT                   GIKLHRKMWCNKEGPFVGKKKGSETAAAPGDAKKRPRSASADRFGFVDEAGGERGERGD
FT                   VRDTPEPEEPAIGPSFDAMRTQIENEFATRTQLESTLRDLDTDAEATAAARGAFVRVRL
FT                   KRKNALDSGYACEQIDRVSRYQPGLAAGVTPARDEGWEWKVHFGSGSSAVRFLSNTRPD
FT                   REETFGWMVRHFVKDGAQLAGAGTKRART"
FT   CDS_pept        547805..551569
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631644"
FT                   /orf_name="MICPUN_59986"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64814.1"
FT                   /db_xref="UniParc:UPI000199B6B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA86"
FT                   /transl_table=1
FT                   /translation="MRWRFAALQLLLLLTLLLAVAHLTTAQSDPSVHDELDDADDLERL
FT                   EALLDEAERLGIELSADDAVDELAGLARDDVPTEDVDDTPPKKATKPVVQQPEPAPAKK
FT                   VEPVKTKAAEAKNADPSAQPAPPKTPPKEDPDAAARRTAKRLEELEKKRADDVRRAEEE
FT                   TARRGAQRRADAKAEADANANAQADAHARVADPDPTEDDVAPAPAPRARMLLDESGEGY
FT                   AADAAARAQLERDAARRSLLTLSVSGDNTRWVGFEDMPQRYREQRSGPEVRIARDHGNT
FT                   QVTRPGGYWQAARFNKVERPSRSRLPANFGRGSGEGTLSGPRAGINQHDRVGINKASGW
FT                   PGRLHDSQRGTDAYPAMDTRDNVGTHVQPFVKGVTSYSPNRRYQNYQYRNQFQTSYLTC
FT                   GTGASLKTTSYPSNGASLCDSGNGGRFVNVVGTHSLKAGDYVTFSGVLGADSADLNNKA
FT                   FKVAVVGANMNNFSVISGIDATSKKWDVSSAYVTKLKTTTAANPHPLVSESDWSYEEGD
FT                   KIYFFVTFNEAVQVTGIPRLLLNTGNHFEAGAADAYATFIGGGFGEKKTFWKNNERSPL
FT                   KNPMEPNSWYEDVYHVNDGGCTMRGFQGDTDEVTAATVPDCATYSGVTKTANAKVRTRR
FT                   VHSFKMGDLVIIQGVTGKDAHLLNKQHTIGSVASTGASGNDLFTFIPPLDLSDGDVEFD
FT                   ARFAVVGRASIGASCRAAGVGDRSSHGENFCMFSHDTRYSLPVSESTLLDHTRYAQQLP
FT                   GQPGRFGIGNTGGGATFAVAAEEGGSVVNTRKEFQYAEDRTEQYMDNVLAFEYVVQSDN
FT                   AYDQSETGLGSTSGQEHLSVDLDYAGKDALDLNGGTVKRACANIFQVKSIDCSGNATIE
FT                   VYGKHRLLPGDIVQLEGIDAADAVSDATIASDIRHEMNRQHVVHALPLDAGTSLDRVDW
FT                   ASIWDASPPWGSDVSKFQIKLDTASTTASTKLCGDNGNEAQFKVTRTKSIARRKRSYLG
FT                   DGSQCKFVDADLKLPTPGDKMKGSSGFVQSLSFNKDITVGRAYVTNVTTDAPPGIYGYN
FT                   DGYGVRAGAAINFGTPDIVDVKVSFSEPVLASCGEDDDKWSAPEQYPGLRMRVCTSIKL
FT                   VLATLDGATAGDANEDSTTGTFGDEKFPTSFLYQTDYDAPNVLNFRYVPRRGDSTAALQ
FT                   YVRQTSLEVGCAEMDGATCVSMSHVRRIADNKPAGLKLPPTSRDAGACAPSTNLAGEQL
FT                   CPGATVGSPTADHRYSLAGQKTIVVNAVF"
FT   CDS_pept        551787..>552812
FT                   /codon_start=1
FT                   /gene_family="HOG000199482" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631645"
FT                   /orf_name="MICPUN_68019"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64815.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG320394"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B6B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA87"
FT                   /transl_table=1
FT                   /translation="MTLTRYVVGSFAVAAGLVYHALKTREQYFPAMLYLSTSKLSVVVM
FT                   GNLMFALTLCLGHLLKSIFLGQLREAEVERLYERSKDAIMETCLAMTIFREEFNMKFVV
FT                   MFVTLLFVKIFHWLCSDRVEYVETSPSTTRLAHLRVCTLAACLLALDLTMLQYAVTETL
FT                   RVGPSVLLLFGFEYIILASRVVATSCKYLIFAIDTWREGRWDEKGTYVFYLELVTDLLH
FT                   LFVYFCFFIIIFAYYGLPIHLVRDLYMTFRNFNRRVKAFIQYRRVTANLNERFPDATTE
FT                   ELEALDDSCIICRDDMSVDAPGGARPKKLPCGHIFHLRCLRTWMERQQACPTCRAPVEP
FT                   ED"
FT   CDS_pept        complement(554232..554537)
FT                   /codon_start=1
FT                   /gene_family="HOG000100105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631646"
FT                   /orf_name="MICPUN_50952"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65163.1"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI000199B6B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA88"
FT                   /transl_table=1
FT                   /translation="MARGLSREQSKEKNLKKQQNAAKGNTENLTPAQRAERDKAAMAAK
FT                   KAAKDAAKAELAQSADGAAQLAAEEKRKAEQRARQKEGSFAAKNPLLAKQLKKTGK"
FT   CDS_pept        554834..556744
FT                   /codon_start=1
FT                   /gene_family="HOG000100106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631647"
FT                   /orf_name="MICPUN_59989"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO64816.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199B6B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA89"
FT                   /transl_table=1
FT                   /translation="MGADMSTPAAGAAGTSAGLTEEQLRERGIAKMDQEMRRKFARGGK
FT                   FNFKIVLRGDSSTGKSTLLRRLRGGTFQPDYNPTPEIRTAHVQWQARSNPEDNIMLEVW
FT                   DVIDKASKRAISESLTLAHNVDETAEGRHTFPLDATMVDVYHGCHAAIFLIDPSKKWTY
FT                   EYVQRELATVPEHIPTCVVLNFRDYPASKRLIRLEEVEADMEYSFGKRPFRPFVMEASL
FT                   LNCYGLQALSTFLHIPFLCLKRASLEQAMQLNTHAIVQAQEAMKTVRGNSYDAYERKID
FT                   AATGGSNVSNALGEAASAGTPGQPPARQSHAAPPTAKEAAITWEKLSNTTLGEAPLLIG
FT                   GAAIGAAVTGVTAVANLTPAQIAENVKSVASVGNVAKAIGLGPKEKKGHYVDEPVEKVA
FT                   PQFSHLTGRGGAAAAAFGGREIDDDDDGAPNSLTPDVRGGEEMDDFFEGDTPRKGGKSG
FT                   DSSSDEDSDSPRRRDWDSDGGGDGSKVQVRWRSDDDDSSEDDGPNPESDESDDDPLPLP
FT                   SKDDPFFGSGKSAAPTNVHILGSNPASSMDLDPSTIAASFGSPAGGGDEYEAVGDDADA
FT                   LEKEFAGLNGVTFSGDSDSDGSGRRKKKGSSHKKSKKSKKEKKGKKEKPKMKDWDESES
FT                   D"
FT   CDS_pept        join(complement(558582..558729),complement(556987..558502),
FT                   complement(556868..556895))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631648"
FT                   /orf_name="MICPUN_59990"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65164.1"
FT                   /db_xref="UniParc:UPI000199B6B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA90"
FT                   /transl_table=1
FT                   /translation="MDHQRNASIASAMSGAGSDFLSAEDDEPVTLEGSPVPLASPRGEV
FT                   VRLKDLLQERDEHIERLKTQLKETVDKGESFRAKLHAAIKKGKSIEAERNELRARLEQS
FT                   PAGSVSGDAPGPGSDPPSTPTASIEELDALRKELDDAKKAAASAEKKLAVMRAMSEADS
FT                   KKNGDAAVELDSLRERCAEAEANLDKAQKELDATAEELDASRRLCETKTVAAERLDEAL
FT                   REATKKAEAKQKRTEAAEATRAGDAERRAASAEGELASLRVELSKVRAAAASRKEELEA
FT                   LRRELAELADASADELQIADDARSKAETERDEALDRLKTAESVKAQAEVRTAEAEERAD
FT                   AAEAEAERLLEESEERGCRFTMVQSQYAKKEEELSAEVERLRRESATRPPADEETAGLR
FT                   ESLDGLRESLARAERAAEEAEARAEKAEAEARAQKAEKAEAKNREELGTAEADEAGNEA
FT                   HVARVGELERIVESLRRELGDAREEIARAERASERAAEDSDKNAEGSRPPAPGSNDESV
FT                   LFKRVESAEALAKRLRVTVESLERDNKSLQWQISMSAGSRAGGDGT"
FT   CDS_pept        558901..560028
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631649"
FT                   /orf_name="MICPUN_108590"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64817.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B6B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA91"
FT                   /transl_table=1
FT                   /translation="MPFIASISTGLRGLVTGRGGSKETGRPGGAKGRHLSVDVKSQVSW
FT                   RSLAAADDDQRRIALVTGATDGIGFHTACMLSAAGYGVIVHGRSASRVRNAVDRVNESR
FT                   SFLDKFGKGGVVGAYVRDFDSLDDVRALARDVLDNHPRLHLLDNNAGVFEPSRHVTDDG
FT                   FERTFQVNVLAPYLLTGMLLPRLATTASSDDESKHDEDVRILNVASISQLPHVNFDNIN
FT                   AEQKFTSHEAYCHSKTMMKLFSFELHERISRAVELSSYDELGDHDYFAMKTGCTELATA
FT                   GARGLGSVLTMTCDPGTVNTKMLLAGWGPCGVETFDANDQFELLTDAKYRDEVKSHGAY
FT                   HVNRTVRQRPGEDTKEERERLWRVLEESTGFEYPI"
FT   CDS_pept        560262..561227
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631650"
FT                   /orf_name="MICPUN_59992"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /protein_id="ACO64818.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="UniParc:UPI000199B6B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA92"
FT                   /transl_table=1
FT                   /translation="MASSADRPAIDLDDPNVSAEVAKKRRLMELAKRRDGTGSRRGNSP
FT                   APGNHVVKKWVVLDLGNRPSRATYDPWSAGDDHRISFTGLGPDGAGSRDLTLRQIKAVA
FT                   GGDWVRMPPCDWHCVTGWSTLGLCFRGVPFSAVVDALSKDDDGKENDPAFAPRPGWRRI
FT                   YQRSADGYDTTVQRRDVHDGFLAVVHGESGEMLREEHGGPRLVFPSLYGWKSAKFLKEV
FT                   VFLATDDDAPGARRGFWEKLGCHPRGRWAEEQRWAPGTSAVVWNALAGMTDLYRVVGGV
FT                   WVWERVMVHGGRVLGAIASTWETVRGWWRVRGGRVGVKAE"
FT   CDS_pept        561587..562348
FT                   /codon_start=1
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631651"
FT                   /orf_name="MICPUN_108591"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="ACO64819.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199B6B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA93"
FT                   /transl_table=1
FT                   /translation="MSGIGTGYDLSTTTYSPDGKVFQVDYACKAVDNGGLALGIKCSDG
FT                   VVLGVEKLLPFKMLVPGSNRRIAPVDRHAGMAGAGLAPDARQIMSRARSECANYKSFYG
FT                   DKIPSKILADRMANYLHMFTLYWSVRPFGAAVLLAVRDPATGKYELYLLEPSGECQRYH
FT                   GMAIGKGRQAAKNEVEKLKLGEMSCLEAVKEAARIIVTTHDEKDKDYECELAWICDDSG
FT                   GEFKKVPKDIADEAIAAAKRALEDDDAMDAD"
FT   CDS_pept        complement(562527..563261)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631652"
FT                   /orf_name="MICPUN_50956"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65165.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199B6B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA94"
FT                   /transl_table=1
FT                   /translation="MRQTRVDEVNPRVGGRAARVRTALRARAAAHHPNAHISSAVRSIE
FT                   RALLGGDVELVLNQLLTGMVESPNSVHTGVIDPSTGGFNSLSHSSSRADLGASSDPGGN
FT                   PVEQSSSAPHLHQLLEAILVQANVDDMSYEELLDRFGPGIEGPAAAPASAVRAVPRRRL
FT                   TGKDVEALVRNETRSTERACCVCLEDYGKGDTVKTLPRCGHRFHAHCIDRWLLCRNACP
FT                   VCRVGLEVPVTEGPPGPAAAAA"
FT   CDS_pept        564433..565998
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631653"
FT                   /orf_name="MICPUN_59995"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64820.1"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="UniParc:UPI000199B76B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA95"
FT                   /transl_table=1
FT                   /translation="MDMDVDMDDAVPFSQEDWTNGEEEDMEWDAAVLEAALHELDHLRH
FT                   GRVPEASDATPRPTHERSLLDTNDAGLSHADGGVMSTTHETGQSSGPRVVTIVPDTNVL
FT                   VHEGGASLDRLLGRFRARIGADGSVTRARVAVPRKVVQELDGLKTHAGGAGSGTGDRRS
FT                   EVAALARSVNRALERRLVGARHKHEHDTQRDAARVDEGDAELLVQGPADAGAMRVRMRA
FT                   EGLEKGGDEEIVYFCQRRRKSLGEVVVLLTADVNAAVTAASVAGPGDVPVCAFHPNDVQ
FT                   ANDVLALFRAVGSFYAGAEERVRGVVADVTAAPGRGKSVTVGERAGESGGFVPSAWPPP
FT                   PRAAPAPRGTLGHDPTTLAGGGGSSRQGPAATRGGVPANSDEAAASVSRVLDALDAAFP
FT                   PAVEAMLREDLGDMWAVAVRDDAEDILEFTPDDAFEALRKNLMTLVAGRGPRGARGYPR
FT                   EAMDSIAVARRQRRQGRGWVGDRVNALGVVAAARDVLACLPGDIPEVVAARDVAEGRRR
FT                   DLAG"
FT   CDS_pept        join(complement(567142..567168),complement(566246..566953))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631654"
FT                   /orf_name="MICPUN_59996"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="ACO65166.1"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="HOGENOM:HBG619641"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199B76C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA96"
FT                   /transl_table=1
FT                   /translation="MSAEEETKPTEEKKEETPAAPIFGFGAAGGFGAAATFDPSAFASA
FT                   PKAAAEGGDDDDDAAAAAAAEAECKAEFVPVVKLEQVETASGEENEDVLFEAKSKAYRF
FT                   TEGEWKERGLGPIKLLQDKDSKKIRVLMRREKTLKVCANFFVKPGTKVEEHAGSEKARV
FT                   FTTMDCSDGDIRPVMVNMCVKFGSAEKAQTFQDEFEKAMEVMKQFEGEESEEKKDGDAA
FT                   ADALADKVAEAKVGEEEKKEEA"
FT   CDS_pept        568543..569223
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631655"
FT                   /orf_name="MICPUN_108592"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64821.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199B76D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA97"
FT                   /transl_table=1
FT                   /translation="MSVGRVASGGNLSGDDYEQSETEPWVRRLPPNPRRVKNAPKTVYL
FT                   DMSHETALMVDTRGGVWAWGKGNEGQTGLGHTRTATSPAGPLRGALENVRVERVVAGDE
FT                   HCLAIAADGSLYGFGRGDDGRLWGAMRNVRSPASLCAGRAFAAVACGSVVDAMGGSKGA
FT                   CVGVTKDDQRVTKDGGGTCYTWGSPRPWLGRGGSDADDAMWARSNDIGAVRFDESGDGG
FT                   DGFR"
FT   CDS_pept        join(complement(571606..571627),complement(570159..571454),
FT                   complement(569301..570049))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631656"
FT                   /orf_name="MICPUN_59998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65167.1"
FT                   /db_xref="InterPro:IPR019366"
FT                   /db_xref="UniParc:UPI000199B76E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA98"
FT                   /transl_table=1
FT                   /translation="MSYREIRNFTECMRSLGYPRIISVENFRNPNFELVADCLDWLVQR
FT                   FDESADIDDDISTETDRVTFLKNVSKVFMSRARLKLNIKRLYAADGYARPRRPPSSNPP
FT                   PTLATHFQITERHTGHPRSPRRPSRPSHRLAVKELLKIANLLYQATKNADEDDATDPEA
FT                   ATDAFELDAGAFDVKLVRRLASEITQRGAAIYDALGDEKRLRGERARAVGRDVDLDEIE
FT                   AQVQEQIASVRDNVQGLERMLGDLRRDEESLESKIEKRRAELERAEKRLSALRQVRPAY
FT                   MDEYDQLEAGMDEMYEAYVEKVRNLDYLEWQLREMSADEDAAREEKERELRDMQRRMRN
FT                   EEMKILRGEGNVGGDDEDFDVDEPARARPGAAAQRRSPPKGPVAKRFGLDGGTRAGSRV
FT                   GSTGTGMGGRREPAVTGSMTGGDLSGDSSEGELFEEDDSSVRGFGDMSTPGGDREPYPP
FT                   PPRRRARSKACWGAMLFDKRMEDAGIPPWCAGLNYGRSNPPRHDSFEDASPPNTLGAFK
FT                   YVCVGYAERKYPFYSKDADEGGGEGGAKGGEPNKLPYCEGILMLVTDKEGGLEKPPRAA
FT                   RVVKERTRDADEDADTIDASTSGGEGPARAGRPLPGLGVPGLSSDGARARERGGGRVDA
FT                   RAGDKPIVEPGYVTPSAEFERKFIKSAGKIVKNMKRHADYIATTVYRAVGGGP"
FT   CDS_pept        join(complement(577125..577418),complement(571798..576996))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631657"
FT                   /orf_name="MICPUN_59999"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65168.1"
FT                   /db_xref="UniParc:UPI000199B76F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EA99"
FT                   /transl_table=1
FT                   /translation="MGEEDEAGDVPDAVERVPEVTSKPGGMFRDLLEGSFPELYEEPKP
FT                   EPEGGEGEEGEDGGDGDGAPAEPPAGDPPAEGEEDAEPEVDEYQQRIDAIRTQTATQVE
FT                   QMDELERYLEERTAAADELERARMEERDSLYTMDHRNARMPRLPHDLDLDRDRVEGVGL
FT                   LDPRTLMEDNERKLRASAAPPSTLEFLDETREPKYMEPTENERVRDAMRVRERETRRGK
FT                   HSEYPRRLVFSAEEWERKKRDAEDRLRELGRVMTPGQRDLEERVIAGMRRKQAYLRNPR
FT                   HPEVPSALDGTERKRVGAAIDPTDVFVVEPDIVEFHQFELGETYEMRLTIRNKSALSRR
FT                   LRILPPPSRHFSITELKYPSNHGLLAPGNAAYATVRFKPDSLADYEDFVTVITETSKFR
FT                   VECSARRHPPCLTLDQSLDVGYVLVGNDVETRMPFKNVGGEGRFRLVDEADWPEHTTPL
FT                   TLPNEDAMLSRGELKDPEPVPCIGVAPFRIGPGYMELAPLDVEQLRIGFAPPGPGSFMQ
FT                   QFRMVCDNSQVQTFTVTGRGTVLDVGLTEIDARATIPGELTQGPVYFGKVVPGSVNTRT
FT                   FTVKNATMVPVPFVWEHPREAGIFAVDPPLGVFEPDSVNAFTVTFSPNDLTPYEADVRL
FT                   VVDASVPARVPHPEHPFAKPVLIEDFSVSGVGAERHCTIDTNLVNYAGSLLPGRHYDRE
FT                   VTVVNHSDAAAPFRWVGHDPDAGLLVYPHEGILEPNGGCVTCVVELTPPRVQRFDAQMS
FT                   CVVEHGPTLPLRVTAEVEGPEVAIAQSQVDFGLLQQHVAGDTYLLIRNQSAIAATWALE
FT                   ERRPQSVDGAPAPRSEIVFSVAEGELPPYAEVEVECTLVPSAPGPYRSNIVCVAGGGRV
FT                   SVVAARADVLQPLCALSTAEVDLGTCYVNVPVEREIVVQNMTMLPAVFRWSPEPEGESE
FT                   ECADSMDFDVDWREDEIPPGGSKAVRFIFTPLRPCARYEALVAMDVDGAAKPLGFALTA
FT                   DVRGLSVEYEVLRGLNGTPVAGDASHVADSSVLDDHVRVDFGDSCEVREHAAMEVLIKN
FT                   TTAIETSVRIDVERHGVPDAVGMRVMECWAAARGADAAGLSKGGVARRGAKSVGGVAGG
FT                   DGIVAHTMGRTQLMEAASYTSTVFGAASTSGPDALRSSLRPHEPATHEHRGGTYEHLGG
FT                   IKSVSMKHGGASFARSLRGLTQPSLLRGGSLPTIAEKRGGKKSGAAVPRTRSDAPVTLS
FT                   AEHEKVSFSRGLGVQMHATRSAHEADAEALKSGDGVAFVVYPSSGILPPYGEFRAIVTV
FT                   VSDMPGEYFDALRCRVGDMPERRLPVRAGITGSPLVVQPVRYSPMGYDAYGPKGPKRFA
FT                   GLDWGSVRVGAPGSTKRFFCVNYGPKDMVVEFQPWLDPDPKNPKDADVPAALATLNLDE
FT                   IGGRVGVDIVGKGRMCQRVGPFKLVPAPAGPGLVTIPKRGGCVGFEVEYRYGGTRAKRF
FT                   VGSVVGTQRVADHEAVEPELTLELGCAKTKLRIGGVDGDGDEVEAAMANAEAKPISVSI
FT                   GGAIAPGRAQPPKPMKPLVVRLTADAYHPRLKADQNDSFNWTCYAHRHVSHSSYFRTVT
FT                   LTNTSAEAAATFRMKLVAPFSVVEIESSVPQLAFGRGRVMTRAGISPDASEEKSVITLP
FT                   PRENVQVTMRFTPPDPDVDDAGHVYRDDYEKDAALVVLYDNGDVQNFPVTAKYIHPELK
FT                   ASKAELDFGRVHPRAAKELKALRVTLTNDTPTDAEWTATFVGPGAHAFECVPPDGVVKG
FT                   KGPTGLAQSTDVEIFMSPDGEGEFSANADFGVRAGRGCGISLRGEGTYAEEEEGGKMPR
FT                   FDPVEAPISLVAEAE"
FT   CDS_pept        join(577729..577798,577924..578603)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631658"
FT                   /orf_name="MICPUN_60000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64822.1"
FT                   /db_xref="UniParc:UPI000199B770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA0"
FT                   /transl_table=1
FT                   /translation="MNSAGFQICTERASDGGPVCDVADGEAVALTVPVSFHIGDDVQGA
FT                   AGTLHITTRRLVWFGDGADCAGYEVPFTSLTMHAVSRGAEDGDADFTSPCIYAQVEGTP
FT                   PEGFGATIAGGGGGTDRPEEAGDDDDEEDEDDDDDDDGFSAGGGDGDYDDMFELRIVPK
FT                   DTAGLDEMFRVLCECAAMNPDDDDDDDDDGGGFFYDEDEVMRGAGAEGRRAALDRFDEM
FT                   LQIDPGVDDLIRDDPGRFEDDDDEEVK"
FT   CDS_pept        join(579293..579590,579868..580832)
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631659"
FT                   /orf_name="MICPUN_60001"
FT                   /product="Ammonium transporter channel family "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64823.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="UniParc:UPI000199B771"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA1"
FT                   /transl_table=1
FT                   /translation="MAIDAGHTAWMLMSCGLVNLMTPGLAFFYGGLVRQQNVLTMIMQN
FT                   YVSMGLMTIVWIVWGYSLCFGENKTSYIWGNPATHAMLSGIENDDGDIPGTVFAAFQGM
FT                   FAVITPALMTGAFADRVMFKPYLLFILLWIHLVYYPFCHWIWGGGWMYDEGVWDFAGGI
FT                   VVHCTAGFGALAVVMALPHRKKLEPELDTDPHNIPFVALGTALLWFGWFGFNGGSALGA
FT                   NEQAGYALINTEISASCALFTWLMIEWAHKGKPTLVGACVGAIAGLATVTPAAGFVYPW
FT                   AAMVIGILAAPWCYFLIEVVKNKFDLDDALDVFAVHGMGGYLGTLLIGILADERLGGPD
FT                   ASGKQFGKQLWGATFCAVYAFVVSFALIKVINLFMPVLPPQSALSEGLDTSIHGEKAYS
FT                   GKDTSNNGTEYANPLKAASAV"
FT   CDS_pept        join(complement(582601..582642),complement(581074..582477))
FT                   /codon_start=1
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631660"
FT                   /gene_name="AGT2.2"
FT                   /orf_name="MICPUN_60002"
FT                   /product="Alanine-glyoxylate aminotransferase "
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="ACO65169.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199B772"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA2"
FT                   /transl_table=1
FT                   /translation="MASMPALAEEPPVQSQPSFPGGEPTGPSMRTPCPGPESERMRAQL
FT                   GATQETGAVKYFVDMEKSRGNYVVDVDGNRMLDMFSHIASLPIGYNNPRMLDVFRDPAN
FT                   LTWLAHRPALFNLPPAGWAERIQSTLMRVAPPGLTHVTTQMCGSCANENAMKQVYIAVA
FT                   NARRAADGLAGPTPEELESSMVNSAPGAKPYKIMSFHGAFHGRTHGCLSVTHSKPIHKL
FT                   DVPAYDWPIAPFPKLKYPLAANVDANDAEERRCLDAAIALMDADPDVVGLIVEPVQAEG
FT                   GDNHASPGFFRALRRAASDRGVKFIVDEVQTGCAASGSFWAHEAWELDDPPDAVTFSKK
FT                   MQIAGYYTKADLVPDQPYRVFNTWMGDPSKVLMLEAVIDCVERDGLIANARETGDALKG
FT                   GLEALAAAYPGKLMNVRGVGTLVAADLASGAERDRAVKELRAEGVDIAHCGEAAIRCRP
FT                   GLYFTPEHARVFLDAFDRVLRRM"
FT   CDS_pept        join(complement(583499..583752),complement(582806..583370))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631661"
FT                   /orf_name="MICPUN_94689"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ACO65170.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015593"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000199B773"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA3"
FT                   /transl_table=1
FT                   /translation="MAMIEEDFEKEVKVVVLGNGCVGKSSMIRRYCMGTYTDEYKKTIG
FT                   VDFMEKTRWIDSIGEDVRVMVWDTAGQEEFDTITRTYYRGAGAALLVFSTTDRASFEAI
FT                   EEWKRKVEDVCGPIVMCVCQNKVDMIDESAVAPEEAEDLCRRLGLKFYRVCVKENFNVD
FT                   KVFDYLVEQWSHCDRDVRAAQAPAMDIREVARQTLIDRGEAVANAPAAATSPAGKKAAE
FT                   PGHFVAPGMRGKGKKKGGDGGETLKLEPTKRRTTGKKKLSSRLKKSCVIA"
FT   CDS_pept        583855..585144
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631662"
FT                   /orf_name="MICPUN_101440"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64824.1"
FT                   /db_xref="UniParc:UPI000199B774"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA4"
FT                   /transl_table=1
FT                   /translation="MGVLSEDESDTSALFTESELDDSDLDFARRRPRAPVAPPRGAPAN
FT                   DARDDAPRFSSEDEEDEPRRAPSPPPAAAPTWVGPGASAGASTRAAAAAAAAPVGRPGG
FT                   ATGGAVPTFSFSHRASDSGIGSARQTSYAPAASSRPPPTAPASRGGTASAQSSPARRPA
FT                   APSHAAASSQPNSSNILASVLGIDVERGVGGFDDDDDDEDVASPLRGKESRRDRAARLA
FT                   REGTSRRQDRRGESVTRESNKGKSLGSLNLAAVAKFGTGARWSARGSGHEIGAWTARQA
FT                   TLAVDGRTTATWLVACAAAQLLGGLIACLWESGGQWAAPGHDLPIAVLTVCAALGGGKG
FT                   ALGSNWRTQAVLQVGHVCALAFALGLDVFVMARMSDVMAATMARPELAANRRAARGGVG
FT                   LALAAKALALPLSMIHAVRVVWPGRGAPRE"
FT   CDS_pept        585419..586165
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631663"
FT                   /orf_name="MICPUN_97653"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO64825.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI000199B775"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA5"
FT                   /transl_table=1
FT                   /translation="MRDTGALAARSLAHVEPHIQPGVTTAALDAIVRDFIADNGATAAT
FT                   LGYRGYKHSSCISVNEVVCHGVPSDKVTLKAGDIVNVDVTTVLNGWYGDTSKTFVVGGE
FT                   DAASDEANRLVRTTREALRLGLSGCRAGARLGDVTEPIHEHLSRAGYGVVNQFRAHGIG
FT                   RTFHAAPFIQHGKGRRGQGLLLKPGMFFTVEPMANEGAVATKTLKDGWTVVTKDGKLSA
FT                   QFEHTVGVVEGGCEVFTRVPGTDAFI"
FT   CDS_pept        join(complement(587322..589163),complement(586224..587126))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631664"
FT                   /orf_name="MICPUN_83662"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65171.1"
FT                   /db_xref="HOGENOM:HBG594056"
FT                   /db_xref="UniParc:UPI000199B838"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA6"
FT                   /transl_table=1
FT                   /translation="MAITASPVVAQPKVSQVRPARIYKASTGPLKTPAGSGTKASPSQS
FT                   RGGRWTHALFEKVRGEVQRSAHALLHDRHDAPLVLPLEVNIVLVGFDGDGGYRYRADAE
FT                   ALETFLRQSFGHFRPSSMSTGRPLEVSIELHYNVVHAGTDHLRTIESAISHSAEPADDE
FT                   PPPHPWGDVELLAKKSTNDNDNNDNDKRWRAYEVEAAGPVENAVDFVYRKIFASLNPTV
FT                   RNLEPVAVFVLNPDKCRMDPGKDHDALDWRDASGISRAPPETLSPPELLAEECGYAYRY
FT                   RYMDGEGASAAWVGAGRYAVLDLGAGPAALTRVGRGVGGAENGGAAADGTDWGDAATTT
FT                   ETSLPRLGPLLLPYARYLEENGDDEGTRADLVTRRDAHMRGRLSTLVLSSVRHLLAPDV
FT                   AAETLDFAERVMVPVIVLRDHNSFWPLDLESAGPFRHLDVELVKEEAKKMLQPGQEIVL
FT                   MTGTHNLHEHKRLTAAVLRSLRTSSRADRRNAGSGPGHEHTYHVTARRYLDGATLLEEF
FT                   RGSADLLASGLVGLEDPDLDAAFYAQANRLADSTDGDDELVGDTNQGRGYKPKPKQQHG
FT                   TRVVPVYVLSLAGLPPGVLIDGESMVAAADDLVIVLQGLGAGRGEWVPVRFASNDRLVH
FT                   ARPGEPTRHVVAGVARALGGVVSPTERWSPIHGGVVENWLWAVGHHPFGPFSGCPTMSV
FT                   VLQDVAKRNAALTRVDTALRAVRAGIAEIEAFGDEFLASPFRSLSTDDTAGDDDDGAHV
FT                   VLKSSKGTWLDYLYRDPKRVGPPGPLPQSVVAQLEKELRGVETAFVDLGGKLYNHDLDE
FT                   AHSASSTILIAAHAFEARARDEVARARHGLRCCRAEHSRPGAARERRPGAFPVVAVVGA
FT                   GAYLAAAYLRGGSGGRGRVGGALRDATGRGRGWMKYKRRAHAD"
FT   CDS_pept        589623..589901
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631665"
FT                   /orf_name="MICPUN_108596"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64826.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000135"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000199B839"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA7"
FT                   /transl_table=1
FT                   /translation="MAPKKATPKKAAPKKAKTPKSPKATKTIKKTAKKADKADKPKRAP
FT                   GPYMLFCKAMRPKIVAKNPKFTFGEVGKELGAQWKKLSDAEKKKYAK"
FT   CDS_pept        complement(590461..592692)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631666"
FT                   /orf_name="MICPUN_60008"
FT                   /product="Predicted protein"
FT                   /function="structural molecule activity"
FT                   /protein_id="ACO65172.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniParc:UPI000199B83A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA8"
FT                   /transl_table=1
FT                   /translation="MGFFSPSRKKQPAEEARGSDGDGGDPASAASDPAPAVTTGVPRPA
FT                   LVSSDRRAAPPPVVAPTNITSCITADDDGAWRFQPCTVVVHNPGAAPVLFKVKALHPDE
FT                   VFVKPNQGAIAAGDDIELTLTFKHPDVAETSAPRPNELAVLSLACDAGHSLPCDPAVEQ
FT                   PPSVFVSRAFDAADKHRAFPARKVAVNFDITVAKAVRRACEAAAREAEGRACEAAARSA
FT                   RARARGEAARRFGCVWRALARTRALARQGYYSEDLASEVRAMEARFESGLAAARAENDG
FT                   LRTNLEISRGNAAREEAECRRLEAEIDELSLELEHTRAEADRARAEANAHEEAAASASA
FT                   AAGVAADRLLSAEKSREEKRDRIVEMVKAEAEGKIAQETTRMATEHARRRKLFDDVVTN
FT                   LTGRCEASDKERHDAVAKLELSRSELADARRRLDTLHRAVPNVLANVHARWKLGGGDGT
FT                   WTARVVFATWRHVAVIARESERLNRCVEELVRERAERETMIREARREARLDAERTASAR
FT                   VVRLESANDALMTDLRDASDAAQLARGEVARLARLRETDSTENARRMRAELDAKEAREE
FT                   AKAHARRIRALRDLSSRVGRSPVEGPGGRGGPVAEDSCAGCSDDDDEPSSPASRLDAEA
FT                   RENLRRGSLMKRTGSSPPPSPSRRAASRDPHVLLSRAKSAARASSQASAGWGGWGDGDR
FT                   ATPPPSPAGCAQLATRRAERGGAGVDGYLALARAAARRFNEPLVSPPAA"
FT   CDS_pept        592848..593510
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631667"
FT                   /orf_name="MICPUN_60009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64827.1"
FT                   /db_xref="UniParc:UPI000199B83B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAA9"
FT                   /transl_table=1
FT                   /translation="MSLRRLATKALTGAATFQRAVSHGPNGLFARSATGAEAASRMLAR
FT                   QAPGGRRFASASTNPDPAKAWSMYYTHENAYLNWVRNGATFTAVGMAFTIFKGQTEHAP
FT                   VSLGGCVVQSMGACYMVLGATQYVTSSVALRNLMGISPVGWAWISLNASWPTALYLIGL
FT                   SCFHGLHPRWLLGLIADNSAVLPARLQERIFQLVAEARHKEFEEKSKRRRTGTRTGF"
FT   CDS_pept        593689..594978
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631668"
FT                   /orf_name="MICPUN_60010"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64828.1"
FT                   /db_xref="UniParc:UPI000199B83C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB0"
FT                   /transl_table=1
FT                   /translation="MGRSRKHEPPRGGLNGYLAWNKSHLFRSFLGLPVPPKEFRHPEFS
FT                   EAFAKLDAENNNAPRSGSAVKVHVDSSDAKEKTEALEGREVFDPVVYHNSDVYTPHICA
FT                   LEGDRSIYSFGTLEDWWFMLVNDASWPTLIGGEIVLEGIVIFTCGCLLTIAQMLEGDSG
FT                   SNATFKDNLLLSLTTVRLSTDKIFGWQPTTASSPLEVCVLALYGWTHWLLLSVASALIV
FT                   ARALRPARSGLFSPDMVVNDDSVQVRFMVLRNQIQNGMGFLYNMEFTMQGMTVNGQTVD
FT                   MPLIRSKYALWRNSNNIITLRHSVKDASSPFNDGFPGGRQKVRDIFVTLSAMDMDGNSV
FT                   LMSAIYLDPLLMDPVVEKKLRPFSRILHNHKFVDMYRIARHPESSQMASADPKFVCNLD
FT                   NFIKTAPLKDGEPGFIMSSPDNPDKDNKGS"
FT   CDS_pept        complement(595037..596944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631669"
FT                   /orf_name="MICPUN_50965"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65173.1"
FT                   /db_xref="UniParc:UPI000199B83D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB1"
FT                   /transl_table=1
FT                   /translation="MGGYDRFPLAASVAGPTQPVPVTPAAHNKHQTMRASIERAAAIDK
FT                   DSGASAAPTWSVGEALASQYTGVPTAAETAAAAQHAPTGVARESVPGMAKSVADSMGGI
FT                   EDLRKGREYAVAWELEVWKQAQEAKWTAHMRQKETERMAVLEGEWRRREAQRESDHRRM
FT                   REDTAALEKKLAAAVAQVEERERKLIAAEESLSVRREAERREMAQRMSEAQHAVRRLQQ
FT                   ECEHQLEMERGRGADVERQKKALEERVEEANARAAAVERAFHGYKRAHLESSEATLHAE
FT                   IARLQQQRSDAEQTAHEAVKSRDRFKTQIQKMAKQVVALERERTYLRAALSAVGGGQEV
FT                   RLPVGTTHPKPRPAPSRTDFMSDLFGGADENAAPSVGKNGQSSTRASDDNFLQEFRDSI
FT                   AALEAEAAEAERVGHVSHGAARQAAAAKAREENEPWRPAGASPAKPPKSPGRSKSPGRS
FT                   KSPGRSVRRSLAAETEEASTKGGKSPSALEQLRARRAASRRESPAKDLGEPDPSWSYGS
FT                   ESGLKALFAEAEAEEAAREAAREAQEASRERRTAAAAAAEREKDAPIAVEPEPEPSPER
FT                   PKQPVTAASLAEKRSLEKEVRRLVAERTELMATGAYTSSDRVVAMIDEKIAELTKAVAR
FT                   "
FT   CDS_pept        complement(598552..599850)
FT                   /codon_start=1
FT                   /gene_family="HOG000265060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631670"
FT                   /orf_name="MICPUN_101445"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65174.1"
FT                   /db_xref="HOGENOM:HBG561930"
FT                   /db_xref="UniParc:UPI000199B83E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB2"
FT                   /transl_table=1
FT                   /translation="MAAPTASLATVATSTWTCASSRSAVGAAARVATPRVRPTRASFLR
FT                   TAAAAKASDDASTESTSTDKASDPSSKSPEMYDNLAKIFLNRKEEDWLGLLASSEQWPQ
FT                   LKDGFFARLKVRAAEEEDPEEMLRVSRVLRLLQGTSDRVMQHAALLEEVQSKDEDMWEG
FT                   MVTSRRAEFTTEFFQFMRFKLEALVRADAAKGGTSSSPRGGKTVTADERAALKGEREDA
FT                   GKDERDADKRRDDLARLASVLLTICEAFDEATKDQQTLEDAADNFKELLEVETLEEMNT
FT                   KIDEMQAQGKLDPALVLTAAKAYMSVKESPYVEEEVKDVMAHLYFKMKETMGRQQPKEV
FT                   RILKYLLSIEDPQEIRKGLEEAFTPGPELTVGDEDYLFCEAPVLLQTIETVLKAYDAQK
FT                   GKANITGQAAELMQPEVIEKMKTVKFQIEAHFM"
FT   CDS_pept        <601059..>601625
FT                   /codon_start=1
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631671"
FT                   /orf_name="MICPUN_72851"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /protein_id="ACO64829.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000199B83F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB3"
FT                   /transl_table=1
FT                   /translation="LILFGPPGAGKGTHAPKIVDKLRIPQLSTGDMLRAAVAAGTEVGK
FT                   RAKAAMDSGALVTDEIVVGIIADRIKEDDCARGFILDGFPRTVEQSKMLDAELAKTGEE
FT                   VSRVLELSVPDAVLTERICGRWVHKGSGRSYHVKFAPPKSLRPGETPGTENMRDDETGE
FT                   ALMQRSDDTEAALSSRLEAYHAQTVP"
FT   CDS_pept        join(complement(602390..602653),complement(601981..602300),
FT                   complement(601837..601942))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631672"
FT                   /orf_name="MICPUN_60013"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65175.1"
FT                   /db_xref="InterPro:IPR018143"
FT                   /db_xref="UniParc:UPI000199B840"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB4"
FT                   /transl_table=1
FT                   /translation="MRTSVMLRALVLALCLGLTTAKASPGVCVNHQGVPSFALAGKPPA
FT                   KGKGLTFCEEYREETCCDAKTTDNVRRVAAHMQLGGFKIQCREAWTQLECSICDPRAGI
FT                   TSKTKVCAHQCDAIYRACKDDYFTEDKLQRLTPCRSSDTICTKLSEWADDMGGGQMCED
FT                   AGYEVVSAGKSKADGGWCFDGSNVPKAGASQREGQLRWGDCQKRVLPRSRGSLSPGVLR
FT                   YEGVRRE"
FT   CDS_pept        603052..603804
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631673"
FT                   /orf_name="MICPUN_60014"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64830.1"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI000199B841"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB5"
FT                   /transl_table=1
FT                   /translation="MFASTLSARCGIGCVDAGSARFRSQRRHGATHMCRGRRKAALNAR
FT                   ASADDPSASSRGGVILEEPKCELLSNEGGKYSLVGEMVVDSDADSMYRMLTDYAASPRI
FT                   FSTVDSVQTRDLDDGRLLVSQQCRWKFMVFGGAFPCHLAVKEEPARRYMEVALHKKGFI
FT                   REFEGSWTVSNEPGGGVRVRHTLALRPALTPPYAHKIFLRQIGEIFTDVKAEVERWDGA
FT                   AYYPAPIDDGSSDFGSGDEGMQPVPQSR"
FT   CDS_pept        join(complement(606038..606097),complement(604074..605810))
FT                   /codon_start=1
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631674"
FT                   /gene_name="PP2A1"
FT                   /orf_name="MICPUN_97654"
FT                   /product="Protein phosphatase 2a"
FT                   /function="binding"
FT                   /protein_id="ACO65176.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG526812"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000199B842"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB6"
FT                   /transl_table=1
FT                   /translation="MASDNSEDLFSVAMLIDELKNENVQLRLNSIRRLTTIASALGAER
FT                   TRSELVPFLTDSNDDEDECLLAIAEEMGNLISKVGGPEHVHCLLAPLENLSTVEETVVR
FT                   EKAVESACKVGAAMTSEGITAHFVPAVQRLASGDWFTARISACGMVAVAYEGCPASEAE
FT                   TRSQLRMTYSKLCADETPMVRRAAAQHLGKFAAVCEPENVKGEIMQLFQQLVQDEQDSV
FT                   RLLAVEDCAALGKLLPREECVAEIVPTVKKFAADKSWRVRYMVAQQLYSLCESVGADLA
FT                   RTELLQSYEQLLMDNEAEVRIASAGNVAAFVQLVGAAAAGAKIVPRVKDLATDQSQHVR
FT                   AALASCIMGLAPTMGKDQTIDQLLPVFLTLLKDEFPDVRLNIISKLDQVNQVIGVDLLS
FT                   QELLPAIKDLAEDIHWRVRLAIIEYIPLLASQMGTAFLFQKGEGDKGGELNALCLQWLG
FT                   DRVHSIREAAAVNLQKLTEVFGAEWACANILPRVMELMSNNHYLYRTTVVRAMTLLASA
FT                   VGQEVAMRDIMPALKEATKDKVPNVRFAVAKALGEVAAALDPSVVEGEIKPALLELQQD
FT                   QDVDVRFYAGQSLQLCDAKLSA"
FT   CDS_pept        join(complement(606832..606974),complement(606653..606731),
FT                   complement(<606463..606543))
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631675"
FT                   /orf_name="MICPUN_76999"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ACO65177.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI000199B843"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB7"
FT                   /transl_table=1
FT                   /translation="MNQPSRAEKFVLPDGVRKLTFTRDTKVANAGTYVVQKEDHTLGNI
FT                   VRMQLHRDPNVVFAGYQVPHPSDNRIVIKVHTNKNSSPMQAMTESVNCLSEEVSRL"
FT   CDS_pept        join(<608252..608520,608647..609153,609250..>609469)
FT                   /codon_start=1
FT                   /gene_family="HOG000160946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631676"
FT                   /orf_name="MICPUN_67384"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64831.1"
FT                   /db_xref="HOGENOM:HBG443712"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B844"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB8"
FT                   /transl_table=1
FT                   /translation="PEVLVPPARLETLVEQALEYQMDKCQFHNAPAKPLTLYKNYSCGK
FT                   EQLPIKTVQRLAAHADEVWHLAFSHDGKRLASGSKDGSVVVYDVLGRKPVAFLLWSPDD
FT                   SYVVSTAGNAAYVWNAETGDLHATCAGGHVHHITAAAWWPDGSRLVTCGLDKAAQAWTL
FT                   DGVRAGGWHSARMNDIAITHDGKYAVSICMEQNVTLRRLGDGREFKVKETDNLMSLSLS
FT                   ADSTWLLVNLSNSEIHLWDVNRLIEKMEEEERAAIPVGGRFVTRSCFGGGNQAFVMAGG
FT                   EDASLYIFHRKSGAQLCEIPGHFNTINTVSWNPSNPFMAASGSDDCEVRIW"
FT   CDS_pept        complement(609737..610555)
FT                   /codon_start=1
FT                   /gene_family="HOG000114205" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631677"
FT                   /orf_name="MICPUN_60018"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65178.1"
FT                   /db_xref="HOGENOM:HBG370454"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199B845"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAB9"
FT                   /transl_table=1
FT                   /translation="MRKIPNSKLFVSEPPPQWFGNESNPPKGSAPGWTNENWLKSRFHF
FT                   SFAEYNTHKNADYGVLRVMNDDLVQPGRGFGTHGHANMEIVTYIVEGSLTHKDSMGTSE
FT                   SLGRGSIQFMTAGTGVRHSEHNLDKSNPLRFIQMWITPNAGGLAPNYGSHETSPDERKN
FT                   RWCRLVGPVPGAGANAGTAPVQINQDAGISVAEIDAGQTLPLSVPAGRQAYLLCMEGSA
FT                   ADGAGGESLERHDAAELEAGTELNLTAGEEGAHLLVVEMAERAGSGRKDL"
FT   CDS_pept        611034..613295
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631678"
FT                   /orf_name="MICPUN_60019"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64832.1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI000199B911"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC0"
FT                   /transl_table=1
FT                   /translation="MAHRPPEMAAMDSSVLKPSCPGLYATTILKADYQLRDHDETIYTP
FT                   AECNSLEFNVECHLSTAFVTCKTQWMVPSKLLKSSANQGKNSCTFALPMDQKGVVTSIS
FT                   AKMKKMHIQSCVVPVADTGKFSGKRFGRNGPEPCPVHPEVFAIAIPNVPANELVDIEVT
FT                   YFQPLKFEDGAYIFEAPTTLPKGALPQGAQLKDIVHIMTTVRGARPEPVMVECKSHPVT
FT                   LVQAGPGVTQVMIDPRSNKWGNGNYLMRMPVWSPSITAAAVQQPSPKGPTADTRAPFII
FT                   SISPPDPKSCAPFARSVFFIVDRSGSMTGKPMAGANQALLAGLSSLGPQDTFNICAFDN
FT                   LQEYLSEDMVPASPENINAAKGWIQGHCTARGTTDILSPLRAAVAILSKRPLLGAVPLI
FT                   YVVTDGAVENEREICRYMQEVMSAPPPEGLMTHPRVCTFGIGRYCNHYFLKMLSQIGKG
FT                   LSDAAYTDERVGSQMIALINASRTPVLTDVMLGIPGAGESSKVEVYPFPVPDLYIGAPV
FT                   MVAGKIQGGLPPSMSIKGRLASGEEWESTIPVAPDLQNNVLSIPLDKVFIKERIDMLTA
FT                   NAWLTNNKSAEADVTALSLEYGVPCPHTKLCAFEVDPKKSAEVEAAKKKGGAMKIAKYA
FT                   VGGAAGVMVLGALAGADFGNVGASLANVAGGIGDLGSVLGSINLPAGIAIPDIDLGVCG
FT                   DMLGGMCGEICEPVAGCLGPILEPCSGCIGSVGDVAGDAVNAIGGVAESAIDVVSGILE
FT                   "
FT   CDS_pept        complement(613481..614656)
FT                   /codon_start=1
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631679"
FT                   /orf_name="MICPUN_60020"
FT                   /product="Histone deacetylase, SIR2 family "
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65179.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000199B912"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC1"
FT                   /transl_table=1
FT                   /translation="MAAKAMAAKAMAATASSTSFHLSARANMGFRRLKTSTSAAEASPS
FT                   SSASKLTHVLATASRAGYGRRRPSTVPDCQPATAEEIASLASFIGSKERLLVITGAGCS
FT                   TESNIPDYRSPTGAYSSGFKPMTHQDFLKTEANQRRYWARSFVGWRRFAEQTAPNDAHR
FT                   AIAELQRESNVWRLITQNVDRLHQVAGAEDVLELHGSTHDVQCLACGAVSCRRRLQRRL
FT                   ADLNPRLAAAADAAIDPRSGEAPYDDGATPPSGGLASETPNLRTRPDGDVELDGELVVD
FT                   FVVPPCEKCKHGPLKPAVVFFGDGVPLATAEEARRASDGCDGVLIVGSSVSTFSAFRLV
FT                   RDAHVRGVPVAVLTCGWTRVDEMASVKVEKLAGEVLPRVVERLRREELWGF"
FT   CDS_pept        614795..615496
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631680"
FT                   /orf_name="MICPUN_60021"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64833.1"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI000199B913"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC2"
FT                   /transl_table=1
FT                   /translation="MGSSSDSDSESDSSACLVYKKTRQVKWSDDEASDDGAPEPIALLD
FT                   REDSPAIISPGGRSAKRRRTSGEGAISGSTAGGASGEKKEIDINEILGLSNPGGGASAA
FT                   SRRVNSEASEAIRRNREQMAAMRRAATEKTVDISDDEEDAGPPPVDDAPGGGNPITLKF
FT                   KLSNGRSHEFQCKDGERFSKILADFLESDAGRPLKGTVQGRMVFDGDTIDMNKHTPKIL
FT                   DMEDEDMVDLN"
FT   CDS_pept        complement(615583..616875)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631681"
FT                   /orf_name="MICPUN_60022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65180.1"
FT                   /db_xref="HOGENOM:HBG609915"
FT                   /db_xref="UniParc:UPI000199B914"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC3"
FT                   /transl_table=1
FT                   /translation="MTCCLMLSGGSLTRAGEMSALTPYRVAILTASTAEGRFRGRPRLS
FT                   RSPTSGNDAVVSRVVSSCRSGTLTNRCRASRSSRQAPWNDVRVESGFAFRRRVVVHTTA
FT                   DRTEGEASATPAADAVPVIRSGRLRDVIVDEVLDAIEGTDSGRKMSPEQRDATDANLAE
FT                   LESIGKTQAPNSLADPLIFGDYDVAYVSTGGRQIGNPAGGRFRGGLGAMLFRTIGLEQN
FT                   LYEPNVVVNRVAFLVFGLIPGEVVLNGTFAALTAELAEKNEKGEVNPFGIDDGQTVRAF
FT                   FDPPRITLGGLPSFGIGPKSSVVLSTTYLDERVRLGRGSRGSLFVFTRKSEEQAARDRR
FT                   RWSVGGLGVTMMLACTAALFVFAVRRFRSGGVTELSVATAVAVAVSFAMALVMRQGGII
FT                   AEDADYDEAYEKTVEANKAVTKAAREGEGEQ"
FT   CDS_pept        join(617003..617076,617185..619102,619157..619477)
FT                   /codon_start=1
FT                   /gene_family="HOG000265093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631682"
FT                   /orf_name="MICPUN_83783"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64834.1"
FT                   /db_xref="HOGENOM:HBG561936"
FT                   /db_xref="InterPro:IPR019335"
FT                   /db_xref="UniParc:UPI000199B915"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC4"
FT                   /transl_table=1
FT                   /translation="MSFNPAEFSDANFDVKAWVNSACAGCPRGESMEKYLSEVEMKLQL
FT                   VAEDISLALEEQSVAGLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASV
FT                   NLLRDIDAVKGRMELTRDTLAEAAGLAELMRSADDVFAGGNVRSMADIVASMRRSLKVV
FT                   GSVPEFEDAPERVEALEHRLEQAVKPELVKALANENAFRASELRNVLDVSGRITALIHA
FT                   YAEVRVVEPLRREWDAFKKGAVPAGPAATAATSEAQRFAEWLPGYCEKVASRLRREVSF
FT                   CRSAFPRECEELIATAWVKLSEATKREFSERMASQRLDWFIAAHRAAGDGYSTAAKSVA
FT                   DATGPERAAYALRAALAPFDAVRDRYGELEARAIAEDLAKLEVRRCDDVEAAAGEMSAA
FT                   VPVAIESLGRAMERCVALTAGTQASAMLKAVDDGLVRYVDSLTASMRRLRKSQGLPTSG
FT                   GEGKKEGSEGRVVAGEESIQSALQLTAVAHALTARVKDLERSLVASLKELRGALLPALP
FT                   EPGPASEMPQPAAADALTPALAAVHANPDGARRLRALLDRVHQDVRFGPLARGVPRCAD
FT                   FEDCARDFVLDVLLSKVRSEFRGLAKRAEWSTSAESSDFDLPTFSAYPQGYVTTAGEYL
FT                   LSLPQHLESIADAAEEERAAAAAAGEMGRAATAAEHFDSGEWMTRVAEAAAGLLLAEVR
FT                   AITTLGEPGAAQLAADLEYFNNIISALFSEPPSALRTYAVCAAAARDSYAISVRDVEGM
FT                   DEDVIRAVAKARGIKLN"
FT   CDS_pept        join(complement(620733..620858),complement(619546..620640))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631683"
FT                   /orf_name="MICPUN_60024"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65181.1"
FT                   /db_xref="UniParc:UPI000199B916"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC5"
FT                   /transl_table=1
FT                   /translation="MADSLVDLGIQDALRYVNVDIIPSIVTVARDVMMILVTSLTCIFF
FT                   AYTLAKTETLAAAVWTLAKCGTALGAFQLVWSHFVDPFILSKTSKLAESGRGSSVFDRS
FT                   RRREDPLAHKRAARRASTKTGGLATVGSPRGGDPRARSDSPSVRENVHVVPYVASGLAS
FT                   ASSPVAPRGLSLDELRDGTTVCIELRGAGSGSSDGWSEGFLCVHPYRTYETAGMMGALN
FT                   WGGHQMTVTPRAQVEAMCADASDSADHEKETARFLFRVHLFGTGCDVTLRSESTGTLVT
FT                   TFLQGVRFDRRRVVAWHKQRSSKLLTAASAMFTPPEGGALEEWALHPVRRTPDGLVSDD
FT                   FSGNLEENESPNGQTTATPEFALCRPRDGTFWAYNAYGDEMMAFTRDLAEASLFRVHRA
FT                   FTDKKWD"
FT   CDS_pept        join(621109..623873,623923..623938)
FT                   /codon_start=1
FT                   /gene_family="HOG000232962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631684"
FT                   /orf_name="MICPUN_60025"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64835.1"
FT                   /db_xref="HOGENOM:HBG561938"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B917"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC6"
FT                   /transl_table=1
FT                   /translation="MTGVTCAPCATIGTIGTPLPAARGRVAGRKVPAGAEAGSAFRGRR
FT                   RSSRAVRVRAAGGGLFSAAPALNTQEIAAKVTEIKETELELSRGIWRAVDAATAAATDA
FT                   VAPLAGLDLSTGLRAAFDGAMQAVPEPVRERVTALVDAVLANEELVRAIDSVPDVAWVL
FT                   VLVATVGSKALGGGSSATAGMDEWAALAAAEGDEEPIELQNYDPDAIYAHFKRRPLVLL
FT                   RRGLRSGSLLGGYGFRLWLDRKILGEDPPEAKKAEVDAKRAIQLRDLLISLGPTYVKLG
FT                   QVLSSRQDLLPAPYIKELRTLQDSVPPFDDDLAKRILAAELGPTGARNLSLGSAPIASA
FT                   SLGQVYRGTLKKPDGTVEEVAVKVQRPGALVAISLDVGIIRSFAEPWRRFKGLNTDLEG
FT                   LVDEWGRRFVDELDYGQEAANGERFRLAMESRPDLAGVVTAAPVMPSASTRRVLTTGWI
FT                   NGQRLDTSEEGDVPRLCAVALASYLAMLLDIGTLHADPHPGNLFRTDDGKLCILDWGLV
FT                   TPVSKDLRTAILSFIAHLVSKDFEAVPGDLDAMGFIPAGKREAMEDAGVASAIGLLFSA
FT                   LAKGGGAEGFRAELGLPDADKIKEIRKELKGVKDMKLRRDKFLEASGGADSKVAQLTRD
FT                   LEGIQEKYGNIFQIPSYFGYILRSFSVLEGIGLASDKNYSIANECYPYVARRLLTDDTP
FT                   ETRRALEQLLYGKNGPKAQLSVKRVKQLANAFGNYSSITNVRESRKEEAVDGKPVSAGL
FT                   SQGTKEALRLAFAPEGSPAQDILLRELARFTGAAASSAVNSAASAPALGFLVGLAEAQQ
FT                   RAAEALGPARPPLPTAIELLAPLTAAARQTEADRETLRVAAELQELVSSLAPKSSTSSE
FT                   PSSSWVDVPVLGEVPVPSAPSLPMDERMLKELLELAPELAPGAQAAALRFGRTRR"
FT   CDS_pept        complement(623992..625146)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631685"
FT                   /orf_name="MICPUN_60026"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65182.1"
FT                   /db_xref="UniParc:UPI000199B918"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC7"
FT                   /transl_table=1
FT                   /translation="MEAFVESVDEEDLRGPPPAKDAFSPIDRRVSAPSTPAFSPGASFE
FT                   SPKMPTPSAKQALLARLNDVSIPSSPWGAATTPPHSPAVLTPTRHFESTAASPGWGRTG
FT                   GGFRKVGTEDSNSGKDGTLRLKETMSPNATVKVYSPVRQNPIVTLMHDVEAMEKKQGEI
FT                   ARRRRDREETKRRTTRGEFEEEIEMPDGPPLEPEGSYVPRLRPTSSPSIVRVRGSIRKA
FT                   EATPRVIDGRTPTKASTESALRTARVVPGMHPVGTGASFLEWSTRVPGKPTPPKPRNPP
FT                   VPKTKDLMRRRKPKKVLKKSQKMAVARWKLAREWVLEKVRADKRRQIRRNLDAVRQRRE
FT                   DERAAKEAARAAAIRAEEEELDDELMRLEMATDAFQQLWLATAA"
FT   CDS_pept        625215..625874
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631686"
FT                   /orf_name="MICPUN_60027"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64836.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199B919"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC8"
FT                   /transl_table=1
FT                   /translation="MTRWERRPAPHIMIESYRPAVSLAPTVRPTRCACVRPAASASAKP
FT                   SRPSRRNVLLLAPVLHTGLASAEEARQPPRDLGEGVRGVDLIPGRVNGAVVKEGDAVVV
FT                   NLKGRLFAKQGWVFSDDWAETRDGLPQSHTFTVGAGEVIRGLEVGVLGMQEGGVRRVVC
FT                   PPNVSYQTKDQQPVPRDFSNRQRLYTTIFNPTRLANGEGDTLSTVIFDIELVRVAR"
FT   CDS_pept        complement(625952..627616)
FT                   /codon_start=1
FT                   /gene_family="HOG000188732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631687"
FT                   /orf_name="MICPUN_60028"
FT                   /product="U3 snornp-associated-like WD40 repeat-containing
FT                   protein"
FT                   /protein_id="ACO65183.1"
FT                   /db_xref="HOGENOM:HBG713247"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B91A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAC9"
FT                   /transl_table=1
FT                   /translation="MPPKKASGLTASKKRPHEAPVKGRKSFAGSRQKVAKGAAAAADKD
FT                   DDAEGDDMLEDALDEDDFGRKKGRKGGDSDDDSDEEVKETADEKRLRLAKSYLEKLRRE
FT                   EAEDGSGSEEEDDEDNIRNMDSHDRLANRLKNEAMAKSGRVRREIAHRVVAPTLDADSD
FT                   VEDEDDEDTAGDAWRDVRRGHKLSVTGMALTSDDSTCYTVSKDGGIAKWDIETGARTRF
FT                   PRAPPAVVDPSRGGGGPMAPPKCGAATLLCCAVSQEHNLLCTAGADKRIHVWDTRTAKK
FT                   VHEFASHRGAVTGLAIRDGTGQMFSSSTDKTLKVWSLDDMAYVDTLFGHQSDVLGVAPQ
FT                   RKERVVTVGRDRTCRFWKVAEDSQLIFRPGPSGGQLESVAFTSSDTWITGADDGTVALW
FT                   STTKKRAVMEWKNAHGFGEEMTGPKFATGDEVDAAIESRLDAQAACGMPEEPEPPEGVG
FT                   SCGRWVNAVAVSKGGDLCASGAGDGAIRMWRVCDDPGRQLMPLFALPARGFVNSLAVAS
FT                   SGRFVLAGMGQEPRQGRWGRDAQARNGLLMHRLTLED"
FT   CDS_pept        628130..629068
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631688"
FT                   /orf_name="MICPUN_50969"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO64837.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI000199B91B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD0"
FT                   /transl_table=1
FT                   /translation="MGKLDVEEYGTYDSMVATLLEHKFLPEKEVLQLCERARSLISEES
FT                   NVHSVRAPVTVVGDIHGQFHDLLEMFKLGGYAPDTNYLFLGDYVDRGYYSVETVTLVVA
FT                   LKVRYPDRVTIIRGNHESRQITQVYGFYDECMRKYGHAGIWKAFTDLFDYMPLTAVIEN
FT                   QIFCPHGGLSPSIDSLEDVRKIDRFQEVPHEGPVCDLVWSDPDDRTGWGMSPRGAGYTF
FT                   GQDITEQFNHANGLKMIARAHQLVMEGYLPTHDNGLVTIFSAPNYCYRCGNQAAIMEVS
FT                   ETMDTEFLQFDPAPRRGEEQSAAKRCPDYFL"
FT   CDS_pept        complement(629260..629814)
FT                   /codon_start=1
FT                   /gene_family="HOG000232447" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631689"
FT                   /orf_name="MICPUN_60030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65184.1"
FT                   /db_xref="HOGENOM:HBG561941"
FT                   /db_xref="UniParc:UPI000199B91C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD1"
FT                   /transl_table=1
FT                   /translation="MTAASAAASSVLRVTPAPASRPRALVCPLRAVVAGKGSYPLPVED
FT                   DERTKRGGAAESAPPSFSRREIDDELSNRWIDLDPAGYYLISVDHNRGVIRAAHFLNVI
FT                   DKEGRACDPMTGEVIPCDGSYKPAVHKTFSGRTAKELSVKILESEEGQGTVTMLVHANY
FT                   LGREFQRAEACLVSGDKYVQD"
FT   CDS_pept        join(630203..630553,630656..633349)
FT                   /codon_start=1
FT                   /gene_family="HOG000167329" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631690"
FT                   /orf_name="MICPUN_107000"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO64838.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG356508"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000199AD00"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD2"
FT                   /transl_table=1
FT                   /translation="MAAAGEIDEDLHSRQLAVYGRESMRKLAGATVLICGMKGLGAEIA
FT                   KNVILAGVKGVTIQDASACELADLGAQFYLSEADVGKNRAEACAAKLQELNPAVTVTVN
FT                   TGEITDDLCKQHTVVVCTEVPLAKAKEVDAFCHANGIAFIRGDVRGVFGSLFCDFGPGF
FT                   DVLDVDGEEPHSCIVASISNDATPLVTCVDDERVELQDGQRVLFAEVKGMTELNDGVPR
FT                   RIKNVKAHSFELEEDTTAYGQYTGGGIATQVKETKKLAFKTLAAAMEDPGEFLLSDFAK
FT                   LDRSAVLHVGFNALDAFAVKNGRLPTPGSDSDAAAVVACAKDINDAASPATKIDDVDPD
FT                   GVLTVFAKTAAGYLSPMCAMFGGVIGQEVVKACTGKFHPLHQWFYFDSVESLPAKETLT
FT                   ETELAPEGSRYDSQIACFGKTIQRKIESQKIFLVGAGALGCEFIKNFALMGLSCGADGK
FT                   VTVTDDDVIEKSNLSRQFLFRDWNIGQAKSTCATNAAKAINGALNVDPLQNRVSPDTED
FT                   VFDDDFWQGLDVVVNALDNVNARLYVDSRCVYFGKPLLESGTLGTKCNTQMVVPHLTEN
FT                   YGASRDPPEKSAPMCTLHSFPHNIDHCLTWARSEFEGMFEKSPGEANAYLAKPEEYAAA
FT                   ARQAGDAAARENLEKAAECLLTSKCSTYEECVAWARLKFQDSFHDKIAQLVFTFPEDAT
FT                   TSTGSPFWSAPKRFPHALNFSTDDASNLTLIRAMANLKAELHGLERPSWAADDAAMADA
FT                   ISKVDVPEFKPKSGVKIETDPKATAPASLGMDDEAIIEDLLGKLEQVRLGFAADYRLSV
FT                   IEFEKDDDTNFHMDAIAGLSNMRARNYDIPEVDKLKAKFIAGRIIPAIATTTAMATGLV
FT                   CLELYKVLNGAKLEAYRNTFANLALPLFAMAEPIAPKNFEFKDMKWSLWDRWILEGDFT
FT                   VKELLDWFEAKELTAYSVSCGQSLIYNNIFPKHKERMNQKVSDLVQTVAKMTIPAKRKH
FT                   FDIVVACEDEEGEDIDVPLVSVKFR"
FT   CDS_pept        complement(633412..635043)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631691"
FT                   /orf_name="MICPUN_60032"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65185.1"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI000199AD01"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD3"
FT                   /transl_table=1
FT                   /translation="MARVGEDVGMAPPGDGGTGRTAVATRVPRDAAALMPPPAPRPQQR
FT                   ARKQKVLDEDEWTERLDAIITRDYFPHVPRLKNKLEWIEARNSGDPEQMRRAQENIQRR
FT                   QRDALGTPGGILDTPSLGGSSGSGVTPGSSVPGTPRNGYYGGVDPAQLAAAAARAADSR
FT                   MSLDQFAATHTSEDNDSFREILERHNAKRGARYAWQQQETHDAWQAKQTLRIEAAEAAV
FT                   KRRRALAAPGGSDGGGGGAIVAVTDGSGTEDGAGAPLVFTKFKAKNELYYPPDGLAYSS
FT                   KEMQAMVQGPPKETVAKNTRFAAPRSRQTNGVGLHKALFTPTPGRFAGDEDAAERVARE
FT                   LEAAVRGKSGEMYTSAGTERRAYGLVHTPAGATPRATPRATPSATPARATPGARVDDSP
FT                   AVGGEFWGASTATPLRDMDDDMDAYFEDLGGGTGGGPTFGMRPADKREELLRKLTDSRA
FT                   KRTPSRAGATPSRPGGVMRTPGGVTPSFDAALRGSYSGRTPGATPRMTPNRGGIRTGSA
FT                   TPKVGGAGSATNARGAGALTDDLLNI"
FT   CDS_pept        join(635524..636542,636765..637539)
FT                   /codon_start=1
FT                   /gene_family="HOG000217922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631692"
FT                   /orf_name="MICPUN_60033"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO64839.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AD02"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD4"
FT                   /transl_table=1
FT                   /translation="MSAPAAPAAPAAPAAGLSATSLYCGDLDSNCTEAQLYELFSTIGP
FT                   VVSIRVCRDLITRRSLGYAYVNFQQGADAARAIDVLNFNVVNGKPIRIMYSQRDPALRK
FT                   SGVGNIFIKNLDKEIDNKALYDTFSQFGNIVSAKVAADGQGVSKGYGFVQFAEQEAAQQ
FT                   AIDKVNGMLLNDKQVYVGPFQRRGERGGGPTTFNNVYVKNLHESVDEDKLKEVFGAVGK
FT                   LTSVVIMKDGEGKSKGFGFVCFEESEAASEAVEKLDGYDKIEDKAWVVCRAQKKAEREA
FT                   ELKAKFDAERRERLEKMAGANLYIKNLEDTVDDAKLRELFAEFGTITSCRVMRDASGAS
FT                   RGSAFVAFSSADEATRAVTEMNGKMAGTKPLYVALAQRKEDRRMRLQAQFAQRAVANGG
FT                   MPGMPYGMPPPGVPGAMYYGQPPPGVMGPPQPQPGFGFQPIMPPGPGRPMGPGGPMQYA
FT                   NMPMPQRGGMPGQRGRGGRGGAQGGRGARGQNMRGFNQNMPPAPPAPNMPPAPEAPMSA
FT                   VEQLAAQLPNASADQQRMLLGEALYPLVDAVEPASSAKITGMLLEMDQSEVLHLIEDSK
FT                   ALSDKVQEAVAVLKAAASEDA"
FT   CDS_pept        complement(<639065..639760)
FT                   /codon_start=1
FT                   /gene_family="HOG000070588" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631693"
FT                   /orf_name="MICPUN_83610"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65186.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG318130"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000199AD03"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD5"
FT                   /transl_table=1
FT                   /translation="MQESSLQTRGRDFYGSLPLGTRGVFVTCVALYVTGVLLGFDDFAQ
FT                   ICMAPSWVLRDGQVYRMFTSVLFHGSVLHLAFNMMAFVPMASSLERLLGTVQFTYILVL
FT                   FTLLASIFHVGLAFIGGTLGYPSMHECAIGFSGVIFGVIVVDTHLSSVAQRSIFGFFTV
FT                   PSQWYPLSLLIFLQVLMPSVSFVGHLSGLLAGLTYVRGHLNPLLLRPSTTAWIEQHAWA
FT                   APAVRHGAFI"
FT   CDS_pept        complement(<639880..640999)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631694"
FT                   /orf_name="MICPUN_108601"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65187.1"
FT                   /db_xref="UniParc:UPI000199AD04"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD6"
FT                   /transl_table=1
FT                   /translation="MDYVIAPCELPATIDARTLTALDACHPPSVVPRGEEGTRGPVVEI
FT                   VAAPASWLRARRPSGPSDNGRSNRDVETADGHGDEPTGMDHPRTYLGRLTSHHASHRDG
FT                   ASSVAVRYDARTAAGASGAAVFETSEDGTYRRLVAMHRAGDPAAEVSAAAKHAEGLSIA
FT                   DIMRDVSEITAERAVRIGASSGDLRPAASELLLRRGAATADGYESRGRRCRAAAAALRA
FT                   AAEHPHRASRAACDLSGGGGDVHEGADALLSALEEWKELSATRSVRFADAAAHLAGSLA
FT                   RAELGGPLRYETDQLLLDVLSKHDEVEAIVSKTLWALRLRMKRRGGVNPALDQLIEQTT
FT                   SRLRGARNDGEESSVHRELLLLDALMTSKRHTI"
FT   CDS_pept        641800..642903
FT                   /codon_start=1
FT                   /gene_family="HOG000265114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631695"
FT                   /orf_name="MICPUN_60037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64840.1"
FT                   /db_xref="HOGENOM:HBG710131"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI000199AD05"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD7"
FT                   /transl_table=1
FT                   /translation="MPMTTISASLAPPSRVTAVHGSASSRTTSARSIPICTTPSIRRAS
FT                   GSSARTARVAAGKFQKIGVSSEDGAEDGAEGSATPAAPKLEIVGLANDDGTQKFDDDEL
FT                   PDNLFDAVATAATATEQAISNGSLGNLVELRIPELWDPISGNVMAEAGDQLKVWEITRE
FT                   YAAQLCERMGPDSKVKAVFPDAGCAAMLKARWPDAPFAIASANDRLLYQDGDEVLVFAA
FT                   PDPPSLEKVTSTTKLANENGAAVVLVNPRLASGDAGIGLTVRRMREDFLGRMTVVYCLQ
FT                   PLPWCNGSIFKRYPGLWRLYLEDETRPGRFKLVQESATRLAGDDLDDVVMSKLRPEGED
FT                   GEEKEMGPGEMVFKLVRDAQRFMNSLR"
FT   CDS_pept        complement(642983..645064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631696"
FT                   /orf_name="MICPUN_60038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65188.1"
FT                   /db_xref="UniParc:UPI000199AD06"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD8"
FT                   /transl_table=1
FT                   /translation="MPLASDARPRGHASDTGNGALRWRAPVVGTKRHESAGRRKEEDSH
FT                   GRTRDERRASSSSATSSGPGEGSDAAVRSSTEEGFNIALVELAAEMERELALERTGDKP
FT                   RTAIGSFIEKFRGAGASSPGGVDERGRGEGGDRGDDAPFWWRDTSATSPSPDRSLRDGL
FT                   GDVVLAASPVLGQSPSLDRSGFSEGWRSEDSYPSDEMLSELSESSMRLTRRLARAREEV
FT                   GLSTEDSLASLEAWRRSDDYAHLIADDVERVDILEQWRRRRRLEAATKGADASHAARAA
FT                   AAVAALDAGSDLDREAIEKIAAAAAAKVSVEEAEAAMLRAEAEAEDAARAGNRAPPATE
FT                   RSSPERSSPSKSRAVETTKEARGGDEAASSPAKGKARRSLEFGGGAGDDGADVHNDGTD
FT                   VPDSASESSSMNTPAGSPRANQASDMRRPDMMLGDMLGDTVGDVLFGDGPADGLMVFPT
FT                   TAAVVAQPAKPPAGAPSPAIDAPSPPPSPARSPESAAFPRPPPSSSGPSSSSSGSIRRP
FT                   ARLPPVHRPPLPKQKAERYQPPREPLSPREPPSPREPLSPIEMVAAEVPPRPPRPPPES
FT                   PPESPKAADAFEHSPTRHPATASAAVVAAAATASNPWLPARMQTGASVHRPTHNAEYAN
FT                   AAAVRGDAAAPSGEPYPKPPGWLGDEWAAPEDEDDGLVVMLKARIENLQGQLARYNSS"
FT   CDS_pept        645207..645584
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631697"
FT                   /orf_name="MICPUN_101458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64841.1"
FT                   /db_xref="UniParc:UPI000199AD07"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAD9"
FT                   /transl_table=1
FT                   /translation="MMSNPVSEITSDPAHSEEEQEGEEEYVGMTKEQLHFGVHEERRAV
FT                   MRVMFASVFDDGEEIKDDVKQTLEMLGIDEDEMADLQDIGDAMMEDLEAAEDDEEMEAI
FT                   MYAAVDKYLGIEDNPFLEAAN"
FT   CDS_pept        join(complement(648374..648418),complement(645694..648270))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631698"
FT                   /orf_name="MICPUN_60040"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65189.1"
FT                   /db_xref="UniParc:UPI000199AD08"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE0"
FT                   /transl_table=1
FT                   /translation="MFRGVNVAHKYVNAEGNILRRLLTPDEYDDIRHYEIIFVEGRTGS
FT                   NLTRGLKKGNIYVAITSRNLHFCPMKGVERHEVVTVPLSEIDNVELKGHPGKQFFHSHI
FT                   FGTHKANKFAKRLKLTRKKKSEFVAEEVGSSPGEGPGEEGIGEKSGAPAPALPETQEAK
FT                   PQSFGGWGRSGPVVESTSTSTPLGHSPEPRNFNFWEAMANLSPPAPGPGPVTESAEPSA
FT                   APETTTAAPPEPTDAKPLQKAGPSFDVAAAVSAATFSPPESADPPPAAFKWTQQDQTTD
FT                   SDFDYEHISIVTYEIGSQVQYQLESATVRNQGRISVRNAEELRATAQAARGEEDTTTEW
FT                   GRVQSALADVFPRELLAYAAKMNDVESWTFGATGIEVAAQMTEQTSRVRRGEDGSLSYE
FT                   TPPALPAVPTQTAYQSLDEPNEGRLIVPPPPNPMLERARNGLMLAAPLAPALEVARAAL
FT                   EAAKGIEEGGVDPRREPNYAREMFGTLELMMLAPVEMGERGLNIAIESVSPLDCGDLCA
FT                   AAAMTEHFKSVPKMRKLALGSRTLFDVTVNRLTKSVMEATYPRPSLVAARRKGNNLGSP
FT                   MANWNRLLHAARQGASAHRAVQLFAWVRAALAGAEGAAHERADIVGRYDSLAALVHACF
FT                   VFEPEKHRATAFRDARGSDEPFPPEPAETADATRLRAPAHAVSTGVIDLVVDVLYECAL
FT                   LTHHAHLMGAGDEVSQPPKHVTAHVVKARVTRRAFRPKVTAMFARLVNLVLDAQHRGNG
FT                   EVTGADAVRAHRCAYVLRHLIEGTGDGSVAACVEEEYPTEMNYVMTRPEVMSVTEAGGD
FT                   EFFRRHVKPHLDFVLAECVPHLLPGKRDKQREEAEGLKGKHQSGTLNTMMRMAERAETE
FT                   VQ"
FT   CDS_pept        join(648651..650017,650037..>650042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631699"
FT                   /orf_name="MICPUN_60041"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64842.1"
FT                   /db_xref="UniParc:UPI000199AD09"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE1"
FT                   /transl_table=1
FT                   /translation="MPTIVVATGARFAPVIRASSGDRASVGSGEAVKGKNSAPIEGGTF
FT                   TPNPKTVWRGDAGLRSGPKRQMKNPDDFGGDYDKIREELMTQGYRGWAGNLSISNTINW
FT                   LSENTFGAGGTSLGRGIDAVAGAYRKFLDALPYRRQDGRQARALPKGRAAEAYKRWEAF
FT                   KAGESKPDDDGPVVGGRQGMLRGERDVFEYWTKVSEEAEAARKAGKRQKAAGRVGLSNK
FT                   LGEGRLVLAEGQRRAISADVMGLVLSLRRAAAALERGDDASAGFASDAACVDASADEAD
FT                   DRRDELLSGWGGGGDSISFYGGYGAITPLEAAEARDAAGWTPTQVAERINAISALLVCT
FT                   PGDAVACAHRFPAVLETPQSVLAARMAALKELLPRADAALIFRAEPRLLLAGDGDIIMG
FT                   NVRRSVEAIKRDLPGINADKLLELEPRMMFEDISSGLEALRELWPEEAFRQSDADNPR"
FT   CDS_pept        complement(<650424..>651371)
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631700"
FT                   /orf_name="MICPUN_68300"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO65190.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG443943"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199AD0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE2"
FT                   /transl_table=1
FT                   /translation="FSFDRVFGPDSTQSDVYEEVSPVVMGVLDGYNACVFAYGQTGSGK
FT                   THTMGGPDGASQHEELVGINDRALTELFETARARGETDGVAYTIAVEMREIYNEQVRDL
FT                   LRRTDKDATWNGVTEQPRFHERRPTTSSEGTDDSDVEVTRVTARDAAHVLEIMAEGTAR
FT                   RASGETKMNERSSRSHSVVTVYVEGSDAAMGAVKTGRLHLIDLAGSERVARSEATGDRL
FT                   KEAQHINKSLSALGDVIAALLEKRTHVPFRNSQLTRLLSDSLGGNSKVVLLAHVSPEAA
FT                   SLPETQSTLLFAQRCSQVELGKAKVNATGGGGSSE"
FT   CDS_pept        join(complement(653798..653890),complement(652727..653680))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631701"
FT                   /orf_name="MICPUN_60043"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65191.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199AD0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE3"
FT                   /transl_table=1
FT                   /translation="MPSAEDPAGFDRSRSWRISASVKGIKDLVFRVPIGDGTLKVSELS
FT                   DMIMERFARLRPGDSTRAEKLEDGDGALLFPNERVCDVLFDKGRVVAVLSNKYTHMIQD
FT                   AGGGKRPTKRIKGAGGGMQVVAVQAYKRDDDEFEYITPTVEEIMDVDTRRQEKRVKCPL
FT                   CDQMFATASKVAFHIKTHKDHPDLQQAIMAMDENTAFSEERERRFFCPSPNCAHNCDDN
FT                   GELAHPFMDFPTLRKHFLRTHVAEKPHKCKICDKAYALKSDMQTHERGCGKAFTCECGR
FT                   RYSQRSNLNAHIRKKAAEGAAEGAHKLKRPGPPAIAGPAAGAVNVPPPPRGADPQRSVP
FT                   ELLHHLSG"
FT   CDS_pept        654040..655098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631702"
FT                   /gene_name="RN3.3"
FT                   /orf_name="MICPUN_60044"
FT                   /product="Ribonuclease III/double strand RNA binding domain
FT                   -containing protein"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64843.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI000199ADC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE4"
FT                   /transl_table=1
FT                   /translation="MAAASLGARFAPCVTGCDDTRAYRATTVASSRTRGGFSVECLWKR
FT                   KSATSRRIRQRKSALRRIYMDPEDEDRLRTWRKLIVNVPIEKILPRDISFGPGIERDGD
FT                   AAERMAFFGDKYLNLSVAKALERQLLDGDETMSIGEMSVLCSSARSNMLFAKLLPKLLT
FT                   PDMVAAVPEEAIMEGRQHSVGTLLESCVYLVYTTGGGEGAAAVDELGTFLLEEAEKQAA
FT                   DVHNYKGALYELIAKGVDGYVVTKDKMGEASGGAHPQRFETEVELDGVRARFLARNKRE
FT                   AERGAAKRVLEKLFERERMRVLAGEDLGSRGGSWQGTPERPVPPPQLLRKKSGSFDSMD
FT                   EAMEADEVMGEA"
FT   CDS_pept        complement(655156..656721)
FT                   /codon_start=1
FT                   /gene_family="HOG000265110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631703"
FT                   /orf_name="MICPUN_60045"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65192.1"
FT                   /db_xref="HOGENOM:HBG561948"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199ADC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE5"
FT                   /transl_table=1
FT                   /translation="MATVVAGTYERFVFGYQLDGLPGSSGGGGGAPEVVRSFTLDAHLS
FT                   SCKSVAAQGGFIASGGADDLIRVWHHNPDGGLADIGTLSGHEGNVSCMQFHGSDPTREP
FT                   TRLVSGSVDGNIIIWSVGQWDALKTMKAHRGGVHALSVHRSGLVAMSAGADSHIAMWDM
FT                   KKGRVAHKTKLKTKPELLAFTPSGNSYASVAGTRLTITSAETGTVSGVFDAPKRVMCMA
FT                   QAGDDTLACLGLEGGDVFGYDSRAPPTKPAFTITKAHPTRVKCMVFPVDDAERGPVMGG
FT                   PGGGPVCLVTGSSEGTVRLWDLRAVGASGGAAARARDMGVDDARDEPLAEATGGGRFTC
FT                   MAVMPTQLPKTVVEAIGAEKDRDPAEMKKKRKEMKLRQAEKARERANATQPARQPQQKQ
FT                   RQQQQKPKQQQKQQKHQQKRVEKPDDDDEGFEVVAGDDDDDEPPRVAKTAGPAKKRKVK
FT                   EASGVGEDGPLVPRKAGFKTGKKSGGGGVGGKSYEEIATAARRKGSGVKKGKPSRGFGK
FT                   PSRD"
FT   CDS_pept        complement(656987..657910)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631704"
FT                   /orf_name="MICPUN_101463"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65193.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199ADC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE6"
FT                   /transl_table=1
FT                   /translation="MYGGYGGGRGGGRGGRSKNVWVRPGSTPATAPSTQDSKKPTTGKA
FT                   GSEGANDARPDPAAIKPPPSSTKGATLSASARSYTPASNGDKGGAGSNHVGQSFLPVGV
FT                   KRKAGESEDGAAGPKRQHIYVDPALQEKQRKATEAKAELEAKIAAAKEEAERMKRSIQE
FT                   AAAKAKAKKEEAQREEWKRKELERKEMEMEKQKKQKAASNLLSGFAAARKKHGVGTADG
FT                   PKPAAEPEVELTQEEKDRQEVRRVMMATSDWQVLNLVPNAQPKWVKQAYRELAKVLHPD
FT                   KCKAPGAKDAFQKLSKAYQNINAMQA"
FT   CDS_pept        join(658185..658423,658567..658867)
FT                   /codon_start=1
FT                   /gene_family="HOG000232520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631705"
FT                   /orf_name="MICPUN_60047"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO64844.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="UniParc:UPI000199ADC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE7"
FT                   /transl_table=1
FT                   /translation="MSAFTTASAAVALPVRASASTRRASAAQPARVNLSGARLASAPAR
FT                   AAGRDRGDSLVVRMASNPNLDRENPDLQEKFAVIGSGEHQCQSCLYVYNPKNGDPDYPV
FT                   ASGTAFKDLPEDWLCPTCGAAPKTFKSLGKEVAGFEQNQGYGFGTNSMSGGEKSILIYG
FT                   ALALFFALFLGGYLLD"
FT   CDS_pept        complement(658939..661527)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631706"
FT                   /orf_name="MICPUN_101464"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65194.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199ADC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE8"
FT                   /transl_table=1
FT                   /translation="MARKQKATEVRHPSSDVDDGVGDKLFFLRTKYSLLGKAEWWWLMD
FT                   DSLAEINARLESEHFVVIDGFLTGAHTRSLRDEIRDAHEHGHLAPGVLAGGKAGDATQY
FT                   TMRDVRGDHVGWFDGTERLEGVQWDTLPTAMKRADTLVNQLGAQPRSELATVSSRSKAM
FT                   CTVYPGDDARYVRHVDNPDGNGRLLTALLYLNPEWEEGDGGELRVFRCLSGSGEAAAAG
FT                   FVDCDGKSLESADSFDTRVKSGHLGGATDEFNVAVDARDVAEGVRDVATLRGAGENGST
FT                   TKPVRLTDVAPLGGRVVLFKSDARVPHEVLAAHAPRYAVTLWYFDKSEVTAARAAPLSE
FT                   AERKEQEEKIAREIEFMRLKHGATSEPEVRIRDSQEGEWRDTGTTRPTPDVPGQCSAAW
FT                   EDGDVIAITVPLPAGTCAADCGVEVDTSSSTLIIEAPGLEGNVARVKLPEGADEDSISV
FT                   KLSKKPTRALVVRVRCEPLAVLPTPTPHTVESPPPEPEPDLPPRTGVPATSAAKDCVGV
FT                   GGTLSWSSSTDFSTLPSVPPREPGTAPRGIDLRDASDWEDFIQTRWALAGKEDEQPVLT
FT                   PHALDGLSFPVTLAWSLQQPGVSEALAAARKKTRTDATRTDATFANLGDETAGTTPVVV
FT                   VIAGASSFTEQYLLDRTRYWEEVTVAAPQPAGGIHLAFVGPDVVAASGEAKRLSPTITA
FT                   SVHRETVRDYTARVPNDVPLMIVGFNTGMGGGGGALARGWAPDLVETLSRRPDAPAVFT
FT                   AANDYADLRGELAVFKALGARFIVDPRANPFRAFTHTIGEGEGEPGVRSAPRQGEKWSC
FT                   ANAFVYAVQGFAKGKGPSAGLTDEQLCTLAAKAAERAAGAAWDALGMRRS"
FT   CDS_pept        join(661760..661840,661974..662600)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631707"
FT                   /orf_name="MICPUN_60049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64845.1"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="UniParc:UPI000199ADC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAE9"
FT                   /transl_table=1
FT                   /translation="MGGLFGDRTASAERLNSAFDSMSVNNSNARASTSQQRPQPSTSSV
FT                   AREFPRLLQKSSAELAELLTDKEAFARFLHGTEGALEARAFTRELRLEIEGMCRANIEK
FT                   AEEARDLRSQMSVIRSCDAQPVKDGYEAARKKADAMMGKYNLGDALARLKERARDAEEK
FT                   AESLSEDLVAGKIEPKDFLAKYVPLRQAYHEDTVRAEIVEPALASRRPGGGPPQPPPPP
FT                   PGAPPAASRYGGM"
FT   CDS_pept        complement(662676..663317)
FT                   /codon_start=1
FT                   /gene_family="HOG000265143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631708"
FT                   /orf_name="MICPUN_60050"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65195.1"
FT                   /db_xref="HOGENOM:HBG561954"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199ADCA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF0"
FT                   /transl_table=1
FT                   /translation="MKKELLQAVANSRRPGADGVRAKRAVLDATEALESGVDASTPFGE
FT                   VSGRWSLVYSTNDDRGPPGLGPLQGVIDTDAIQKLTSQLYQVFFTFLPALAGSAETGAK
FT                   GVANEQVVDIPNGRVVNNVDVDLPWPIGGARVGVMGEVTANDPEGREVVVTFTSWELGP
FT                   KPGQRDRGGDPPRLQLPLPRPKGVLRNTFCDDTLRISRGGRGGVFITSRL"
FT   CDS_pept        <663942..>664718
FT                   /codon_start=1
FT                   /gene_family="HOG000212937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631709"
FT                   /orf_name="MICPUN_70696"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO64846.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG526758"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000199ADCB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF1"
FT                   /transl_table=1
FT                   /translation="TGVNAKEKTLILSSRGVTSRYRHLMLDFCTMMPNSKKDAKLDTKN
FT                   PQGAVVEVADMKSCTGAMFFECRKRTDCYMWLSKCPQGPSVKFYVENVHTMAELKLTGN
FT                   HLKFSRPVLHFDASFDDKPHLRLIKEMLTHTFATPYRHHKMKPFIDHIFAFYWEDGRVW
FT                   FRNYQIVHPEGKEVRATGLTLSEAGPRLCLQPIKIFQGAFGGPTLYEDPAYVSPNIQRR
FT                   EQKKQDMGKYARKVQKKAERKAHARMNALKPDELDGW"
FT   CDS_pept        664922..667618
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631710"
FT                   /orf_name="MICPUN_101466"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64847.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199ADCC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF2"
FT                   /transl_table=1
FT                   /translation="MPPKRTREGEDKVPAESADAVVDTAAADATALVHLRGTDAGASPP
FT                   PVECRLVESRGRALVASRKIEKGAVFMSERPIAAVQAVANRAAFAACAHCLAPVGLGAT
FT                   HHLALACGATTRRDLVAAVSSPQGWGRIKYDKPTLPRLSGDEDGALVPCRRARGGCAEV
FT                   FCTARCRADADGWHSLVCVGHCEEGSPMYEFRRHAMRTHESFLLAANAAARALADAGAS
FT                   DGVGEGEAGRSADEKTAAFDPRRDASLAAAANVRALTALCAPREPWWETAARVAGLEDP
FT                   DAGSRDPKRSAKYARRLERRAETLREQIEDAWQLLEMSWVRMRNLGVDAGTGEPTPVAP
FT                   LLTFDAFHRLVAAVDNTVLPVGDEHPGATYARRALKAEAWDAEMACRALDGWLDAIGEG
FT                   GVAMGHAGDGSEDESEEDEGSSEDDSSDSDESGPGTPGRSDEDDEDDDEDSESEGEDGG
FT                   APEPNVTRRGDWTERGPVAARPAPVSNAKGAGMLDVVERAAAKLPRLAALALAPGVALV
FT                   NHSCLPNCQVEITRGTVDDAEEGDDEKTGEKTKKPERGADCGSLRVSLLALRDISPGEE
FT                   LTVGYVPVTQDIASRRADLAARHGFVCSCARCELESGADGANPSVADMKRLADQAQEEA
FT                   RYEDAEAAARFVLKSDPTDGDAHHKIGTAMLGQGRWADAHAAWREGVAVAPDHPALSSQ
FT                   AAKDEAYAPGVPAADQTRRSVAFESVHEAGIWATPESSPLMTEAECAEWVRLAEKAGEA
FT                   RGGWTTSRHYAVPTTDIPVHAIPDLLPLWNALMRDKLASLLSAACPEEMPKPSSVRVHD
FT                   AFVVRYEAGAQHHLPMHADQSAVSVTLALNDEGEYEGGGTTFAVPVGKTVRPGRGHVVA
FT                   FKGGLQHGGSPVTRGVRYIVAAFLFAE"
FT   CDS_pept        668286..669866
FT                   /codon_start=1
FT                   /gene_family="HOG000012756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631711"
FT                   /orf_name="MICPUN_101467"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO64848.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG349450"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199ADCD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF3"
FT                   /transl_table=1
FT                   /translation="MLVMRLARVSATRCSTGYVNRFTAGLGTTADATTSSVETSGWLGR
FT                   PETDSRPSNSEDTERGDVRTPADSDRDHFRENPSVALWNEWRFDGTPEGARALLLECAS
FT                   SARTPRDAAYWAYHVARSSWFLGQGAAGILASSLGGGGGPSGGGAPLAGDGSIRSGIIA
FT                   GSRLMAEALQTFRQDLAHINAGTYKAPYDMDPNHRQFNPAYVASKTARFLTEAASTLEK
FT                   NRAARRSESAPETKVWMDSPMYPDYYLKTFHWQTDGWLSSRSAEVYETSTETLFLGRQD
FT                   AMQRTALVPLSEWMRERGVKDGAGAKFLELACGTGRFLTFVRDNYPKMDVTGLELSPFY
FT                   LAEARKNGAYWEKLRRRKRSSPAGLVTETLSKVGGLAKAAGLPVPPMPSARRDDVQDEA
FT                   GKETLGSCEYVQAQAEKMPFPDASFDAITCVYLLHELPPETRREVAKEAARVLRPGGVL
FT                   ILADSIQLGDRPRMDKNLGRFGDFNEPYYRSYIEEALVEVFGPEGAGLEPWTKDLCSST
FT                   KVLSFRKPE"
FT   CDS_pept        join(complement(670110..670488),complement(669971..670074))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631712"
FT                   /orf_name="MICPUN_60054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65196.1"
FT                   /db_xref="UniParc:UPI000199ADCE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF4"
FT                   /transl_table=1
FT                   /translation="MFADHQHSGTSHTDTRACRTHHMRLVCLVLLLLLHAEFASCRVVS
FT                   TRPNVTEASPLTKKPPPQLSLEEHLFDCRVKCRDEIWNPVCHANTTYANDCWVNCTAGI
FT                   RDVNTGAITEEGSCNRRQEDPEFRFRKPHSVRPMETRMWRRRHYIHHCVFRFVFRG"
FT   CDS_pept        complement(670748..672007)
FT                   /codon_start=1
FT                   /gene_family="HOG000264800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631713"
FT                   /orf_name="MICPUN_60055"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65197.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG561957"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199ADCF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF5"
FT                   /transl_table=1
FT                   /translation="MSTSPAPEGEDPADLLDRTNLAAYLSARKQLAAENSQLGLPTRPV
FT                   LPGVLRTDETVSEAMELLSSLRVQAAPLVAMHADNQHYDAQAFISCGDLVLGFLERVNS
FT                   SGLGTATRDVNVLDRMAALTAVGQAYSKTKLVDIRSRWDGTGVWSTATEDMSLADALRR
FT                   CMHIGEEHRNEPGSPMLRQCPHRFAVIDASGMVVDIVAQSDLAMYLRRNADLLDQTVMN
FT                   ATLQSMNLGSQGSRRVVSVNASTPTVDCFYEMERANVQAVAIIDENTDALIGNLSETDI
FT                   MTLKSDAYGALALPVGEYLLHAHGITNPKIPDIVNRTLYNPDSTVFSAALANEGSRLVV
FT                   TCELGATIAEVLDAMHVKAVHRVWVVDDAGRPVGVVALSDILAAIAVKKPAGVRGTSEG
FT                   TMGKSTMHAAIPTPTSQSSA"
FT   CDS_pept        672255..673913
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631714"
FT                   /orf_name="MICPUN_60056"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64849.1"
FT                   /db_xref="UniParc:UPI000199ADD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF6"
FT                   /transl_table=1
FT                   /translation="MVHEPAPLSVLTNIESQVSGGCRWRDSKFHPPIVSSVTSPRGTAC
FT                   GLVCLLRDIPTLIAPCHVIGGIDELRSVKAVARVPIHPVDAFGSETVAKDTASAAVHME
FT                   LKLDPETLFFHSPPPSAGRPLDHNHLDYVAVAIRYPYPRERLRRLEDAAEVVAPRTRMT
FT                   LFAAPGEWHELTSDDPEALARRAKRYQLTSASAAACISSRGGAAAAAEVLWRPGWVTSS
FT                   NALTAAEHVVVRHNATRLPNEAGALVMSATPGWNGSEPSAGPGEYWSGLRLLALQRSRT
FT                   GDGEEGAGVMIADVLRDVAEHEAERTVRASVKALRMRPVVEELMRDAAGMYPGSGSRGM
FT                   RCRAAIEALLAVGNEPVGATAQAALMHKNSDREILTVNSTARAENGCAHLQRDMERWTE
FT                   RFSLSVQLADATCHALGWLARARIGDGDAGAGTGDALCLKLMWRHPTCGALRAKGLWAL
FT                   RMRLQHRMNHPAVGSDGRTGLARMAEAAKRALQEPEEVAEGPGRSAMMNQAAMLADLCL
FT                   QSVPGYPPEKPAPPIIPEDVTDRPRSYFNDTAHLL"
FT   CDS_pept        674041..676188
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631715"
FT                   /orf_name="MICPUN_60057"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /protein_id="ACO64850.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI000199AE92"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF7"
FT                   /transl_table=1
FT                   /translation="MATRKRCTALVVDVSPSMHPHLGPVGDHLSRVVQNRILNARIDEF
FT                   ALIAFGSDETNNDVHTEGLDAAAASGERDYEEEYRNIAVKVPMGCCSSESAEVVASLRG
FT                   MAGSAPSDYLEALVVASDMLVNHQRGGAFLRRIMLVTDLRTPCEVDDDFIEDIARGMRA
FT                   VDMQLTVAVVRGEESEDETTRIQEEDTVMANRETLQRLCDLLNEPSDKGPVAVTNRSCI
FT                   EDHAAALQAAQVKTTKPTTTFRGDLEFTPWMSLKVWVYKKVSEAKPPAMKMYSDAADEA
FT                   AGDDPTVGRERVFRSYADPDAPVDVAPEMMISAYPYGPANIPIQDEVKELIAARNDKGM
FT                   KIFGFTSLDQVPHWMGMDEPRVLVPWPTKDGSLAAGMAASAGATDREHRKATEAMSAMA
FT                   RAMQRKGQAALVRAVWTQNSDKVSFGALTPHITKEGDFLLFVPLPFAEDMYSNDFKPLP
FT                   VPGCKAAAQLGANAKAKLVPTDEQRAAAAALVDSLDGSGPDPWDCLNPSLTRTHALIAA
FT                   RATNELAAPPASASGSGPDAAAVLLASPFTGVPAMALPAGRSLAGPGAREAAAAFRLAC
FT                   GGLKLTEPKTGGWKRKRAGTEALPAHREVPEENVAVEHRADDDDDAAVPAHASAQRPQR
FT                   EDGAAPRRAPEAARAARPDSPRGDEDAWTVVVKEEPVSQVTMDLPTQVLPVEMEPANIA
FT                   VPTQVEAPKPAEDDEFFDDMD"
FT   CDS_pept        join(complement(676348..677692),complement(676252..676313))
FT                   /codon_start=1
FT                   /gene_family="HOG000265144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631716"
FT                   /orf_name="MICPUN_60058"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65198.1"
FT                   /db_xref="HOGENOM:HBG407598"
FT                   /db_xref="UniParc:UPI000199AE93"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF8"
FT                   /transl_table=1
FT                   /translation="MYVPRIAVVGGGVSGLVLGKELASRGLHATVFDTGEHACGGRASS
FT                   REAADNGRRFSFDHSTQYMTCTEGSRFESMAKEWAKEGLLAEWPADRVGTLKDGSFTPF
FT                   DDGVVRYIGAGGLRPLADFLAEGSTEVVRPQWVGAMTPVGGEGPKRRWELASGPRGKPL
FT                   GTFDFVAISHNGKCALRLAETAKLQDGSPAAAKTRASLQCAFGARPTEELKKQRKLILS
FT                   SVWALMFAVDKPLNVKDNMEGAHIVGSEVVSWASNITAKRRHGKVRTDTDGGDTQCWVV
FT                   HSTPQFARDNKCPQEAIPKSVADSVIAAMTREFERCAGLEPGSVKPVFTKVQLWGAANP
FT                   LTAAGVPAVFDSETRTGACGDWCQGPPSVEAAAESALALADAIEATFSPTTARDPAAAG
FT                   RLDAAKVRWAPCSGDAAALGAFPGTNVPSMGEIAAAPRREGGGGRGGRGGADNASVAAA
FT                   GGAEAGVEPV"
FT   CDS_pept        677843..678574
FT                   /codon_start=1
FT                   /gene_family="HOG000186907" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631717"
FT                   /orf_name="MICPUN_60059"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64851.1"
FT                   /db_xref="HOGENOM:HBG620708"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199AE94"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAF9"
FT                   /transl_table=1
FT                   /translation="MPDYVDQRAIMCVAGGIVAGALVGAHLKGMSWCPALWGTSDDGKG
FT                   AGSAGQSRSTKEEFISQLGMIPHPEGGFFVETYRSGSVPMTSRGLTDKDGELMTTNRGP
FT                   TPERNVMTSIYYMLTAERPHQDWVNNMSDHVHYHHAGGTLIYNLVLPDGTFVERRLGTN
FT                   VAAGDEPQLVVKGGTLKSVRLEAGAEFGLLGEGVAPGFDFRDFKWVTAKELKALSPEAF
FT                   AKTSDLIKPQPEETFDHFYDK"
FT   CDS_pept        join(complement(678810..679882),complement(678714..678732))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631718"
FT                   /orf_name="MICPUN_60060"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO65199.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199AE95"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG0"
FT                   /transl_table=1
FT                   /translation="MSACGSGKSSKGGGSKSRSKGGKGDALHKKVSLQTSKEHLTTLRQ
FT                   ALRDELGHDRDVVSGFGAFTKYDRNDVALDIHFRTGSTITDDELEWAYELVSSNLGPLG
FT                   HKWKPQALMDDLCDPSSRYALVTERTSSAPAAEKKPASKSKGKKKAPAPPLGKPVAFAH
FT                   FRFTVQGETREAMEGEPVLMLRDLHVEADYQRRGLGRHLCQLLELSARKNSMRAMMLLV
FT                   PSGSAGVPGRSFVDQKLKGFTCVDDEWAPVDVNLSAYGKSLVAQVPAKKPETVPAASPD
FT                   SILAGPERVEKENVEPEASVAKLETAFESATIAPAAEKEPEPAAPALFAGFAPVAAADA
FT                   TKAPLSFASFGTAAAEEVRRRGG"
FT   CDS_pept        join(680025..680626,680810..>681134)
FT                   /codon_start=1
FT                   /gene_family="HOG000264445" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631719"
FT                   /orf_name="MICPUN_69661"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO64852.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG746046"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI000199AE96"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG1"
FT                   /transl_table=1
FT                   /translation="MGIKGLPEVLRPWLKSVQVGKYAGKRAAVDAYSWLHKGAYSCALE
FT                   LGTNNRWWIRQRRDAPYVRYCIHRAQMLRHYGITPVIVFDGDRLPAKGGEEKERRERRA
FT                   ECMRKGHERLAARDRDGATFMFAQGLDITPAMAHELIAALKREGFEFIVAPYEADAQIA
FT                   ALAQLGAKGDPGGVDIVFTEDSDLVAYGCPLVLFKLDKSKAGGGAKGPLNFIGWKHEQF
FT                   LELCVLSGCDFLPNIRGIGIKKAHALVAKHRSVAAVLAVLHGDKKIHVPPGYDDDFRRA
FT                   FWTFRHARVYDPALRRLRPLNPMPEELE"
FT   CDS_pept        complement(682274..687610)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631720"
FT                   /orf_name="MICPUN_104880"
FT                   /product="Bromodomain-containing protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65200.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR000770"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI000199AE97"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG2"
FT                   /transl_table=1
FT                   /translation="MPRSSHSRHAQLSRQFERRVGARSGHARAKVATREIASRPPLGEA
FT                   GLADNSALPMDPAKEPSMPGDGDAATADDKENGASMGPAGAKSTAMDTAGAQSAGAEGG
FT                   APAADGDAPQAEDGDDEEDEESEEESEEEEDDGMTEYERQRQRNIQRNRELMMQLSLKK
FT                   MADNIKPDEEENAAKKRGPKKGWKKNRGPVAPSRGSSRIQRLQEERKHTAWKDLRVDKP
FT                   LKTHPNCYVELAPQCLGIADNERRVDGSDGIMIPGGYFAEGEFMSETLYCWTDMLGKHF
FT                   VAWGEAEGDRQRHVETEDGGSDTAAGAALCILRELQRRKLELFGAIPGRGVSEPTNIRM
FT                   RIDDLPTLYREPEKMPAVLKPLLEAASRPVLPPKRKPGRPPKEKKEKLAKTPKTPKTSK
FT                   SVYGAAKFADVPDAPECHNCGVKREQTQKMRFGPSGAKTLCNACGLYWATQGRNRPNGV
FT                   FKDDYERKVPEGQVPAVAYTRGFRPDTISRAYNTVAVGNLDEKKSPIDSAEKKEPEEGT
FT                   VVAMPDSAEKKEEDGEDVADVVDDDDDDDDEPLMDIARKVDEDEEDDDEDVDDEEEEEA
FT                   GAEQQTEPTAASTPAKDLGRGSFFQNMVKMASVGIVTPAMIGADDFPAILPVGFPAPRW
FT                   APHLTHPLPPLLGMTEDSAYEVKTDPQNSKLAKAIAVIAESDPIKDAQGDKLKDYPDFA
FT                   WYAVRTCAAALSGWGATVAGVGPTGPCVFPTRFTPTSMAPTPRVYVERDVDGLTLFGYA
FT                   EPEVQQALEGQMEKYEQKAEVEGPESEEAERKVDLNEALAFLDTHVKRAMKVLQNADNR
FT                   ADRDAKYERAAPRVAMASEAKILCPPLPNADKSKKTKGKGGAGVSGASAGDDSEQAGFL
FT                   TEEAVRALPGQEEVPEPISVVCGTATEGVLLPYCRPREEKIQINDSEETIVTPAVYERM
FT                   GGMGASKKWRKSIRLANNTDKHLGNHLAELGAVKGESVVGRRIAIYWVDDKSFYLGVVD
FT                   SFTPQTGEHGIKYDDGEIEDLFLPMQRIKWLSQDVGPAGFGQLKGDAPAAAEKTQEQLA
FT                   HESIMAAAKAKEEEAAAAEARRIEEEAKGILSPEGRNRMTLGAFDVWVNRPLQWRMKNS
FT                   ERRKCFEILQILRSVPDPDDDPDDEDEPPRLLIEPFDTLPTPRELPDYYEIIRCPMDCR
FT                   CIERVLKRPAERSFASPWMFAVAVELMLTNAQIYNDEDSQIHEEAGIIRRAFVKAMEER
FT                   FPNQPLPRPFKIYETVDEPMWMRPWGWTAPQPEDVADEADPFGPLDWEQEAKDEDEERA
FT                   LARAMKAGAAMYGGAPVVIAKPKGRPPGRPRKEDPGAYARDDTNYDPKSRHGVSAASRG
FT                   NKRKQTDLNLGPAATAAKDALDEAAEALTLDELVEAAESAKAPELAGARRPGSTMLSIL
FT                   RQHPDIFVESLTGNGAVFSINERLVEYSDDDEPAGPARKPTTRAKPKKSYADPDEDDFD
FT                   DHDAASPDHHGGKRKREEPHYDGLSPQQTEACKNILKKVKELKDRDGRQVAELFILLPT
FT                   RKQLPDYYKQIAHPIDFDSIGKCLNKQGGYQTVWKFLLACELMLSNAQVYNEEHSELWE
FT                   DAATLRKAFIAELKKVYPGHPYPKPMSVYDEEECQEPEWNRPEKKSGGMKVVVKAGGGG
FT                   AAAQGLKVKMHNAGKGDALKVTMHKATDEPDPMPAFEDCGKCATCTMARKSRAHRCLEV
FT                   QMKEQLHLGHEGAKVAAKGAGAKGMKLEIYWPGDDSFYSGQVVGFDAVKLEHKIKYDAE
FT                   GEEEHIALWGPEEVVKVKSSRR"
FT   CDS_pept        complement(687802..688362)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631721"
FT                   /orf_name="MICPUN_108602"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65201.1"
FT                   /db_xref="UniParc:UPI000199AE98"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG3"
FT                   /transl_table=1
FT                   /translation="MAEAAVVALWAQRARTVARRVFTAWLAAAVRSRADKAEEEIKRLK
FT                   FQMAEAEAAAEVAAEAAAAAAAAKKSKGGFLTRLTSTKSVKKAPSDGSGLALGNPFEES
FT                   QEEPSSPRLPESPSSKASMDDNPFRRSPSVSIEDNPFKAAATADSASSADRDLTAPAAR
FT                   RPDPAPSKPLAEPKSAPKCCVIM"
FT   CDS_pept        join(690509..690613,690694..691785)
FT                   /codon_start=1
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631722"
FT                   /orf_name="MICPUN_83398"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO64853.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG330750"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI000199AE99"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG4"
FT                   /transl_table=1
FT                   /translation="MGADEDRAPEDVAAGDGEEASAGGKKGRYRRDKPWDHDGIDHWKV
FT                   DPFTKDDNPDGLLEESSFATLFPKYREKYLREVWPSVTRALKECGIACELNLVEGSMTV
FT                   RTTRKTFDPYIIIKSRDLIKLLSRSVPAPQALKILQDDVQCDVIKIGGMVRNKERYVKR
FT                   RQRLIGPNGSTLKAIEMLTNCYVLVQGNTVSCMGGWKGLKMVRKIIEDCMRNMHPIYHI
FT                   KELMIKRELAKDPALADQSWDRFLPKFKKKNVQRKKPAKIGKGKKDQVFPPAPQPSKID
FT                   MQIESGEYFLSQEAKRRRAAQEKLDKQKEALSASQKRRRDAFIAPKEDGPEDGDAARKK
FT                   KREVSADDVKASVAKLKEKSAAKKEEERNRKSSRNVLGAGKREKKEKKEKKEKKRSSD"
FT   CDS_pept        <692189..>693133
FT                   /codon_start=1
FT                   /gene_family="HOG000240556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631723"
FT                   /orf_name="MICPUN_75700"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO64854.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG286166"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199AE9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG5"
FT                   /transl_table=1
FT                   /translation="AGLGLAFAARRLKRDLDTPGRPWMDGTTVGREYDAWTEEQILEYY
FT                   WGEHIHLGYYSDDDLAKGAGTLLGCKVKDFIEAKLDFCDEMLAWSECPDKPAKVLDVGC
FT                   GIGGTSRHLAKTFGSGTQVTGITLSPKQVERATELAKEQNLPNASFRVMNALEMEFPAD
FT                   TFDMVWACESGEHMPDKKKYVEEMVRVLKPGGRLVIATWCQRSTPPAFTEEDLVNLDYL
FT                   YKEWAHPYFISIEEYASLVEGTTTMRDVDTDDWTRQTIASWRHSIWAGVWDPIPVFSRP
FT                   NIWYKTLRDIVCLERMRRAFGRGLMQYGMIKGVK"
FT   CDS_pept        693282..699455
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631724"
FT                   /orf_name="MICPUN_60065"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO64855.1"
FT                   /db_xref="UniParc:UPI000199AF48"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG6"
FT                   /transl_table=1
FT                   /translation="MGGWRGGAWRLPLVVVALLTWLAGCGGDAAITGPPGFVAGYPRIE
FT                   RVGALTFVVAIRLDVPGAVDLVAASASEYPGCGECFEAMGVQCVDSCFGQCLVACLIAQ
FT                   NATNATTAPKPYFRRTIELPNPGRETRVLIRGAYNLQRPDLSGTYGDFVVYPNTTYSVA
FT                   VAPRNSSAYLNQPGDDDTAVVHVTTAAAVSSDASLARLGSTNSTALTPAFDNSSSPSTW
FT                   SYETSVADDVDAVTVWALPSAGAVHSVVIDGVAARPGPGSAAVPAGAYSTAPRRVFYGR
FT                   SEPVVVEVTAEDRETRARYELHVTRRRSTEARLADLVLRSIEIRPAFDPDVYAYSATVA
FT                   HDVVSMRVIPTLMDTRAQAIRVNAVVQENKAASRDLPLRLGSTPISIEITAQDPADENK
FT                   KVYRIDVTRAYASTDVQLGALEVSSVMTERTGRDMGLMLFRTVRSSHKLTPAFDDSPLE
FT                   SVQNVSIVADYNTSVDNTVQRVTVKAAARDPQATLVVKAVSLDVEGNNNEVMVAVAAQP
FT                   SPDKERLPAPWNTLLYKYELDVAPGRTLVTLDVIAEDPRHSRVVNLTVFHHAPSTDATL
FT                   SDLVVHVAPGRAEPTLVPAFDPSTLDYTVDIDYHDEAVLVIPTVADDQYRFLRVNTVLQ
FT                   RSGDPSRAYFVKPGGMAVVTVSVTAEDGVTVMNYVVVVRRGLPSVEARLADLLVSTGNM
FT                   TPAFSPDVYLYSLGPLRYDQNTVQVTPVAMDPDHERILVNGARQPSGSISRQIEIEEGY
FT                   GNGAEYTLGNGTVEVMVWAENGMTFKTYRILVTRQPAPISDNDATLRELRISPSATTRL
FT                   IPSFSPLQFDYRLFVPNREPSVAVTPVSNDVDAFRVSVNDDDVGSGGTFITTMADLLAR
FT                   EDVVLDIEVRAKSCGPTYQPAECVRNHYKVEVLEYGPGAYDGLLHTLSGNMVDPGGAVR
FT                   VMRPFPVPFKDPEGFLESLSELRLSEYDMGKKSSQTEGFCDNYLCVNSVIDSSLTALEI
FT                   QVSGTLERLVGDSSIPSSALPNATVQYSPSFHNETRFYVADVSSPRTESIRINATAASN
FT                   MITGIRINGVSADSGVFSADIKLDYRTTIVSIVVTAGRYEIQSTYTVHIYRPLNTNTFL
FT                   ADFSFYGYNLLKFQEPNLTSVPEPMEPCDMHNASLRQSLNISSHHMCGGTGSALVVGTI
FT                   SLFQGLNTSALEDGAPAGALPGSASSTRKLIHPCDDTFLATHPVLKEACAKADIDDIID
FT                   CEPQADSVFQVAAFDYNWPDYLVNVESRTEYLIASVSVIDKNAEMISIGKVRNCRDAPR
FT                   SSGCEGRDFTDFGWDYGDYGIVSMRDKHESPPIDVDIGSTVGTVTVTAHDSITKGTYNF
FT                   RAVKLSPVVYPEILNLGSYLDGLIGDSEDPNFEMEFTLRMAGFNPLWILDSFFRQNLEQ
FT                   HVRKYITYAAVVEDAVVSVKIYGSPRNQSACRLLDPGEAGGGVDVKVYTKFWKETDATH
FT                   LLAWLEGQGWHNARGFTFDGYLLSFGPIYKVDGPSQRTFRATFIPTRHRYEVTLPTGTR
FT                   HVPLTVPPPPHVPPIEGFGVRVNGEEYTLGSTFSVEVPRCAIGPRHCDARHLTITAEAC
FT                   IFDECVTYTVVATIPAVSIPANDASMRAVNITAGPTNSTAGGRILVEYSPSFFHDVRRF
FT                   SARVDGGLEFLHLSVAPNSPSYSRLFINGRPTLPYTEVSVPLSLLLTELNGVLTVRVIA
FT                   EDNFTTSDTKIHVLVDSPRGLMTDNANALDPLKGKYGFDGGVLPGGVDTTPPEWKESYP
FT                   RVEPVWEGGPHLELAAQTMEPAVVYWALAVPWSRPPTSREVYDAVVRLNHTKTRLIEGS
FT                   VSDFIADALNSSVPATTESGFVATGVMTSRYSMTREERTAVTCLDPNVGFDVYFVAEDK
FT                   ALDLSLNPAANRQTVPTLVRGVKPGSGPLGLLYPWVDSFSELHGDLWENITGGELIALS
FT                   LLFDGAASNHFASTYAAKGSLACPGAVHFEVTAVNASSVDSSSGDVVLEARREPAGEAA
FT                   GDWTQLWKTTLLDLKTKSDASVDGWISVVSEKIPAGDYWTLRWRVEGSCCHSWALRNLT
FT                   TRYITP"
FT   CDS_pept        join(complement(701254..701460),complement(699731..701128))
FT                   /codon_start=1
FT                   /gene_family="HOG000294940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631725"
FT                   /gene_name="SSIIB"
FT                   /orf_name="MICPUN_83804"
FT                   /product="Glycosyltransferase family 5 protein "
FT                   /function="starch synthase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO65202.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0009011"
FT                   /db_xref="HOGENOM:HBG596384"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniParc:UPI000199AF49"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG7"
FT                   /transl_table=1
FT                   /translation="MTLARSSFAPAPNRAFRNVVKAPARRTRSGVAVKAEGDFDRLNVV
FT                   IVGAECAPFSKTGGLGDVVQSLPKALVRRGHRVMSVVPMYHHYDECHTPCARQKFNVMG
FT                   TEVEVEYYHLNRDGVDIVFVNHPCFHEVGDQIYAGSTMDVAWRGALMSQAGIEAVWHVH
FT                   CGGFPFGDENLIYVSNDWHTGLLPVYLRAFYQDHFKLGYARAVHIVHNIAHQGRAHPEE
FT                   VWRLGLPEQHTGAFYLDDPMEGPCMNIMKAAINYATKVIAVSPGYAWELGTDEGGWGLA
FT                   PTVRSDPAKVSGIVNGIDFHDWDPSHDRFLQSDGFQTYGLNLEGLWTGKQACKAALQRS
FT                   LGLPERHDACMIGFIGRLDEQKGIDLVLDSEEFLMNQDIQLVFLGSGRQDLKDRLYDME
FT                   CRNRDKVRSWLGFSNEMAHRITAGCDILLMPSRFEPCGLNQLYAMHYGTVPVVHAVGGL
FT                   RDTVRHFDGENDGTGWTFERATPDKLQWALGQAIYTYQSHRESFMQVALRACHQDLGWD
FT                   HAAYLYEQKFYEAKYSH"
FT   CDS_pept        701902..702546
FT                   /codon_start=1
FT                   /gene_family="HOG000154889" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631726"
FT                   /orf_name="MICPUN_108604"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64856.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199AF4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG8"
FT                   /transl_table=1
FT                   /translation="MSAAVHATLAVRAPVKPSALTSRFAVAADARVSRRAPISFSRHGR
FT                   RGALRAVAAIEDNQVVTIHYVLKFASGEVADDTRKRNAPVRLPIGQGALFPTLEAGIKE
FT                   MAEGEKRVFNLACKDAYGERDEGKIQKFPASAEELESVKAQVQPGRVVQLPNGGTAVCV
FT                   GFEDDGLILDLNHPMAGKDLEFEIELVEVEEGPKLFGVPVVPFDVNKLVMK"
FT   CDS_pept        702857..703399
FT                   /codon_start=1
FT                   /gene_family="HOG000064533" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631727"
FT                   /orf_name="MICPUN_108605"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="HslUV protease complex"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO64857.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0009376"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG288822"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="UniParc:UPI000199AF4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAG9"
FT                   /transl_table=1
FT                   /translation="MADGQVTLGSQVIKPNVKKVRRLQGGVVGGFAGATADAFTLFERL
FT                   EMKLEEHPGQLTRAAVELAKAWRNDKYLRRLEATMVVADKHHTFQITGGGDVIEPHDGV
FT                   IGIGSGGPYATAAARALVDIDGMDAMAIAKKAMNIAADTCVYTNHNFIIESIGPNDEVG
FT                   GGDAAKKGDEKGGKEKK"
FT   CDS_pept        complement(703496..704734)
FT                   /codon_start=1
FT                   /gene_family="HOG000265142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631728"
FT                   /orf_name="MICPUN_60068"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65203.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199AF4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH0"
FT                   /transl_table=1
FT                   /translation="MGKPAMSGVKKNKKKGFKPSRGKTPGGRVYEVAQEILNAPEGGVA
FT                   AVIAAALNDKEAPIRRDPRAFTMFSTRCRKKGDWSKCVEIFDAMRDQGVETNTIVYNAT
FT                   MSACSKGGDWERALELFETMPREGHDRSTITYNVAMSACMRGGDWERALELFDQMAEEG
FT                   LERDHVSINTAMAAAEAGGQTERLKELTSGAGATGAPGGDIGGQNDDDDDEDEDIDQDD
FT                   DDVDGRVDGGGAATANGSSNAVTKEKDADNRDDDRSDGEEGEKDPDIEEDPVVRERRLK
FT                   AERRDARKRKFEEKRRARKAAKLARGWVTDNGEVPEDGPGAGRKKPAAAGPIVPTETAK
FT                   KRKEWGSNPLKWVDEDEGLKKKGGGDDDSESDDVGDGLPPITGPSLLDAPDEEAGTLLN
FT                   DRDDTDDFWATGF"
FT   CDS_pept        705332..706735
FT                   /codon_start=1
FT                   /gene_family="HOG000100107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631729"
FT                   /orf_name="MICPUN_108606"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64858.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG610964"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199AF4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH1"
FT                   /transl_table=1
FT                   /translation="MNEPSEALACKKDGFFVAGFETPGQYSQLKGQYIPLSRAICCRPC
FT                   LPPGDSALPGVKGNVTAEDVVAISSDCQASAKPSRGSSVGGQTCPADSFVQGFAHDVRA
FT                   NPTSAPDDQYYYPTGNAQCCSPRLLLRDGDELPVERCFCTEQSAAYAVGCGAANTPDSA
FT                   QASGALIYAFDNEVSALSALGEKIEVPVTPVRCCKLCLSPNARPAMNDCSPLNYCGGNG
FT                   DCTVDGHCQCKTGWMGSSCETQVDDEGTMTDWATNGMKIVIGVILGCCFGRPIMRCLGL
FT                   EPRRRLAGDLEEELLPAQPQNDWEFEASDLSTSDDGEGDEDDDNATESDEEHGRDGTRQ
FT                   RDEDSGADADADVEAAPTESVEISEADEDTPRDEEAAETSSEVTKERKPDPSLGDEELK
FT                   EVTSPSHDAEEKVVKNRSTAECTVCMSARVQVVLVPCGHACLCRGCARRMRLCPICRRE
FT                   VQRRQKLYI"
FT   CDS_pept        join(complement(707098..707178),complement(706824..706991))
FT                   /codon_start=1
FT                   /gene_family="HOG000115759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631874"
FT                   /orf_name="MICPUN_60070"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="ACO65204.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000199AF4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH2"
FT                   /transl_table=1
FT                   /translation="MDSQNSELVKQQVQAELANAYAQEFFTTVREKCFAKCITKPGPSL
FT                   SSGEATCVSRCTDRYVDATRMISGVVLQAYSSGQGGV"
FT   CDS_pept        707412..708416
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631875"
FT                   /orf_name="MICPUN_101480"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64859.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199AF4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH3"
FT                   /transl_table=1
FT                   /translation="MASSGTLAGIDQTTKEQIAAAASNVHVPKVEMSSKPISPWYNVKQ
FT                   AGGLTPLEMGLNFGLVGASCVAAQGTVHWTRTAMVQQQLAGMRGEVPLGMMAQTSAIFR
FT                   SEGMRGLYRGFSAAALREATYSSLRFGLYEPLKVMMDTSDGKEELAVWKKVTAGLVAGA
FT                   GAAAIASPSDLIMIQMAASKQFPPPSMYQVASQVIAKDGIAGLYKGIGTTVTRAAVLGA
FT                   TKMATYDVVKTELRKNGWAEGPGLVFAASVVTGLAITITTSPATNMQTIIMSGNAAGGG
FT                   SGMLSAAQDILRRQGPVGFFRGFGMQWARFGPYAVVQFAVWENLRKACGIGAI"
FT   CDS_pept        708887..711565
FT                   /codon_start=1
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631876"
FT                   /orf_name="MICPUN_60072"
FT                   /product="p-type ATPase superfamily "
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64860.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199AF50"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH4"
FT                   /transl_table=1
FT                   /translation="MPTGMFGWRGKHLGRIGGAGTYSRQLWSPPRASGATLAEEGVSSA
FT                   VNRQEEENEGSTILFTVEGMRCGGCSAAVQKVLVATPGVSRAAVNLVTETAAVELAAGA
FT                   SESTIAEFTKAVGDKGFTMSPRPVGRAAEEAAIKAEARRAEEMERTKWDLYKAWGLTGL
FT                   CLVTHTTHHLHHFGLHEYAHGELLTALGQPWVGGAIAVLALAGPGAGIMREGFKALANG
FT                   APNMNSLVGVGASAAFALSIAGALAPPVIGDYGVPVNNDFFEEPVLLLAFILLGRALES
FT                   RARARAASDLRSLSTLLPLDARLVVADKLPEVGDDSDPMTVSVDRLALRPGDLVRVLPG
FT                   EVIPVDGEVVSGAAAVDEATLTGEPLLVPKAGGDQVSAGTGVFEGPLTVRATTAGDGSV
FT                   AAGIARTVADAQARAAPVQRLADAVAGPFVYGVMAASATTFAFWNFAGDAFFPGALLEA
FT                   SGGAGATLGALKLATDVLVVACPCALGLATPTAVLVATSAGARLGLLLRGGDVLEASAQ
FT                   IDTVALDKTGTITEGKPRVTGVACASDELTSADVLRLAAAVESTTTHPLAAAVEEAATA
FT                   AVTADRGPHNTLPRADDAETSPGRGAAANVEGKRVYVGNPEWVESQVGAPAGSAAALSA
FT                   AAADNSEATGGPAAAACSLVAVGIEGEGIIGAIALADKIRPGAAGAVRRLVDMGLKVVI
FT                   LSGDRQPAVDAIAQELGLGGSVVAKGGLLPADKEAFVKGLQERGAKVAMVGDGINDAPA
FT                   LVAADVGMAVSGGMEATAQAAGVVLLGDKDDGKSGVAGGGVGQAADAIELGRSALSKIR
FT                   QNLGWALAYNLVGIPVAAGVLLPEYGISLNPAAAGAMMALSSVAVVTNSLLLKVPGGVE
FT                   RAGAPGDGLIKRPSARPAPAR"
FT   CDS_pept        complement(<712337..>712765)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631877"
FT                   /orf_name="MICPUN_73774"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO65205.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AF51"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH5"
FT                   /transl_table=1
FT                   /translation="GHTVLVTGGTSGIGWESSRQLYEAGCRVIVAGRTEEKAGKAVKSI
FT                   VAASGTTGTGSLEAVGIDLADLSSIKKFVDDVAYESFSAIVLNAGVAPDRAAMGMAAGP
FT                   QTAKRTKQGFEETIGVNHLGHFLLCQGLLPKLLSTAGAR"
FT   CDS_pept        complement(713167..715014)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631878"
FT                   /orf_name="MICPUN_50982"
FT                   /product="Grf-like transcription factor "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ACO65206.1"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR011525"
FT                   /db_xref="InterPro:IPR014977"
FT                   /db_xref="UniParc:UPI000199AF52"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH6"
FT                   /transl_table=1
FT                   /translation="MEDQEPQRVEKWKTSPGGPLERHVQTSSGENAQTSSGEHAGDAGS
FT                   DLSDPNDDETNAETAVDLQCHEPVMGDAKRPRLRRHDVADKNKNKEKEVKEETDQGAAA
FT                   AGVAGETPEKAIDAANDRGTSDPTERKMEEQPENEQKASSTQEKLRQAMSTRQLQSKYE
FT                   EIFGVPTKVHNKDWILNKIRERVELELPTEQPTVSPSAKSQKRAQATTGFGSGAAIGKA
FT                   KEGGGTKKGGAPVEVPVGQIRCSRNDGKNWRCSEMAVPGHKHCPKHMRWSAGSRSAAAS
FT                   KQQGANGGVKRPRWMPDPGAKDVHSGGMPFGAQNPFLASPLLSAAASALDELHHKENMM
FT                   RALGGMMPAAFGFGRWPASVPAASAPGSGTVRPTPSKAPFSFENLHTSATAAATQSAMG
FT                   ASAAASAAAAVAAMAAASAGMAGSLPPSVSCTVELATFPAAGDTTGQGETGPTIHRTLS
FT                   LAALSSFDALHCTLAGIAGAPPPTGGRYDPSTLQVAYTDEHGVPRVLGGETWPIFMASA
FT                   RTVHARILVTKETLAAASPSAVQPVPAAPPQLPPGAMFNPFMMAMMSGGNPGGVPAPPA
FT                   APSIDPNAMYMAMMMYAAAGGGMPGATATPSERQDSPRK"
FT   CDS_pept        join(complement(716802..717956),complement(716590..716679),
FT                   complement(716439..716528))
FT                   /codon_start=1
FT                   /gene_family="HOG000265129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631879"
FT                   /orf_name="MICPUN_101482"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65207.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561968"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B000"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH7"
FT                   /transl_table=1
FT                   /translation="MSISFKVPGDEGVYIPNEFLDSLMQPDVIKNALCKHFFEGNRDLM
FT                   EKYWKTLKERELREFFRLHFGKTVEKEERPFTFVVYGASGYTGSLVLEYIYKHVRGLGS
FT                   EVTFALAGRTPSKLSDRLDEVLAKFPDATYRPEIFKADISNSMDIRKMVQKCRCVLNVA
FT                   GPFIKTNAHLLVEACIDFECDYVDVNGEVPFTHKLIPLHDWAKKRNVIICPNSAGAGGL
FT                   PDLAAFFTAEELKKVTDAELKTLRCFITSNGGAPSGGTLATRAAMTAEMGKFVKIMGDP
FT                   FALGGTVGDGKRPEDSDKVLAKVEYFPEFEGWSGPFTYAFYDTRLIRRSNWLLADLGED
FT                   PYGRHLNYSEHLLFPSEEVAKEVTSANTSSKKEEEKLKKEGKLFGLGDGLAEDVRSKLF
FT                   IDYYFHATAEDGSKIRTKISGGDGYDETARFAVEMTMLLTTKREE"
FT   CDS_pept        join(718323..718415,718741..720054)
FT                   /codon_start=1
FT                   /gene_family="HOG000259276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631880"
FT                   /gene_name="RSP3"
FT                   /orf_name="MICPUN_60075"
FT                   /product="Flagellar radial spoke protein 3 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64861.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG523291"
FT                   /db_xref="InterPro:IPR009290"
FT                   /db_xref="UniParc:UPI000199B001"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH8"
FT                   /transl_table=1
FT                   /translation="MGKGGVAVAAQKKRDESYTVAEEAPSGSLKRPKFRPQPPPEAEYG
FT                   NYPANIMYDRRVIRGSTYAAQSLHSTGPELKPTKRTRSKPPQTPEPVEGRRHMDIQTEQ
FT                   YLEELVDTVPESDVTTQTDAFMDRPPTPLFVPMKIGIDVQTQIEDGDLFDFDFEVEPIL
FT                   EVLVGKTLEQGLMEVMEEEELAAMRAHQEYFEQLRNAELVALQRMEAAEIRKMEEKMRR
FT                   IAQEKERVEREKAMREKVAAQTFARGYLNGLMGNVFDRLYDSGFFYDPVQREVEQEFMP
FT                   WFTDAVVDDCSNAAVTRRCVNDIIAKALKDMLTAKAEANENAKREVDAVANAKAARKAA
FT                   EEEEEKQAEAERNALALRILTEIDPPLVTEEQIAEAKTALTPAPPEPEAANEEAAAGDE
FT                   AAAGDEAPAVEDAAGQEEPAPVPEPTSEEILKHFLENGVVKEEDVAKALADYAPPSEEA
FT                   AEEKSEEPAA"
FT   CDS_pept        complement(720138..720533)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631881"
FT                   /orf_name="MICPUN_60076"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65208.1"
FT                   /db_xref="UniParc:UPI000199B002"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAH9"
FT                   /transl_table=1
FT                   /translation="MPVFDEHVNATSECSVEQHVVDEVTNINSRDDEGEPEVEDEDTRH
FT                   LTTPVPKGILSETRRGAGTGASPWKQVKFQSTLPEGFPERLTQQSRGFTQRGGELGGLN
FT                   LLFLVLICIFLARVLTTAVSTMLLEEL"
FT   CDS_pept        join(721035..721130,721424..722209)
FT                   /codon_start=1
FT                   /gene_family="HOG000265132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631882"
FT                   /orf_name="MICPUN_101484"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64862.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG622182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B003"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI0"
FT                   /transl_table=1
FT                   /translation="MSSCTFATPRVEVIRSRGSPLSARAARSSSSSKFPAASVIGQTNT
FT                   DTSHERLLSLGVFPRLKEKAGDEQYPFVVFSAPPSGSEDYAAEVEAALKYWDGSGAFVF
FT                   TSSTAVYAGKDGEPCDESTPQFEIGESPRADRLLKAEAAVLAAGGSVVRLAGLYHSQRG
FT                   AHMYFLKTPSLASNADGLVNLIHYEDAAAACVDVLVAQFEGRTGGGEVFLATDGVPVTR
FT                   KEMVECCLESDAYDGNMPEFTEDNGPLGKSMNNPQTREKLGWVPVHASFVEFVEAGATD
FT                   SFYPKRRKSTWK"
FT   CDS_pept        722606..723697
FT                   /codon_start=1
FT                   /gene_family="HOG000049437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631883"
FT                   /orf_name="MICPUN_96480"
FT                   /product="Serine acetyl transferase "
FT                   /function="serine O-acetyltransferase activity "
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64863.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0009001"
FT                   /db_xref="HOGENOM:HBG754554"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI000199B004"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI1"
FT                   /transl_table=1
FT                   /translation="MAQLVTSTGFATPRQCLERKLRSIAKHSTMLPAHCVGSERRRQSE
FT                   RPKVRAIADRLGARQKLSTDVPERILEVRRIPEEESATAAEENIMIEGDACPINENVVW
FT                   QTLCQEARADANSEPALASYLFSTILAHRSLEDALAFVLANKLRSNVLLDSQLLELFSV
FT                   QYRRDHSLVKKAQADMQAVMDRDPACDKYLQILLFFKGFQAIQAHRVAAALWRQDRKPL
FT                   ALLLQSRISEIFHVDIHPGATIGEGVMLDHATGVVIGETAVIENNVSILHGVTLGGTGT
FT                   KDGDRHPKIGSGVVIGAGVTILGNIKVGANSKIGAGSVVLQEIPENSTAVGIPARLVKV
FT                   GTKAEPSLSMDQVSGLDSLNYNI"
FT   CDS_pept        723943..727212
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631884"
FT                   /orf_name="MICPUN_60079"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64864.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013940"
FT                   /db_xref="UniParc:UPI000199B005"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI2"
FT                   /transl_table=1
FT                   /translation="MKRVKLAPGSKKPIEQNSSRPFLAATKPLPRSLRGGEAEFTHQDV
FT                   STCDLPGQSHNRVKDVDVEQTISREASPQPAEGREGTENVETPEGRRCAPSEVGRISSA
FT                   QERNQPVIMSTNAIADKVMEVCDALSSEALGLKEAATLLSAVLTPDLLRHPCCEDKEGT
FT                   ERLFSSSRILWNYCVAYTNDLLTGVTEQSLVPHGLTKSLEQQREAAKQVTLLRSIAADL
FT                   LEYCLSDHITISDAQIALSFTSKVACLYHEEGDFEKAATMFARASKYCDIVRQHISLTN
FT                   NDENHSEASANTQLLLSQLFDLLATEASNAWHLSDIDRCHLLLDDAYAVATHRKQNEAS
FT                   QADAVKKLVLVQLFLGKSTLEVAVSNNPNQAVRFLEGAFEILSKHLPSWMTEEYCLDHP
FT                   DVTCGNENSEIAIEVLRYLACARLSCNLYDGTTKCIETIKGKVAKYKPSSMTPNLDFTL
FT                   SYLSFQAHLQSASMDQAFIAMEKILQNPIAPLKSCTRVLLEYFHAAPGPQRKAIELFVS
FT                   KIGDPSADDVEVLHSIDSVLEGIIVTAKHEILDDTTEAILLLISEEKVKTRLLASQGTE
FT                   SRAHILIFNHASAMFKAKCFHLACKLYQCSEDFLDANGSGSNPPRVQLLRLQARCQVGS
FT                   GLFEDALATIITVESLESPLSPSTLLIKFTILLCLDGKETELDELMKLLFALEDVDFLI
FT                   AAAHEAEIRANHHIASLVLFELHRLISKDREDGPLHDIEILVFRLAVFHLTEPRNKDAG
FT                   EGDSLAVRIGKLFQLLVDRLKQTKGMQPLSETDGEYFTSVAWNTGLEAVKKGEKTPAAV
FT                   CFSTCAFLIPFFFPDTTDEGHPNKSSLIHKVRKASALLLVGACILDLCKEQHPAITRNG
FT                   LPKNYQNLLHQARGALTKLLKLVDALIAEEYEEEFVSRMRVSAIVLMHELLCLEGNDSP
FT                   DGSRQVQLMQTPCLSVKDIVLMASISAKFGSPKASSRALDIALDTMLEASSPDEDTIAA
FT                   IVRNRIELEDSEKVEEQLFKNAATNLALLSSYPADEAAWLVTTSFNRGVAHYRMGRIEK
FT                   AAEAFVIAQELVCHGKKFDPTLVRLESRIREARAAVEPAQA"
FT   CDS_pept        complement(<727716..730488)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631885"
FT                   /orf_name="MICPUN_50989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65209.1"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="UniParc:UPI000199B006"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI3"
FT                   /transl_table=1
FT                   /translation="MQLAPDIPMATHVGVATLRVADLEDTSGMATPQKVRLLLQSPSVT
FT                   PELSQNGSALPRLTAVHLVVDCFVESRASAEPHYDLKNRSGSHDMTCREELSVSSTEIV
FT                   FAVWNAWMQRGCLSNGGPLEGPLRAGLQLPPVGDVKYNSKATTNNVDKFEGRAKQMVPP
FT                   QGWRGLLSAYSALYRVPRSTIALAEAMIIARSWTSGPELSIISEIHARLAMSVASIASG
FT                   RAAQTERAMHAKAAAFILPHAEKSLQKWLAPPPGTITKEAISIIRALTPVLALCLPLET
FT                   SASKFANYMHRAALQAVMIRTLGSLSPITRDGDTAGVAMRQENDASDASQTSFNCARSD
FT                   TVPSVSALKDVVLPKHASFGSDAPLSFSRVTSAVNLAIACFDVDMSVYKALPSGVSAAP
FT                   VVFHGMVAVLMQVVNDVIVSACKLWAPPYGKPFEDLESALRQLRMKLHGAGVVSVAGSL
FT                   SVRAIERLMRIPLNHMLSSLCPRLVGILEKGVARERSISLPPTPVAPARGAMHSASLVD
FT                   LFAALRDAYIAAMPASVNDDIRWHHHTKEVDNILAQALCWYVGEHERDCLSEVRSSRAR
FT                   LWADLDRSHVIPRESSIAEGESYDTKDDVNAITATLSCGFHTRLSNIHACVASLRALRE
FT                   DCPLLWRGRESEPAAAEKHDQEVDNSDSEDDELQQDDVDQSTRLNFKNGQKDSYTAQVE
FT                   IVNFNFDVLLRKLRCSRASVIAAAAELLMDVITPDLSLAVLSPDFATRRIALAKVFDII
FT                   DAEFAIMNSSLAAGAFRLAAGSIYRALCAALERLILHRSHDDIDSYVASLSMGAYAANG
FT                   GCLSGTSKPLTESQHSRVVEIADALHDFLAVDGAGVPAQVLADGEKRLRRLLNLWFTPT
FT                   VEVCREYHRQTDAIAHRGGGAAMSDQDGPVSVLRPPEGGGVGLLDLLQLLAQR"
FT   CDS_pept        join(732083..732259,732324..732449,732509..733438)
FT                   /codon_start=1
FT                   /gene_family="HOG000030005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631886"
FT                   /orf_name="MICPUN_50990"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64865.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG561971"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199B007"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI4"
FT                   /transl_table=1
FT                   /translation="MAAVVNDFRARTRCGPPTSFDLRSTVVRTGPARVPLNLDSTCSAA
FT                   SASKRLPDVGSTKRVTLVRHGQSTWNKEGRIQGSSDLSVLTQKGESQAEITREMLQGKH
FT                   FDIGFRSPLARASRTAEVIWDSRDSKLIDLWELREIDLYSFQGLLKEEGKAKYGDKYAA
FT                   WKADPANFEIDGHFPVRELWERGAECWKSILDADGQDVLVVAHNAVNQSMVANALGLGS
FT                   EYFRRLSQSNCGLTTFVFNPYQGEEAHSVILERLNQTPALPLKGNADMTYNRALLICSS
FT                   LPKDEDEAEERTKVVESLAKVLMEEGIKSIWHDSAAFSSSLAYEIANLLKVKDFDNVFD
FT                   STDANMRSLRGAGTTVLLAEESVIASCVAHALQVDGGLGVTLTLSTGGMTLIDFSDQNV
FT                   SIACINYTAHL"
FT   CDS_pept        complement(<733984..>734253)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631887"
FT                   /orf_name="MICPUN_76856"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65210.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B008"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI5"
FT                   /transl_table=1
FT                   /translation="SWHAKFKDSAYIFAGGLSFDLTEGDILAVFSQYGEIVDVNLVRNE
FT                   ETGKSRGFAFICYEDQRSTVLAVDNLNGAKVLGRTIKVEHVEDYR"
FT   CDS_pept        join(<735420..736433,736506..>737939)
FT                   /codon_start=1
FT                   /gene_family="HOG000200829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631888"
FT                   /orf_name="MICPUN_65408"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64866.1"
FT                   /db_xref="HOGENOM:HBG609991"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="UniParc:UPI000199B009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI6"
FT                   /transl_table=1
FT                   /translation="TVVDVAVEVPKEFFQEKDYLDHRYHVKRMAYLQVLQQNLESADWV
FT                   ASSVYSTHHADVRKPCLLVKAKKPGDVCLRVLLTIPVHTFPSARLHHEKANLRNLEIQN
FT                   DERLPSPHYNHSIIEDMFMDEHIKYLRGAAETAEYYEDACILLKVWAAKRGLLGAPDGF
FT                   NGFVLSMILAYLIRSGGKLSPQMDAQQLVKGALSFLSNPATLKAGFTATGVKQNVASWR
FT                   SMFPFIFVGPCGYVNIGARISRSAMDEFIHEAARSSSLLERGGRTAFEQVFLVSLYPAM
FT                   RYDLHVHVKLDRSDNTAVGSCEGDIVSWRNHERTIHDLVTKAISNRAKLVRVQHQPFEQ
FT                   DAEDETDLYTVWVGIIFDPEHALRLVDLGPSSDNDKLAKEFRAFWGDRAELRRFKDGRI
FT                   CESVVWDSIPFNKRHHIPALATDYVLKRNFSSTETVEWSCNLLDPAMGMKESDSKESSP
FT                   IALIQCLDRLAKRMKDMKEVPLRVVNAQPISPAFRGTDPFPPRQHQLAFGAGIGLGRSD
FT                   EQMPVCPKTLDVVVQLEGSGRWPENSMAINKTKAAMALKIAEQLRSSYATPTIVTEEAT
FT                   DVLHEGYVFRLHINSSASGANNEAAEKYLIKGAAHAAVIATISARFPVYGAATQVAKRW
FT                   ISSHMLAPHIRDEVVELIMGYLFLHPGAVDPPGSREVAFIRFLDLLASHPWNVLPLFVD
FT                   PEDEFTLADMQNLEKKMDSSDASSMCIATPYDTEGDLWTQRGPPGVVLKRAQALASRAA
FT                   ERLKVLLQGKNRMGHNLSGSFMNNLLLGDASAWESLFTPALMHYDIVLKLRRTALPFPD
FT                   QALF"
FT   CDS_pept        complement(738499..739329)
FT                   /codon_start=1
FT                   /gene_family="HOG000264578" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631889"
FT                   /orf_name="MICPUN_83621"
FT                   /product="Predicted protein"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65211.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG618562"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI000199B00A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI7"
FT                   /transl_table=1
FT                   /translation="MMALQFGGLLELSPALLVSKQTVQALVSAVLMNVAIVGINQVYDK
FT                   KLDRVNKPYLPLASGAFSSDTALSIIAACTTVSLVLGVLSGSSALIFSLVVSLLLGIVY
FT                   SVDYPGLRWKRSPVLAASCVLFVRAVIVQLGFFAHALGRGLLDFHFPKNLWFAIGFMVV
FT                   YGAVIALFKDLPDVVGDQKQNIRTLSVRLGPSVVFNICVSLLSMAYGSAVLLSVMYNSA
FT                   TSTVLGILHTAVIFSLLVASKRVDISSSASLYEYYMLIWRAFYAEYFLLPWCTF"
FT   CDS_pept        739800..740345
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631890"
FT                   /orf_name="MICPUN_60085"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64867.1"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B00B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI8"
FT                   /transl_table=1
FT                   /translation="MELGGKLHAIHPSAYRASKSSAVRWTRRVGARRSSVSLAKGSESN
FT                   ADVIRKVIGLEEDAKLTAVELSAGFCNQVMLVKRIAYDGGEEALVVKLYSNLALLRTEQ
FT                   RQRGVVDKKLSDLNMGSQLIASTDEGIAHRYLEGRILTEEDMHTRADICAATARLVAKF
FT                   HLLEVPPQFDDATSPLLW"
FT   CDS_pept        join(complement(744058..744111),complement(741053..743920))
FT                   /codon_start=1
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631891"
FT                   /orf_name="MICPUN_94701"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65212.1"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199B0C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAI9"
FT                   /transl_table=1
FT                   /translation="MSRYAGTFAKPENALKRAEELINVGQPNAALQALHDVITSKRHRT
FT                   WQKVLEQIMFKYVELCIELKKGRLAKDGLIQYRIVCQQVNVNSLEEVIKHFLKLATEKA
FT                   EAAQAAASAATIDIEDLEAENTPENLMLKSVSAESDKDRSDRELVTPWFKFLWETYRTI
FT                   LEILRNNNKLEGLYAMTANRAFNFCVTYKRTTEFRRLCEILRNHLSNLQKYRDQRDRPD
FT                   MTLAETQNYYLETRFEQLKSAAQLELWQEAFRTIEDIHGLTFILKKSPNPRMMASYFAK
FT                   LTKVFWVSENHLYHAYAWYKLFNLSKAYNRNLTPEDLKAMASAVLLSAIAIPPYESRTS
FT                   ASTSNEEIENAKERDVRMATLLGYTLDPKRDPREVLSRKALLSELISKGILSLVSTEAR
FT                   QLYALFEKEFHPLDLCKHAQKVFGSMDTETVELSAASPIPSISFGDFLPRMRNLAVVRM
FT                   LQQSSQVYQTMKLETLQQMVPFLEFTQVERILVNCTKGGAVSARLDHQNKCICFEGDKL
FT                   ESDGIKNHLVLMAQKLRNGIKMIYPDEVPASSLASQSNTAELLSKIEVEHKLALARKVI
FT                   IERRKEEAELILQEQEREAEEARLALQRKNEAAEAKRLEEERRIREETRIRQEMEEKEK
FT                   QEALALLAEAEKRSKGKKLKIKLEEGQKLDKRSLMEDAIKEQIKERQDMERKLQRLAKS
FT                   MDHLERAKREEEVPLIEAAYKLKMAEDEQYHTTMQQQNAEKHRQTWETNVEEKKRLAKM
FT                   AADKEEFAAAIVSRRSEEFEALRLEREERINELRALRRAEREIARRRAYVRRLQQIEDE
FT                   ARAAAEQEERERIEEEARARRAAEQEEEEKRRDEEDRARRDRYEPRRDGSGEAPPGRFE
FT                   PSRRRDDRYDDRRRDDRYDDRRRDDRYDDRRRDDRYDDRRRDDRYDDRRRDDRYDDRRR
FT                   DDRYDSRRRDDRGPSRDDRGPSRDDRGPSRYSARGDDRRPSRW"
FT   CDS_pept        744589..745830
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631892"
FT                   /orf_name="MICPUN_60088"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64868.1"
FT                   /db_xref="UniParc:UPI000199B0C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ0"
FT                   /transl_table=1
FT                   /translation="MAAEGDPLDDEDLLAEDRELEEREECVGDILELIVERVNAHLEAA
FT                   ELQGKVTGYAVREAVKDALAVVDMTFLERESFAMRGVTATESTVGSWEPDDDFTPGPID
FT                   AWARGTVKARRRQRTATHENATSSARHTIGGVEKHINRISRASNTIGAVEKQNRKSLAA
FT                   TMPLPKPKPRKSKLTGEAAEREQRLRDEIETRKAMQKMQRLQLQKDQEDLKQLEVLQKS
FT                   LRGREYTYDHNGQVVFVNKPNTEKLPAYGAGLRINVPETRGGLQTHGKYKRFANVGLSK
FT                   LVETDFIEKEKSSQPSALEVMQMAKGVTLREGGGAKAGPPVGSSKQNMSRKDFLELYSD
FT                   PSAKKQWQRGDTTDEGLGTQGSQERVVQPDPNLKLLSAADWGVNPPAAMKENPYVPPSR
FT                   MPKAKTPMMRQRRV"
FT   CDS_pept        complement(745915..>747174)
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631893"
FT                   /orf_name="MICPUN_83677"
FT                   /product="Serine/threonine protein phosphatase 2A 57 kDa
FT                   regulatory subunit B' beta isoform "
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="ACO65213.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG602178"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B0C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ1"
FT                   /transl_table=1
FT                   /translation="SFRDVVASERQNLFIKKLQLCSYTFDFTDATANVREKEIKRQTLL
FT                   ELVDYVNQGQGKFTEAVFEDISYMLAQNLFRGLPPSNHEITGSAAGDNFDPEEEEPTLE
FT                   PSWPHLQIVYEFLLRYVVSNEVDAKVGKKYIDNTFVLKLLELFDSEDPRERDYLKTILH
FT                   RIYGKFMVHRPFIRKAINNIFFRFIYETERHNGIAELLEILGSIINGFALPLKEEHKIF
FT                   LQRALLPLHKPKCVAMYHQQLSYCITQFVEKDPRLADTVLRGLLKYWPVTNSQKEVLFL
FT                   GELEEVLELTQAAEFVKTMLPLFRQISACINSSHFQVAERALFLWNNDYIVNLVAQNRH
FT                   VLLPVCFGAFERNARSHWNAAVGGLTVNVRKMLMEMDQQLYEECQRNWEEEELRSQETE
FT                   ENRKQRWKQVEALAAKSIAS"
FT   CDS_pept        complement(749993..750919)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631894"
FT                   /orf_name="MICPUN_60090"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65214.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="UniParc:UPI000199B0C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ2"
FT                   /transl_table=1
FT                   /translation="MDYRERRRGYDDRQWRESSDPRGGAWGGTDGRGNYHDPPPRRGHS
FT                   RDHHGGFDDRGRLPEREHRMQSREWDGGRNHTNDRYAPAPERMERYGREEDRNGRREHV
FT                   RRESSRDAFRRSARGDDSARRTSASRKPDYSESDSSETEYTRKPRQWDVTLTPHEQLEA
FT                   LDLWLKANPEVAREVDELNKRASGANSQQPPPFFQDGDWLCVTCKEHNWKNRLDCRTCG
FT                   APAPAEKIAEVQAQKARAAVAQAARPQTQSAKAGDWMCVGCMATNYARLNSCHRCSRSK
FT                   PNEWVCVLCNSMNSGAELTICRVCPPA"
FT   CDS_pept        join(751091..752725,752788..752814)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631895"
FT                   /orf_name="MICPUN_60091"
FT                   /product="Type II secretory pathway family "
FT                   /protein_id="ACO64869.1"
FT                   /db_xref="UniParc:UPI000199B0C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ3"
FT                   /transl_table=1
FT                   /translation="MGDADEAPQKELVTNLTLDILQIVKVSQSQHGLRHGDHARYRQYC
FT                   TRRLARLYKANRMSHGRGRYQKRTLEVSMVDNEAFLLIPLMMSERAWSYAMELKRDAGN
FT                   EPRKRAHMIRRLKKATVHATELVNLCGQVGSARTALEAEAYSSYIFGCYLSEQERDWDR
FT                   ALAKFMRARKAFEQLARVGGPDQAEVCRERLEELEPSLRYCTYKRGSEGSPVAGSMDEK
FT                   DMAALKGDGGEDDERLKAVLAEESGRASGAVTTSWRGYDIPIRNGKVRECLANVAVQLA
FT                   KIESPLIMATDRALAIFDKVFMLYSDARQHLRDDLAEASSGAQSDSTSRLTDLKLADRA
FT                   IAVMLIEQTIQRNKFLVDSANAKLAGEIRLAKGEKATRPEDIVHLLSASLRSYEELIES
FT                   GPEVLRGMDGAERVEEELRVECMTAQKMLSSDRAAALGKVHSSAGSHVDAAILFNRSAE
FT                   HAAGVSEAAATRARVNRIGAIKSGIDTLLADRKGLRSGLEDVSLEGPTSSESRFLMESL
FT                   DEYKPAVLGKGASKVHIMPIPNRMESLAICEEGQHS"
FT   CDS_pept        join(complement(754344..754445),complement(753611..754024),
FT                   complement(753389..753534),complement(752889..753354))
FT                   /codon_start=1
FT                   /gene_family="HOG000207528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631896"
FT                   /orf_name="MICPUN_60092"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="ACO65215.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="HOGENOM:HBG388608"
FT                   /db_xref="InterPro:IPR004907"
FT                   /db_xref="UniParc:UPI000199B0CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ4"
FT                   /transl_table=1
FT                   /translation="MDTTFWLVALPLEGGSAENTWNTLQQKTSRGRVPFNLPELRVGTL
FT                   DSLLALSDDLVKVSSLVAGTTQKIRRHIMESASAEGENEVNAELVVDGISAERFLTAFT
FT                   WDEAKHPARRPLRETMERLQESVAKIEDDFRVKTGDLASAKTQLGALSRKAAGSLATRD
FT                   LGEIVQDSDLVNTENLTTLCVAVPKYNQKEWLDTYETLAQFVVPRSSKYAKLLFEKLSL
FT                   INEDGEYALYTVTLFRRVVDAFNTAARENSFQVREFSLDTEAVQAKIAERNDLERDIKE
FT                   RRTSMFQWCQTSYGEAFGAWVHVCAIRLFVESILRYGLPPSFQACVMKPQKRSEKKLRG
FT                   ILANTFGQGASSHWSNSDDDKGEEAFPYVSFSIEI"
FT   CDS_pept        complement(755358..756767)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631897"
FT                   /orf_name="MICPUN_60093"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65216.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199B0CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ5"
FT                   /transl_table=1
FT                   /translation="MFDGKDVANVVGGRGSRIVAAERNEDSPRASVKTADAALPLKRYI
FT                   PHRELADGTIEILGGMGGSARFIAPDPVERAMHRANVANLLPPVINRPPPSTEHGQDLV
FT                   DNMKGIVLQKILDNENNALKREAQDRLKQGLEVDEDDRVWTAAAFPSWSAAQCRRLRED
FT                   MERRRVEGKQLEAERKRKREVREAEREAKRVAAAEAAKAAAEKKAAAEAARKAGAEKKA
FT                   AAEAAKAAAEAARKRTAQLEAAEFQRMKPTGVSKQKSGNFNVYIVMKDRRVIQIGTYAT
FT                   VMEAARAHDLAWLSVPGRKADKRPNFPHDPPPTDKELEAMRAKVETKAAKPAKKRAEKA
FT                   ARKAGAEKKAAAEAAKAAAEAARKRTAQLEAAEFQRMKPTGVSKQKSGNFSVCIDIKGS
FT                   KGFCVIQIGTYATVMEAARAFDLAWLSVPGRKADKRPNFPHDPPPTDKELEAMRAKVET
FT                   KAAKHAKKRAA"
FT   CDS_pept        757814..758755
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631898"
FT                   /orf_name="MICPUN_101488"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64870.1"
FT                   /db_xref="UniParc:UPI000199B0CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ6"
FT                   /transl_table=1
FT                   /translation="MWLADERYWQHTIDAAEAAVKGEKIPLLFILVSKCAADDYAANFL
FT                   RDERGNERPHRKTLNEIRAELELLHRDRHIILIDVPARLFGCSRMKPTSTGYPGCESCT
FT                   DAGLTTLDHMLRVVMTTAVSCGIAVGGIATICADVREDWLNKLVNGTGATTPPSLLDDA
FT                   VAEYELKRMKWTDVVSGNVSVGRGLHYVFMHIVGYPEAAKMCKKLTAYALGVFKDDRDL
FT                   VIGREDAKVLVNLAFMLHNFVGAKARRDFINILIDAKLKLDVSKQQDYRSEMSSNLVNI
FT                   NVPDDMIIDLTSDQEEEQKEDTDEDTDDHPRQ"
FT   CDS_pept        complement(758852..759850)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631899"
FT                   /orf_name="MICPUN_60095"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65217.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG607496"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B0CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ7"
FT                   /transl_table=1
FT                   /translation="MTRRRRRRSASSSSDYGGYVPRQRHRGKDNRASGAANRGAAPQSL
FT                   GLDKPAAQADPAITQAERQRRAQQWILEQQAASLNVVRADGSKEQGGNRLAREVYVGNL
FT                   LVGVVNAESLRQFFDSSMAVAFPSDNPFVKPVIEVRMSHDLKFAFVELRTEEMATAALQ
FT                   LNGTNLCGRAMVIARPSGYVDSIAVAQLAASKLAESERQQHKQPTTATDVVDRQPTEKA
FT                   KSEQSPVESCVVCLGNLVTESDLVTEEEYKDVCEDVLQECSKSGQVIELRIPRNSIDAN
FT                   IKCNAFVRFATAAEAKAAVNLFNGRKFDGRSVSAVLWPEEDFDELPPASFS"
FT   CDS_pept        760871..762391
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631900"
FT                   /orf_name="MICPUN_50999"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO64871.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000199B0CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ8"
FT                   /transl_table=1
FT                   /translation="MPKTRKASDARGNEEPASADAPTREGEDCIDLLDDNSDGEGGATD
FT                   TAARKQSAKRNTSEKGKKKRQPSQPKAENEGKGTAEDPCELLSSDDEVVISEPDQKSKA
FT                   RNNGTTTKKGGKSADKTTAGRGQGGRGKEKAKSKSKAPERDPPKSQREESGQRRGFQDN
FT                   TTQAAGAGPSSTGFTNHTHAPYGVPHVPPEPAPNHHDDTPLVSTRRANLLTTWRRFKAA
FT                   HTRSNELLIMLRAKQEEYRVAVAQGRMFSHGSSSYQAQLINVTRVAAAVEEIMKLHHIV
FT                   INEVTVIAAQYKRAAEELDNAILTMKSQRHASAHQRHGEAKATDFQAEVKAWELVEQTA
FT                   DLNVFPAGELKRIAIAMGVDVTGCLEKSEFVKSIAAKRDNGKEAWLVRKRKRGAEEEIA
FT                   ARQRKKLAELRNEEAKREADEGAQASAKQRAASQVAAWARNADLRLFLQRCGITVEGTG
FT                   RTKKALAGAYKRAMLKFHPDRTQKDSTEQRILAAEVTKWITHAWQNLS"
FT   CDS_pept        complement(762452..762943)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631901"
FT                   /orf_name="MICPUN_51000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65218.1"
FT                   /db_xref="UniParc:UPI000199B0CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAJ9"
FT                   /transl_table=1
FT                   /translation="MPPATRPKKVREENVVNDDKNWRLRIKEETESQRHFESEWGFLLP
FT                   DYDSRSEATRGPIEMKKSAYYDYQTRQWTVLEKRVTAPSAQQSSESDEVADSKSVAGVT
FT                   AATHQTLMDSIPANTAFLTSNRAYGARKTLECFGTSEYGVRAIQKNMAKSLEFRPMHPF
FT                   "
FT   CDS_pept        763556..765031
FT                   /codon_start=1
FT                   /gene_family="HOG000239858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631902"
FT                   /orf_name="MICPUN_83849"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO64872.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG318900"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199B0D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK0"
FT                   /transl_table=1
FT                   /translation="MGRGGRSRSGAGASRATPATLRDPDRHFTIVTTASLPWMTGTSVN
FT                   PLLRAAYMANRGDECGVTLLVPWLAPCDQKLVHPNAMFQTPEEQQQYIRSWLAGRVDFD
FT                   PKFEIHFYPGRYAIDKGSIVPVGDITDYVPDNEADVAVLEEPEHLTWFHHGKRWTHKFQ
FT                   HVVGIIHTNYLEYARREKDGDKKEVLLRGVNAFVARAHCHKIIKLSDAVQDFARSVTVN
FT                   VHGVSPHFIEVGRKIAAAAKDNTKSEEEVGSTFGKGKVGYFIGKVVWAKGYLELLERVK
FT                   EYNATAASKDKLIMDVFGDGDDFKAVKDSAARQQLALTFHGRADHAGDVIRGYKFFINP
FT                   SLSDVVATTTAEALAMGKFVVCARHPSNEFFSTFKNCRTYSNPDEFAECVREVLHGEPE
FT                   PISPSDLHRLTWQAATERFLDAAEPDPPEQNIVRKVRSLLGDWVSAKFHNMLTASEAVR
FT                   CLVGGGAGTLLRPGTGLANWRPDIWSGGVMDRK"
FT   CDS_pept        complement(765081..767951)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631903"
FT                   /orf_name="MICPUN_51001"
FT                   /product="Kinesin heavy chain"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO65219.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199B181"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK1"
FT                   /transl_table=1
FT                   /translation="MPASESSGIDKLPDRVLVYARVKPASPSGSREVATRCVDHDAEDA
FT                   SPRDGKSSRSIRVVNPNAAVVRKTFDMDRCLGPRSTQHDVYEAVGAPVLDSVLRGCHGA
FT                   ILGYGQTGSGKTHSLLNLGDGGEAGLVPRLAVDLFTRIAADWTHMYDVEIAMVQIYNET
FT                   VMDLLKPNDMKRTPGNSERGLRACQRKASAGGGWELLDCTWYRCKSPEHLLDCFRQGRK
FT                   GLVYAETMMNKHSSRSHCVLQLKVNRVPRPDNTTVMPQLNSSGYRRTLELLQHQGLLTV
FT                   VDMAGSERVKKTLSEGIRFSEATNINTSLLAFGNVMQALAEKRSHVPYRDSMLTKILES
FT                   SLSGRSRTALLVCLAPELEHSHETTTSLEFASRAMRVTTVPVVHSANVEFDPADLTREL
FT                   AEAASNSALQKMGEEVLSSRQMLDREKAERAEKEDHLCDLITRERAERADVEEKLRRRL
FT                   AEAEAEIASLSIKLSDAKTEAHNLSDELAHARIDITAAEECRTKQRIAAEELERELALE
FT                   REALREAAQNFADSMRALERDLVARQEAEKLLTEQRLRDSFESERAQHGAIEVQLRHAL
FT                   EREKAERIEMETELRGTILREQKQRIAAENEMHELLRRETSNFMATQSELQEALDLEKS
FT                   DRVKVESSLRQRLSELEENILTVKQQLADAAADNAKLKEDLTNAQKDAAAARERFHEQK
FT                   KVTDALDCELKLEREVLQQSAARLSESAEEKKIFAQQVCTLEEKLKETSLAKDIAESTI
FT                   ENLEASRQSLIDEMKLLRENWHSGLAELQKASTAAVGQVETAARLQLAAGAAMFKRGRN
FT                   GKIYRRMVRCSVDTNTLEWAPLGEFRKMSVRGAHIDWMPDASGFVIRGPERDLRLELTD
FT                   AAVASWARALDQRLPRSENTRRICTPLRFGNPMQKAFGSFMTPSRKFTPSPESQPMSPG
FT                   GACRTTAELAARQLANLGAPNKVLFK"
FT   CDS_pept        join(768422..768488,768663..768724,768837..768917,
FT                   769046..770338)
FT                   /codon_start=1
FT                   /gene_family="HOG000278604" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631904"
FT                   /gene_name="ADG1"
FT                   /orf_name="MICPUN_60100"
FT                   /product="Glucose-1-phosphate adenylyltransferase "
FT                   /function="glucose-1-phosphate adenylyltransferase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO64873.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0008878"
FT                   /db_xref="HOGENOM:HBG703946"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="UniParc:UPI000199B182"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK2"
FT                   /transl_table=1
FT                   /translation="MQAVSMRVQAPTFASGVAPAKFGSRQAVRGKAVASRRVVPKAEVK
FT                   RVTRAVATKAEIATETATEVNDNTDNVLGIILGGGAGTRLYPLTKTRAKPAVPLGANYR
FT                   LIDLPVSNCINSDINKMYCLTQFNSASLNRHLSQAYNNNVGSYNRQGFVEVLAAQQSPK
FT                   NKDWFQGTADAVRQYIWLFNESKCDEYIILSGDHLYRMDYKPFILKHRQTKADITVSAV
FT                   PMDEERAAAFGLMKIDDTGKIIDFAEKPTGDALKAMMVDTTILGLDAERAKEMPYIASM
FT                   GIYVFNARAMEKLLMEDFPTCHDFGGEIIPNAKDLGMHVQAFLYDGYWEDIGTIKAFFD
FT                   ANLACNDPEKAKFSFYQTGAPIYTQSRFLPPSKLLDAEVSKCTIGDGCFIKKSKLTNAM
FT                   IGLRTNIQEDCVIEDVMIMGADYYEETHECEDLPGCTPIGIGAGTTIKRAIIDKNARIG
FT                   MDCQIINKDNVQEANHEDKGYIIKDGIVVICKDAIIPNGTVI"
FT   CDS_pept        join(complement(771507..771555),complement(770490..771388))
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631905"
FT                   /orf_name="MICPUN_51003"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO65220.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199B183"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK3"
FT                   /transl_table=1
FT                   /translation="MTFKKRKRPPALSISNDMRTHVSGMQMKLATERELEDASLAEEVT
FT                   VVEGRTFALSSKRGNRRFSCEDAYQAAPGLDGDPTRGIFSVFDGHGGREAADYAADNLH
FT                   DNILREVNDVGSHLDPDEFMKQVKAAMIKGFLATDQEFLSFGDLRGGATATTAYLCKGR
FT                   IWVANVGDCRAVICQGGQAVALTHDHRPDCAVEREAVERRGGEIVRERVQGILGVSRAL
FT                   GDRELKSYITAEPSVFCGTISESSEFLILGTDGLWDHVDNQEAVEFVRLTLSQKKGIHA
FT                   ACRGLVELARANRSRDDISVLVVELCSYQASGLI"
FT   CDS_pept        join(772348..772572,772703..773236)
FT                   /codon_start=1
FT                   /gene_family="HOG000218325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631906"
FT                   /orf_name="MICPUN_101490"
FT                   /product="Predicted protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64874.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="UniParc:UPI000199B184"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK4"
FT                   /transl_table=1
FT                   /translation="MAQSTRMCAGLRCNSMGSRAVGRSLGRAQVAKKTHAFIATSAAPL
FT                   RVTCMANQRRVAKVQQQMRREISNMMQTDKKLRDMVYPEERMGVDNVMSCMVTVADVEV
FT                   SGDLQVVKVFVSILGDERGKKNAINGLKKMEGYVRRNIGKRVSLRLTPDIRFVYDDSFE
FT                   RGQRVSSLLDELRVEREVREARGGGYTKSELLAVEDTITNPYGDEEDSDWIEDLDELIG
FT                   EEEEEEEEEEEDIDIEAVWDELQKNAKIDD"
FT   CDS_pept        join(773532..773719,773864..775010)
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631907"
FT                   /orf_name="MICPUN_91262"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64875.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199B185"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK5"
FT                   /transl_table=1
FT                   /translation="MSTVMQQAAATPVAILRLRGKTHSRAIRAHRLGARRQVSCAASPA
FT                   EAIKDKRIPVTILTGFLGSGKTTLLNRILAGDHGKRIVVIENEFGEIDIDSELVAFKEN
FT                   GEEDIMLLNNGCLCCSVRGDLVDMLGRLVTEKKGQFDHILIETTGLANPAPIIQTFYLE
FT                   PDLLDTLRLDGVVTLVDAKHAMMHLDEKKPEGVVNEALEQVAFADRLVLNKTDLVNQSE
FT                   LLSIENRVRTINNLASIQRAEKANVDLDFVLGVGGFDLDRVEDVIIGEKKEEEHGHSHS
FT                   HSHSHGEAECVDPECNDPSHSHSHSHSHSHGEAAESEAECEVCGEHGHSHSHHVHDDTV
FT                   TSVSLTMDGEVDLDLVNDWLGMLLNDRWQDLFRMKGVLAIEGCDDRYVFQGVHALFEGM
FT                   PDKPWEDGVARSSKLVFIGKDLDRDELEAGFKACAVGASVGAASQ"
FT   CDS_pept        join(775305..775462,775595..775703)
FT                   /codon_start=1
FT                   /gene_family="HOG000223547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631908"
FT                   /orf_name="MICPUN_83618"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64876.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199B186"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK6"
FT                   /transl_table=1
FT                   /translation="MATNPSQLLPSELVDKCVGSRIWVIMKGEKEMVGTLRGFDVYVNM
FT                   VLEDVIEYEMTPEGRRETKLDQILLNGNNIALLVPGGMPEDTA"
FT   CDS_pept        complement(775771..778035)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631909"
FT                   /orf_name="MICPUN_60105"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65221.1"
FT                   /db_xref="InterPro:IPR011677"
FT                   /db_xref="UniParc:UPI000199B187"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK7"
FT                   /transl_table=1
FT                   /translation="MTNTASLRTKAGRRASLLAGVLVGALLATGADAQAATRPTAESAG
FT                   LNAPSTYGIDWTDVPTEPTKTVVKVTAENCLCDLTEGTCDANCCCDPDCDSNEKAQFTE
FT                   CATCVYDGANAAMNGKVCLPEGRSPPSLEYCLPSSTVSRVNLLSSSSLGVVEQRKADMS
FT                   FLSQQLCIKDDNSASLGKYFLDPGFATDDILKSSVTLQSERFWNPVPAAASETQPKYRH
FT                   NDTIGVVKAASEPLLPGNKFVLPGATFSGVCGWTNVIGYNMPLPASAASEDATCLVPID
FT                   DTLSKSCTTLLNAKYLVNDLKLAKTPGSSATPTEAPTISSMKYRSRIGGKLTDLTGTVP
FT                   AATFTDGSGGSGAADTCNFAVVEAHYVITHDGSGSISSFAVDLVFADVMTSTRWSAVYN
FT                   ANGALADPGNPSSVRVKYTVSWKLSAETVVPRSGAPGYVVGAPLLAGTKDTSSGKNAVA
FT                   RLKDGLTIPGAGPDGRCSGNGKSTVRFGMSQSSSCAIPLSQDNLKTFCQGSGDKAVADY
FT                   LYDLISVNGVLGGTTPDKTKAPGSSVPLPAQLMDGLLYGTLDSNYDLSAKTVMVAAWAN
FT                   ANYENIADWKSCDATDTTDCATELTAAEQLTKPSGDSAMSWDETTKTCKNVAVGVNIDV
FT                   LTAKVGHLDHAQSKVQRVKVSWNLADWTYTDFPWDNAADDRQDFMLKSTVHFVEMAQDA
FT                   PEGVKPASPPILPTLPADVFYPFLSAGPAGGRAAASAAWCVALVAAIFVAWVTARGDDS
FT                   Y"
FT   CDS_pept        join(778553..778862,778990..779135)
FT                   /codon_start=1
FT                   /gene_family="HOG000243306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631910"
FT                   /orf_name="MICPUN_60106"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64877.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199B188"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK8"
FT                   /transl_table=1
FT                   /translation="MSEPQDDLPRAHIKRIVKAKLTALMNEGGPDAKGNKAPDGHVQKE
FT                   ALLAFGECAKIFIHILTSTANDICRDGKRQTISVDDVFKAVEELEFGEFGEPLKEALAA
FT                   FKKDAAAKSAKRNDAATKKRKAEEDDAAGEGEEDAEEEADEEAAEGA"
FT   CDS_pept        complement(779247..780914)
FT                   /codon_start=1
FT                   /gene_family="HOG000265105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631911"
FT                   /orf_name="MICPUN_101493"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65222.1"
FT                   /db_xref="HOGENOM:HBG561986"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniParc:UPI000199B189"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAK9"
FT                   /transl_table=1
FT                   /translation="MNFVKEIAKELMPEAERKGLSDFMRIIRLLFHFEYLESRDKLKRN
FT                   FDIVTAHQDDNEALIDVMKESKMTPSEFLDVSVDFVSDFCTLLADANFSLLTQKEWELA
FT                   KAEDFMFTLPCDIAWDKFDKELLGTFLKQNPALSEGLTQFADAALLFKRGNGVAKAKGM
FT                   FIMEKVEMFLEMCIMEPLLAIVGRPKTVFASLGGVGKKRTAMVKKDGAGKGLIEEERHD
FT                   VTVIERRTLRRLLPNPLAILKNLFKTMELQEPTFKEVVLLYRMAKPVEDRQAGPGGVGP
FT                   LILKSFHDIPMADLEMIFPEVNVTVKFKDMLINVTLAIIAIITFLWTLMTGGWTKEVIT
FT                   LISVLGGKVAQSVTALMAAQTRYTGMMAKELQAKSANSQTGMLMHLMESMEDQECKEMI
FT                   LSYAVLAANGKSMTLKEIDAKCEYELYDRFRLKIDFDVEGAMVKLLREGLVEQRAGVLY
FT                   TATPLKKALKRLDTKWDNLFDYRDDGGATKADDAAMQLEAARKARYQTVEATLREQLAN
FT                   TDAERAAAVGKLKGQQEEIAKRIKLLEDAMSSYKWRTG"
FT   CDS_pept        complement(781356..782585)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631912"
FT                   /orf_name="MICPUN_108617"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65223.1"
FT                   /db_xref="UniParc:UPI000199B18A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL0"
FT                   /transl_table=1
FT                   /translation="MGAWNPRVAIAALFGLLLFFATGGVVAVSSPDLSDLSEVLRWLEQ
FT                   LGSLDADTQRAMLRLFGQQMVDSGVTKCDVFGGRESCIDLDPSSKFAHSCVNYPLKVDC
FT                   AFYRGALAEQDEDPTSELEAEVEAQKATMCDGCNANLKDLYCAQTVPPCGSFQDHIELA
FT                   IVPPLQRIVQGQIDGDNIADAVAKEVPNLVKTLALVAPCRRYCEAITSSCGCGRKITIG
FT                   QVLASNKTKNILPAPPEGISYEQLLAQVKDTPLCDLYADETEPGFSGHCPKDPNALIGD
FT                   TCGWCSDNNEIPTFVEEHLGVALIDGVWGWLIGPEGLLVDAGFLSRDKNVPEIPSEGKV
FT                   RGPNRGRRVLSFFLWLVGLGGVGVGAFFGLRAFRRFREERGGFRHEYTRADFLEEDEGE
FT                   YTAAVDLDEL"
FT   CDS_pept        782721..783707
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631913"
FT                   /orf_name="MICPUN_60109"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO64878.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B18B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL1"
FT                   /transl_table=1
FT                   /translation="MFGKMFGGDKAPGGGMGTGMGMGGGGMGGMGAGGAPAGGGGGGGF
FT                   ALSPEEVKEAFREFDLDKNGFVGAAEIAHVLQSMGEKATDDEVDEMILMADLDGDGQIS
FT                   FDEFFKLINSFQGMPPPPNASMGGGMGGAQQSMGMGGAQFQPPPPGNPVADMESFQKSH
FT                   GLNNEALKKIYKQFLAIDQDKSGMVDINEFCRLLRVERSPFVERLFSMFDSDRTGLIDL
FT                   KEFVVGLSNVGTEARENKVKFAFQVFDLDGSGSIDSSELRKIVKATNMASEKQLNRKVE
FT                   WLMKQCDTDGDGQISFDEFVNLSKKFPNIVFPAYSLASGLGGLTGGK"
FT   CDS_pept        complement(783826..784467)
FT                   /codon_start=1
FT                   /gene_family="HOG000262754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631914"
FT                   /orf_name="MICPUN_97665"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /function="uracil phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="uracil salvage"
FT                   /protein_id="ACO65224.1"
FT                   /db_xref="GO:0004845"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006223"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="UniParc:UPI000199B18C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL2"
FT                   /transl_table=1
FT                   /translation="MLVFVPPHPLINHWLGIARNAMTPPAIFRSTLGELGRLLVYECVR
FT                   DWLPTFTAEVEGPMATAQVEMVDPGQPVAVVPVLRAGLVLLEECKTVLPASVTYHLGFV
FT                   RDEETLEAKMYLNKLPKQFAEGQRVLISDPMLATGGTIVQAIEECLSRGALVKNIRIVC
FT                   VVACPTALSVLSDKYPGLRVYAAMIDEELNDQGYIIPGLGDAGDRAFGTE"
FT   CDS_pept        785111..785926
FT                   /codon_start=1
FT                   /gene_family="HOG000218563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631915"
FT                   /orf_name="MICPUN_83560"
FT                   /product="Predicted protein"
FT                   /function="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase activity"
FT                   /biological_process="terpenoid biosynthetic process "
FT                   /protein_id="ACO64879.1"
FT                   /db_xref="GO:0016114"
FT                   /db_xref="GO:0050518"
FT                   /db_xref="HOGENOM:HBG672839"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="UniParc:UPI000199B18D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL3"
FT                   /transl_table=1
FT                   /translation="MTCVALSASTSSVRTFSSVGRRSSAVRRAVRGPVRCVAAAAVEKD
FT                   SVSVVLLAGGVGKRMKADMPKQYLPLLGTPIALYSLKKFAEMEEVGEIVVVCDPSYRDI
FT                   FEGCPVSKPVKFALPGKERQDSVFNGLSEVREGAALAAIHDSARPLVDLADVRRCCADA
FT                   MEHGAAVLAVRCKATVKEANDDLSIAKTLDRSKLWEMQTPQVIKPDLLKEGFKLVNEKG
FT                   YEVTDDVSIVEFMGERVQITEGSYVNIKVTTPEDMFIAERLLNEQAVTV"
FT   CDS_pept        join(complement(787473..787742),complement(787268..787325),
FT                   complement(786594..787126))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631916"
FT                   /orf_name="MICPUN_105843"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65225.1"
FT                   /db_xref="UniParc:UPI000199B18E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL4"
FT                   /transl_table=1
FT                   /translation="MASIILAGVNPVARSLPARRRAVGRAAGAKLAFVASAAPAGHSSR
FT                   VAGPAPRGPAALVMPGAATVRGDQMMARATALEISAPAANDDKKQLLFKIAVGVTVAAL
FT                   ALAFPCASLAAAKAKGAVAAAYPISFLPYTHNQILHAVNLGSLPAWFSLLVLPRWHMTK
FT                   KITAAVAVAYSVLYVALAYALFSESILSMDYSSLSTTQGLSKAFSDATSVLAGWAHFIV
FT                   FDLWTARFFVLDSGRSGIPHLAIVPAILGCMFFGPVGLLTYLAVKRVYESLQMRNPMST
FT                   KTYNF"
FT   CDS_pept        788063..789169
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631917"
FT                   /orf_name="MICPUN_60113"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64880.1"
FT                   /db_xref="UniParc:UPI000199B18F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL5"
FT                   /transl_table=1
FT                   /translation="MASVITSVNILTVAVNRRRANPAGRRAAPTRAAGDGAPSETAASP
FT                   SDGASTFESPPRRPSPLERIMKDPLAAAVMGPRLALGGATEALDLLQKGQLLGVLAQAP
FT                   GELNTLLQDPRPINDKAEDLVRRAEGMVETLEERGIAAEAPGREIFKAILPADLYDRYL
FT                   DPAAVGAAAATATQPPPPPAEYKAEPPTRSAPRTAPATAAEEDDAAVPVPDPDPVPVPA
FT                   AAEGEVDEEKGSPPEATERGERGWVFDSDEDPAVIAAARAVASVLDSEEWDEDREAGLY
FT                   PEVLGGQKPASTSSGDAIAEDDGVPETASPRPVEPAPVQAASSVAPVASGSAPSSVPPE
FT                   LWAAVEEAEKLAADVVMQASTVAARRER"
FT   CDS_pept        complement(789504..789974)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631918"
FT                   /orf_name="MICPUN_108620"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65226.1"
FT                   /db_xref="UniParc:UPI000199B235"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL6"
FT                   /transl_table=1
FT                   /translation="MDFGHSSSSGGGGPPTKEDPTYAMYAYGLPEGFYENCTTTQAEAI
FT                   AMFTKYNELHDPCEWAKLNGPFNCERAGPTGIGQRFSLAYANALLAYTVISATIVNIFY
FT                   AKAKRRAEGKDVEKGIEEVEFVDVGPRPAQPTTQIQFADGTTLTPEQIQAKV"
FT   CDS_pept        792112..792756
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631919"
FT                   /orf_name="MICPUN_97666"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64881.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199B236"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL7"
FT                   /transl_table=1
FT                   /translation="MGSAAAAAAAAVAPALADSCPTADTAPLLCNAEVTNKVYFDVSIG
FT                   GEPQGRIVIGLFGKDVPKTVENFRQLATGERDFGYKNSIFHRVIPNFMIQGGDFERGNG
FT                   TGGYSIYGRKFPDEAFPLDKLNHVGPGVLSMANAGPNTNGSQFFITTTATPWLNGRHVV
FT                   FGNIVEGMDVVRKIERTPTARGDRPVNDVVVTASGELPLAAPAPVAAEPEA"
FT   CDS_pept        join(793655..794881,795008..795932,795981..796402,
FT                   796529..796682,796818..798364,798419..798577)
FT                   /codon_start=1
FT                   /gene_family="HOG000238707" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631920"
FT                   /orf_name="MICPUN_83330"
FT                   /product="Predicted protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64882.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG408731"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B237"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL8"
FT                   /transl_table=1
FT                   /translation="MRQDAYDHDDLDEEEYDDDEEYDEEDRDEEDEDREEDEEEDEDEQ
FT                   GGDEHDPSGLQALLRRLGGGLEDMIPAAGQTRGRLKEILGGLRADGDDTRQIMALNELC
FT                   ELLVISSEESLITLSVDAFVPVLVNLMQMEHNPDCMLLAARALTSMADILPNSRGAIVH
FT                   YGALPAFCSRLLTIEYIDLAEQSLQALEKLSQDHGSSCLREGAMMACLSYLDFFSLGMQ
FT                   RVALQTAANVCRQLPASDCWDQLSDSVPVLTNLLMHDDARLVESACTCLTLIAANLSSQ
FT                   PQQLQALCSHGLIPNATRLISPSGSATAAPVGASTYHGLIRLIGTCCKGSADVAEQLLR
FT                   NGLPGTLKSVLAGCKVLASSTASASPASPIVSADQLLEVTTLANQLLPSIQPGSGASES
FT                   PLESLGIDAAPELLREYGSNLTSSLMQVVVASVGTNVKLQCLAALAKFLHHAPPEMLIS
FT                   GSAALQPGQMASFLAGLVSSRDGAIAQVALYIVDLLMQKLPDTFSRAFRKEGTVHAIEQ
FT                   LCEMHAASNDGSGDSKGSSGDITPRGQVVPSGVGSGSAASIVARMALTNSGRKMSDTPQ
FT                   RRAAMDRAVSLRAAHFSAAATGGTVERLQSVCAPLRNAGQDPLKATAVAMKFLNTLDEG
FT                   EGTSTFELIESGGVEALSSFLTGSDLPKGDGWSDSISARLSAFVRAASTDLPPRAISSL
FT                   TERLLEALAVTETLPMQLSAGARAGAGAGAAGDGLSILARPFKLRLRRASGERAELKDY
FT                   ASNIILVEPLATLNAIEDFLYPRVHKPPSGPATPAGGASASGTAPTRRSGRLASGAESM
FT                   DANEEEEEDHEMRGDEEEEGDGEEDFDDEELDDEEDGEEDAPTADDVAAAAPPRLLFRA
FT                   PGVGPFHPSTSVLQAIHAAALHASAAAEGDEQGDGHEDETADAAEALAALGSVERRAAL
FT                   GGVLSALRGKLCDRESVANVSDATRSILTVLSVLHTVSTSASRIINLGEQVDDVKVTAL
FT                   SLPADAFLSSKLAGKMVRQLQDALALCSGSLPTWCTTLARACPFLFPFEVRQQLFYCTT
FT                   FGLARALHRMHGQSQDNNGGGGGRDLRVGRLQRQKVRVSRQRILESAMKVYEMPGAHKM
FT                   VLEVEFFNEVGTGTGPTLEFYTLMSKEVTQRSLKAWRDAPVDGKPGPADGFVNAPHGLF
FT                   PAPVSAKDFDATVPGAPGGIKRGDLFRMLGRAVGKALQDGRLLDMALSPVFFRAVSGRT
FT                   LALDDLAEVDPELGRTLSQLSAAAKRIDALKRSGAAEKEWRAITVGGAAVEDLCLTFTL
FT                   PGDDTFELMPGGAEVAVTAENLGDYVAAVVDASVGGGISRQLDAFRGGLADVLPPVALG
FT                   MFTEPEIDRMLCGQGQAWTPELLGECMTYDHGYNAQSPPIKALVEVMCGYGPEEQRAFL
FT                   RFVTGAPRLPPGGLAALQPRLTVPLSSGTTLADADLPSAMTCASYLKLPPYSCVDVLKE
FT                   RLGYAITEGIGSFDLS"
FT   CDS_pept        join(complement(799091..802331),complement(798922..798986))
FT                   /codon_start=1
FT                   /gene_family="HOG000261131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631921"
FT                   /gene_name="IFT122"
FT                   /orf_name="MICPUN_97668"
FT                   /product="Intraflagellar transport 122 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO65227.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG357107"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B238"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAL9"
FT                   /transl_table=1
FT                   /translation="MRATVSWQDAPPDRDGLRSVCYDVAYKPDGSQLVTGMGNRVLVYG
FT                   CQDGALLHSLKAHKDAVYAVSWSFEGSRFASGGADKTIIIWTSEAEGILKYNHNESVQC
FT                   LAFNPCLMQLASATASDFGLWAPEQKSVQKHKVSSKVLCMGWTKDGQHLALGQYDGCVS
FT                   VRDRTGGEKVKIQRGAPVWSLAWNPNKRETHDVMAVGCWDGTLSFYQLNGMQVGDDTRL
FT                   GFDPCSVSYFGGGDYVVVGGTDKTARLCSKEGTVLTTLCERGSWVWCARARPGHNAIAV
FT                   GSEDGSISTHALTFSTVHGMYKELYAYRDLMTDVIVQQLETDQKVRIRCKDYVKKIAVY
FT                   KDKLAVQLPDKLVIYQKIESDDPDDMQYRMMTTIEENLKCNLLVITSHHVILCMEKKLL
FT                   LYTMEGKKERTWSMDSVIRYIKVNGGPEKGEGVLVGLKDGMCLKIFIDNDFPVELVNHG
FT                   ASVRCLDMSAFRKKLAVVDENSAVVVYDVKTKAVLFEGKGANSVAFNSVYEDMFCYAGD
FT                   GILSIKTADFPVHTQNLEGFAVGFNASKIYCLHNISMQTVVVPHSWSVKNYIKKGDFDG
FT                   AYAVACLGVTNKDFMNLGLAAHWGMNLEVARKCFIRCRDMKYIDLVADTEEGLKKGEPP
FT                   FMFRALSLAYQSKFHEAAKEYAEGGRADKAMEMFTEMRMFDEAKVWAEEYAKTHGGGDI
FT                   SLTDFVNRQAEWAEETSDYESAVNMYVQAKKFEKAVALVGKNNWRDKLVDIMRVLDVKD
FT                   DAKVIQQCAGHFARWGDSSHAKEAYNKLGDHAGLMTLHVQQNQWDDAFALLKQHPEYAE
FT                   KVHLPYANWLADNDRFDEARVAYRVAGRSEMSTRMLEQLTLNAVLMRRFKDAGYYYWLM
FT                   SEEAADSLPKDSRALLSDDDEAKLARFHELKDRSEIYYAYDYVFRAMEEPFSSCLPSTL
FT                   LNIGQFLLSKFATHDEMPMGISLSYVLITIAKHGEALGAYKLARFAYNKLQSLRIPAAW
FT                   QAEVDLASVVARSRPNVDGDDLLPLCFRCSTTNPLVSVKGDVCINCGGHFVRSFVTFEH
FT                   LPMVEFHLADDISAKEARRLINEDPPNKASGSDGGAQLSHRVRPGHAAEPAAE"
FT   CDS_pept        802774..804072
FT                   /codon_start=1
FT                   /gene_family="HOG000253909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631922"
FT                   /orf_name="MICPUN_83602"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64883.1"
FT                   /db_xref="HOGENOM:HBG444813"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199B239"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM0"
FT                   /transl_table=1
FT                   /translation="MDGAERFERRATASARPKLKKFLLRYYPPGIILEYELAGELMQRS
FT                   VDLLDLSADTDADVLVNAITRQESMIKESHREPLRKLVKKLQSKLRAVSTKSFSLVKEL
FT                   RAHILPLTNCAFNKSGDKFITGSYDRTCKVFDTDTGEEIHTLEGHKNVVYAIAFNNPYG
FT                   DKIITGSFDKTCKLWDANTGECYYTLRGHASEIVCLGFNPQSTVIATGSMDNTAKLWDV
FT                   ETGTEVCTLAGHTAEIVSLCFNTSGDTIVTGGFDHDARVWDARTGRCVRALEGHGAEVS
FT                   STVFNYAGDRVVSASIDRTCRLWDVGGGRTEFVWRGHSDEVLDACFDASGARVASASAD
FT                   ATARVYQVSSGELAHVLEGHDGEISKVAFNPQGTRVMTASSDKTCKIWDSATGLCAQTL
FT                   EGHTDEIFSCAFNYEGSYVITGSKDNTCRIWKA"
FT   CDS_pept        join(complement(806861..806911),complement(804115..806688))
FT                   /codon_start=1
FT                   /gene_family="HOG000030831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631923"
FT                   /orf_name="MICPUN_105844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65228.1"
FT                   /db_xref="HOGENOM:HBG319752"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI000199B23A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM1"
FT                   /transl_table=1
FT                   /translation="MDHLTANGVMLGILPKKGEDVDLVGPIRSYVENTFSPEEATSSEE
FT                   DLTRLGLLRSETVANQQTHEQRRETLLAYYRALCVVESRFPISKQSGHIDVSFSWADAF
FT                   KTHKRVSIANVHFEKAAVIFNLGASWSQLGLAADRATPEGIKTAAHAFQQAAGAFAMLR
FT                   EDVLGKVGGVGGGDATADLSEECAGMLVSLHLAQAQECFYDKAATDGKSTAVCVKLAQQ
FT                   THLFYEEVKTALASPPLSEHLEKSWLAHVAAKSAMFHAEALSRAAKMAEEDDEDIGSAI
FT                   ARLLVASTELHAAHRMAKNTGGISVHCVGAVATLRDAVDEQLRRAQRDNECVYMVRVPA
FT                   YEDVAPLGAAAVVKAVRPPAEAVDAATEDMFAAIVPESGFKALSRYTEKVDALIREEND
FT                   VLALASDEARVALREMELPELLIAAEAGAQPESPPGCGQDSAAGSGGGLPSPLDEEVAS
FT                   IQGAGGLAALRGGPPRLAEMNEACTQQIGAAQSELDAEATEDEACRGTYGPGVWTRPPS
FT                   AGLTVNLREKLASFRNNLAQAARSDDSLRRRIEDGVDGVLGVLDPVNLAAAAPKLRAPM
FT                   LSTLDDSGALPSLRAALEDLEAVGGERAGIEEMMRRIKEDDNIMGKVMAKTDNYDGLFK
FT                   TELAKYDKAREAIATNVSSQADILSRLRATHARFTQMYDVDAWRAATDAHASSVRAAVA
FT                   HYRELSSGLEQGLTFYSGFAEAVNRLAGECEGFVENRRREKAQLEGVVARRAEQAAAVA
FT                   HHQAAAAAAQQNAAADQAAAQRAMAEAQASAAAAQIRNMSMSAPPPGPAPPPGIAVGAP
FT                   PSPHGYYSQPQPPAYGYPPAPQGYPSAPQGYPPAPQGFPPPPPPANYPQPPPGVGPPYG
FT                   GYR"
FT   CDS_pept        807163..808134
FT                   /codon_start=1
FT                   /gene_family="HOG000012769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631924"
FT                   /gene_name="HEMD"
FT                   /orf_name="MICPUN_60121"
FT                   /product="Urophorphyrin III synthase "
FT                   /function="uroporphyrinogen-III synthase activity "
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="ACO64884.1"
FT                   /db_xref="GO:0004852"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="HOGENOM:HBG729418"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniParc:UPI000199B23B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM2"
FT                   /transl_table=1
FT                   /translation="MSSASLHAAVCAGVRPHVASKRFCVTSVGHGASSPVSWSSIGLFS
FT                   SSGRFLRGPLSMKAAPATAAASKETEQYAGRCVVLTREEGKNGDMCSRLTARGIDCLEM
FT                   PLIETINGADRDALPAALNDPEGWTWVCITSPEAAKVFLEGWTEAGRPDLPIATVGAGT
FT                   ARILAEHYASGALAAPTFTPSKANADTMVVELPVDESSRVLYPASAKAASTLQDGLAAR
FT                   GATVTRLDTYSTENVTAVDPAVLARALAADVVTFGSPSAVKAWMALSGLDPAASDHPAY
FT                   ACIGGTSAKACDKIGLPGVLFPEDPGVDGWEGVVLKALEAAR"
FT   CDS_pept        808288..810438
FT                   /codon_start=1
FT                   /gene_family="HOG000079168" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631925"
FT                   /orf_name="MICPUN_60122"
FT                   /product="Ribokinase/xylose isomerase "
FT                   /function="ribokinase activity"
FT                   /function="xylose isomerase activity"
FT                   /biological_process="D-ribose metabolic process "
FT                   /protein_id="ACO64885.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="GO:0006014"
FT                   /db_xref="GO:0009045"
FT                   /db_xref="HOGENOM:HBG561992"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniParc:UPI000199B23C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM3"
FT                   /transl_table=1
FT                   /translation="MATWRVFTRTVYTAIAVIILIASPDVSFAAEQPSCGAPPPHIVVV
FT                   GSVNVDLTVKVARPPALEETVTATDPRVSVAVGGKGANQAVAAARLVAGSRPVRFVGQF
FT                   GGDSHASMLEQELVANGVDVSLSGRHPDLPSGTGLVMLSPGGEASSVVVGGANSAWPEN
FT                   DDELVSTMVRAARGAAVMLLQREVPDRVNLAAAAAAKAAGVPIVVDAGGVDAPIPAALL
FT                   EAADYLCPNESELARLTRMPTSTDDEAVAAGLELVAQGAKRVLVTLGARGAMVIGATGV
FT                   IARHDALPVPGGEVGKVGEVVDGTAAGDAFRAALAVAVAEGVDVVKDSRGLALAAAAGA
FT                   HAVSVPGAVPSLPTRDEAENLIPEHRHLPAPALAATKACEETDAALRDDECPLRFGSRL
FT                   NSMKERPDLWSGRERLDVLGMVRRLGEVEGIDLVDFNYPQHLDGRKPKAVTGALRAAGL
FT                   AAGAVAVRFPASRFRAGAFTNPDPSVRAAAVDVVAGACAWARSLDASAGVIVWPQFDGY
FT                   DYHLQVNYSDAWRRGVGAIRAALDRDECEGVKVSYEFKPTDPSSRFALVPSTAAALALV
FT                   RDVNRPGRFGLTLDAGHLVAAGENPAQSAAMVADAGALFGFHLGDVHSKLAAEDGLAFG
FT                   SVHAPGALELVFWLRASGYRGHAYFDTFPEAEDPTREAAYNVRAFKRMWSWAARLERDG
FT                   IRDVLLNHDAMTSLEMQEGLIA"
FT   CDS_pept        join(complement(812056..813147),complement(811247..812004),
FT                   complement(810535..811045))
FT                   /codon_start=1
FT                   /gene_family="HOG000224129" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631926"
FT                   /orf_name="MICPUN_83307"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO65229.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000199B23D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM4"
FT                   /transl_table=1
FT                   /translation="MDGRGRGGRGGRGRGRAGGRGRGAGDDQEPEAIPPSWPVYFPRLR
FT                   FAEDDRRAELVAVLARFFSSEIGFELIKGVRTHHLRDVLVALDFTQLKARADIPDLFAA
FT                   LELAPPEAMLCLRAAIHEVVFNSPVGRRELPHMQIPAPAVKLCRPPVVDVHLVNHPEAR
FT                   VTFRDLRSTLAGKIVTLRGQAVRVSPASYLAKTLQFTCDRCDTPQTFYFTNGLYDEPES
FT                   CAAPGCRSKKFTPDRDSVKCADWQRIKLQELIEDVMEDDDYDGRGQARFADIEAEGTLV
FT                   NKCAPGDEITVVGIVEMRNVEQKGSALERERAASQFELVVNALSVTRQRAGDDVNRQPL
FT                   SKEAEEAFRRGLPNLAAEDAHFGREPAMSPADLEFIVRFTEECDGEQFKQLVHSLCPVI
FT                   YGQELVKAGIVLALFGGVSKKFEDDGWIPTRGSINCLVVGDPGMGKSQMLTAASKVANK
FT                   GMYCCGGSGVSVAGLTAAVIKDPTTGQFTYEAGALVRSHGGVCCVDEFDKMQSEHDAFL
FT                   ETMEQQEVSIAKAGIVCTLPARASIIAAANPNGGQYNRSLNITDNLNMSPALLSRFDLI
FT                   FILVDDADATLDEHRARHVLAPHGVGGVAQLKQAQQQLLAHLMRKYITYARAYCFPMLS
FT                   EEAGKILQDYYVEIRARCAAGADSVPITPRQMEALIRLAEARAKVELRETVTAEDAHDA
FT                   VEIMKEGMRDVLKPGGTLRGKGGKLKKSGKAKMFIDAMKRKAQDKDSAYFTTGELYALV
FT                   DDLQLQIPDVDAFIDNLNMAGEILKSGRLWKVA"
FT   CDS_pept        813244..814335
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631927"
FT                   /orf_name="MICPUN_60124"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64886.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="UniParc:UPI000199B23E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM5"
FT                   /transl_table=1
FT                   /translation="MSGAKERFERAKAGIAPAKGVMDGIRKDMQAEKLGLKPKGGTAWS
FT                   HGFLNQKYWHPLSYRNQERLFKAEQEEEAKKTRNELAKKEFAEQAEFFKNTELLSQSDR
FT                   DALRNRQQLAFMYQQPPGFKEMQEREKQEAEERKRREMEDLKAREDEAAREAAGLPPLV
FT                   PEKPKRHHFKKDMYGKNVMTEEEMPELRGAPKMDGVGLARVQPFGKQVKAVQCLRCGGL
FT                   GHQSGDKECPMRDQNPADEFRVKLEDPLTLMRARDELMNSRKFALKTPMTCGRSPTRGG
FT                   CHPDAANQQMLVDDPQVELEAGRPSGILDSLPRSERKRLIKEYRAQEKASKKAKIKAAE
FT                   DYLRSQGVLSSKGKDKKGSKKQR"
FT   CDS_pept        join(complement(815293..815421),complement(814507..814812))
FT                   /codon_start=1
FT                   /gene_family="HOG000216571" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631928"
FT                   /orf_name="MICPUN_91267"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO65230.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG714769"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI000199B2FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM6"
FT                   /transl_table=1
FT                   /translation="MKYSTSVSSSRRKSRKAHFTAPSSARRKIMSSPLSTDLKSKHGVR
FT                   AVPIRKDDEVTVVRGNYKGREGKVVQVYRKKWVIHIERITREKVNGATVNVGIDPSKVV
FT                   ITKLKIDKDRKALLERKSGGPEKGKGKFTEDEVKAMQDVD"
FT   CDS_pept        join(815909..815982,816078..817974)
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631929"
FT                   /orf_name="MICPUN_97670"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO64887.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199B2FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM7"
FT                   /transl_table=1
FT                   /translation="MAVAAATYAVPLPERLSDGDFQVYRNAGKYTRLMTGYAPPFDGVK
FT                   TLHDLWESTCSRHSDEECLGTRDVAPDGTPGAYRWMTYAQLHERRAACSSGYVALGLKP
FT                   GDHVGMYSVNTAEWCVLDSAMTRNAMVSVPLYDTLGPDAVRFICNHAELAAVCVSHACL
FT                   PVMLGCLAECPTVKLLVVYAHGGKPLPPIPSGAGHRCEVVTIEQLEAEGRRRPVAPVPP
FT                   REEAMATICYTSGTTGDPKGVMLTHRNLISNAAAYADDLDLGPGDVHVSYLPLAHIYER
FT                   VTMLVCLFAGAKAGFFRGDVLGLLDDIAELKPTVFCSVPRLWNRIYDKVHAGIREGGFV
FT                   KQKMFAIAYAAKKKALEEGRPPPAIWEKIVFSKLRDKLGGRVRYMSTGSAPISAQVMEF
FT                   LRVCFGGTVFEGYGMTESACVISKTHEGDFSCGHVGSPVPCCEIKLESVSEMNYTTSDR
FT                   PYPRGEVCVRGPSVFKGYYKAQDKTDEVIDNEGWLHTGDIGLWLPGGRLKIIDRKKNIF
FT                   KLAQGEYVAPEKIENVYARSKFVAQSFVHGDSLMPSLVAVVVPDEEVLLPWAAKSGHPA
FT                   GGDFKRLCADPAVAKMVHQSMLAVGEGAGLKGFEQVKAVHLHPELFSVENGLFTPTFKL
FT                   KRPQARAAFQADIDRMYAGLG"
FT   CDS_pept        complement(818436..818786)
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631930"
FT                   /orf_name="MICPUN_108622"
FT                   /product="Histone H2B"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65231.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000032C773"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM8"
FT                   /transl_table=1
FT                   /translation="MAKPTSKKPAKKTVKGAGGKAKKSKTETYKIYIYKVLKQVHPDTG
FT                   ISSKAMSIMNSFINDIFEKIATEASKLARYNKKPTVTSREIQTAVRLILPGELAKHAVS
FT                   EGTKAVTKFTSN"
FT   CDS_pept        819170..819538
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631931"
FT                   /orf_name="MICPUN_83469"
FT                   /product="Histone H2A"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO64888.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199B2FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAM9"
FT                   /transl_table=1
FT                   /translation="MSGRGKGKSGKKAVSRSAKAGLQFPVGRIARYLKVGKYATRVGAG
FT                   APVYLAAVLEYLAAEVLELAGNASRDNKKTRIVPRHIQLAIRNDEELSKLLGTVTIASG
FT                   GVLPNIHSVLLPKKSKKD"
FT   CDS_pept        complement(819899..820903)
FT                   /codon_start=1
FT                   /gene_family="HOG000283611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631932"
FT                   /orf_name="MICPUN_97673"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65232.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG561995"
FT                   /db_xref="InterPro:IPR007005"
FT                   /db_xref="UniParc:UPI000199B2FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN0"
FT                   /transl_table=1
FT                   /translation="MNFGAGYVGSSADGLKIRRLEDQRKKQNEQAERVKAELAAESSKS
FT                   RIVNFSAGNSEVIENAFKQESVGLQTKEQFVEKRANIERELEEERAKTEKAAAVADAKQ
FT                   KEKKRKKQKKELGAKLSFGDDEEFQDEDAEDEFVPAKKVGKVGKNPEVKTHFLPDRDRE
FT                   VAERDERERLKAQFLAEQDAIKKERLQITFSYWDGGGHRRKVECLKGDTIAQFLGKARD
FT                   MLSNEFRELKHSSTDGLMYIKEDLILPHTATFYDFIVNKSRGKSGPLFHFDVHDDVRLK
FT                   GGSNVEKEDSHAGKVVHRTWFEKNKHIFPASRWEPYDPLKDYGGYNIYSGEKD"
FT   CDS_pept        join(complement(825902..825949),complement(822177..825787),
FT                   complement(821129..821669))
FT                   /codon_start=1
FT                   /gene_family="HOG000230582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631933"
FT                   /orf_name="MICPUN_101511"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65233.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG561996"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B2FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN1"
FT                   /transl_table=1
FT                   /translation="MAGAIDLSFSTTACLEVFRLDYSNPSTDMPLAGGAVAANERFHRL
FT                   VWGPLQTEGMPHGLIAGGLVDGSVNLYNPARIIGSPIGAEPSDGVSSGALVTKMQKHSG
FT                   PVRGLEFNSFSPNLLASGAEDGELCIWDLARPAQPSLYPALKGGAGGQPTAGEVSYLAW
FT                   NKKVQHILASSSLNGTTVVWDLKRQRPVISFTDPNSRRRCSAMQWNPEVATQLIVASDD
FT                   DRSPSLQIWDLRNSISPAREFVGHSKGVLAMAWSQADPGLLLTCGKDNRTLCWDTVAGE
FT                   VLAELPASSNWNFDVQWSSTTPGVLSTSSFDGRVGLYNLQRAGGIDAGPGTVDQYGVQQ
FT                   PGPKAPMKKAPAWMRRPCGATFGFGGQLVGFGVKPKGGAEEPAAAEKPSGTALTLMKVS
FT                   TAVEAEVSAELEGAVSTGGSDALKTFCETKKSEATETAAKEDEETWGFLGILFEEDARR
FT                   ELLKHLDFGEALVAKELAESEAEAEKARSAAEAEAAAADAAVAAAAAAAPLPPVDGDEF
FT                   FNNLPEPTPAAPAAPPPPPAPVDDGMSFFDDMDANGGMPKPPPSPPPAPASEPIAEAPE
FT                   AVAARKAAAARAAAMAAAAAEPVEHMDAHDAAVQRALVVGDYRAAVNACIAAGRHADAL
FT                   VLASVGGAELWEEARSRHIAANIGRPYMRVASAVVSEDLEALVKSRPLAKWRETLAILC
FT                   TYAPAESWGALAGVLAGRLADAGNFHASTLCHICAGDVDSAVQHWLGALPPGKVAPPAL
FT                   HSVLEKAVVLTRATGQSSGVGLAQLVVSYAEVLVSQGQLDAAITYLDMVPDGGDAIVTL
FT                   RDRIVRGGAGTTASSSAAAPAPAAPAPAPAAPSRGAYGGAYGGYSAPPAQPANPTGTYD
FT                   GYGGSSAYDGGYSQQPAQQSSYGAYGQSTYEAPPAPSLPPQPAQSAYAAYDSNPVQSAY
FT                   GTQSPMGMGAAGMGAAGMGAPPPAFSPAAVTAPPPAYGHPNVMVPSAPPQHAPAAPPPP
FT                   PPTSTVAAAPSFDPSASTPPPPPPAPAAPAAYAASPPAANAYNPAPAQYAPAPGGDYGA
FT                   YGASPAGGYGAPVTTAAGGYGTPPPAQFQPAMQPSVMQPGAPAAPSSAPAPPPAPAVPK
FT                   PPANLTMDTVDTKDVKPAHQGIVKSITVLFRQCEAAAGSHPARKKEVDDASKRVSVLLW
FT                   KLNRGDVSESVCGKLLQMCAALDAGDVAGATQVQVAMTTSDWDEASGFLTALKRGLTWW
FT                   TTDVDIETYCAEYGTVKSCVFFAEKSNGKSKGTVCVEFEDPAAARVCYEKLPYKRIRGR
FT                   DISVKYAPKTSKKEGGSPAAPPRPVPDTAWKGPVPPDTAWKGPVPGQKMNQFQQQQMMM
FT                   QQQMMMMQQQMMGGGMGGMMGGMGMGMGMPNMMGGMGGRGGGRGGGRGPQHKRPRN"
FT   CDS_pept        join(826251..826301,826430..826798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631934"
FT                   /orf_name="MICPUN_60132"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64889.1"
FT                   /db_xref="UniParc:UPI000199B2FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN2"
FT                   /transl_table=1
FT                   /translation="MNFLKRGFKAAKTFVFGDEDEDEYSDGSNGGFSTKREVAVERRRI
FT                   PVVQYAVSSLTGAHMGGIQSLSWFTRSMFRDDDGDVAEQFIDGEAGETKVGECAGDEDE
FT                   ARAGKVSYREARVEVERVLDGNVLLKNSFDEVQMD"
FT   CDS_pept        complement(827100..828722)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631935"
FT                   /orf_name="MICPUN_105845"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65234.1"
FT                   /db_xref="HOGENOM:HBG561998"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniParc:UPI000199B300"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN3"
FT                   /transl_table=1
FT                   /translation="MAGVSVSIGAGVVGARASARVERRASASRRVTASVNGASRATTAV
FT                   GPAGRSAFLRGVGGPAGLGSAALPRRRASRAAPLAPNALFSEFMQNLAGPALLDGWGLP
FT                   NVVEAVKALPAITTETIADLAVGAVAVFGAGVFINDTDSGGEVQTQTGGGGGQGGGGRF
FT                   GGGGGGDDFNDKWYFEDPDSEANNFFIRGGVQGIWWILLCAAASAYCVLIGKAPHLGAF
FT                   WGLAAVGIGWGLFVSVAVGFTAIVAVVVAVDYFLQWSHGDLHAALKAGQEKLTGGLIQR
FT                   EFDIQPAAADKKNVTSDPNRNLPEGVRILGTDAQMVQVDLKAGEEMSAEPGAMCYMSSN
FT                   VRSITSLQGGVFAGISRVLAGEPFFLNSFKNIANDGRDGYIALAGRREGDKIIVLDLDA
FT                   FGGEILCARDSYLCSKGEVSIDAATTFTRGQMGLRLFLSNQNTIFMQKLSGSGLACISG
FT                   NGTVIRQDLLEGQEMVVDARAVCAFSKTIGYQLRLMSSPLAAIFGGEGLFFARLSGPGT
FT                   FYLQSLPAARQDGGLRDEGEVAV"
FT   CDS_pept        829136..829759
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631936"
FT                   /orf_name="MICPUN_60134"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64890.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B301"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN4"
FT                   /transl_table=1
FT                   /translation="MVRRGPWAERVVSPHLSSVIELSDGSDDEGTQRSPVAGPGRVRRR
FT                   SKGGSTPLGSPAVRRRRLSGGVGGETQAVDLTLESDGEDEDEVRVVAEKGPVDLTHLEE
FT                   SPPRDTWTGLPIRNQPTKEDGKGTPEREPGGDYGPPRQEPQSAGKGIKCVICMDVIKSK
FT                   EMASTTCGHVFCYDCIREALKHTPRRCPQCRKSLRPTQVHRLYV"
FT   CDS_pept        complement(829828..831534)
FT                   /codon_start=1
FT                   /gene_family="HOG000241155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631937"
FT                   /orf_name="MICPUN_60135"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65235.1"
FT                   /db_xref="HOGENOM:HBG320485"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI000199B302"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN5"
FT                   /transl_table=1
FT                   /translation="MVVPPYAEVGCRIETTDGARAVVRYVGPVEAQDGIWIGVEWDDPT
FT                   RGKHDGSHGGKRYFECTASSEDGATPGSFVRPHKIRPSVTFREAIATKYLDGKLPVASG
FT                   ATGGDGGDDEENDEGMFVKSSNGQKIEIQLCLKKEDPNAVLGTLDRVYLPDAAIHTAGE
FT                   PGDAASCGLPAAKVRILDLAGNLMRDWNAVAAFGPEFPALRVLDITGVRASWPSIPPPG
FT                   PSPFPNLSVLVMNRSGASWREATAILGTCPALRELSLADCGISRLGEGDLGTFGDLAAL
FT                   AGLEALNLERNAMEEWSEVEKLASLPSLERLHLGGNKLRRVRYPAHVAKPGGPVPFERL
FT                   RALLLADNAIDDWDSVDALNDFPSVAEVRLTGNPVTESAATRHEIVARVARLSQLNGSL
FT                   IADQERKDAEIRYLRRVLGLVKSAEGAEGAAGGEAEGAAARAPQRGTEAVQAMHPRLKA
FT                   LVDSYGELSTHAAKGPGTGKMGEDMLELTLVCVAASAGEKAPQKKKVPMTITVGKLKLL
FT                   CEKLFKVKVDAQQLYYKEPFMGMPELLEPDDYDISYLGVRDGSSILVEEKA"
FT   CDS_pept        831722..833941
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631938"
FT                   /orf_name="MICPUN_101515"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64891.1"
FT                   /db_xref="HOGENOM:HBG562001"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="UniParc:UPI000199B303"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN6"
FT                   /transl_table=1
FT                   /translation="MAPPAKTPRRGYSTDETEEIYNGLMFLANEFEEDNAPLQAVRCYE
FT                   ALCLKDLTLLPVPEARARVRLASLLLQYTDNVHRAKQHLETCMLLLKNVHGYEKLKCQT
FT                   FSGLARCYRLFGRDVRMSWLNATTSGLDLARQAEKKYPDEREDWVTWQFHFMMDRADLY
FT                   MVYCDFAAAERELAAGAALARETGMSEVAVAFALARLQRAIAQRGAGEGAGAGEVDAAK
FT                   TAEDAVNALEEAVGEEAAAPARLHLHVLRTLGNLAAGNVHATAEVPKIVARLVKSIEGK
FT                   TDDEIDAKHAYVWLPVRATIALAKLLTGESLRPLGKFSEARRDLEDAMDQCDAALKHLG
FT                   VMPEGGDADAKAVVEQEQLIAEQRAAMEKEGSPSGRGGSKTSPRGKTKGKRSRGGKKAN
FT                   ADEEAEDQPPLPPKRQWVGSEIDLAPRTANDAKPYLHIRMLALQGLVGADLTATKLSLA
FT                   AARTEQMRAMVESYPRTLRGYASVADHAEGQVLHSLGKYEEAAARFAAAAAAAESFGPD
FT                   AMRDIAAVCGALSELAEGSPGGISRALDLVRPVLKRHEAMQAAAAAGADEKTGEKDASA
FT                   LPNFAHQAAALFVSGYANIVKGDASQEAKPKLSKALKLAHTQCCNHQLVAQSLSLIGTI
FT                   VLDTRGGDLSQSLDMLQSSFTLSKAQEDMPAQLGCLDSLLRLHRIRGSDQEEQDALVSY
FT                   HRRKASAYQSLVRAALEDEERLARITNGGIHLDDAEEMEVDEDET"
FT   CDS_pept        835954..836484
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631939"
FT                   /orf_name="MICPUN_60139"
FT                   /product="Copper transporter family "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64892.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG749299"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI000199B304"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN7"
FT                   /transl_table=1
FT                   /translation="MDHSHHFGGEMAGGAGSGGGGGMHNMHMHGMPVAFEWGHRVTLYF
FT                   DSWATETHFDYIVALLFMFTLCVMQEGLYYLRTLPPKVRAQTTEEIEGVTAPILPAPYK
FT                   TPALRRRLWGTALYALNLCSSYLIMLAVMTCNGGVFLTVVLGLSVGHFLGKSRRPIATG
FT                   MGESSEACCIEGQ"
FT   CDS_pept        join(complement(837560..837649),complement(837346..837439),
FT                   complement(836684..837249))
FT                   /codon_start=1
FT                   /gene_family="HOG000193563" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631940"
FT                   /orf_name="MICPUN_60140"
FT                   /product="Unc-50 family protein"
FT                   /protein_id="ACO65236.1"
FT                   /db_xref="HOGENOM:HBG395669"
FT                   /db_xref="InterPro:IPR007881"
FT                   /db_xref="UniParc:UPI000199B305"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN8"
FT                   /transl_table=1
FT                   /translation="MNHPLKKDAMSQKGAYRGSGFPTYVRRLMKFRQMDLEYTFWQMYL
FT                   MCTNPKVVYRHTMYRKQTKNQWARDDPAFVVLTAIMVFAVSILYCLFYSRSLGQAAYAV
FT                   VRSVLVDFLGVGAGVATAYWYVANRYMREGVNHSHAVEQRVEWMYAFDVHVNAFFTLFV
FT                   SLYCGQLVLSPILMMNGFLPRLLSGALYGVALSYYHYCVFCGYNVLPFLEHTALLVYPI
FT                   ALIMLVTPLAILVGFNPTKFVLGIYFH"
FT   CDS_pept        join(837842..838078,838202..838307,838465..841079)
FT                   /codon_start=1
FT                   /gene_family="HOG000189403" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631941"
FT                   /orf_name="MICPUN_60141"
FT                   /product="Proteasome regulatory complex component protein "
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="ACO64893.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG324892"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016642"
FT                   /db_xref="UniParc:UPI000199B3A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAN9"
FT                   /transl_table=1
FT                   /translation="MAVAGPISMGPALGLSSAAGLISMLEETEVQLQTTALRSLNKVID
FT                   THWAEVAGSISVIEAMYEDEFFAQRELAALLASKVFYHLGELNDALNYALCAGSMFDVT
FT                   ESNDFVKTLLAIDEYIEQRQKPEAEQAIDARLVSIVERMFQRCFDDGQIHQAIGVALET
FT                   KRLDKLEEAIHKSTDVAEALNYATRVCQTLVTSREFRREVLTVLVRMYESDHVENNYLN
FT                   VCQCLMFLDDADGVAAILTRLVEGEEDDQLLAYQIAFSLCENEIQKFLSNVASKLAPSP
FT                   KDTPRENGADEDAAMEDGEEDKKEDEEKKAEEKKEPIALLRSVLSGELPVNLHLEFLYS
FT                   HNAADLLLLKQMRSAVESRNSVCHSATVLCNALMHAGTTVDTFLRENLDWLSRATNWAR
FT                   FSATAGMGVIHRGQLNEGRTLMGPFLPREGGAGGARPSPYTEGGALYALGLIHANHGEG
FT                   ILPFLLESSRSSNNEVIQHGACLGLGLAALGSGNEEVFTDMFRILRTDGAIAGEGAGVG
FT                   MGLLLAGSGAVDKQQQILNYCHKTQHEKIIRGCSVGLALTAYGREEEAEPLIEQMVRDS
FT                   DPIIRYGACLATASAYVATGNNAGIRRLLHVAVSDVSDDVRRAAVMSLGFVLCSTPSQC
FT                   PRVVKLLAESYNPHVRYGAAMAVGISCSGTGMKEAVALLEPMLTDAVDFVQQGALIAMA
FT                   MVMVEQSEQSLAPFRKRLMNHIQDDREVTMTKMGAIMAQGIIDAGGRNVTIGLRAKSGY
FT                   PRMTAVLSMLVFTQYWYWYPLSYFISLTFVPTAFIGLDSHLKMPMCSVTSHCKPSLFAY
FT                   PAPVNLDDKKDKGKLVKAVLSTTAKAKAKAAKKAREEGKEAEGMDVDGDKKDDEAEGMD
FT                   VDGDKKDDEEDAEKEKKKPEPTKEELSNPARVTPAQERYVRFDEGSRFVPAVADLRRGF
FT                   VVLKDTTPGEDIEYVAATRTLVPGVTNTGGGAAAAAPVEEEPAPPEEFEFDPNDV"
FT   CDS_pept        841463..842224
FT                   /codon_start=1
FT                   /gene_family="HOG000071903" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631942"
FT                   /orf_name="MICPUN_108624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64894.1"
FT                   /db_xref="HOGENOM:HBG748003"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000199B3AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP0"
FT                   /transl_table=1
FT                   /translation="MVFVHGSYHAAWCWSEHWFDYFASRGHDCYAISCRGQGKSDVPQG
FT                   VSVAATLVEHADDVTAFCASLETPPVLVGHSFGGLVAQQVMCRRNPPELAALALVASVP
FT                   PTGNGPMVRRFLARNFIASVKITYAFIAGAFKTNAALCRECFFSRDLPESELLAHMGQI
FT                   AESCNVRLLDLKALDDVLPIPAPRAGSAPVCVMGGRDDFVVDVEGLEETAEWGRTEAIV
FT                   MEDAAHDLMLDTRWERAAAALDGWMATNVSA"
FT   CDS_pept        join(842441..843248,843281..843351)
FT                   /codon_start=1
FT                   /gene_family="HOG000191723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631943"
FT                   /orf_name="MICPUN_60143"
FT                   /product="Predicted protein"
FT                   /function="DNA-(apurinic or apyrimidinic site) lyase
FT                   activity"
FT                   /function="damaged DNA binding"
FT                   /function="hydrolase activity, hydrolyzing N-glycosyl
FT                   compounds"
FT                   /function="zinc ion binding"
FT                   /biological_process="base-excision repair"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="ACO64895.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003906"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016799"
FT                   /db_xref="HOGENOM:HBG690070"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="UniParc:UPI000199B3AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP1"
FT                   /transl_table=1
FT                   /translation="MPELPEVESARCLVEAHCIGAKVTKVEFNEDGSFDEKIFKDVERK
FT                   AFVSALLNKTLTAAHRRGKHMWWDMSGGADSPLFHFGMTGAFSIRGKGAMKYKAFVVDT
FT                   SNWPPRFAKLVVTFDNGIALAYTDPRRFGRIRLVRGDVTASPPISELGFDPLLAMPDEA
FT                   AFASRFAKRGGPIKSVLLDQTIAAGVGNWIADEVLYHSRLHPEQPAKSLTPAQLRDLRD
FT                   AMEDVIKTACDAGADAEMFPDDWLFHHRWGKVAGEVGGEPIQFITVGEENEREACGWRE
FT                   GGAQETRGRER"
FT   CDS_pept        join(complement(845427..847072),complement(843536..844958))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631944"
FT                   /orf_name="MICPUN_105848"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO65237.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI000199B3AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP2"
FT                   /transl_table=1
FT                   /translation="MARGGGGRAAEHVGRRTSSCVFADNIAKASIAAYNAALASVPEPA
FT                   RSDAFGGGRQTVLAAVVARDERLDALRVVSLGAGTKFMSAVDIEADAEAGARVRDSHAE
FT                   VLARRGLKRFLYAQLAAEAGRSHREPSPVATGRKRTREREDPASFTAPATEPGSRSARD
FT                   NASQTWSVLERAGERYRVRPSVTFHLYTSSAPCGNATVKRWAKGAKERFVDGLGAFETP
FT                   PGSDDHGRPSWSAVKEGQIAFLYKKDPGSTACEPSEPRGTGLGADKADETEKDVASGNR
FT                   AIASGGGSGDVGRFVPPGASTTGRVLTCSDKLATWSCVGLQGALLTEFLAEPVYLASVT
FT                   VGRKFNQAILRRALCCRVHRFIDPNGAERSAKETERRAKETEQAKGSSPSSPSSPSSSF
FT                   GVRHPSVMCTAVPFDLGAYAEGEGAVFDRREALAWWLEDGGPTSMTATRARGTSRDDEL
FT                   SGDEDDGVVGGIVGVGVSVGVGGRWEVLDGRAGVRLMPDGRGPSSLSRVSLLATHRFVV
FT                   ENLGRGDVELGRGDAAGGTYADAKRSAGEASGTMDKSRVVSTFKPFFGDSKKAANVEET
FT                   PVEARMRKALVHTLVKHSMRCATVKGEDRAALVIQRYWRSYAAARVLRRLRWAARRKAL
FT                   REGTVATILGLPFAVARTGLKGTYLALRSFLMTFTVFRMLAGTVGRIPVSLYRALISAE
FT                   GAVGVSGAATLAAVDCVLVRGTYFRGNFQDYVALYVATFMFCDLFLPGFVLGPYRAVGA
FT                   GARRGARLAARRGVFFAAENAPDAKAKNTVLRTGVFLGLVTEDEAKPKPIVSDADLPND
FT                   PDLLKALKAAEKYAEASRQRADELQERLNAVEQMMKMFGEMSEHQYNTAKEIASEATRR
FT                   LESTTNVDERIDKRFEDMTLMLREARDEGRAEGFTEARNELQRFGSLEDEIAAMSPEAR
FT                   AIVEKGLREGMEHGVVKGMQLEKERRRKAAISYKIKRALGLASSNSPEDAKKRAAQASL
FT                   EHLKSHIREGGAFPPAQQPRHRRSGSKTSNNSR"
FT   CDS_pept        join(847221..847304,847377..847797,847868..847965)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631945"
FT                   /orf_name="MICPUN_60146"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO64896.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniParc:UPI000199B3AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP3"
FT                   /transl_table=1
FT                   /translation="MDDAAKAAKRAEIEAKVAAMKAEQKKQEEQKAAYFGEHQGITCDG
FT                   CGAVPIIGYRFRCKNCPNHDICEACHERWDNGKGSMANGLAKQQISLDPKDHDFFIHKE
FT                   RGFKPLVKTAGPTQKSEKKLKVSTRTLQAALIRETPAPEPIVISFCTVAHRVDSPNLRA
FT                   TPAMTGEEVRLWSLLVNELQGLRVLFIEMMTVAVWSK"
FT   CDS_pept        848394..849764
FT                   /codon_start=1
FT                   /gene_family="HOG000224766" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631946"
FT                   /orf_name="MICPUN_83736"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="transferase activity"
FT                   /biological_process="RNA modification"
FT                   /biological_process="peptidyl-L-beta-methylthioaspartic
FT                   acid biosynthetic process from peptidyl-aspartic acid "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO64897.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009451"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0018339"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG457663"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="UniParc:UPI000199B3AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP4"
FT                   /transl_table=1
FT                   /translation="MVSLGCPKNTVDGEVMLGDLFANGFDIIDEHEDADAIIVNTCGFV
FT                   EDAKNESVDAILAAAAMKAEQEQGGKKKKVIVTGCLAQRYAEELADEMPEVDVVMGFEN
FT                   YKDLPNTLGEQLGVETGAAADGAKRGRVRVGTASPPFRPEALRKRLTPQHYAYLRVAEG
FT                   CDHKCTFCAIPGFRGKFRSKPWDPIIEEAKALADTGARELCLIAEDTNQWGMDLKASDG
FT                   RGLAELLEALAVIDGVEWIRILYAYPSYFSDPLIDAIADIPQVAKYIDIPLQHITNLSL
FT                   LRMNRPPRQHTEDLLYKLRDRIPGLALRTTFISGFPGETEEEHEDLMRFCREFKFERLG
FT                   AFAYSEEDGTPAATYPDQVEQAVRDLRRDQLIAQQQQISEDFAASRVGREVDVIIDGYN
FT                   PEFDAWTGRTSLEAPDIDPIVFVADPTGGQRALEMGQMRRCKIVGTSLFDLEANLVD"
FT   CDS_pept        complement(849936..850295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631947"
FT                   /orf_name="MICPUN_108625"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65238.1"
FT                   /db_xref="UniParc:UPI000199B3AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP5"
FT                   /transl_table=1
FT                   /translation="MSAVVWGIVGGVLLVSMLCGLWYSRCSENERRRREEGLPTTWHPS
FT                   LTGSYDPRGPRHAEFGPPPVQAPMYAPYPPQPYGAQPAYVVQPGYPAPPQPMPPQQAPI
FT                   PMYTATVPAQAGVKQ"
FT   CDS_pept        complement(<851941..852659)
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631948"
FT                   /orf_name="MICPUN_83563"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO65239.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG750941"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199B3B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP6"
FT                   /transl_table=1
FT                   /translation="MAPELSAERARLSIPKGVLFEGPPGTGKTLLAKAIAGEAGVPFFY
FT                   ANGSEFVEMFVGVAAKRVRDLFKRARQVSPSIIFIDELDTIGRSRALYGNMDSATQERE
FT                   AGLLQLLVELDGFDTKANAGVDQEMVLVMGATNLSAQLDPALLRSGRFERSFHIGVPKR
FT                   HKDRLAILQVHAKKLNIPREGDHKWESDALLNRAADLTDGYSGASLAALLNEASILSVR
FT                   ADREFVNLSDVERVIER"
FT   CDS_pept        855528..855941
FT                   /codon_start=1
FT                   /gene_family="HOG000265608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631949"
FT                   /orf_name="MICPUN_108626"
FT                   /product="Predicted protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64898.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG562006"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniParc:UPI000199B3B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP7"
FT                   /transl_table=1
FT                   /translation="MFPRLSIRSSGTRVSMRAPVVGRKVEKTVVAAVKDRAAPARYEAV
FT                   ILMKPGVEDSVRTAEVEKLKAMFMEGGATEFEVTDKGLVNNAYEIKGFADSHQYMIHTQ
FT                   CPRGTAKKVQNYLDEPVIGQEEVVLRYMFFKEK"
FT   CDS_pept        join(complement(856601..856606),complement(856408..856526),
FT                   complement(856207..856315))
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631950"
FT                   /orf_name="MICPUN_60151"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65240.1"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI000199B3B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP8"
FT                   /transl_table=1
FT                   /translation="MMIKVKTLTGKEIEIDIEPTDSIERIKERVEEKEGIPPVQQRLIF
FT                   GGKQMNDDKIAKDYNIEGGSVLHLVLALRGGC"
FT   CDS_pept        858423..859262
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631951"
FT                   /orf_name="MICPUN_108628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64899.1"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199B3B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAP9"
FT                   /transl_table=1
FT                   /translation="MEDAHRREIARLREMHASELAGVRGDLALRARMASSRDGRDGGRS
FT                   PAHPFEGRAGGPIGDDAGASGAGTGHPHEPASRSHDRPGVPTARAIAELERNEGRMRPS
FT                   ERVDAKVRGWNVPDAVGVGVDPSEGTIEWDATRPPGRDTPTGGTGTGTQQSQWQGTQRK
FT                   YAPSETGSERSGRSRAGTAAQVAAALRGGGATAVEALLRNGDFDPVDGARIGAFPGQGS
FT                   VPRPSKSSRTMTVAQLVVRGFTRAEAAESLDALGDDVDVDTAHEWLTDRDLTGGLAT"
FT   CDS_pept        complement(859389..863615)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631952"
FT                   /orf_name="MICPUN_60153"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65241.1"
FT                   /db_xref="UniParc:UPI000199B3B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ0"
FT                   /transl_table=1
FT                   /translation="MEDEPTSPLAAFLGNRSASWFGASPADDDRATMGTSSSAGADLTP
FT                   LGLPLFEADKVFAVQAAREAGGPKKSASRVRSLGACQPQRVCDPMDGLAPGNFLQGIFG
FT                   AGAGDGDEDGDRAGASSSPSIPPGSHDPASSREFVAATCSNAFDARRRLGAARLTRVFH
FT                   AAAHSSEGFTKHHLLLRAEDTAPHMDGVNGVNGLETPNKPPVLRALPWYEGEGGRIVSM
FT                   AFGPAPMDDRLLCGTADGGVYVIPCDAVLAGDAARDESEGEKEPDEEAEVGDRKKTKKT
FT                   KTKKGRPEPMIQVLNAGGSAVVSVAWLRASDAAGHPTAVVVTAAGEVKFWAAPSFSSLA
FT                   SAKVGCARAESAELVDAGARGVTFLLIAGYEASAENTSTRADRVYWTLKLPAGDVHKPA
FT                   EPVLGRFGVDRKGDVEGLDVSSSGGGGRERWRAAAAAAAAPPGERAPMLQAHPGANGGG
FT                   DGSGSLVSCLRRRAGGGRLGRLELFDPAIDERVPVAVHLVPRGTVSVRVTTRFVFALNG
FT                   VVGRRARLTVIARRVPGDETNRNNDETNRNNDETNRNNDETNRGTDTPAPAVALQEIVL
FT                   SSNCGFPRGLMPPGLGSDDAANLEGCAVWMSGAVLECRQSLPSVGAVFRGLMGASAPGA
FT                   ETEAFARAVENAGGKDGARRMRRAIQARAAGAGLGYWITGGTPSDDAAAEPDGDVKIAA
FT                   LSAALGLDPAPLYADAAREAIRAGDVAKARELLSRAHDDDGSRDDDDSRVLSRFVAMCL
FT                   REWRAADALDQLAEDASGPGDGTGVGITDKDWLGLCCGAHLRLSAWAASAAAAALGAAG
FT                   EFADSVNLPPLPPGAMPPPIAAKAAEDAAAACLASEGAGRVVAASRAAGVAAGAAGAVT
FT                   DFLDAVVRGGGGAGVDPAVTATVRVMLAAAIAVETLHRHGEPALTYPPPPFATTGDDGG
FT                   DGEGNADNDNAADDAPDAPWCAPTASPHAAAMDALAPPASFAARSSRRDLDRERWSERD
FT                   GPSDDPSSDLVDGSCPVTAVLPLMTPSEMKALARSASIGDSAHSAAEARTCTHLALAAV
FT                   HRGTRREKAAQRSLERALGRMIDEKSVDAGWAGATCLGWDNPRAASVAYMRGGKWLAAT
FT                   VCRVNAVLKDQPRRSSFGDDFVPPDPERRRLVESELADLIRDTAPRCRGARERATALVA
FT                   VAKAWRALNLPQGRLETLLLDGATAGGVVGAEAVALVLRRNRTVLSNKMSNDDDFERSA
FT                   DPELCKIPLSAKFAIAVASLRVRASEPREEEPGSHDDANEDGDAKKDGTWSRVRAALAA
FT                   DASVSSSVRYPAPVVAAAFGEPLEPRSPGPYNLPTPTPPESPANPTLTPKPRPDPSVDS
FT                   YVFSCGHRFSAERMAKTTAALRVGMRDAGMPIVGELLAADFALDRCASACPGCASRAVA
FT                   TLAAKS"
FT   CDS_pept        join(864038..864055,864256..864297,864428..865384)
FT                   /codon_start=1
FT                   /gene_family="HOG000265610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631953"
FT                   /orf_name="MICPUN_108629"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64900.1"
FT                   /db_xref="HOGENOM:HBG608048"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="UniParc:UPI000199B3B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ1"
FT                   /transl_table=1
FT                   /translation="MTRIDHADIRNSAEMELANVMRIEEAERDTVRQFFTMLGDGGWSH
FT                   SGASDGTDIFKLPGERIHRIMGVTRTTATPEEVLTFFSEPKNFDKHFKILDEMFKDGAV
FT                   VKIGGQGLELAASGSRQRMHKLGNFAALSIGGKDRSGPTDLSDVADGAIGLLDKARRSP
FT                   VGIKLQSFVRSKILKEHGAASTIASLPSSQDAAIGEALAAGPGASFREGQFKDLPGHAL
FT                   LHGTFRLPAIVPDRDFIWDQVALRLPTGSVLIAGKSVDDAEVSDVPSPKGHVRGAVLTS
FT                   GYYITPRWSQDGEMEGSQIAFVVQADPKGVLPAWVVNLVAPKQAHNVTRLRKFLDSN"
FT   CDS_pept        complement(865517..867403)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631954"
FT                   /orf_name="MICPUN_60155"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65242.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI000199B45F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ2"
FT                   /transl_table=1
FT                   /translation="MADGAGGEGRASHGMDPKDFHHTGLRLEWGHAHAPDGFEVFSLAV
FT                   SPDGTAVCAGGACPADPGCARVWVWLLGEEDAVSEETMTRRVDRARSGARASTAADVAA
FT                   SSTARRAHVLRAEGAVAALSVAVAGDVVVSGMADGSVWAWNLRDGTLRWGGRECDPHPA
FT                   LAKLPRRRRRDRNPFAAFVGRVDPGGFEPRQVRFLIAPPTPPPAANAAARLPGTRFDPR
FT                   DAAHLVVGSVGGHAVFPVWDAGTGEPPSGESDRSIPELGGHGRGWEEDSSTNRRYAEEP
FT                   AASYARDDPWRGDGRDGGDQIAPHVASSGDGRVLYVTSLDAKEVRAWRIRSGGGDTAVF
FT                   GTNGAATRAWTSERLAVRGLRLAGLTSLPRTRGVRRGDAAGGDAAGGELVATCCAPMVD
FT                   GTCYAAPDAPIKVVLIDAEDGQEVRRFELEGVTACNRFIDCGSLAGGGGGTLLFLAHRD
FT                   GSIWIHAARSGAQIAALHAHSTWAGTSGHHRLLPACVAIVGDGEFLWAATTDGQCVHRY
FT                   QVGPPRTWTRASHRRFPAAFRRAVKTLVTSVHVRNARGRAGLGGPLGSAGAVLMSAGPG
FT                   LRGEQIGDGFSGKGAAQLWGEGFAEVCAIEPAILELVVARIARLTHGSCVET"
FT   CDS_pept        867533..868555
FT                   /codon_start=1
FT                   /gene_family="HOG000248665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631955"
FT                   /orf_name="MICPUN_60156"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO64901.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG434986"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B460"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ3"
FT                   /transl_table=1
FT                   /translation="MSVETHRAELVDQSLPMPRRFRALFTLRSIGGDDAVAALLGAMTD
FT                   DPSALFRHEVAFALGQMQAPGAVDVLKRVLRDVTDDEMVRHECAEALGAIATEECVDAL
FT                   RDACVDGCRVVRETATLALRRLEHARAKRGEAKDAVEAPASKTLGSAKERLSAPAAAAP
FT                   APANGAPRDGVDADSPYLSVDPVPAAPASVPSDALTAVLLDESADMWDRYGAMFALRNR
FT                   GDGPGVARTLGEVLGSSQSALLKHEACYVLGQLQEADATARASLVRTLEDVREHPMVRH
FT                   EAAEAIGSIAAPDTENLLRKYAGDGDRIVAESCEVALDIMASEMSGEFVPLAACGEVAA
FT                   "
FT   CDS_pept        complement(868648..871077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631956"
FT                   /orf_name="MICPUN_60157"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65243.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B461"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ4"
FT                   /transl_table=1
FT                   /translation="MGRSRSVSRTDSRSRSSSRSRSRSKREKREKRHRRDRKDRKHRSV
FT                   SRTDSRSRSSSRSRSRSRREKRDRRDKRDRKDRKHRKHRKHRKRRRRSHSSSRSRSRSR
FT                   SRSRERKEDRGRSRPRSREAKRERSRTLSPRELDGSRVEPPQPAHPPRDDDRSFGRAGD
FT                   DRRRPGDAAWGRGRSRSRDRTSRRRDDGGYIRDAYDRAPPRRSPEHDRGRDASRDRGGG
FT                   GRGGHDDRRPPPAHYGHDRRGDHHHHRRGDHRRSPPRERAAPRHGGRTGSFFGRAADIP
FT                   RRAFGQSMTHLPRGPENIPGAAPVVIVDEEDPPPVAYGEELEGTGEPAWAGAAGFGLKE
FT                   GSAGKEGGPPTWGDRYPASVEGLGEEIADFVEYASPDADELRSRFAAMRRLDSVAKSLW
FT                   PGSEAEPFGSTKHRMLLHGSDLDVRIRTVGKFENIPECHGINQLGAEVMKQPWAVDMDP
FT                   KVTGRVPQISYVDSISKLRCKVCVGNRQTVRGTSFFNSPMIPLSARFPAFKVLMLPVKT
FT                   VFKQRGLEKSFAGGVGTFRIGMMLLNYLAMHAPASTRPPTPDVLGGALIGFFRYYASAP
FT                   ADGSEWQRWTEPFAFAGDLYVMGVQVDFSGCAMGEVWTVFATCAKSLESCPVGAPCGTS
FT                   ALSRVVKESIVVGAREETRSAARRVENQTPPETKMPGYLAPERRSYGAPVAAAAVPTLH
FT                   GDGGSRNAASSSDEAPTRCLTLKNMFDPAQIGDGGEGDAWWVDIGEEVREECAKHGAVT
FT                   HLAVDRHSQGFVFVKFATPEAATGARSTLHARWFGGRLVTCEFTAEDEYDVKHGVR"
FT   CDS_pept        <871398..>871679
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631957"
FT                   /orf_name="MICPUN_77085"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO64902.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B462"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ5"
FT                   /transl_table=1
FT                   /translation="RNARLPPEVNRALYVRNLPFNITADEMYDIFGKYGAIRQIRLGDK
FT                   RDTRGTAYVVYEDIYDAKNAVDHLSGFNVANRYLIVLYYNPAKTAKKRD"
FT   CDS_pept        complement(871963..>872916)
FT                   /codon_start=1
FT                   /gene_family="HOG000126427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631958"
FT                   /orf_name="MICPUN_83299"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65244.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B463"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ6"
FT                   /transl_table=1
FT                   /translation="EVLRTVGEGAYGVVMRCRDRVSGEIVAVKEFKINSADPDVEEVRR
FT                   TSTREVTVLRALSHPNIVAYLGDFYAGEKLYVAMEYLPRTLLEILDDTNGAGLPSEDVR
FT                   LYVHQLCDAVAFMHAAGYVYRDIKPENLLVDDSKRLKLCDFGFARRIDVADARGNSRGK
FT                   DPLTDYVATRWYRAPELLLGQPYAGADGATTRTGYGQPVDMWAVGCLMGELTDGEPLFP
FT                   GDSDVDQLRLLQRCLGRLTPGQMMAFSLNPNNAGVTFDDLRDAEPEGLDARYAGKMSTL
FT                   ELDFCGRLLTMNPKERITGEECLRHPYLAEHNRAED"
FT   CDS_pept        join(874363..874524,874615..876447)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631959"
FT                   /orf_name="MICPUN_60160"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64903.1"
FT                   /db_xref="UniParc:UPI000199B464"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ7"
FT                   /transl_table=1
FT                   /translation="MEALVRASFAGHVAAIRDLERREDDALRVKHSAELERLRERVCVA
FT                   ALGVRGADEVSAKVHALNHLVKIKMATGEYAAAWDARNAANKLREMERVDAENRHLDAP
FT                   GATLATAQLLARHDQEARDLLAEQRVRAARLEREIQTEIERRGGPCGGDTNPAAAVGGA
FT                   TMGRWLDVRDARTEHQTRWTQRENARIAPGILPTPAPPPPPRPSAAPPASVAAAPAPPR
FT                   APPRRPSAVAAFLVAAGDATPFEASYAGVPTTLGAGASMALTLSAYARDAATFETESGV
FT                   ETFASASASASAADKTETGVEIPGPARTAEETPRPHSPRPHSPTRSVDREEYVFGRRRT
FT                   WTRAPEAPENHRGTPRASKLPPRSSLPPSLVSYRADVDARTGNKAGTMKDPDHHPRAGR
FT                   RPAVHVPPLDFREVLRDAEQRSRTHARVRDPATRAAAVRGYGEYVDGSAGRFASKEAGG
FT                   KDARGGKGARRGFTTGHDEPARGSDLEGRVGGGVGGGTDGSRFLRAGEAEGDGCAPSEH
FT                   SSDLSSDDVSSDDVSDGIGAGDAEVWSATPERLREALTDPGGRSGARGELRAAARRGGG
FT                   PVLDVAVARVFRGAAAAEEAREAADGKENVEDGDGGGGGGGGGEGAKSAAAKGRAPTGL
FT                   FFRERRGPRAHGASLPSNTAGHTATRVRT"
FT   CDS_pept        complement(876562..877362)
FT                   /codon_start=1
FT                   /gene_family="HOG000265122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631960"
FT                   /orf_name="MICPUN_60161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65245.1"
FT                   /db_xref="HOGENOM:HBG562013"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniParc:UPI000199B465"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ8"
FT                   /transl_table=1
FT                   /translation="MLRAAVLSVGLAGTTPASSLLLLRGSSFAAPRLVAAPPRVVAARG
FT                   VSSAKGGRGGKGMAEFRNPHNLPVKTCVVCDRPFTWRKKWERCWDEVTTCSKSCNAARK
FT                   REKRAENGADDRDDDEDDDDAHSGRDDGGGASDAEEESGGPDGARDARREQRKAAKKAA
FT                   KAEKRAKRGGGDGIDAEGDGRKACDGCGARVDLLIRCQTDATRAWSMRCGKCWKAASGG
FT                   VPDGDADHPHYRYGGLWKNRRAVRRVSTAVPDLDLDAVKSLRVK"
FT   CDS_pept        878013..879398
FT                   /codon_start=1
FT                   /gene_family="HOG000007630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631961"
FT                   /gene_name="FAP45"
FT                   /orf_name="MICPUN_96484"
FT                   /product="Flagellar associated protein FAP45, tentative "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO64904.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG716409"
FT                   /db_xref="UniParc:UPI000199B466"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAQ9"
FT                   /transl_table=1
FT                   /translation="MATSRSGTSFGGPGSPLALTGAALERMRKPASVLSPEQIEEIKRA
FT                   RRAARDAEAEASKSRKERMLSTQSSRDASSDAGSESERLKAMRAEMTKSRAQTLLDEQL
FT                   DEVKNMNQMMLYSKCVTIRDAQLEEKKHVKAEAAEEERRLDVMMEVERLKALDLYEARE
FT                   KQRAADRRQGAEVLQKQIAERAKERELQDELLDMDRKLMLSEIQRMKDEAEAESRRKKE
FT                   AGQKLLAEVAKANAAQLERKKLMVQSEREEEERIARYIAERDEREAREQAEKERVAREK
FT                   ELETARLRAQQEKHADTAAAMDELRAQRIQEAHERAYREKERAAAERERAINEDLRVAR
FT                   EYQKMLKMKQLSDQARQERDEFFRVIDVQMQKEEEDANQAAQLAAMRRQHKEELQSQIA
FT                   YNEEMRRRERREYLEEGDRVRANLTAERARLEAIKQRKLEELAASGVPEKYLAELAKKK
FT                   IAV"
FT   CDS_pept        complement(879848..881101)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631962"
FT                   /orf_name="MICPUN_108631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65246.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI000199B467"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR0"
FT                   /transl_table=1
FT                   /translation="MHPDSFGPWPFGRYIKLILESHIHLRELVVYHPKMTNNNMALHRT
FT                   VTADPTTLLPANSPGLEGTVPQHINDGLLSTYTHTRGGNSVDPAWFEIDLGEEKPIGGI
FT                   YIANLCDGVMDDPRWCSMENWENMNHRVVSGKLRVQIMDDAKNLVTQTASPTLSNRSYV
FT                   VDFSEGYDNGNFWQRLDVQDDTWQNSSGTAQASDRWDAWHQSKFVVQNTFSVKTLFVPE
FT                   YSYTGPGNSGAPSTSQGSSGQPAPLGDCECMCDEGSGFSPWSPQTLINTVDCDPTSEDC
FT                   RVTSEQCSQQGSSMCVSQNTNNQYCSSGGSVSATWIYVEAYNSQSPGSTPGGNTFGDCE
FT                   CFCDDQRSQYAGFIEVCDQNGGPCGILEQECYQYGPQECANKLGQACSNYYPDWKSNST
FT                   YTGSSIDYSTSSSQGSSG"
FT   CDS_pept        888624..889673
FT                   /codon_start=1
FT                   /gene_family="HOG000009101" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631963"
FT                   /gene_name="GGPS1"
FT                   /orf_name="MICPUN_104883"
FT                   /product="Geranyl pyrophosphate synthase "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="ACO64905.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG732667"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI000199B468"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR1"
FT                   /transl_table=1
FT                   /translation="MQAVCLSTPAAIVRSSVRGRARSKSVVAPRRGGVPSVRAAAEAPA
FT                   AAVEASELDFAAYIAEKNAAIEQALSDSVPEMYPERLHESMRYSLLAGGKRIRPCLCIA
FT                   ACELMGGTMDVAMPTACALEMIHTMSLIHDDLPSMDNDDFRRGKPTNHKVYGEEMAILA
FT                   GDALLSHAFEYIGRETPKSVPAERTLRVIVDVGKCVGSEGLVGGQVVDIMSEGAEAGEV
FT                   TVETLQYIHAHKTGALLEVSVTAGAILAGAKEEDVERLGKYAQLIGLAFQVVDDILDCT
FT                   QTSEQLGKTAGKDEAVGKATYPSLVGLEESKKIADKLIADAKDLLKDYDQEKAAPLIGL
FT                   ADYIKNRQN"
FT   CDS_pept        join(complement(896393..896561),complement(890034..896245))
FT                   /codon_start=1
FT                   /gene_family="HOG000030138" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631964"
FT                   /orf_name="MICPUN_101536"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65247.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG591477"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B52B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR2"
FT                   /transl_table=1
FT                   /translation="MGADDEATQLADAAKLPWDDRFKHSFWKARVAAYECVVKEAKLSQ
FT                   EIASSACLKAFGECAKNAAGDANANALDFGLDALNAFLAVADEDYARTHSAGILANVVA
FT                   KGMGGRPKTVDRATETCMLLLELECGDAVVDALLKGSAHKVPKLALACVEAMRISVKEF
FT                   GTPAVVPPKPILKGIAPLFDSKDAKVRGAAKDLTVELTRWLGHDAVRRDLIEKMRGTMQ
FT                   AEVQAAAEAIEIGRAVRQRLTREERANPPPDTAGVDAMDVDGGDGAVVVATDAAPRLPD
FT                   AYEFADPESILDKLEKQPKDKETPKFWDAVNSAKWKERLDAMTRLKELADAPRLASGDY
FT                   GDVARALKKIVTKDANIACVGEACAAAGALAKGLRKEWTREAKVLLPGMLDKLKDKNSS
FT                   VVQKNQDALLEFSKHCFSLADVADDVLAALAHKMPKVPQQTLLWIATAAREMKTNTTAT
FT                   THAQRALLPGVLKCVDAANPDVRAAAIEAIAGLARAGGGYKSVARAVDELDDAKKSKIE
FT                   EMCAQTGGSSGGGATGPAPLQTRNPNVASVPAATLAAAKTAASRSGPTGPLTRPSAAAP
FT                   KRSVAAASGAASGAVGSNSEADADVAEGAPASKEELVERASRLYAADVVAKLQSSNWKE
FT                   RVEGVAAVAASVDAMSDEDAGAAAGDTIRALACFPGFDDKVFQVLAKVFEVFGSLAAKA
FT                   PKFSKRDGAIAVQGLAEKIADVKLRAPASAALTAVAEALGPKFVMAQLHKRTASHKNPK
FT                   VTAESLLWCAGAVEEFTVAVVDVSFVIAWCKQSLAMSNPACKSAAGKVLGAMHAGLGPG
FT                   LKDFLADLKDSQLKTLEAEFARNPYVGPAMVGTRKVRADGTEGASVSAAADGGLPRADI
FT                   SGKITEKLIKEMGDPSWKVRAAAVDAVNEILDESAKRIGPNTGDLMPSLAKRFSDANRN
FT                   LAANALATVGAVASAMGAPVGERRHGHGLVPEIVKQFGDSKASVRTAAAGALEAWSAAA
FT                   GLGKTLPYVADKMVELSGKMSGDGKSDALAWILTAVSGDDAAVTEDDLANAIAAAAAGL
FT                   GDKNAAARAAGGGVVDEVIRRVGSAGAARLLAASSLPPALKSAVSAHVEKSALHAVSAS
FT                   APGSLNPSPSTSPVRTEGHRSRPSTARGAAARSSLRASRVGGVRASASGLPPVAAGAVA
FT                   SGPVLVADGTEKEARLRKLPRKPVKFEGMRDDEIKHAEDDLKAASAPHVRADVHALLFG
FT                   KDFRAHIQAVEHLEAALSESPDAVEGTLDLLLRWVVLRLCEQAPNTQSLLKVLDFTADA
FT                   LAVVKDRGARLSEQEGALFLPALVDKCGHPMEAVREKFRRIVRLVPGVFPASKVAGYLV
FT                   RGLDSKNTKTRLEVLDVMGSLMERHGLDVVERAGNRALAEVAKLADQARDVGMRSAALA
FT                   CLVTAYKVGGDDAWRHLGRLSDSLRDALEDKFAKAAREMERRNEGLPGGWTRGVEKPSG
FT                   SPIAAMASAVFRPVQAMVSTMSSVLPGRRQHATSGPAPEPAPEEEREEEEEPPEREEPP
FT                   PMEVRLAGWTRSLDSVASVSDAVAVEGMKSLCHEVMAAVGDGEMLSAMAPDSDRLVGLL
FT                   ADRVSPIFDAAVAAPGPSTTRACKYVLNTMMQVFQEPTLAASVGEENERATVAVLLERL
FT                   LDPNVPKMEEGPQLVKALNVLMLKLLEHCPRTNSFRALLRLLADAPESVADEPAALVKF
FT                   HDLVVKCLIKLTKSLGQNLDAVNLPTLLGDVHAFFHSLGVDEIRRRGQCDDKPLRMVKT
FT                   ILHEVCKLVGHDVWDALSLCPPRDSNPAPIVYAYVELNLQSMPDAPGEPRAAPIAAPSP
FT                   KAPTPVKAAPAPVKAPAPVKAPTPVKAPTPVQAAPAPVQAAPAPVQAAPAPVQAAPTPV
FT                   QAAPAPVQAAPAPVKVPSPEASTSKAAATPATAPRALRTPAAAATPIGGGDVEMTDAPA
FT                   PTPVSADLKSRLAGIFKKIGEKATTARGLEELCDFSTAHPTVDIQPHLARTSGAFQNYI
FT                   KRGLGKVEAARAAQAASAGFGGAIGGSASLIAPSPVPDMDRSAAEVYRERLARMAAAKG
FT                   SAGPGSATASSGSRPGPSAGLTTLRERMDRIAAKASGNGPISGGAGSTSDRTPDHAEAF
FT                   NDLQARMAKIRAGREQ"
FT   CDS_pept        896848..897660
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631965"
FT                   /orf_name="MICPUN_60166"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64906.1"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000199B52C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR3"
FT                   /transl_table=1
FT                   /translation="MEPVVLDLPDEYKSSRENTPFVVVVGWVGAKDRNVKKYTDELRAM
FT                   GCVTLRSIQGTWDCFSPFASGRRKFARRLLTKAREARAELGMSKSPLYLMFMSNGGCWS
FT                   HATMTQCGMLEPGGEFEDLGPHLKGRVFDSSPAKMTLRNGPKVVCVSMGVRNTAARAVV
FT                   HALFYVYGVVAFLLVVAATGSTTMHIDEFWRTCASAPRTCRELYLYSDADEITDPRPLS
FT                   ELIAARKCTGSSEEGCDIVEVRWKDSRHCAHLVDERDEYLDALRGFIV"
FT   CDS_pept        complement(<897992..>898540)
FT                   /codon_start=1
FT                   /gene_family="HOG000238562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631966"
FT                   /orf_name="MICPUN_72121"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65248.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG591698"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000199B52D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR4"
FT                   /transl_table=1
FT                   /translation="PITSLVIALCSGVWYFLNSKGLGYEEVGVSYAKVVRDREYWRCLT
FT                   ASFSHISPLHLLFNMSSLWSLGVVEQMRGRGEGWGSGWYVRYTLVMLVGTMALVILSYH
FT                   VLVRMGHERYERVTAVGYSCVVFGWMTVLSVRQPTSSLSLLGYIQLPVNLAPFGSLIFT
FT                   SVVVPQASFVGHLAGIVVGY"
FT   CDS_pept        join(complement(899139..899158),complement(898767..898965))
FT                   /codon_start=1
FT                   /gene_family="HOG000005723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631967"
FT                   /orf_name="MICPUN_51032"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65249.1"
FT                   /db_xref="HOGENOM:HBG317029"
FT                   /db_xref="InterPro:IPR020101"
FT                   /db_xref="UniParc:UPI000199B52E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR5"
FT                   /transl_table=1
FT                   /translation="MGRSAVRLSEVVYTVSPMKTGVLGGLFKDWPKVMAKKIGGWGDAF
FT                   FFGVIPTVGVYQYAVNYKENEKQSHRY"
FT   CDS_pept        899845..900819
FT                   /codon_start=1
FT                   /gene_family="HOG000255975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631968"
FT                   /orf_name="MICPUN_91276"
FT                   /product="Predicted protein"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /function="transition metal ion binding"
FT                   /biological_process="deoxyribonucleoside diphosphate
FT                   metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO64907.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0009186"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG418082"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniParc:UPI000199B52F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR6"
FT                   /transl_table=1
FT                   /translation="MLQDNEDRFCLFPIKEHAVWKMYKQAEASFWSAEEIDLSMDYKDW
FT                   VTLNDNEQHFISHVLAFFAASDGIVLENLGLRFMKDVQLPEARAFYAFQLAIENIHSET
FT                   YGLLIDTYVKDSVKKRHLFRAIHNVPTVARKAQWALKWIQSSECFAERLVAFACVEGIF
FT                   FSGSFCAIFWLKKRGLMRGLTFSNELISRDEGLHCDFACLLYSMLKHPLDPARLQEIVK
FT                   DAVDIEKEFVCDALSCALVGMNADLMSEYIEFVADRLMTQLGVEKVWNTPNPFEWMEMI
FT                   SLQGKANFFEHRVDQYQKANVMTSVQGKCDGFENYVFRTDLDF"
FT   CDS_pept        join(complement(903156..903422),complement(900943..903000))
FT                   /codon_start=1
FT                   /gene_family="HOG000232481" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631969"
FT                   /orf_name="MICPUN_60170"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65250.1"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B530"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR7"
FT                   /transl_table=1
FT                   /translation="MASAVSFGLAASAVRPVAHARRTATVRASASGPHRRPVAVPCPGV
FT                   SARPGSLLGMTRRGSVRARNVVTKDKDSSKDAPLDVVEIEECLSDEACKTEMLSKLEEA
FT                   VADEPVAPVGEKNGVAASKMEAAAVGAAAPAKTAAVAVAQAPKKAEKKKVEVEEEKVAV
FT                   SEPPLNFDRLKSVGTFVRTLEIWGFVFNFLFRRVALNLKFTYKGGFTEAKKLERTEALA
FT                   KWLRLGLLRLGPTFIKIGQQFSTRVDVLSKPFIRELEKLQDRVPPFPTPMAKQIIEEEL
FT                   GKPIDEVYTDFQDEALAAASLGQVHLAKLKATGEQVIVKVQRPGLKEIFDIDLKNLRVI
FT                   AQWLQKVDPKTDGAARDWVAIFDETARCLYDEVDYQNEAKNAKDFAAQFAGTDWIKVPR
FT                   VYDQYTRKRTMCMEYAPATKINDLEAIQKMGVDPDRMARLAVESYLMQVLRFGFFHADP
FT                   HPGNVAVDKGDAEGKGRLVIYDYGMMGRIDPKVRSGFLDLFYAVFEKNSDSAVKALGKM
FT                   GVLVEGGDMTAVKRTADFFLGSFDNRVEEQQKQRTENKEEYEAEFKQKRTKEEKKARRK
FT                   QILSNIGEDLLVVSKDQPFRFPAELTFVVRAFSVLDGIGKSLNKKFDIGEISAPYARNL
FT                   LIDDNPSALPPQVVARQRDWERRFDRQNKAIVNLFKGPDAIEEIADVVRAIERGRLKIR
FT                   VRALEAERALERVQVMQGLMLKMMVACAACNVGVVLYVSGMLLQAKGVFGVAGLFAMQA
FT                   LVAQMKLGKLIKKEAQYAGAA"
FT   CDS_pept        join(903955..904152,904263..904327,904477..908947)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631970"
FT                   /orf_name="MICPUN_60171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64908.1"
FT                   /db_xref="UniParc:UPI000199B531"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR8"
FT                   /transl_table=1
FT                   /translation="MTASTPELAGSGTLLDALRRHALKGSPAAQSLRAKLGETRRDEKL
FT                   ERRELLATAVGVHAVFKSLRTDRSRGDSTLLSSLLHALKEGYKVNLFKNYKSNEGSPAQ
FT                   DVYSVFKALSEHVIDALKSDNLTPADDLAFSALNVTVRDMIQSHDAKGNPFVDKLGALL
FT                   LPELLDAALCPDMPSARRRELLDVAAALVVDPRRGAKCAVELTKLLKSDGYAAPAVADA
FT                   VAELAHLDDSLAAFVSLMYTSRDFACQARVASMLSTLVARAGLDEGDAGRAFESVDKGG
FT                   FARLVLAARRVESPVAFARDVCSFVRAFNAAKGREATGVTMTAATTTRVMVGRARLECP
FT                   AVAFNGDEGFCLVAALGGDDPNGETPVTFAYGECVRVARLAADGVMTCGVHRAPVGWER
FT                   SVHGVDSRDDGWIKVEFSAADVPDVKRSLATAAASHPSVFKDAAATGTSRPACSKDSGF
FT                   TMSDAGKSPLAALKRAVPTIKTRGLNDCHPGSLPATDKSRDSDLNPSKEPLPANLPKAV
FT                   VQPAIVSLAKANFEPFMLSPGPKPDLSEFDVSPVPSPRASLKVPATQSKTPSMSPDLSP
FT                   RAIMAAAADAETEAPTECFSQEEAVPETQPEPGPAPEPTLRPMSQPTAAPTSQHKPLGT
FT                   LLAEPPTLSSGRPEKLVDGLAALLAEPSLKAAEPEPEPEPEPDPTVDTKVKVRPKAKTP
FT                   APGFKLSRGKTIINPQNEPKEPRIPKEAIQISVRTRTPSPPRARVTRASNRSGKPAAAA
FT                   AGELTKNAGRSKASKGKNVDSDSEADSDFEPEPEPVPKKPAAKSKPAAKSKPAAKSKPA
FT                   AKSKPAAKPKPAAKPRARSPLAAAKPKKVTGGKRKKAADADDDDERDYLTVDPAMLDAS
FT                   TPPVMTQPTGGVNFADFKRSNLDDFTLVEETQSQMEPPSMIGWQEVLERKRARSPGMSP
FT                   FRSMLRKRALQKAPHAPKKGYGALPVVRSDAVAVVATAAAAEPARAPVVENWYDRPKTP
FT                   AADKELSKDFVTPTAGQFRLGRGGGKKVPDTAFDAPAKTPLGSRFGKGAAAKTHASKPE
FT                   AAPEKPEAPGHPEAIQTAERTEPFPSPPPAKRAKRAKAAKAAKTAEAAAAAAEKTAEAE
FT                   RAAKDAAAEKAHADGVRWADIDAEPVVEDDSYGEEGGFGLPADEPTIRTTDDPVAMIAA
FT                   VDEEDPPAERLSRSPSPARRTKAAKKPAAAVAAVDEEAALFAAAETYAAEDLPTLRKMG
FT                   KSDPRSARIAVIVEARLVREKAAAKTAAAEAAKKKTSSKRRAAEDDGGPRKKTKAPRPS
FT                   SPARSPAAAPTPSPPTHGDESTLRMSSGDDDDEFDFSDGPAPPATTTTTKRGVSFPLAK
FT                   VSSLPTGSKERLKERRPGSTGSKERRAEGSMPKSARPVSVSPIAPTTTLPGAALVPVKV
FT                   TGGRDKEDIDAVCAAMHALKRNRAREVELKIARVVKDLQAETRAQAQALADEIAAARKC
FT                   HEDAARARAEKSAARYEAIVADADAALARIKAETKRRIRAFEEAREEDDRARAELAAAV
FT                   ARSEEEMGRKAGAVKDSVARKSARAAAKVSELQKERDSGLGLRDMLMTLVQQLGPSE"
FT   CDS_pept        join(complement(909475..909525),complement(909110..909358))
FT                   /codon_start=1
FT                   /gene_family="HOG000216525" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631971"
FT                   /orf_name="MICPUN_60172"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO65251.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG317170"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="UniParc:UPI000199B532"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAR9"
FT                   /transl_table=1
FT                   /translation="MGHGYVTLVSADGFEFVVDEEAACVSKMIKSMMQSSGGFSERRDN
FT                   KITFPEISGKILEKVCQYFYYKLQYTDSRDSVPEFKVPPELALELLMASNYLDC"
FT   CDS_pept        join(complement(911418..911555),complement(911250..911321),
FT                   complement(909787..911121))
FT                   /codon_start=1
FT                   /gene_family="HOG000255572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631972"
FT                   /orf_name="MICPUN_105855"
FT                   /product="Bardet-biedl syndrome 8 "
FT                   /function="binding"
FT                   /protein_id="ACO65252.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG526510"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B533"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS0"
FT                   /transl_table=1
FT                   /translation="MADDEDDPSSREISKCWLAMKALERHDLDECLEHCNAALEKNPYD
FT                   QQMWYIKTRCLTLKNWIDDTELEEEGVAEVLMDEHATAAMPRPGTSLRRPGTRTQTGMP
FT                   NQGIRPTTSSGRPTTGFLRPGTSTRPMTNKGGVEGAFRGNRPGTTRPVTTSGRLVRLGT
FT                   ASMLAEPGGPFINVDKLDLRKYAQRPALARVLCDYILHHDRNPKKAVELASLATVNAGF
FT                   DDWWWKHRLGKGYYQLGLLRDAEKQFKSSIADMPTIDATLQLANVYIRLDQPASAIRVY
FT                   RAGQTQFPGETSMLLGEARIHDALNDMAAGVALYKNVLQWDATNVEAIACMGAHHFYTD
FT                   QPEIALRFYRRLLMMGVNNTELWNNLGLCCFYASQYDMTLHCFERALQLADDDNMADVW
FT                   FNVGQVAIGIGDLNLAEQAFKIAVSVDANHSESFNNMGVLDLRAGKVDQAIANFQTAHE
FT                   LLEFAHEPLYNAALTAFKLGQFQRAFEKVEKALENFPEHEDSLELRRQLVQHFNLL"
FT   CDS_pept        join(911693..911768,911952..912346)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631973"
FT                   /orf_name="MICPUN_60174"
FT                   /product="Ribosomal protein L27"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO64909.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG285569"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI000199B534"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS1"
FT                   /transl_table=1
FT                   /translation="MFGGLRSVGRCASNSTFGALQSLTNGLPELGQTLGPACSSIFVRT
FT                   ATKKQGGSSNNGRDSNPKFLGIKKYGGEHVIPGNIIARQRGTKWHCGANCGIGVDHTVY
FT                   ALISGRVHFTDAKNPHKRGKKVINVVPHEQWPEVLAAAQARNAAKRAKKEVQ"
FT   CDS_pept        join(complement(921583..921950),complement(913039..921436))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631974"
FT                   /orf_name="MICPUN_60176"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO65253.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199B5EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS2"
FT                   /transl_table=1
FT                   /translation="MASSSSGERLDNSGGFMSEDTDDGDFDPNNPSQSTPGGDDGNMGP
FT                   YGPALERERGRNASPTSSAGDGAPLERIVSRDFPHNDYYMVAEGLNRNPNWTVYPAQLA
FT                   VVLKACAQLAEDEDEAEKSEHIRKLYRDLVPNSFERCLTYDDLRRWPQDIHANILTASM
FT                   RLAHLVAVKLHQAHYFSGPGAHEQWEENEVDMCHLLDALAWALDRDSEYHKKHRFDRIP
FT                   NQLEPLERAFTAPIAVTQAEARTLMDADASKERSVYGTNKFQSYFGRKDDDGVIHVSDE
FT                   DDAPAVPVRFPGESSGTTGNPFVDPRGYDDPRPDRRDVEIDTWLDQIANCFGHHGGWEG
FT                   ILGLLGDPGPISLAMLEHAARPAKLAARTMIGSLRREFAEQANRCLNHMLRIVRTADPQ
FT                   LVGANSGERDERYMHLSKVLRHLEEILAHALKEEGGKPARDMAARLVSEVHQAMIEAML
FT                   KVPTFNMQLEALREIKRSLQEAAKTRDNHESKEQLKGIVAWMEAKKVLPHILRPTYLHH
FT                   KQYVDQVAAVLRFLLEEDAMTKAHIDELWAITQKQDTFEEVKNNVLDLLASLAWKFSDE
FT                   QLDYLFTLFEGAGHDALADCGKILETVQKLAGSDGKGVMAERLLELLWRMTHDAGGAEM
FT                   VAAFTRVLGHYDRMERASKSQWMARVVGDIRERRADLAVSLRLVIKIVQLESPEAAEDL
FT                   LGSDDTDGVKGKKARRRRLQERQQQITVSPDDQDYKEIRRLWIERLIAGEDLLELLTSR
FT                   FEEFQAHAWSEGFDRAQPAPPSGQPGAHRTGYQDTLKTFMEALMFVLKTGCIEVDPETA
FT                   LRFWAAFVDAPGAAVSEPLDPGVKPARFSDYGRIWITKMLVVGGKPCSVSPETVRTILE
FT                   TRLVNEPAARMRKQGYELLRSYFLQCAADEGKLDNSLDVDDDDSIGDLPVGVDPSDLGP
FT                   EATGVPARLLVHGKAVHDLRIRDHNFAGVDQLWRVFLDAPERDDEDTWEDAAHHLMWLH
FT                   LGADAETWQGTVAVREEFLAAVIDRLKETATGLLGDDRASAEQRAHRLTLLASSFIEKC
FT                   EDMYAAAPGAPLPHGGSYPGFAVKMEVILMHAVARTGQHDKVTVEVHSNVPVRALREAV
FT                   AREISETDPNRVRLLCFGQELRHDHKLLHEVLPAAAGAEEDQSFTVQAVLGLRKTDDIP
FT                   SPANNSPRALFASQPGAYDVLLELVDRSSSARVRENAQVILQMLPTRDSIRNELRGLLE
FT                   ATAADPATTAADARGRLRELLGLGPAELVYALQVLDGLLSSAPSRYVPGPGAAGGDDGD
FT                   KCGDMSGGPSSSSSVAALRGSFLALGCARDILTTLPSGITGEDDDTGAAAESAAKLASA
FT                   GLAAWRDVSLRRALCTAALSLLRILLRGQSVVDSEPSESLGSLGGAIGTMGLREERDER
FT                   MAADGDDPGMTVSDDDATGSRRRLAKDAITALANLAYIMGTGIRVGDPSEKGSDVDDAT
FT                   RDAMDSDARLDSDARSEDPECESDDEDDLTRDDWRLSRDSLALLATCTQLCASGASHPA
FT                   DSVMAMPVFPAMLRDMLIRSPHDAIRLNTADALYQLAVRGGKGDKKDGGKEDEKEVSPG
FT                   MVTALLSVRSLAIEHPSQCEQYHMLLCKMLSFHDDASAIEELLQEEVEALRVTPPATEE
FT                   TEAMLKSRLILIRTLIERLEKVGRGSKAAGRGLVQVLLFRCLFPEAVPMLRPSAEVLKL
FT                   AGMPPPIVHGGDDRPNGKVARGSKRKQDDEELPDLDDGDDGAVASDDDADTLSADVATD
FT                   RDVISGGPVTSGGKSSELNAGSHFFNGEEVEMLDEHLSPVCASPATRSAAFRLLADLCS
FT                   HDTENMVEVTDVLMELHYRGGVDVNEWDMLPSHNNRPQGGYVGLKNAGATCYMNSVFQQ
FT                   LYMVPELRDAVLSVDSTAATEEERKDSVFYQFQMMLASLAATRVDFYAPRGFWRAFKDY
FT                   DGEPINVREHQDGLEFFSRLQDMVDTEFKKSLAAADPDGPNKDAAKPNSGVKGAMEAVM
FT                   GGQFVNQMLCRECPQHRSERLEDFVHVSVDVRNKRDLVESLASYVQGELLESDNQWFCE
FT                   QCGKKVDAVKRACFSGEKLPNTLLVHLKRFEFDYETMQRLKIKSRFEFPMELDMSPFTV
FT                   EGIERDASAESDPTAPVPELPLGPDHYRYRLVGVVVHSGTAFAGHYYSYIRERGAPPGA
FT                   NAAEHGVGARWHVYDDQRVEPYDVANLEADTFGGKYTVNMSQFTGSDHDVSGDLHGPAH
FT                   HHHVPRQSGRLTEHDRPNSAYMLFYERVKPSDGERMASMPPSRTATPAFGKPAIATGDA
FT                   AGDASTQRVERIASPPDMPRQIRGHVMTQNLQFVFNGNLFSREYFAFMQRLVDSAHSGG
FT                   GASRKSQRRGERGGPRAAVNQPSSGAERDSMEENGGGARRVRTPEEEDEHAVLSIRIAT
FT                   EFLCHVYLRAHGSMRDERGLHAWRRTVANLLERSPASCRWFLGWIRSRPTYLAAFLQRC
FT                   PSGDARGTFASIVSSALVCATRHADGGASAEALLSDPENKERAQGPHVRGASETSKAVD
FT                   RVLGFLARHVRELLRVRDKYASPAQYFKVLNEYCKLGPGQALQLLRFEILDLVKEYVSM
FT                   VYFTPNRAGCASNAAENKPAFELFSNLICACDCEQVRMDMAVVAMEEAKKTYAELERVG
FT                   DLLEDSDEANGVAKTAPDSPFAFPNSGFKGWIMYHNPNTGDDSATGHVGFLLTRSTQWW
FT                   QLMVDLACENEAIRRALLHVCWRWEWPSYVATREIQGQMEEEDCMENVHAYLRLMESLM
FT                   ALEDWAQERRVRLCLEGPLEVQFPDGEKKDAPHLQAAYDAVAGKTSGAKRGAMAASGAI
FT                   ELTALRETKYGSRYVVCKWLVRTATRETSYRDWTRECLRRQRKDWLLGLECLEDDRHRF
FT                   GAPQQLSIGMERSDSTPSSAAQHPSDEVDYIINRGRELVGGEQL"
FT   CDS_pept        922292..923152
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631975"
FT                   /orf_name="MICPUN_60177"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO64910.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B5EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS3"
FT                   /transl_table=1
FT                   /translation="MTVVERQVAAMLRKQREEQDEQAALSRRAEELRSRGEQALNDNGD
FT                   LDEDSDSEHDDLERRGATGRARREFRDRGIVFDSSTDEVTVTVRAMTDLELGMAFAWMR
FT                   RDQRRYEGATSFWSKAGTGIQECFEEERCPGDKDVHAAVGAWPRLTGAFVPFLGPAPFA
FT                   FAMLKDDGLTVDTMGVRQGFRRMGLGRTVASAFIDRARRAAKVRAGPPQCIIDAVPDAV
FT                   AFWRAMGFSNRGGADSPTTAVMRKLCGDVAMSMTLLEDPPTPRGHEWWFEKPEEEKGYW
FT                   SDDSW"
FT   CDS_pept        complement(923223..923789)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631976"
FT                   /orf_name="MICPUN_108636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65254.1"
FT                   /db_xref="UniParc:UPI000199B5ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS4"
FT                   /transl_table=1
FT                   /translation="MRAPVGGDDGRLNEAERRTAPAPVEPTPASPVVFARSRTTTRDDD
FT                   DDDDDKRTVPVPARSQRGVGSPGLVDSPTPANLAFARSRPGGRAAPHLTSVPPPTAAAA
FT                   KEPGPATNDSSEPGRVAVSGLSRSRRGAGASEGPTTTPADRPAAAANKWGAVKGKVVAP
FT                   RTPGVADVAVRVVAEMARSRRPAKD"
FT   CDS_pept        complement(<925616..>926533)
FT                   /codon_start=1
FT                   /gene_family="HOG000241297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631977"
FT                   /orf_name="MICPUN_69441"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65255.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745150"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199B5EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS5"
FT                   /transl_table=1
FT                   /translation="LRVSSFIFFWYFLNAIFAIINKRTLSVFPYPWLLSWVQIAVGAAF
FT                   MLVMWRLRVFKPPSTVGFDAKSWKALWPTSCLHLVAHVTACASYSLGSVSFMQVVKAGE
FT                   PACSVILLTLFFGRKYSKLVWLTLIPIVGGVAVGSTTELNFSMASFVCAMISNVASALR
FT                   SVTSKDLQDATGLRGINLYGAMSVVGAVVLLPISLIVEGAKLPAAFASAPAGMAAKGIT
FT                   LFGATVPFLAYLFVGSMLFHLYNQTSYQALGELSPLDISVANAVKRVVIILASVAVFRN
FT                   PITPLGAWAGAVAILGTFLYSLAAQ"
FT   CDS_pept        join(927143..927226,927367..928944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631978"
FT                   /orf_name="MICPUN_60180"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64911.1"
FT                   /db_xref="UniParc:UPI000199B5EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS6"
FT                   /transl_table=1
FT                   /translation="MSGRSMRQRAPVSYKAGDMNQAKTPSWLTKTMVNAPEPERKRKPK
FT                   EPPVDAAKLAKKLQNIADNDGKENKPGKSKPGRKKLVKKSEMIVATDDAAPDTDDDMDD
FT                   VPIGRAFALPAPKPKPAKEGKMREKTVKERKLSEKGKQPGRKATAMGKAANIAAAGLKR
FT                   PAKQFEIDEEPSSRGSKKVPAGGRPAKRQARAALEDRFAAVKTPKPSRSPNVLDDTDVV
FT                   ATRWPSMANLTGSGDVSPLDDDFFAEKPKGKSKKGASKGADGKPVSRFAQMARAAEAAA
FT                   EHAKSVIGARGERLPAGKPDGAWSSAYRTLQAAHVKLQTKYEKLKETKLADMVGVAEQY
FT                   QSEIAEHGAKAEELINHFRAETDRYRELAANAEVMQERVFELERESSELKETLLAYQGK
FT                   ILRMEQDAAADADRRGAEVDAESSGRFWGSEELEAFTGLRWEKQETGVHRFTHAATGFC
FT                   FQLAAAEPEEEEEDAATPVGGGGGDRRRSEVMAARGGEPAAEDVAYEPILFGDAEGYLP
FT                   GYLAEAIEFERGEMPEFVGRMLGVLNQVAAERARGR"
FT   CDS_pept        complement(929021..929926)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631979"
FT                   /orf_name="MICPUN_51040"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65256.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199B5F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS7"
FT                   /transl_table=1
FT                   /translation="MAHRVTLPGVSRPRCAPPSITCTAKGSSDAPGSGPTPPTPPRRAL
FT                   LGGAASYAILSSLATRADPAVAYGLGNAPPPKTGGLFGRKQPRSEAEIRAIREEAERRR
FT                   EEREAEENPGELVTLPSGIQYRELDEGRADGKTACKGDTLYILYTVYRLAPGAYFKYSS
FT                   GGTPIFLWSRGYGNEGQDDVGATYRFVLGDSDAVPSAVAPALVGMREGGRRRVLVPPQL
FT                   GWTSDAVGPRPATFGAGRRLENHKEEPLLFEAELTRVRKSDEAPTEEDLAADLEPAGWS
FT                   GVFKLPAPPSPFRDKLGETS"
FT   CDS_pept        930319..931140
FT                   /codon_start=1
FT                   /gene_family="HOG000188453" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631980"
FT                   /orf_name="MICPUN_108637"
FT                   /product="Predicted protein"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64912.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG593164"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000199B5F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS8"
FT                   /transl_table=1
FT                   /translation="MGDVAVDMGASGDDLSRESKKVQGLIFQMTTSVSSFKRAVDSLGT
FT                   GKDTRELRAKLNKQRESIGRTAKECSLAVKRLAQSVTNSDDDGRSTHVAQHQKLVKDFH
FT                   VVLKDFQKAQRTCAERESTFLPQRDPARSPSRSYGAADDTEATRGEYHGAQEQQALLQD
FT                   SRRQELMSNEGEMEYNNALIAEREQGIAEIQQQIGEVNEIFQDLAVLVNEQGQMIDDIE
FT                   ANIVSTAVRTKDARRELTKADKSQKAARNKMICLAIVIAVVLIVLILFLLQ"
FT   CDS_pept        complement(931198..933048)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631981"
FT                   /orf_name="MICPUN_60183"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65257.1"
FT                   /db_xref="HOGENOM:HBG610051"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="UniParc:UPI000199B5F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAS9"
FT                   /transl_table=1
FT                   /translation="MAGRRFLPKLGFVPCSIIAGIVFLVIVALAQAIAETHPDAVSDRH
FT                   HGDEFLSRRAHETGYRRSGSRHRTHHGGLFGLNLDGEEGEDLKPRRARAGDEEVEEVEV
FT                   VEEIVEVEEDDDEGSDGGEEADEKGSVTATRDARDDRFDEFPASLAPLGGGGGDSPGPS
FT                   CDAGDFIEHAEFWGDVVVDGTQNLKTSASRCCEACAKIRSCRIWVWNPDSKQCWLKADE
FT                   REQPEPVAKGASVAWTSGVLPQRKGPGVKYALAKDVVDPTPPPKCLHTVLTSSGNAYMN
FT                   WQTRIMYQTYLKHAAEPGSVMKAFTRILHRGKDDELMMEVPTMRFDPNQGKCDTWCDYP
FT                   VADRSLAVAQWSQTTDSMRCSHVMMVETDYIYVKSPSPHILMPRGKAIGFEYSYIYPQD
FT                   LNMKRVYEEYMREHADELGRSEWKREKFALPRTGNAPSCLNVEDLRRVAPLWAEFVART
FT                   EKPEEVRKALGWLRDMYAYDAAALAVGVEHVVAPTPRTPLMAQPPADEKIGDAFLLHYT
FT                   WGPEIYDGKDEKLWVFDKRSYGGGQYQRGPYQLSKIPDPPRWDPAAGLQLQDFFQPRTL
FT                   SESKLELIRLMIDEFNEAVGKLPRIPKGHKTLEEAQAMAA"
FT   CDS_pept        complement(933301..934701)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631982"
FT                   /orf_name="MICPUN_60184"
FT                   /product="G2-like myb family transcription factor "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65258.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199B5F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT0"
FT                   /transl_table=1
FT                   /translation="MAHETTFWPEFNEDGGADEDQAIDDFLNVLLEIDTETLESQGEGG
FT                   GGTAKGKISSSRGDRIRAEASVADPRGTSYSRGVGAVFDEGAHHHHLSHETAAADLLTQ
FT                   HQLRQQVDTQMSSHARHLSDPMAGTGGQFGGIGDGWHPPGMADFSIFAQQFQHNNPALG
FT                   GFGVAGSATARDRTAGPNGGNDGKMRLRWTPELHKRFVDAVNRLGGLELATPKGIMQLM
FT                   EVDGMTIQHVKSHLQKYRLQDPGDRDVLDGDGKRGREGDDAGAAAGGKRVRRRPSAAER
FT                   SAARARAAEQKAREEREAAAAAAAAAAEAAAEAIDAERRMSSGGHGDLLGMEGGHHVPP
FT                   YANTGALMTTIDTTSGLPSVAHDHGARLALLGVEDDDHLETAARAAGLGTAGRSPEDVS
FT                   IALMKQIEMQSQLHAQLMEQRKLQQRIEAHGKYLESILERQQRQQHQQHQNKVHGDDED
FT                   GMPPGSLS"
FT   CDS_pept        935476..939642
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631983"
FT                   /orf_name="MICPUN_101547"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO64913.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199B6B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT1"
FT                   /transl_table=1
FT                   /translation="MTVTYSQVPSQSQGIGTIPVTADTYRTEEVSGEGDRTKGGAEAID
FT                   HDVSSVPEPDHLGAGVPDDDDTREDVGALRREVLEVAEAATRGDEVAAVSAMVTAAETA
FT                   ALREAMGGPHVPPDADHPRDPSDDEIRADPPSEDKNAVAATFGARRRLNLEAVDHGADV
FT                   WRGSSVLGGGGGVRGARLAPSSLSAGLDTQEALRDLGYSSHGWESVEASECDRSAATPG
FT                   YHAGGPPSVIDSQGLSAAPRVSDGGEGTQRKTVTFSLEPEEAPEREPERDGPDGLEGED
FT                   EEDEEEKGEEDDENEDEAILATQAWDPAADDEDDDEEGDEDEEGEDDDDAFVYAGGTQA
FT                   APPESPGTRAARSPCSQSPRPGLLRIREKPASALPIRPADPATASPYSDRPANPPKAPE
FT                   EDAAPEEDAAPEEDAAPEEDAAPEDNTASTPPAREAPFVDATPGDIIGSYVPNTFAAAV
FT                   NKDGTLGTATQSTANGTPAMSVAAVLEAAAKEAEAGAANPSMDEEDAGDLDEEDEIEET
FT                   ARPIGRSFNQAMSAALRTRQRRTVDLGGLTGMSLSLGHDGGDADDEPEKPPTQSMTSNV
FT                   AETPADVPAVPPVAPSGAGHDASQFSGARDAAAPSRVHRGDGGSDAEWAGGAWGAGRSD
FT                   PAPRRAAFAPPPPRSPPALAPATAPEPPDSPDFCEMMSQQVRDVVSAAARAYDSQATYN
FT                   NARGSNDPVDSQETEAPEEEEEEERDNEEEEEEEEVTDPDGTDPTFDFADPRFVAASQG
FT                   LASQMRVVRETFAPAGGRGRGGGRGGGRGRGRGRGGGRGRGRGGGRGRGRSDAEEVDFG
FT                   EWHREMEEKERAERQQLWEQIEASEKQEAGRGSARNRKPREFFGDSRSPSQSEEDREEV
FT                   QQAGVARTRAQRARRSDWKTRQFFGDSQFPPRSPGDDEEDVEEEEPEIAIVSDDDAPVV
FT                   EEDEEDEEDADADGEDAWYVGGTQAFPDMSPLPEEEEEEEEEEEDADAPPPNDKPLTPL
FT                   GCSKCRYASKGCGRCRTMRQCDMDGTPYPWSAAARGGRGGRGGRGGRAPASAGRGRGRG
FT                   RGRGAASSASAKRSSAASGAARRVRFAGDGEDPGVGGRLSLRTPSSARRPKKFLRRSQS
FT                   SGKKRGRPPAAAAERAVEEEAPSSKKRAKPKPRSSTFADLTFYLSGFGRDESAALAELI
FT                   VRNGGVVESQIPSPGDGQTLEPFTPSPPAGAPQPVAPDPADYTRVVTPTSMGRTLKCLY
FT                   ASAIGAPVVTPAWVREAAATGNPSLSPSRTPPGSIISRGGRPSRDKTSGHPGSSRVFER
FT                   IFAGLAFALSGDDGFHAQFGALLEHAGASVVDGSELTDDAGDDRDARCDLVVVQESPAE
FT                   RRGFRGSALRRAAERHGVPCVWHPWAVESLLRGFRQDAGEFAAVK"
FT   CDS_pept        939930..942380
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631984"
FT                   /orf_name="MICPUN_60186"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64914.1"
FT                   /db_xref="UniParc:UPI000199B6BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT2"
FT                   /transl_table=1
FT                   /translation="MGGCASRPVHPSYVAAQEAELERFRGTPRSPGPVPTTEARQPEEA
FT                   WESPSGDGGDVVDDAYCDDNADAGDCPRTTTPVGTLSPVGPVTEVFGGKRKDAAPPPAA
FT                   PGAGAASPQTAKAKPPKKLTIEEERQMLRQKLAECEELMIKGTEKALLMATMEESMEHL
FT                   ARQLRTEQDARRVAELAIEDERKLRRQIEDKVDIEVRLRQEIENRVRDANEVAKQAETL
FT                   AWKARRAQELDEIEQTNKKLRANDPERNARLEVELAQTKRLLNEERARARAERAVAETT
FT                   QKAEEDRPRLDEDSEKTRFERRVKEEVLLAMAKHEREMTIALSKAAEDKVNALEQAAVQ
FT                   KRQTISQLEEFHKSELRRVEERAEKAIEAARTEMRPQRAEFEALVQQRLDDHKTFVDER
FT                   KQALALAREEYEANLDRIRQSHEAEVKGLREAAENLMATLKWEAEGEEGTRARTIEDIG
FT                   RQLRDTKEILDREARLREQAEARSEADLAARRDAEKNARAAELRARDAEDRAYEAQRYV
FT                   QAAERRTKQQYLEIERVRRAGEKRREIHLLEPGEMPRPNTADVAVDALEADLGLVIDDE
FT                   REKALADARLAVHDATAPYRAAVANLQEYLAGVDDGDNRVNPRKKLDMEKAAEECRRRL
FT                   LAASETCAKLLAELEETQSGALERTRGEREGLFSERERRRREEQKAEAARAQKEKEEEE
FT                   ERARVADEEKEREARRLRIAKLQAKNAKKRGDGPGDGSGSGSESESDSESDSSDSESGS
FT                   SSDSDGDGDKENAAGKKGGKDPARVASPVVESKGRLHAGAVVREPSRPRVKMFEFSALE
FT                   RHKQ"
FT   CDS_pept        942546..943550
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631985"
FT                   /orf_name="MICPUN_60187"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64915.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG562026"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199B6BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT3"
FT                   /transl_table=1
FT                   /translation="MPSAKSVLPARIRYDGPYSMDLGNPAQFSMCLLQYAMLWEVPRFL
FT                   SGWFFRRRWGGKDGKANEEFTSCAPSYVMSFVHAIVVGGLGIWVLSGLWDCPLHDKFFI
FT                   NDATPPQTLKIVDVIERTNWVFFGYMMDDLAHVLARYPKLGKMDMVAHHLVFIVCSILA
FT                   GYAQIFVFPFSWLLIGELSTPLLTVKWFLRQSGLGQSKRPIEWAKKLGFKGKALESTYE
FT                   AASAIEYKVSEIFVAVFFVVRVCAYGAGLTHLLRHLIAGDLANVPPWPRYTVLGIILAG
FT                   AALNGHWFRIMITKALGLGGGSKSKGGKAEANSGEDAMYTFSAAKPENNGKAD"
FT   CDS_pept        join(complement(944605..944753),complement(943673..944456))
FT                   /codon_start=1
FT                   /gene_family="HOG000224022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631986"
FT                   /orf_name="MICPUN_83796"
FT                   /product="Predicted protein"
FT                   /function="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="ACO65259.1"
FT                   /db_xref="GO:0004514"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="HOGENOM:HBG751540"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="UniParc:UPI000199B6BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT4"
FT                   /transl_table=1
FT                   /translation="MSAPMSAGEAAALPYTIAPPAHPTYSIADAIKLALEEDIADVGDI
FT                   SSLSTIPEATVSTATLLAKADGVLAGQALCNQILAAVDPDVTVSWSKLDGDVIGKGDIF
FT                   CEMTGKAHSILRAERVLLNFMQRMSGIATLTKAMADAAAPAYMLETRKTVPGLRLPDKW
FT                   AVLIGGGKNHRMGLFDMIMIKDNHIAASGGIDKAVANAQNFLKERGMDGVKIEVETRTM
FT                   DEVRQIVDLLDDEAVVTSAVSRVMLDNMSLDDMREAVALIGGRVETEASGNVTLETVHA
FT                   IGQTGVTFISSGALTHSVVACDISLNIST"
FT   CDS_pept        945056..946567
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631987"
FT                   /orf_name="MICPUN_60189"
FT                   /product="Histone acetyltransferase "
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="chromatin modification"
FT                   /protein_id="ACO64916.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG562027"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="UniParc:UPI000199B6BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT5"
FT                   /transl_table=1
FT                   /translation="MDEQQEAKRRKLEALEAKMGGAPPPQAVRPAKMPNLPAVAPTPVS
FT                   SAPTAAGASEEQTRSPFVCDANDVVQFRLVRTEADMDAAEVFEPEFTHQVFRDDETVFG
FT                   YRDLEIKIFMSANLFKTLVEISYAEKVKSVLNPADDIMAMLKAHLGDDVFTDRDLFIET
FT                   LRKDAAAPVPGGGGVVVSTWKTTGADGVEYVDTARVFRLSDPEIYPWHARFEPMILFYI
FT                   DGASAVDSEDTRWLLFAVIRTRADDADDASWSLVSFATVYEFFVYPSSTRARLSQIVVL
FT                   PPHQRAGLGSKMLGAVREYCVANGFADFTVEDPTPQLQRLRDAADVRAMTNAPEVMAAV
FT                   RTCAMAAAALPRHVPAGTGGTAASDEGKGVLEMPRAAAKFARDELKICAPQAARCWEAL
FT                   LYMTAKKAGAPDDSPAAAAFQELVIRRLKALHCSDARRDAGSKRVYNHAQGRDDREFVM
FT                   CRGVAGGQAPDMEEDGDKADPAEVLADYFHDTMSNLAWLASAVKI"
FT   CDS_pept        join(946746..946814,946948..947805)
FT                   /codon_start=1
FT                   /gene_family="HOG000190918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631988"
FT                   /orf_name="MICPUN_60190"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO64917.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="HOGENOM:HBG324731"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="UniParc:UPI000199B6BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT6"
FT                   /transl_table=1
FT                   /translation="MKLKVVSRSGKALFPDGLEVKDSATTDDLKAAFHKIKRKYYPTRQ
FT                   RFTLQVPPGAPPKTRGTPLTAGKSLSKDYGLADGSTVVFKDLGPQVPYAVVFLAEYAGP
FT                   MLCYLPFFFMRREIYGGFLGMKGADKPAHISQQLACAFHTAHYLKRILETIFVHHFSND
FT                   TMPIFNLFRNCGYYWGFASFISYFINHPDYTPVGETQMMVGFGVSALMQLGNLHCHIYQ
FT                   ASLRSDGSKAYKEPKGGLFKVVTCANYCCEIYQWVGFNIATQSAMGWIFIACGAAQMAE
FT                   WANAKHRRLRKLFPGFKRPFKLLPPFY"
FT   CDS_pept        complement(947907..949535)
FT                   /codon_start=1
FT                   /gene_family="HOG000264295" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631989"
FT                   /orf_name="MICPUN_60191"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="ACO65260.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG562029"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000199B6BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT7"
FT                   /transl_table=1
FT                   /translation="MSGASVASVPGRLGGVRAKPSNRAVDRARGRSSRRAGRRGDACVR
FT                   EAGAFTKLIEIPLARGVARAAVAPAKKFFLDGERRGESEIANVTVRAPDADVEAYDSAP
FT                   MQALSGYDVGEVPFVMQAVCYYEETLDVGVLERGLSATLAKYPMLAGRLDLRTPGWEHK
FT                   GAKLTNDGVPLRVVRDDNLRFEDLPQDYAGETRRFLDFSPWIDVMLGDAPLFTAKVTQC
FT                   AGGGSVLGVCMSHAVSDGQGFIEFLVAWAKAAGGEAHPWGDPVFDRSLIPQPALAMSVD
FT                   EMREMLTEEGFDNVPSVPMLGGALLAGRTLVPDFLRFPAGNRMMVSVNEANMRSLREAS
FT                   GASNDNEALSAHAWLALADLCELPVGTPLEHVTVVSGRGGRTGLPDMYFGNAAIGVCTG
FT                   RVAVGDYSTLAQTRDGLRPGFTKAMMRRNKYLMLTEAAFRAGVNGFDFDIMAFMQGRMV
FT                   WCNNLVEIYKKLYDLDFGGGGPTLALPPELNDIVQIQCSRPDRKTGAPAGANGVEMFIN
FT                   LPPAMMERVRRPEAIERLAGARGIR"
FT   CDS_pept        949634..950458
FT                   /codon_start=1
FT                   /gene_family="HOG000264772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631990"
FT                   /orf_name="MICPUN_60192"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO64918.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG609166"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199B6C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT8"
FT                   /transl_table=1
FT                   /translation="MRRGLLLLALLAGVGGSKLDNVARNNAFIGYTETKGKPCVVEDRD
FT                   ARCPRWASSDECARNPSFMMSTCAKSCGAPCEPEADDRLAKHANVGAVVFHTAQGDIRV
FT                   RLREDLSPVVAGMFKAFASKPGASGSFYRSEAIPEPGAVDNFGGPGPPYALVQGRLDGN
FT                   HRSDLPREGAPKVRRGHACLIGGGPDFFIAVGPHPEWGNGHTVWGEVDLHEMGAVDAIT
FT                   ALDVKKETWGETHVTVLVHPLRFELSFEPPGWPGTLANLRGAGSAMLSDVDR"
FT   CDS_pept        complement(950556..953678)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631991"
FT                   /orf_name="MICPUN_60193"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65261.1"
FT                   /db_xref="UniParc:UPI000199B6C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAT9"
FT                   /transl_table=1
FT                   /translation="MGSCSSKPGEVGAMPIAGVGRVEPMDPDVKREVVRRARESGTFAT
FT                   DADATWVGSPLPASVNRRVVSRDATKRPGPGPDASSSSSSASHFGATVAPRTLDYDGAG
FT                   GRGSFSGAAVHPASLDEEERADGGVGDPSPDRVRAFRASPTPEEERGFGAGRLPWGSVD
FT                   LTAPVTAADAFTFRDDDDDDDDDDAPKSPGGGPLTLRRARELQAEKERATASALGGAHR
FT                   PVSREGGGASGFHPDSFAGSRPQSREWSGVASGARGPARRRVTAAEISGAMRARGGPSR
FT                   GSDAAATPGADSSPGAEFPPRPERLGGKPESAGTDSSTEFERETDALLSRAAALMEEEE
FT                   GLMEEEEEGLMEEEEGLMKEEEGLMEEEEEVVRASTAVSDAKGTAEGGPRGRMPMDADG
FT                   RRESSRDEPPPPPPAAAAADTSPPSAASSSHHSGDENLPPPPASLAGTRGKVPLESVPV
FT                   RALDRAVGGEDGAGARLERPPPKRGWVDEVDEVDKVDEVEAVEVDKVEDEGEGGTPDDV
FT                   FLTAAVASVAPPSVAATSTPSEEAETSTSPTPTSPTTATVASAGARPGSAASRSNFVSK
FT                   LPAPPPLSARNPKDGPQKPKGGTRANQNSRLASTFGRDAPAGPAARGPGTARAGARVRS
FT                   TTSAGYRAPEPRATGGSVNPGLPSAEGETNAKGGTKKATYRDRIASGRRAATATATATA
FT                   TTTTATTERPAAAPLGTPRHPSSEPDAADGPVPSETPAKLRRREGGEGDDATSRSTTLE
FT                   PTERVLTKAEEAKNRLRRNRRSSQSAVGAAGGFTARASDGGGGGSAGSAVSASVPSHPT
FT                   SESARPAQKVGLSAAELADRLGSVKRVIKPRSSMPDLGRSRRAETTDGGPEKVDADAAV
FT                   SDTNTAASTLEGGVPVVRGLDEAELVLRVDTLANEDALNATRSAVTRMTELLEYVDATS
FT                   RRLGCEPQNVFGHLLFRCGAPTDPTSRQLRLNDAVDPTRLQRMVAVTAELRSLLRIKVQ
FT                   DNNDLQLAATALRETAGFFARLDAAAAACSKEPWRVLAAQRPGGRARGGRG"
FT   CDS_pept        complement(954039..956966)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631992"
FT                   /orf_name="MICPUN_101553"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65262.1"
FT                   /db_xref="UniParc:UPI000199B776"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU0"
FT                   /transl_table=1
FT                   /translation="MGNSPSSFATARKGLTVGDASSISEEVWSDLWGSDGSQPPLGPGD
FT                   MLNFLTDATLRKLRAERPMNLAALVARAVCRLEELIAPDVGKESFGAVVVPKDACLLLT
FT                   PLRVLTRAIPFAIGSRGCDDDDVAVRVLEDLLWGHYSEIFQCPRPAPTWRGHVALAPPP
FT                   SRAAEPAERPPRRDPTLGERIASLALDLLFLPGFTTRFDPNDALTGERRVWDAPTGREY
FT                   APPYDAYVDVTRHRTEVTRLWLALVGAEALCAEPRTSPHGRFSALLAGRGCPVGVPCSR
FT                   PVSHRDVHGALTDAIKSQSGSAKSLDGSAAGELLATAYHTYTALLEYDDSAPNEEPTDE
FT                   LNGSSTPPTHHGVGRKTQNPNLPAGGAGGRTRKGGVFGWLDDVFGGFFIPYDPIAEAAA
FT                   SSCVANGNRVGTASEHAAVVGDTAAADGPRGSGTRNAYATILAETRSESELEGLHQALL
FT                   RTLRSAIDHPSGSSESSLMSYVPAVGFSDGVVKVRARFALEGEERDRAPAQEAAILAMR
FT                   LLRSDDDGFFQHVTDPKFKAGVPLASSLLQIMYQKRLDVNAGGFNQCASFVLLRLSSSP
FT                   AFASALNDVLPPAAAAKLNLPTDGGARTHTHADSLIHAVHAILCERAEYAEYVAPLVDP
FT                   LLTTLRNAAPRWRGLGDVGAAKLLRLCEHFSSPPVLFLAERNRHDLGAVVHAIDGCLSH
FT                   GAGRNPRLVLELCRGDGAAALDRVDEICAGRFRSPRPALDRVSMSRLNGGFKRAGLGDD
FT                   APEFIPAATFVGARPGYFFRVDARGAGYYVDRGMRAFVARSDDDGSSSDGDGSDNDSDD
FT                   SYSDDSGSYSGSGSGSGSDSGSLAAFGVNVFRPDDAWLRAVRSDIAPALFAARTLRREL
FT                   ADALAAYEEGHGADADALVEHLASLELANLLPPPPPVTVRHFASNAPEIRKWLKGYAMG
FT                   VALVRHNAGPSARACGILFDASRVRLVRVATSAVVHEEDFFGGGG"
FT   CDS_pept        complement(957111..958925)
FT                   /codon_start=1
FT                   /gene_family="HOG000264790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631993"
FT                   /orf_name="MICPUN_60195"
FT                   /product="DEAD/DEAH box helicase"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65263.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG609182"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B777"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU1"
FT                   /transl_table=1
FT                   /translation="MPLPPADGLGLSDQEVQTLLSSADENVLTTALSRAIAVEDFGLAA
FT                   KLSARLKELQGVGDSPAAEILDWRAMGMAEWLCDRAESLGYRYPTAIQRRASLAFFKKR
FT                   DVVIQAQTGSGKTLAYLMPTVDNMDFVARRMLQILIVVPSRELVIQTVMLAFRLFGGNV
FT                   NSGVPGDPGNMYNYKGPQGIKCVGVFEEDHVVREGFADVAELVVGTPELLARMKREGKL
FT                   EVDLAQTIVADEADQLFEQFPDAMDELLRPSPFEPVMEDRQIVLCGVNVPSWVIDSGVR
FT                   KGHLRAPLEVSMGTPGRVPPDVSHRRLVVPRVRKLVALARQIRSDLKNAGEDAPPPRTI
FT                   VFVPSAAAAEAAATPLRKSLWGRHKLAVLLPEGEEAVRTMQDFRNQKTTLLLCTPDVER
FT                   GLDMPGVDYVYSLDAPGTSASYLHRAGRCGRLGATSRGTVTSVVTPEETQALDQTMLDL
FT                   EISSWECLEEQANEPAMGRLVDEASRAVNSDAYGDSEEEEEALAWTGEGDLAGGNPARE
FT                   EEQALTAEALNDLFYLMDAQAEAVNALEAAFSMDDAFKDDSVDELETEEDARSENMKQA
FT                   LEDIRKIFDVSDIPEEDIPDEFKPPDMK"
FT   CDS_pept        complement(959311..960900)
FT                   /codon_start=1
FT                   /gene_family="HOG000264789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631994"
FT                   /orf_name="MICPUN_60196"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65264.1"
FT                   /db_xref="HOGENOM:HBG562032"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199B778"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU2"
FT                   /transl_table=1
FT                   /translation="MASAAAFALGAAPRAPSTASRSRRHIARAPSAAVASPAPATADVD
FT                   TRTARELVAWLTVEKGLPGGAAKAVSFGDGGVAKLVNDVRAGEPLIEIPQNLAVTSVDV
FT                   ADSPIVAGLAAGRGELVGLALWLCLERHKGPLSEWAPYVATLPSAGSDHPLLWTAGELQ
FT                   TLLQGSPVREQAVSRLESADDEYASIADQIRSNPNDFPPDAYEFLTRDAFVDALATVLA
FT                   RAVWLNAANCYAMVPLVDLLPLVGSPPPGVSPAAAAGGPAVGKPGLAAAAGVVDYDAAT
FT                   ECVAVVSANDAQQTARVVCVDPLARNAGDLFLATGAVDESHCGDYLAFAASCTQTDRLY
FT                   EAKRQILEGMGMSADGQTFPVFADRMPMQLLAYMRFARVQDPGELMSVSFEEDRIVSPM
FT                   NEYEVLQLLMQDAREMLAEYESSSEEFELLQLKEKGLSARQRVAAKLRLAEKRLINATT
FT                   TAVRRRLAPIRGIPTKQGLEDPNADLLEIFDAIENLPNKPKQMFDEFRKWARGDYEDQI
FT                   RSGGGKGGSGCG"
FT   CDS_pept        961328..961942
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631995"
FT                   /orf_name="MICPUN_108643"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64919.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B779"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU3"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLDRLRASVAEMEGSESEEEEKHATKKGVKRKRAPPTK
FT                   GPCEHGVKYRSRCKVCSACPHGRERRYCKDCGGSQICEHSRVRSTCKECGGVSICEHGR
FT                   RRSQCKECGGASICEHGRRRSECKECGGASICEHGRIRSQCKECGGASICEHGRQRSYC
FT                   KECGGASICEHGRQRSHCKECGGSQICEHGRRRSDCKECKK"
FT   CDS_pept        complement(962052..963209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631996"
FT                   /orf_name="MICPUN_60198"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65265.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B77A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU4"
FT                   /transl_table=1
FT                   /translation="MWWDDPPPDAASFDALCAKSGGRVRAGESATTGGGRALFATAPVA
FT                   KGEIVFRESPSLILQDPANRPLARACARCHSMLRGAPSETACAQGCGEGYCDERCRVAH
FT                   VEQGSHGLLCVGPIDSWEHPLAALKLACARDDDGDGHLALIAEMCAWCIASAARRGDAS
FT                   SSSSSSGASTAVAAALDDANLRTYVAGAVWDWTGASGGDGARARCEAHARMIREAMASH
FT                   EGSSEKLRGAEALMDPASGVVGARGVAELAGVLARNSLAVAVESSSASASAPASAPASA
FT                   PGDASTSNASPRKLGARYEGVALFPLTCLMNHSCEPNAEVRFEDAGPGAGVVAAVHALR
FT                   EIRVGEELRHSYVDETRPVFLRAADLAAFGFRCDCGRCARARGGS"
FT   CDS_pept        complement(963331..964098)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631997"
FT                   /orf_name="MICPUN_60199"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65266.1"
FT                   /db_xref="HOGENOM:HBG655218"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199B77B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU5"
FT                   /transl_table=1
FT                   /translation="MSSHFLTTSRHKNVFRLPSISTLPTHALTMSSVTFHALPPSANSS
FT                   CTRCVLKCGGIDFEEVNAYGQTRTPEYLAKFPTNLAPAIEHDGACVSETNAIARYLCGA
FT                   FPDKAGKFYPGDAKSKAKVDMVTEYTGITLYNYLAKATYPTIGFPLYAGDVAATEALKD
FT                   HVAGSQEAAAAELLNLINDKYVNNWLKDSTFLCGDEPTIADFRFAPIMYFARVAVVLPE
FT                   RIVKYLDDMETKVPGFKEATEGPRGFTADKVKA"
FT   CDS_pept        964478..967009
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631998"
FT                   /orf_name="MICPUN_101556"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO64920.1"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniParc:UPI000199B77C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU6"
FT                   /transl_table=1
FT                   /translation="MAHFDPYWNKDNKRVSGMFQEASRRKEEEAAAAARKPPQSTLLDG
FT                   LHETNAARRWQGGALQRLNASLNAQPRAPAPARAPAPTNDRRKSFGPAPPPGTNTLSRG
FT                   YQPKAPGELCSQEEIQRKKEAALKRRLERERTEKEELQRKLDQALQQQQQQQGQQQQGQ
FT                   QHQQQHQQQRQPPLNANPQPNPPVAPKRNPMVSLTAAKPAASTARSLAQHPTTSDDKLW
FT                   PDQPFEIDVVLATDPADDKLTVRAKSFPGYPAHAVLMDGGLRARNMWKTLAEKGACATW
FT                   DVKPTAVYQPLLARAAAEKLLRVEDRVREKIDLLRAEVEAADERVSRAVRAAEAASLSL
FT                   PSDLRDLVDEARGVANKAGGAGGRGGRGRGRGRGRGGRGGRGQGRGDAEPEPEPKPRFQ
FT                   SFSAAAEEEKVGGLGESDVVAAIVFGLRSVPGPKVVPNAADARALVRVLRHVQSQIGVP
FT                   LGVSAATDPTPPIRLAPVVARAVAKCGFGASLTTTTMTTTTATTTSGTEEDGARRTGKE
FT                   NEKGKGRESIASWFNRSEPEPAATAPDEAPEVESSMDTAYDHDGDRVAPEVIELLSDDD
FT                   DDGSAQSARTTRHPPGTLVTATGLRSRPELNGDVFEVRAWCSERERYHLARWGTGTPEV
FT                   YAKPENVTPMHAGPSEPASAPTAREEEPITIDDDDDGPSCRQMSDDDLRGLVRDQLRAA
FT                   TEENRLESTTVRQIMDALEETYLVSLSGERKRFVREVVDEFIAERTRSARKASDEAKAK
FT                   ASDEERGRREREALVGEVRAGATELIRAKKDLRRIEDAIKPKETRKRRELAPTFDAGDY
FT                   VQFAPNARTGAGMAWEGAGGMSMGPNVEDFF"
FT   CDS_pept        join(complement(968164..968226),complement(967172..967804))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631999"
FT                   /gene_name="LHCP2.2"
FT                   /gene_synonym="LHCP2.1"
FT                   /gene_synonym="LHCP2.3"
FT                   /orf_name="MICPUN_96389"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65267.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199AD8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E7K9"
FT                   /transl_table=1
FT                   /translation="MACIASSFTGSVAALKATKIQAKSVSKVIKADIYPEFGTYPGGGE
FT                   SPIIPFGSEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADKF
FT                   PGAVAPLAPEGSGYPSFWAVLAIEVVLVGLAEAYRTGLSDPVFDELTVGDVSPGGRFDP
FT                   LGLAESGDLEELKIKELKHCRLSMFAWLGCIFQGLATQEGPIANWQAHVADPVHANVLT
FT                   NAASGFGFY"
FT   CDS_pept        join(968842..968904,969253..969885)
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632000"
FT                   /gene_name="LHCP2.7"
FT                   /gene_synonym="LHCP2.5"
FT                   /gene_synonym="LHCP2.6"
FT                   /orf_name="MICPUN_56050"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO64921.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199A7FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1DY58"
FT                   /transl_table=1
FT                   /translation="MACIASSFTGSVAALKATKIQAKSVSKVIKADIYPEFGTYPGGGE
FT                   SPIIPFGSEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADKF
FT                   PGAVAPLAPEGSGYPSFWAVLAIEVVLVGLAEAYRTGLSDPVFDELTVGDVSPGGRFDP
FT                   LGLAESGDLEELKIKELKHCRLSMFAWLGCIMQGLATQEGPIANWQAHVADPVHANVLT
FT                   NAASGFGFY"
FT   CDS_pept        join(970503..971027,971214..971348,971463..971623,
FT                   971690..972161)
FT                   /codon_start=1
FT                   /gene_family="HOG000100109" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632001"
FT                   /orf_name="MICPUN_83429"
FT                   /product="Major facilitator superfamily "
FT                   /protein_id="ACO64922.1"
FT                   /db_xref="HOGENOM:HBG562035"
FT                   /db_xref="InterPro:IPR008509"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B77D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EAU9"
FT                   /transl_table=1
FT                   /translation="MHGFTTTRGQRAYGSDRGSGDQQHATFRRLRRRYNVVYTLGTFGD
FT                   WIQGAYLYALYSEHGYDMASIGYIFVLGYFASASVGTYVSSLGDRYGYRRFVILYGTAY
FT                   GIACLLMRSSNLVILLASRVASGVAYSLLFSSFESWAITEADRLRLDRRYLVGLFSTAT
FT                   FFNACSAVAAGVPSTLLFPRNKYTPAFDVGAGVLFLCALGAYKLWWEERPTGGGGRNAP
FT                   ERGILRAAAMVLAKPELLSLGVTNSLYEAALHVFVFVWTPALERRGPRMLAGAVPHGLV
FT                   FSLFMACKMAGSQLYMIIGDRVPAATILRAVFLGSTLVFAAPLLVESYSFTLLCFCAFE
FT                   FGLGLYWPAMAVTRAELVPNYLRATMTSVFRVPLNVLVMGCLAFAGNASEPSFLTMCVA
FT                   MMGSCLFFTSRGRAGKGDGSLPPGSPRGIAP"
FT