(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_6

ID   MICSR_6; SV 1; linear; genomic DNA; GRV; PLN; 1260462 BP.
XX
AC   CP001329_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 9, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001329.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260462
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 9"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        complement(342..1910)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632884"
FT                   /orf_name="MICPUN_61018"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO65697.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199AD1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED61"
FT                   /transl_table=1
FT                   /translation="MAPSKRRKTSTKSDSASGKASSGVRTRRSASARGDVPDADLADLD
FT                   AEPEELMCPITRTMFRDPVMLFDSGHTYERGAILAHFERNGAKDPLTRRALSSTKVMTN
FT                   WAMRNVVQAWLDKHPGVTPDGWDSRELLEPSRDVGTRSFDDEGDVGVLRTWRAMCPELQ
FT                   GMWPEDEQPEYWEGVTMENGRVVELELEDVGLTGAVPAEVGRLTALRELDLNGNQLTSV
FT                   PVEIGQLTSLVKFGLGGNELTSVPAEIGQLTSLQWLDLSDNRLASVPADIGQLTSLEGL
FT                   GLNGNQLTSVPAEIWQLTSLKVLGLRGNQLTSVPAEIGQLTSLSELNLNNNQLTSVPAE
FT                   IWQLTSLRGLFLGGNRLTSVPAEIGRLTSLSELNLNNNQLTSVPAEIWQLTSLRGLFLG
FT                   GNRLTSVPAEIGRLTSLKGLALYGNQLTSVPAEIGQLTALTELSLQRNKLKSVPAEIGQ
FT                   LATLKELWLNDNLLTSVPAEIGQLRALTSLNLDRNRLTSVPAAIRELRAAGFYVQLDDG
FT                   LTVDE"
FT   CDS_pept        complement(2039..3271)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632885"
FT                   /orf_name="MICPUN_50442"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65698.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniParc:UPI000199AD1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED62"
FT                   /transl_table=1
FT                   /translation="MRSLGITIAPLICSLVLLTCALLMAPKRVQRSMSRLLKPAVDMVD
FT                   SQIACVFIPYIVAVPISPLPAGGALWVSLGVCVVGHLFTMCTAGHLAQLAASYDEASDV
FT                   EWCEIESEELDADELAAKAEVKLMATPKAPVMFSKASFWSIIAVGSATIGMFMIFFGSH
FT                   RHVALAPAWLCATFAVYLIAKRIPAKLQRVGFFPTLTGGVAMSLIASAAGVLSGGTCAD
FT                   GLRLYMSGAGSFLLWFVPVAVLGLAFRVYSQRRVLAANLAPLIVSLGCAVPMGMTFSVV
FT                   LGTWVGLPGDIILSTVPKCFTTGLAVLMAGTLGADSSLVASGCVVAGTMGLAIGSFLLD
FT                   VAGIKKVVARGVATGTSSHAAGTAGLASNGEDGAAAVSGVSFAVAGVYGALLLELVPWF
FT                   RAMLIRVATGM"
FT   CDS_pept        join(3897..3959,4061..6253)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632886"
FT                   /orf_name="MICPUN_61020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65384.1"
FT                   /db_xref="UniParc:UPI000199AD1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED63"
FT                   /transl_table=1
FT                   /translation="MARGPLASLSENVTTVPDGEEASTSSSTDSMSKLREYRSAARASR
FT                   WEAPPACEAPLPASHQFQSVFQPRGASLLMRDDVVDGGIVENEDKENDPSSSDTTTMRR
FT                   PPPFTVPSGPPPPLAALPSHQPASTSSAMVPVGDVSDIVSAAIAGDHPRPSAAIKGAAA
FT                   AAMASIADVVRRAVTDARREGASIGASETRLALQRSTAKAQESAAAAVRAAEESQRVAE
FT                   EKARAAEERRKVLEIESNTKSKQLSKQLEEKQGDLGDKVRTFRARADAATNEATALRAE
FT                   LKREKEKNEAIKNAAEKNDATEARLKALTVEAKRAKEEAKKLKTEMDSRVEFETKQVQR
FT                   ELANERARSAKELAWFQSEMREMSAACDAAVAAAREEAFLAARTAAEETARLRAEFAEC
FT                   RELVSRASSAVSARHRKSLMTVMKKESWTRDEMEQLRNELEQERQARLKLKAAQFEKTS
FT                   ELAEALKTVEKLKAERDEADRAKVAAEAKASLVDDAFRSRDDAMSMATSARLEMDAATA
FT                   AAKSAAQEVEAAWAAAATAEAEMAEEHKRVLGEESAKVYRVVRNDLRALRRRYFVRMGK
FT                   DTSGAEIDVEDCDEDNDGVDMGRARKRLGIEGLVSAMMDFKRRGEVDADAFGDMGLRKE
FT                   LRRMEECLLLALTGDLENGANEEIEEIQAKEAPQVCESPDVVKSKRSSRSAIADFKADR
FT                   KAARERGGGVRKISSMHEREREDEKVSEDKGRTGCMRELTSSDEDVLGLLAGVTLGR"
FT   CDS_pept        join(complement(7918..8092),complement(6437..7722))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632887"
FT                   /orf_name="MICPUN_61021"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO65699.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000199AD20"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED64"
FT                   /transl_table=1
FT                   /translation="MREKQNPAATILKGRGLTRSSERRARGAEYPYSRALVASDSLWCR
FT                   YDAFAVRWERTQTEDASATPPEPRSQRFLTSRVPRVRHQVGFERALSTMPAAKGKGGAK
FT                   AKAAAKKSSSGNGVVPATAKRARSRGGRREAGINVAGSKKDNLPVAAANMDAPLQWGRQ
FT                   KARGADPGAEHVDKPQIRHVPEATDEENLGFESLLQLADAGVHLEKRGKKRAKNRGAAN
FT                   SKGGKAGGKKGQVDGGKGQVKKRGRGPNKVQESEEEREAKRLRRVQANRESARQTIRRK
FT                   HEIFDDLSGRAKVLEETNKTLRDQVNALYDEMKSLASKNTDLRNDIKVIAEEKGMPVPE
FT                   LPRQPETAPPPRMVPADGTPKPTRIAPKVDIGSSKPAAPAQAQPATVAISVPQMWPPHA
FT                   AFAHLAAAAAAANGSTSSQAPPNPAMMWPPAMIPNPYAMFNPAAMAAMMGAAAGGFPPP
FT                   PAFQAPTATNEAPGSPVVATTEKAVAAK"
FT   CDS_pept        join(8385..8470,8578..9865,10044..10103)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632888"
FT                   /orf_name="MICPUN_102087"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO65385.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000199AD21"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED65"
FT                   /transl_table=1
FT                   /translation="MRETAGVKRIALAPSTNYERQLLEDAFDRFGWERVNSPREATLQW
FT                   GKARDIDWRAVLDGELVANSYYLKTALTRKADLAKLLAKHAKIVGPNSPATSAVPETHV
FT                   IDLDDSDDSDNESSSLPAWFATTGGAWVLKRSESNRGEDIFFVRSESPEDRLEAERLLA
FT                   ADRGGESPWVLQRYIKRPMLVDGDFKFHLRVMVLAIDDLRVFVHDAAVALCAAERFGEE
FT                   DGVDLSNKFAHATNHCVQKKHGGDGKTTESNSFTIDELCERVRLPKDSPTAAALSECIR
FT                   NQIDAVVKDLFFAARSRASPAVGFFPMAGSFELFGLDFIVDEDGKVWLLEVNSDPSLAV
FT                   FGERLKPLCSDLIVDVVRVVSGDTNKVDGGFRLVLELPPRFPDATEARRRVSKLVSIVG
FT                   SFTAGTYDEHEGGKKVASIAIGAPGAKGAAKALAAREDWEVTTNPNAPLCSLQWAPHRT
FT                   VRMRQLRSKRLREELAGGA"
FT   CDS_pept        join(complement(14339..14460),complement(13937..14081),
FT                   complement(10744..13473))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632889"
FT                   /orf_name="MICPUN_105988"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65700.1"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR013989"
FT                   /db_xref="UniParc:UPI000199ADDD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED66"
FT                   /transl_table=1
FT                   /translation="MAGYKSATEILDELDRGASGEDMRVSSSGDDELGGVIFICSRDTY
FT                   DERMRNGLFGLTQQSWSFVKDIKPGMPLFLYNLSEKKFQGVFEAVRCKPTRVQGSLSAA
FT                   SCRNWIRTLRPLADDSANKKFRLDLNPAETAAFIRMFVFGVKAEYMSSQQPGSPAAANG
FT                   HHDADGWETVGPKKKEVRKDGRASSGPRRNGDSGMGGRKSSIASISNAGDNSGMDTPDE
FT                   EPGSPAAPRPERAPTGWAAILTGRADSASLPTSAAEAAAKEAAAKEAELLRIKEQEAER
FT                   IRKEKEEARVRAEAERISKQAHSEAPGSPKTEPKRVASPAPGATKLTAAAKEPVRAPAQ
FT                   AAASSDGASKPFKGWASVVTGATPDPAKEGWQTLVEGKLDAEKQSTATVTITSETVNGA
FT                   PIDAAVKKAPPAEQVSEPQSPNKSPASSVENDDMTPLKKAWSGWAVKNPPPTVDLKAEM
FT                   EEEAKKAATKVKAVTIDPASSPGVEDGVEGKKKEGKREKKEKKEKDGGDGKATRGVPQP
FT                   QRGKNAQGANASPRPPPPPTSPPLASPNGVGAPARPFSAAPAPPREPAAAPEGAIVSEV
FT                   GCAELTDEIRAKLAERIGREMLETARVQPFSVKGNVLRIERRAVDMLIRTMNAIVQSLY
FT                   PTASVEVFGSFPTASWVPGASNLDIALSLPEAVTSDPQKKLDALNSLAVALRANPHWVS
FT                   EVNVVPSPFRPLILLTTHSAFFQPPPPPQAAQGPRPPPGAPPTANGGSPGANSDSPGAP
FT                   PLPPGPPPPAASVGFGLGNGGVGLPLEVAISIKGKDHKGAAAMKFLRQAETEYPALAPV
FT                   LAVQKAYLANRGLRGVYKGGIGSYSLALMALHSMQQAAAKSAGAEGGSGAGDDDAKDAK
FT                   ILGDSLLQFLEMYGHTVDLTKASIKVHALKPGKGKKAAEAHEAARKADWGVLPAPTSGD
FT                   GPRAAMGGGTLQVQDPTQTGNNAGSGCFGVVGVQAAFKDQLKQLMAVPADASLLQHILT
FT                   GAPGKVCVV"
FT   CDS_pept        14962..16587
FT                   /codon_start=1
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632890"
FT                   /orf_name="MICPUN_50445"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65386.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG746942"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199ADDE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED67"
FT                   /transl_table=1
FT                   /translation="MGAPLSKDGYEEVQRWDDDGEGLFDAGDVKAVSGTGAMSPAAREN
FT                   AATELGGFVGEARNQAGLALPVSLSMVCNRVMSLTSVAFVGRLGPVPLAAAALATTLGN
FT                   VTGNSIMVGLASAVSTLGGQAFGAGSYPTLGFVLQRAIIILTLAAVPISLAWWCSEGIL
FT                   RILGQDHDLAKASASYIRALIPGLFFYAWNVCLTAYLQSQRITRPAALAGVVAAVMHFP
FT                   ANVVFIHTLGLGYVGAGLATSWSNGVVLCLNVLYASRFKKDEPGRETWPGFSVRAATTE
FT                   WRPFLRLALPGILMMSEWWASEANILLAGLLPDPEYNVAAVSIFQVTNALAFMVPVGFS
FT                   VAVSTRCANELGARRPAHARFASRVAFSLILAVEFIVSALLLAVKKHWGRLYTNDERIV
FT                   RLVSALLVPLAVYTFFDGMLCVATGVIKACGRQWIAGPVVFFSYYVVGIPLACWLSFGS
FT                   PDIGAMGLVVGGTVGTIIHSVIILVLVHNTDWIGEVTRALERVEANSFGRKDAGGADTD
FT                   AEALLPDVCAEVELEDMKKKSADN"
FT   CDS_pept        16891..17577
FT                   /codon_start=1
FT                   /gene_family="HOG000264833" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632891"
FT                   /orf_name="MICPUN_114083"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65387.1"
FT                   /db_xref="HOGENOM:HBG562930"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI000199ADDF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED68"
FT                   /transl_table=1
FT                   /translation="MAASKKKMVALHGKGGTAASFEEYMRPLVEATSDTWEWEFIDGPF
FT                   ESAPGKCWWQLKPGERTFEAKELIGCDESLALLDRHWPFDGVMGFSQGAMLAAIACGRG
FT                   LGPGSTKMGRPPVAIIAGAAFPTCRGADVNKLKMLEYAAAESEVVVPESVAASPGALNF
FT                   DPLVKSLHVIGKRDAMNPPEQGMKVAEAFGPGAQLLEHGGGHTVPLDEDAMRRYLEVMG
FT                   VEVNAP"
FT   CDS_pept        complement(17651..19291)
FT                   /codon_start=1
FT                   /gene_family="HOG000264838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632892"
FT                   /orf_name="MICPUN_61025"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ACO65701.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI000199ADE0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED69"
FT                   /transl_table=1
FT                   /translation="MTGGRLSSFKLGGASGNAQGQYRARLEDSPAMSVDAESAAAAPPS
FT                   NPPAVSMEVGVRPAPVEVSVPAYEAAGSGDLQIEVSDPHRAGEGMSKHVEYKVTYWSTL
FT                   SGYTNVSGCVTRRYSDFEWLWKQLRATTDGIIVPSLPQKTLVANDDPTSAAIEARRRHL
FT                   AVFVARIAAHPIMRESKDLQIFLEEQDKASWSERVPWYERGITSDAVRGVSDWFNHTVR
FT                   LDDSGTAANLVSAAAQGISGVAAAAGGAASAAAAAAGGAASPAKSPPAAAAATTEQPAA
FT                   TASQSGPTGDVLLGSGAPASQGAPGDGITEDQHFLDVAEYVGKLKGRLDKLSSATSALV
FT                   KHAQLTGSVLMEFARVVVDLDETEAKAKAVFETRTNGVEWTNAAKLFASASGPPNAQAA
FT                   AVTAAFGEPLDGAVALTQACVSACDARKAIVDHYNRLCKQIERLDQKAAAMGVPEPGPR
FT                   REEKQKLELAASDTRIARTQAMGRYDKCRQHMEHELVWFHEELARTMGAALKDLVVAQG
FT                   ASAGQAAHACAGHFEELRAMLRSAPAAFV"
FT   CDS_pept        19463..20233
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632893"
FT                   /orf_name="MICPUN_61026"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65388.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199ADE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED70"
FT                   /transl_table=1
FT                   /translation="MPALDRPRREKKNGNSSKFSPDPPRKSKKKKAVPKQVTARKPRVS
FT                   TNAAHLRRRSARPVSVNPSDHSEDPLWYLADLAAEIPGGVGSPPNRGGNLQTRENVDGR
FT                   DVGERVRLTREAIALEVSRLDDLRRARLGLRDLRERRLSLVAGEGVRAEELLAAIARLE
FT                   EAWRAFLARNEVRWSDQLRRDGESQVEARRRQRATEARVARLEGLAKSLARERADAAHA
FT                   SPVTPATGTRATNPIATFEGRECAPFSRTPPWKG"
FT   CDS_pept        complement(20329..20568)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632894"
FT                   /orf_name="MICPUN_61027"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65702.1"
FT                   /db_xref="UniParc:UPI000199ADE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED71"
FT                   /transl_table=1
FT                   /translation="METCNKEDKIQKKADKMFFDRDKIRWVSWDSGIDSVKAVAGEEAL
FT                   NRTLTKKKESDPDERTPVKIHYPTTKSRVFCTVD"
FT   CDS_pept        20974..22050
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632895"
FT                   /orf_name="MICPUN_108839"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO65389.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199ADE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED72"
FT                   /transl_table=1
FT                   /translation="MPRPEPTPHRRQTRARQFAAEDVVRRDQRDRARIDFDRRYEVDDG
FT                   DSEVRNRPVLTQAQLPAAVAVASMLYAQGKSDDARKVLRQILALDPHDAVALELLKRVA
FT                   HSAASAVKAADAMAANMEAAGEAARRRDEARIGEMARANDENDAPEAIPMRTGKKVFPE
FT                   RAPRRLPLWLDEDDVDEDTRDSKDLDDALAMARTALDPALFARGFSWSDRERPMFHDKE
FT                   TEDDIRKGKKRGVVAPKVTTAELDAHLEAKLAREAAQKKADWELEVSEAQKAMANMRAE
FT                   EDAEKDARRAKVIAMRKGLDEGLALARARHAEEHAHRVKESVEASSGNDGGGGEVARTG
FT                   KKLLRPRKREPAPWAMRR"
FT   CDS_pept        join(22683..22742,22883..23869)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632896"
FT                   /orf_name="MICPUN_61029"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65390.1"
FT                   /db_xref="UniParc:UPI000199ADE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED73"
FT                   /transl_table=1
FT                   /translation="MAAIIGQSAFVRVAPKAVAKAQRVNTKRAVVCSAVNDERDASKAA
FT                   AVAAAAAVALSTASPALAISARLEGTETARLIEEAQVSKKKPAAAPAKAAVKTAPVPKT
FT                   AAPGAQYPKPGNAKAENADLRLPEVKLAVPEPTKAAKPAPVTKATVKAPKPAVGKPSAP
FT                   VIPKKATAPKPAAVKPAAPEKAVVKTAPVPKTSAPRIDAKQAKANLAELKVEAPTATKG
FT                   GKGMQLAKEAPKTRLEKYAAAGGIGGAGLAGLLGAGKAAGKAAAAKGAAGKAAAAATQA
FT                   DALEAAAVLVAGGAVGQTGTSIITKNSRIRKIRITPKGELPLPLQTAAALAVPASFLFT
FT                   LVTILASL"
FT   CDS_pept        complement(23966..25660)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632897"
FT                   /orf_name="MICPUN_61030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65703.1"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniParc:UPI000199ADE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED74"
FT                   /transl_table=1
FT                   /translation="MTSATDKAPAPSHNAGGVEVDRDELERSVRAMLEALGEDVHREGL
FT                   ADTPKRVAKAMAFAVRGYGMSAIDAVGSALFHEPGLESDEANAAIEAERAATGAERSGG
FT                   AVDDHLLARPGVVLIRDVPFFSTAEDSLLPFYGRAHVGYVPSRGQIVGLSKVARLAEVF
FT                   ARRLQNPNRLAADIATALHEGAAPRGVHVVLEAAQMGPFGPIPVSGEAATGCFATGGRG
FT                   NDADGYGAEFRAMLGAGVGAGPGPGVGLGEFGNGSGGRWTTHGADAVCRRCVCGSVSPT
FT                   NGIDDDRVGSSPGTAVTTYNTYNTVTDAEAASTSTALHECPSGGGGGRDSPTDSSHNFA
FT                   VPSEVSVSLDARPATPFEAALGTPSPPPAPQAVAEAVEGMMRALGLGAKMDADRLSLTA
FT                   RRYADLMAASREGHAAADAEPATALGGKKRKMVDGSDGSGETELVRDLELATLCEHHLL
FT                   PFHGAVHVATTGSRKDVSRAMLQKIVTMHGRRLQVQERLTRDIARDVAAATGASGVMVA
FT                   CRAAHLCMIARGVEKPGSTTCTSACLGEFASDPTRRSRFWRALEGGK"
FT   CDS_pept        25987..28176
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632898"
FT                   /orf_name="MICPUN_61031"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65391.1"
FT                   /db_xref="UniParc:UPI000199ADE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED75"
FT                   /transl_table=1
FT                   /translation="MAVSDPPSRPASSVATGKSSPVAGGDVEGDMLGGSTTVDDSSEFA
FT                   LGSSDVVDASVSLEGDVERTPPRHERGPSLVHDIVTSAIDKAEESAEAWEAVDAAMERA
FT                   TEGISKSGSMAGSRPPTAGSQGTQVHNLVEDAIHNVEQQAEQSEIIHTLVDGVVQNVID
FT                   SAEKNPDDRPPSVVAHDVSTASNTQEFDESNEYSADFESADPTDPSSGDIARSLMPSSK
FT                   LSSMQDMEAAADVSEMSPKAVGGATGDLFAATRKTTAEPQPDPDPEPEPELEPEPEPES
FT                   LSLMPSSKLSSMQDMEAAADVSEMSPKAVGGATGDLFAATRKTTAEPQPDPEPEPELES
FT                   GPVEAKESSSMADPEYSADFEDAPAEYSDTFEDPETLSKSKLSAGGSPKPSPPRDPAPP
FT                   AAKAKARRPARKYTLPPVKPSMQRSQLGKMVESEKKSGPSFGFGTATRFDFQKKTPEES
FT                   LALNASLRRNRSRLGDTGPKYEVPGPGYYKAANSVGRQGYSERRTMPSGCFGRASRDAA
FT                   GKAEDRQKIAPAPVAYTLPDSVGRQPHSMKETLPSISFTKSKRRVGAAALRYDETISPG
FT                   PVYQAASGIGRQALSGKYSANPIRFPKELRSTDRTKKNPDEVRWASVPGPGAYALPKSV
FT                   GRQAESHRGTLPAVSFGTCYREQAAKASLGKLQAKAILGGALGPGPAARTLPSGVGMQR
FT                   LSGNVTLPTIGFTKGERWQTRRSKLDVPGPGAYRV"
FT   CDS_pept        join(complement(29226..29243),complement(28899..29036),
FT                   complement(28359..28610))
FT                   /codon_start=1
FT                   /gene_family="HOG000210138" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632899"
FT                   /orf_name="MICPUN_107054"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65704.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG378807"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI000199ADE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED76"
FT                   /transl_table=1
FT                   /translation="MVKFLKANKVVVLLQGRYAGKKAVIVKNYDEGTSSRPYGHALVCG
FT                   LATYPRKVTKKMDKKKQDKHSRVKTFIKTVNYNHLMPTRYTLDVDLKATVTPDALENAT
FT                   KKVAARKEAKKILEERFKTGKSRWFFTRLAF"
FT   CDS_pept        29412..31976
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632900"
FT                   /orf_name="MICPUN_61033"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65392.1"
FT                   /db_xref="UniParc:UPI000199ADE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED77"
FT                   /transl_table=1
FT                   /translation="MSLRTAACTRGPRSVARSIASSARGARRRPSTVGRIRGSTGYTVD
FT                   EGARAMENSRGRSAGRAGTSGHGSAERPDVAFRRSTLSEDVRDMLWVPPEAEDPSFGRD
FT                   DPDEGWSFDPASGLMDPRASPPATADCDDRTAARVLRGLARASLKRIRAGDMTVRDDGA
FT                   AHANLLSTLMEDIRRGGMGTDGPTSTYHALALSLAAVERRCVDLYVSAGGTSRGTSPML
FT                   SEVLASEEFSKAVGEAGDVAGGIGLLASALPWALRRALHPRCMNLRNVVWHGHIAPPDA
FT                   QPELAALALALAASVPAPTGDGREGASGSGSEVGTSGWEVGTGRTLARHDAELVDHVPE
FT                   RLARDGWWRSPRAADEVAEIVASSTFMPDGWRDAASHAARDLIERGDDARFVAVACPAL
FT                   ESALREMFAAVNDAPEALVARLGEYYATMDGFGQSRVHDVILHPWRAPIEPARPDARRP
FT                   NALPSKLPPGARNALEDLFMRDRGPALRAAYAHGSVSLDPRAGDGARGGDGARGGDGAC
FT                   VRLLLLIVLDMCVAGETLEDFDGRSDGDGFDSSTDAIGSGPTSFARPTLAGYDARFHPS
FT                   VRFRASLESAFRSMRPIAGPSPRFTCTFTADGGDGDGRGGEALVLVFDSEAGGEDGKPN
FT                   ARAGFTEKTDKLGNDSETRETALREIVNGFLDVGDAPDGSSAALARWVLGDEKVVAAAV
FT                   TSCPPPAGPFAGAEALRAAADEVASASTAYASWIERLVGAAERREARSNQRRQLVSLLS
FT                   HQKSVALGLCALLLAAERMERVAGGCASDEAEIGASTTKLLSQAASVRAACEAGQGADA
FT                   ARAAVGAWQTKAGRALLETCVRAQQAKRFSMSQDQWRSRIVE"
FT   CDS_pept        complement(32196..33620)
FT                   /codon_start=1
FT                   /gene_family="HOG000264837" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632901"
FT                   /orf_name="MICPUN_84886"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65705.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG561884"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000199ADE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED78"
FT                   /transl_table=1
FT                   /translation="MSAFCAPHQALTARVTVRVTAASSRVRSRVALRSKPVLTTRAAIS
FT                   PPITDDAEPPKSKPKTEAVRVGGANPLSAAIAVPTNDKPKGEPVRIKIDDQWYDARGWA
FT                   KAHPGGERWIWFFDGRDATDAFYALHSYGPNGSSKALDRLKKLPKCDPPPESEYKAPSP
FT                   SEYAASMSFRELRAKLENDGFFKRNVFKEAWAFVQVAGLYAAGQFFAYSNPWLATVLLG
FT                   LGMVQAGWLGHDYVHGRGPLCDALRYMPTLLNGHSVEWWSQKHSMHHTFTNEEHLDNDV
FT                   MMEPFFFLRPPSESGRPDSAMRKYQHIYGYPLLSIMFWLWRFHSAESAWKRKDKKELVL
FT                   LGINYFWLATCMPWQVAIGSVFLSGFIVASLVSATHQSEEIMEYGEGAEYVEGQFRSTR
FT                   DADTVFGPLETWIWGGMDTQLEHHLFPTMPRYNYHKLRPLLQAWAKANDINYRISPSTK
FT                   IIADNFALLKRVAAAP"
FT   CDS_pept        34489..35181
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632902"
FT                   /orf_name="MICPUN_61035"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65393.1"
FT                   /db_xref="UniParc:UPI000199AEA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED79"
FT                   /transl_table=1
FT                   /translation="MGRSESFMRTPGHTGVVTYRSDVIAFGTAKVSEAATTARRDVRAT
FT                   YKGPDPLGLRGSKWNKSVTPDYGTYNRHLQQHTTRNLLDTAVGTVAPCASQRRDLDDAL
FT                   LKTGYSTSIAFAKVSTSGSWEPSTKATAKEMGESLRRTGLAARANSEEANREMTRRKEY
FT                   KTPWKIEEERMAAMREAKRKGHWPKPPPPIELAPGTRRAKTRRADLQAVLELDDFVPPP
FT                   SRAPTPDW"
FT   CDS_pept        join(35358..35621,35701..36120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632903"
FT                   /orf_name="MICPUN_61036"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65394.1"
FT                   /db_xref="UniParc:UPI000199AEA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED80"
FT                   /transl_table=1
FT                   /translation="MDPETQYPVDAVTTEAMKTSKPVGMDMSLDDIVKQHRNANKKRGD
FT                   GKLSKGGSLKVKAGVNKGGPGRSMSGTFGGRGSGPMYQKLYVHHPKAYKREDGMTVVHI
FT                   FKINKDIVQVSREGEVLLDTGGDRGRGVRRAMNNALRKFGFRVTFSADDPEEWTVSDGV
FT                   RYLQRYEDGMVIPRPNPPGPGRALALLQADPPPFAYAGFRSGFPRRSARGFGTRGMGRS
FT                   RRGLC"
FT   CDS_pept        complement(36178..36621)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632904"
FT                   /orf_name="MICPUN_61037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65706.1"
FT                   /db_xref="UniParc:UPI000199AEA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED81"
FT                   /transl_table=1
FT                   /translation="MYIECCQPYPALHCSRRGLGAGMTSRAAAQALRQLSSVTCRPPSI
FT                   RAAVTGLAAAGRAATTRTQSSVSAQQTVRRLLQTSAEGVGGCGSGAFNGSRARTVHLVR
FT                   SLTSMTVGPSGTKKALAMAKALMHDADEERGLLDGCVEDIDDT"
FT   CDS_pept        36885..37952
FT                   /codon_start=1
FT                   /gene_family="HOG000224153" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632905"
FT                   /orf_name="MICPUN_61038"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65395.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG330815"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR019483"
FT                   /db_xref="UniParc:UPI000199AEA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED82"
FT                   /transl_table=1
FT                   /translation="MLWVDKYRPHTLDQMTTVNTDIAQHLKRLVQDGDCPHLLFYGVGG
FT                   AGKKTLALAVLREIFGAAVEKVKVEGKTWKLEQGERKIEVELTTMSSNYHVEMNPSDVG
FT                   TKDRYVVQEVIKDMAKSRPIDAAGQQGYKVLLLNEVDRLSKEAQHGLRRTMEKYSSACR
FT                   LILICTSVSKVLDAVRSRCLPVRVAAPSVETVEKLVMDVAQKEKLVMPPELAARLALHS
FT                   ERNMRRCLLSMEACRVQQYPFKADQPVQLCDWEAYVTQIANEILQEQTPKRLLQVRGRF
FT                   YELIVNCIPPELIIKRLVRELNRKLDVELKHETARHAAYFEHRMNEGSKAIIHMEAFVA
FT                   NFMAVYKKYLISSFG"
FT   CDS_pept        38099..38980
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632906"
FT                   /orf_name="MICPUN_61039"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65396.1"
FT                   /db_xref="HOGENOM:HBG607686"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AEA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED83"
FT                   /transl_table=1
FT                   /translation="MGDEVDLHGAARTGDVDALGKCIAAGADVNGRDKHKRTALHLAAY
FT                   AGQLEAVRFLIASGAKTAVEAMDGIAPLHFACQKGHWEVARELINLGANQKALNYKGEN
FT                   ALHFAAQSGNQRLVEMLLRKQVNPCHRSKRGKLPSECAKDDIVRAILEAAAAAKEAHIA
FT                   STQAGIAEAKAAQGEGEENDDEGGGEIGPAIGPPTRPDTGPSIGPPARPTAYTEPSAGP
FT                   STGPRSVAPEDAPAVGPVIGPPARPAGIREKREIAEVEDAPGDALAAASAGGPSKKAKQ
FT                   AKTPVLSFGDDD"
FT   CDS_pept        join(complement(40428..40523),complement(40204..40277),
FT                   complement(39083..40085))
FT                   /codon_start=1
FT                   /gene_family="HOG000168008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632907"
FT                   /orf_name="MICPUN_61040"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO65707.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AEA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED84"
FT                   /transl_table=1
FT                   /translation="MLSSTRQLQRAVPRGFPAVAVETLRETLASQQVFSRDASSLPVTY
FT                   TGRGTGGRSSISGITSTVFGSSGFLGRYVVNHIGKSGSKMILPNRCNENARQHLKVMGD
FT                   LGQIVHLDFSIRDADAIKYAVERSNVVVNMVGREWETRNFSFEDVHVEFPAKLAEICKE
FT                   VGVERLVHVSALGASHTNPSKYYQTKAAGDDAVRAAFPNATIVKPAKLIGTEDRLLNVF
FT                   AEHTCKFPLAPLVDDGESKHQPVYVDDVALAIQAIVEDEETAGQTFELAGDKVYTMEDM
FT                   LRFVQKTIRTPGYPKILYVPSFILRALGAPHEFLLRKVPFPLPTPTGLTKSYIDAQSVN
FT                   YLKNPRVPGFEQLGIKPAKLEGVVIDYLRAFRFGGYDAGDVAGHLQRQKS"
FT   CDS_pept        complement(40676..44749)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632908"
FT                   /orf_name="MICPUN_61041"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65708.1"
FT                   /db_xref="UniParc:UPI000199AEA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED85"
FT                   /transl_table=1
FT                   /translation="MRSKEVDEALSLAIQAAEALGAGELTGKDAHQLSRVCFLSDPTSC
FT                   HDPTLTPLSRPFHPLNTGEELGWLDSVRDAVTTNLRPADTAPTSPRSARSPRKVGTVPW
FT                   DGGAIVRELVRHVTRTRLAMPRPGHDPKSTAPEPFPVLPLGSTLCSVAELRAMGPCASD
FT                   LTRLWARSRRSDSDDEEDEDEDAPELNDASTAPVVPVAVVGRLTLAPALPVNAPGHEYE
FT                   TIDPAIDAAGLALADATGSVAVVTSASLPDARWIGKAVLATGWTRPGLGRSDIEGLGFS
FT                   GDCAGFSGGSGGSVVLEVTSFACLEEDGVGGHRPPAMPSVVDAAVAPPRKKKGAPTVTG
FT                   AVVAVSPVITLRDRAQRFFMAELGACPRCGAGDERGLLFNGETLCRWRPFLGAAMGGEF
FT                   DASDGYAANQCGCVTVADTREMSMFKGDGDGKEIRLLAATAATTVVPNPAGPARLFRSV
FT                   AGTGRSSTRSNVECGCASCARGATLGRLEASVVGPDPNGAGVVLVRPVGTRGRGIPFVP
FT                   DLGVMSTGSVVPSLRAGATVALTHAHPVWKRATGDEDDDDDLDGDGWGLRAVGACVRTR
FT                   VRTVTPSPSCAPAPTLTTSTEGGKGDGCVEVFTKRDVARACERGGIPAAVRLRDMAAAL
FT                   GRKFDCADPGQRRNANRLLVGKRKRSSVGGVGDDDASATGFDLDGALRRLGGEETAPDS
FT                   SSNRRGQSIYHEFFTPVGLGGDERPVPAVPTLRSIVDAGVGSFADAVRAEVTAAETAGR
FT                   RSSKSAAAALPFGNNAGAVLVDRVVVSSREFGGPTPCLLLGWLKEYKTGEGAREKRRYA
FT                   LTDHTHEIDVCLAGDRVLPPLPCMMACTRWSLACEGAKESVAVEGYSNARDAESLPPRL
FT                   AAPRCHLRFAASDVACAEDAFNDENAPPAARPEPNEIKSLSDVLVWVRGTSDGWHKGAG
FT                   PPPMGGAYADPEERAARVNPAYRPLTQAQWPPRASGAPPFRALVVGDAYQRDTWGRGAQ
FT                   RVLKLRDVDTGDRCDGYTDRTEDLPSGVGVGAVLVLENAKRGVSNTMQCYVKFTPGTRV
FT                   TVEVPGHATLGPSRVPIPAPLRSRTVRLADIAAAAAAGAGAVDNRLWQFRARVVSVNTL
FT                   AVRWGCKFCGSDAGSMGAASAELAETSMRTHRRARAGVDDVEGIGAVLAGCGECRPRSA
FT                   SAAARAAAAERSCGFEVECNATLDDGTYHCDLWINGTAGEALLPPGLKSKAVALARRHG
FT                   CVRATLAASSRDVGDDGPRFFSHDLRGYAGLPMSKVEGAPLVAAVGHAKSLGEMIVAAN
FT                   LSYKRWTEDKSATDFFGARSHPGPNACPVVLNGKPCVMSYAPIPKLRAVAVTPVECARE
FT                   AAAALDALERRRRR"
FT   CDS_pept        45098..45967
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632909"
FT                   /orf_name="MICPUN_61042"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO65397.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG562656"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199AEAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED86"
FT                   /transl_table=1
FT                   /translation="MSRGIGAGALVRQMNVSSLGFVGGLLYAIRRAGRSPPEPPDYLKC
FT                   PVTQELFTDPVILSQTGYTYDRPAIDRWLRQKFPPTDPSSNVELWTTETVPNWALRDAV
FT                   NEWCAANGTRQLDAPTHSKRHVAGGRNARDAKPPRDGSSGPYGRRPGGTGWLLSALRGE
FT                   LAAQVAHDFARWAMNGVGMPAPAAAHLFAFGVLAGCCVAMTALLVTCEWALRVTGASAR
FT                   DLQLDASFAHLAGPLSSLVWWAGIFSVVYLAQGGFVDPIRADMERRRRHRHHHRHHPRL
FT                   GPSLIHRF"
FT   CDS_pept        46167..48089
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632910"
FT                   /orf_name="MICPUN_61043"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65398.1"
FT                   /db_xref="HOGENOM:HBG609500"
FT                   /db_xref="UniParc:UPI000199AEAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED87"
FT                   /transl_table=1
FT                   /translation="MAARVAAVAGMTASVSSIARVRVAGPRAIVPARVDVGTTASLGSS
FT                   TRGERSGREGAVRLASLTSPSSSRARLRVVPVVPRAAADNAPTGEDAAAAGDAKDGDDA
FT                   SGPDVQPWFRFLTRTTIIAAGLVVFGSMAAPWPAGGQVPFMTTLMKRLGAIWVARQLAK
FT                   AILKPLVIWAHRLGRLLAPAAATVGRACVNAKAKYDANPKGIILIPFVAAFVGWFTNWL
FT                   AVKMIFYPIGFLGLPFLKQAVEGEMYGFDILNPLALGWQGIVPAKAARMSYDMVSMVTD
FT                   KLIDVQEVFMKLDPRRISELLAPEVPEMARRVARDMTKDVPMGPWAVDLGERALPSSCG
FT                   PLVDGIQDAIVRYLAGFVRTLQEQVDRVVDLKELVVTAMCEDKRVIVELFQRCGREELK
FT                   FLTNSGLWFGFLLGCIQALCWLFYDNPWTLTIGGTIVGLLTNWIALKCIFEPVEPVYLF
FT                   DGKLKIQGLFLQRQLEVSGEFSDHLATKVLTSEMVWDNMLKNRKGPEFEAMLDEFTRDF
FT                   VRNEAESQGRGLLAGGVEETALLDEVVSKVKERLIDHVHVLHEYTDDTLGLKELMREKM
FT                   ALMTPQEFERVLHPIFEQDELTLIISGAVLGAIAGFIQQVYTIATDDGSVGPEEKEGGG
FT                   ASPAK"
FT   CDS_pept        complement(48116..50356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632911"
FT                   /orf_name="MICPUN_102102"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65709.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniParc:UPI000199AEAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED88"
FT                   /transl_table=1
FT                   /translation="MMLTVTLGRGSLPPRVEDRRVRRGTHGRGATISLVRAGAQPDEYE
FT                   KSNLSAVIVGGGIGGLAAAVALRRIGVDAHVYERASAMRGNAGTGIAIWPNGIKALRFL
FT                   GDDVASEVASRGCEITGMRMGMIDEPSARSGEPSSDDGGIGGALKKAATRLVGGAFPAI
FT                   IRAQHGAGLICIRWAEAQAALASFLPAHCVHLDASLDGIELVEYADGTAKARCTFVKRD
FT                   GTPHSDPVTADFVVGADGINSAVRAALIDDGAPRDNGRVIWRGVVDAQRVAKAYARAAT
FT                   GGTIGGGGGDDDGFPPFCPRGATALSASKDSSVGRTVCFMDVGGDKLYWAAGCLDGGIV
FT                   KGTDDAESCAATFKNYPDVMACLEATKEEAEVGGAGAGGNFYTSRVLDRGPLFPGDAER
FT                   FMAPAGPVTLLGDAAHPVIPSFGQGANLALEDAAELAIAMAGKGKTQSVASVLRTWERS
FT                   RLERTAQAQIASFISGSKSYGEAKFAEAMRLSGISPDALARHKERFRDANSTQQWLIGW
FT                   TPSAGTAARVKDLDPKAALRLAIRAANEAPSRRSALIAATAAGLASAFGALSSAEASDE
FT                   TVDTGDRYAGDGFSMLLPKGWTVTEAMGVSRSTVDVFAPGRTEPVATMIREPTFTMGGG
FT                   GAGGAGSVYTSPENFGLYIAGTRRGSLRTSREVGGAVGGAFVAEGVGEDDKSPWVELIA
FT                   IGCRGGEAAKKYNLLQTVRLTASFAGGADVEAIEGVRAIVNSFELSAGTTCA"
FT   CDS_pept        join(53034..53284,53570..53975,54402..54751,54809..55232)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632912"
FT                   /orf_name="MICPUN_84731"
FT                   /product="RNA helicase"
FT                   /function="helicase activity"
FT                   /protein_id="ACO65399.1"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="HOGENOM:HBG562678"
FT                   /db_xref="UniParc:UPI000199AEAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED89"
FT                   /transl_table=1
FT                   /translation="MLDALNPEQRKVVTDVLDGTAAAVASRRARIGPPYCVLGPPGTGK
FT                   TLTVVSAAAAVLESDPNARILLCAPAAFAADVLCSRLADASLLHADQTANSRCFTHIFI
FT                   DEAGQATVPESLVPLRLVTLNCKAVVLAGDPMQLGPVVHSGVAARGSADGILRSGLMTS
FT                   LLEQAAAHHAHPQARATVQARCMRLVRNYRSHKDIIDLPSKLFYRNSLVACVDDSANSK
FT                   PPPRLARVLFYGVRGRQAREGSGEAPSFFNAVEAQELVNLVETWLSRGGGGSNDDDADD
FT                   DGLKVSDVGVVAPYRSQVIRVRNLLRARNLGAVRVGTVDDYQGQEEKVMFISTVVAGEA
FT                   SVAGLALGFLACPRRFNVAISRARALNVVVGHPVALTHWPHWHSLLQHCYSRGAFLGSG
FT                   SEFIPRLGGGRENVDPALDSVVGDVEPDDEADFEELKRAVDRMAEMSLLGGGDDMWPDD
FT                   GDMMASAFQEDREWRVAL"
FT   CDS_pept        complement(55463..57001)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632913"
FT                   /orf_name="MICPUN_105993"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65710.1"
FT                   /db_xref="UniParc:UPI000199AEAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED90"
FT                   /transl_table=1
FT                   /translation="MAPTSPRAKKGGVAAPAGYGSIPSGPNAQADELGDGSFQQYLETF
FT                   GMKMESDPYRLDIAKFILVSLIVAGNFVHPFAQLGNKVACVLENFVSIINVPAYVLLTG
FT                   YMSATTNKTRRRYIIAHLLIPYLIVQSIYLALYIGLYWNNSFRSHPNGVDRKPGMFTDN
FT                   WTPQPHFNGLSMMTPVMDNWYLLALVGWTMWRPYATELRRTVIVHVVFGCLIGFSPLER
FT                   FMSIHRTIAMMPYFLFGHMLRRNKVFIPPAATNAMKAAAAFVLCVIFAGCVTAVYAFGW
FT                   RSNGVWEQQISYHVTWETKFRWGPLIQLFAYLTTTITSVAFFALIPPASKAGVRDLSSS
FT                   EGHKGEYQNIKEKDVVQIGGSKYTVGSPDDVEEELGAAGDPLLVRGRRKYDAAERDQIK
FT                   PDELGGGKNWSAIYYLRVSKWGSRSLCPLIFNFLFMILLEVCTYYNDTWTRGNNSTWVT
FT                   VHCVISLFLGFAVATALSTRPACMFFGWILCPPINNDWIFEDVDVATLEDPGTE"
FT   CDS_pept        join(57515..57554,57729..60328)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632914"
FT                   /orf_name="MICPUN_61047"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65400.1"
FT                   /db_xref="UniParc:UPI000199AF60"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED91"
FT                   /transl_table=1
FT                   /translation="MFGAPATPATPAFGGFGAPASPAPAAGGGLFGAPASPAPAAGGGL
FT                   FGAPASPTPAGGGLFGAPAASTPASGGGLFGAPAASTPTAGGGGLFGASVPASTPAAGG
FT                   GLFGASQPAAGGGLFGASQPAAGGGLFGASQPAAGGGLFGASAPAAGGGLFGASAPAAG
FT                   GGLFGASAPAAGGGLFGSAAPSTGGGLFGASSAPSTGGGLFGAASAPGLSTGGGLFGAS
FT                   SQPAGAAATGGGLFGGTAPALGGGGLFSGQPGNALALAQPQASFLSTTNGQPVRHYTQW
FT                   GELTPQSQQQLKQLEAMIIAAREDSKLLDGVERLAEYQPPKKGSSAVGNKKGEVARPSP
FT                   GANGKLTKGEIQRRDLERAAKATANRLKLLETQLWSDNDRLTGLTEAVVECLRDTEHAQ
FT                   ARLQRLKDAHAADDLARSHALAHPNQPPPPAAAPVYLPAPRRPSPYLEKTVERLYATAE
FT                   GFERGTLEMEHNLRTTGRVLGAGGGGAGHGLEALTAALHGHASSFPAIGSGGGGEDGLE
FT                   KFDGGVAALKALRASRTGGPAEHRSAVEAARRYFNKVGGDLAKLHERVSRAKAAHLAKL
FT                   REKGDHRDPFAEAEKEEEEARRLAELAERPEAAMALPAPGAPGQPLALPAPATGGGLSL
FT                   TTPGGTSLFGAPAAGGGLFGGASASATGGGLFGASQPATGGGLFGGASQPATGGGLFGG
FT                   ASQPATGGGLFGGASQPATGGGLFGAASTPATGGGLLGGAASTPAAGGGLFGAPQPAAA
FT                   GGLFGAPQPAAGGGLFGAPASTPAGGGGLFGAPAASTPAAGGGGLFGASVPASTPAAGG
FT                   SGLFGSPAPATPSFGAAATPSFGGAAPAAAGGGGLFGSPAPAAGGFGAGAFGSPAPGGT
FT                   VRRSARRR"
FT   CDS_pept        complement(60422..61660)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632915"
FT                   /orf_name="MICPUN_108845"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="calcium ion binding"
FT                   /function="potassium channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65711.1"
FT                   /db_xref="GO:0005267"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AF61"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED92"
FT                   /transl_table=1
FT                   /translation="MGQNGHHGHQNGHSNGAIREPLAGQDGRSHGASHAPRHSSYPRKS
FT                   RERGDGVAKRSDRAEVLDEEDRDFMRKISSLKKITIRLGSALGLVVAIASFYGAVISGF
FT                   EGWKFEKALFLAFTVLSTIGYGNYAPDSEGARVFLAIFTLPGVVIFAYALAQLALVIIG
FT                   IIKSLRRWLGLVQEVKPPHIGSRAKVLADTLRECDKDGDGTITLEEIESSTGKICAMLG
FT                   MDVSKQTFKAQEEARAFIENAFNEADFDGSGDLDMLEAMCMLCDLVKMREIQQKEQNQR
FT                   DQIKGAIYSLIPLIVIGALVFWSSQESWSALDAFYFTIISVSTVGLGDLTPSEGGVKVF
FT                   WYVFMTLTLGLMASIIQTLGSLLGSISARENIAGNSGDGKRDNDASVRSGRRSREEVRV
FT                   DMEGDTPEYILRL"
FT   CDS_pept        62311..63912
FT                   /codon_start=1
FT                   /gene_family="HOG000100078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632916"
FT                   /orf_name="MICPUN_61049"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO65401.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG561518"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199AF62"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED93"
FT                   /transl_table=1
FT                   /translation="MSSKEDLESEVQRLLAMNTKTVDSKTESVKSPLKKENKKKGKSGA
FT                   GDEKTPLLNDGGEKKGWGISCGNPFTGCFSACSGCVSSIQAVLGVYGSWIAGVVLVVLA
FT                   VYLCLTFLIVPSGGGSTKVKLAFEKDPATQWAAMASAAYRPIDSIADWTCEPCQSADVK
FT                   PRDVITQTIPEADGLFYTSVVKTDSHPKGVLVLVLRGTMLESAATWTSDLDFFYTKTKG
FT                   IGENTDGKFGHKASVSWLPKELDVHPGFFKLYEMYQKKVIRLMAESTFILKNQEFPVIV
FT                   VGHSLGGALATYAAYDLYASGFNVQEVWTFGSPRVGSEEFASAYANVLGHRTWRVVNNN
FT                   DKIPHVPHYPMYHHVPAELWCKSDNGSCNKYEHGDGTGEDWSLSGHYHFAGMPIKSLVD
FT                   HNRAMGIPFDGAPKFQEDALLTTFKSGAFTASFDIIAGPFPDECAARDDKDKCEKAKKE
FT                   FTDTKQRAIDWATTNEQNALKKIMYVAPPHPPPPSPPSPPPGQLTFDGVKPGFEPELED
FT                   AVNKFGDDIQGAERRR"
FT   CDS_pept        join(complement(64659..65326),complement(64042..64501))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632917"
FT                   /orf_name="MICPUN_61050"
FT                   /product="Predicted protein"
FT                   /function="glutathione gamma-glutamylcysteinyltransferase
FT                   activity"
FT                   /function="metal ion binding"
FT                   /biological_process="phytochelatin biosynthetic process "
FT                   /biological_process="response to metal ion"
FT                   /protein_id="ACO65712.1"
FT                   /db_xref="GO:0010038"
FT                   /db_xref="GO:0016756"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0046938"
FT                   /db_xref="HOGENOM:HBG433213"
FT                   /db_xref="InterPro:IPR007719"
FT                   /db_xref="UniParc:UPI000199AF63"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED94"
FT                   /transl_table=1
FT                   /translation="MARLRLVALVATLLAACIPCEGDTADRRTLLPVPTDDIPLNSTEG
FT                   ERLLRDCTHYPGVDVLMHLATQRNQAFCSAATAATLLNAMARTVTAPVDVEFAPYPYFT
FT                   QRSILQDACVRRVPTHEDGTLMSVKFLATHGATLHEWATYLSCFAEVEHVHAEVSTAAA
FT                   FRDVVKAVFPTTRGAKAEKFVGINFLRTGVGEDGGGHMSPIAAYDETADRVLIADVSRY
FT                   KYPPVWARLTSVYGAMNTTDDASGKSRGWVVLGPGAGTDEKSPPPPPPSEPFEADEYVA
FT                   SRARCMDAVADDDDWDAVMRCTEWPNVFPAGNAHGNGSCDGSRRGAAAAETAAAAFASA
FT                   AIGAGVVGGWWWREERRRASGFRRHVVLGSEFEDA"
FT   CDS_pept        65541..66767
FT                   /codon_start=1
FT                   /gene_family="HOG000168000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632918"
FT                   /orf_name="MICPUN_84789"
FT                   /product="Predicted protein"
FT                   /function="coenzyme binding"
FT                   /function="racemase and epimerase activity, acting on
FT                   carbohydrates and derivatives"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO65402.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016857"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AF64"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED95"
FT                   /transl_table=1
FT                   /translation="MESLGACAAISLFVYALVRFGVGAGDVGGASGVGGPGAAVSTFVP
FT                   AKIDVAKVQRSCASRTDGAGAVLVTGSAGFVGFHTALALKDRGWGVLGLDNVNDYYPTS
FT                   LKRARMKELEKAGVHTVEADLNDRGVVRDALDACKFTHILHLAAQAGVRYAVKNPGSYV
FT                   HSNVAGMVNIMEEIIRTSPMPKVVFASSSSVYGLNTEVPFKESDVTDSPASLYAATKKA
FT                   DELLAHTYNHIHGVAITALRFFTVYGPYGRPDMAYFSFANNIVRGKPITIFKGENDAEL
FT                   ARDFTYIDDVVQGVIASLETSEASGKKPDGSKPPFRVYNLGNKHPVTVSDFVTTLEKHM
FT                   GKKAKREYVPMPKTGDVPFTHADVSRAARDLGYSPRTNLDDGLKKFVDWYKEFCKGAAC
FT                   AGIQSYVPA"
FT   CDS_pept        join(complement(80987..81022),complement(80664..80713),
FT                   complement(66973..80500))
FT                   /codon_start=1
FT                   /gene_family="HOG000257779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632919"
FT                   /orf_name="MICPUN_61052"
FT                   /product="Dynein gamma chain, flagellar outer arm "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO65713.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniParc:UPI000199D585"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED96"
FT                   /transl_table=1
FT                   /translation="MGDARTVYIAGKVAECFDISKDDATRGMSWYHDQILAFYKPDGPP
FT                   KLLFYYQIPEEKNIDGDFIPKAGEPPKLIVTDGDVETLRDKALYLVRTNPKGVSDKSPE
FT                   NDIYSGEIRGSVLDTLASLVANLYAPVLKAQKEWGKTTRESAYDCVIGVQRFGDTLTSA
FT                   AHSLQGGVELIGPDQKYVDSIDLKPQAFSDAAADQETARHFEEILTDWCDKTEALLDAS
FT                   EDAYAMSAKEDAGPDTEVEYWRGRMAKFNSITEQLKGKECRLVLGVSMAGRSQAHKRWK
FT                   AVDMRVTDASNESKDNVKYLTTLENSMTPLYEGDPRQILDGIPGLMNNVKMMHTIARYY
FT                   STSERMTTLFKKISNQMIVNMREYITAPGNLWTQDREEMLGRLELCNKVKVRYFEEYMV
FT                   TKDRLEQNPKGRQFDFDEDQIFAKINLFGKRVSKLLDMFTTIKQFTTLNEKNSIDGLVG
FT                   PIKAFFKVVEEFKRKPYDLMDFAKNQFDRDYLEFNVSVHELETKLQDFVNASFREITST
FT                   EQALNLLRQFQSILQRDSLRQDLEDKWMVIFQNYSLDLDAVQKIYEKHKHGPALPRNAP
FT                   PVAGDIMWARQLLRRIEEPMRKFATNEAIMRSKESKRVVKTYNTVAKALVAFETLWLQA
FT                   WTKSIETSKAGLQATLIVRHPETGNLLVNFDREISQLMREAKYLQRMGIEVPESAKMVL
FT                   LQEEKFKRYYNQLSHALKEYDRVMSAIMPVAKPLLGPHLDDLEKKLAPGMYILTWTSMN
FT                   IDGYLMHVHKSLGRLEELIGKMNDAIDNRIEANLKLVAKTKFVDLPDDQSFTVEEFQTT
FT                   QARFIKQQTDELVVKNVEIERGVHDLCEMMRDYPRDNPEVELEDVAVDEFTHHYAKLMY
FT                   QAILTATKRGFGDMKKRLGSRSSGGFLFVERPFFDVDVELTVPTVTMNPPLDAIQAAVN
FT                   SVAKKILKVSESLHMWGQGTAHGELDVSKMSRRQSTGFIVPNENYFKWIAADKEIVKSV
FT                   LLLTGSMEGTKAQVMEYIETFTRFDFLYMDDLQAAYTAFMNTNPSLEAFENELKKYMDI
FT                   EKQIQAIAPVHNIGAMSLETQPLKNSLKAEAAAWKSQFAKNMHSQGKEQLEVLHEYMHA
FT                   TTLKLNRKAEDLEDVRVTMGVLKEIREKESELDTIMTPIEEIYALLARYEVRVPKEETE
FT                   TVSELRYGWDKMKKLAESVAENLSRLQVGFKRELIKEVKVFVVDAAEFGKDWDANGPSV
FT                   PGLDPMEAVQRLKKFQTTFAVRKRKWDNYRSGEELFGLHITPYPELEKIEKEIDMLDKL
FT                   YSLYSEVNATMDDYADVLWSDVKDQIDGMEEKMKIFQYNSKHLPKSLKDWPAFNDCKKK
FT                   IDEFLEGTLPLVRLLCSKDMRPRHWTQLQELFETTFDLGEDVFKFGTLIDLRMFKMAEE
FT                   VEDLAGGAVKEAQIEQKLEQVDEDWSEQIFEFTKYKHKGDVILQMSTTGELIEKLEDAQ
FT                   MQLGSMATNRYSAPFKSKVNDWITKLSTVSEIVEMWLIVQNMYVYMEAVFSGGDIVKQL
FT                   PAEAKRFNNIDKQFMRVVGNAGDIKNVVEVCYENDQMQQTLPYLTEQLELCQKSLTAFL
FT                   DTKRAQFPRFYFVSDPTLLEILSLGSDPPSVTPHFQSGLFDSLTEVTFDRQDKTKMLEM
FT                   FSQQKECVKFVKENDGVLDPNPVMAVGNIESWLQALVEGMQESIRSIIKMANEAVFEKE
FT                   LEEFIFGFPAQIALLGIQFLWTNDMQTALTGAKKDKTMMVKAFKKQETLLKEMIVITTR
FT                   PDLDKNDRKNLETVITVHVHQRDTSEELLKKRVKDPADFEWMKQCRFYWRNELNTVIIS
FT                   ICDVDFEYSYEYLGVKERLVITPLTDICYVTLSQALGMFLGGAPAGPAGTGKTETTKDL
FT                   GNTLGKFVVVFNCSDQMDYKGMGKIYRGLAQSGLWGCFDEFNRINLDVLSVCAQQVYCV
FT                   LQAIRERKKEFVFTDGAVVSLDPRVGFFITMNPGYAGRQELPENLKALFRGVTMMVPNR
FT                   QIIKKVKLAACGYQENEFLAKKFFVLYGLCEQQLSKQAHYDFGLRNILSVLRTMGASKR
FT                   ANPNKSEVYLAMRTLRDMNMSKFVAEDVPLFLSLIDDIFPGTKADKAVFPDIEAAMAKV
FT                   ATEKGLQLHPTWLAKCVQLYETYLVRHGIMLVGPTGGGKTAICETLAGALTEVGNKHVV
FT                   WKMNPKAITAPQMFGRLDAATGDWTEGVFAVLWRRAAKEKKNNTWIVLDGPVDAIWIEN
FT                   LNTVLDDNKVLTLANGDRVQMSGMMKAMFEPENLNNASPATVSRAGIIYVSETELGWKP
FT                   LVASWLDKRRKQESALLKPMFEKYIDPIIHFITLECKPIMGGIPWEHVSRDFCSVGSLL
FT                   TMLQACLKPTSEGDKPETLSEGHYERLFIYCVCWSLGAMLPADDRPKFNAKLCELAKGN
FT                   VPDMEPGDTLFEYYVNEDNTEWAPWVDRVPTWEYPKLEERPKFASLVIPTLDSVRLEYA
FT                   LNLVSSVDGSSLFVGGPGTAKTTTIKSFINSFDPDKMLNKPITFSSLTTPGVFQTAVEG
FT                   AVEKRQGRTFGPPTGKKLIVFVDDISMPQMNDWGDQVTNEIVRQLLEQGGMYSLDKPIG
FT                   DMKMIVDVQYLAAMNTPGGGKNDIPNRLKRHFCIFNVPLPSVAAINNIFGQLVSGRFAA
FT                   DVFSANVVAAAEKLVPITIDLWNKVQTKMLPTPAKFHYLFNMRELSKVFQGLILAERDR
FT                   FKNGVQHPPFGGNVKSPEGYLVALWRHECERVFVDKLTSYDDKNWTDSLIQKIISETFG
FT                   EKITKEVEERVYFVDFLRPPVVDEQTGDVLEANPSYYESSVDLQMVKDLADKKMAMFNE
FT                   TSKTVKLDLVLFEDALTHMMRIARLLSMDRGSALLVGVGGSGKQSLTRLAAYIVGAFTF
FT                   QITISKQYNQSALFEDLKALYKVAGLKGQKVAFIFTDAEVKEESFLEFINQILMTGEVA
FT                   GLFPKDELDMIVNDMRAVAKRECPEMPDTWENLYQLFLGRVRDNLHTCLCFSPVGDKFA
FT                   TRARNFPGLINGCTIDWFLPWPQDALIAVSTKYIGDFSMACGDEVKALLQEHMGHVHTA
FT                   VTQACKEYFEKFRRNVYVTPKSYLSFIDGYRSLYQKKLDDVNVLADKINSGLSKLFEAK
FT                   SDVKKMQVELTQKNKDLAEAQKSSEKLLKEISASTAVAEKEKAKVAVIVEGVTAKANEI
FT                   EAGKIEAEEDLKAAQPAMDAALEALNSIDQKSIQNTKALKNPPDLVKRILDAVLVLRQY
FT                   PMSKKVAWHEPKKGQVVIDASENWKNVSMAMMGDNFLNALLSFPKEQINDETCEFLDAY
FT                   LDAPDFNYEGAMKSAQAVAGLCNWCEAMKTYHFVAKVVDPKMRALREAQAVLDDANREK
FT                   QKAEDELAEVQAGLDAMQAKFDEAMAEKQRLLDDAEATQKRMDAATALITALAGEEVRW
FT                   TEQSKQFDLQIQRLTGDCAIASSFVSYLGPFNKEFRDLLMQRDFYGDLIKREIPVTENL
FT                   DVSKFLVEEAEVGEWTLQGLPTDDISVQNGIMVTRATRYPVLVDPQGQGINWLKNREQD
FT                   NQLRVTSLNDKHFRTVLDDCLSFGKPMLIENIEEELDPVLDPVLEKRFVKKGKNFIIQL
FT                   DKEVDYSPSFQLFCTTRLPNPHYSPELCAKVTVVDFTVTPVGLEDQLLAKLILKEKNEL
FT                   EVQRLGLMEEVTNYKKKIKQLEDDLLFRLSNSQGNLLDDVELIEVLNNTKITAQEVNEK
FT                   LANASETNAKITEACEEYRPVAHRATLIYFLIAEFASVNVMYQTSLKQFNELYELAIDN
FT                   AEPAQMPAKRIVNIIDHMTYSVYLYIQRGLFERHKLTFALMMTNKILISAKQLSPDNVN
FT                   VFLKGGGSLDIKSVRKKPKEWIPDKCWLDVNALQKTAAFSDILDSFDRNEPMWKKWYDL
FT                   EAPEQVNVPDFEDRITKFEKMMIVKALREDRTQVAAQAYIGDAIGQQFVESVPLNVEAT
FT                   WEETTPYRPVICLLSPGADPTKLIEELAKKKKLKLSGVSMGQGQEIIARKLIQTAVKKG
FT                   EWVILQNTHLGLGYMAEIEVYLTKAEELHEDFRLWITAEPHPQFPIGLLQMSIKLTNEA
FT                   PVGMRAGLRNSYAWVTQDMMDAVPRYEWRQLLYIMCYLHSIVQERRKFGPIGWNVPYEF
FT                   NASDLGACVQFLQNHITEMDMKKLNSPTWPTVTYMISSIQYGGRITDGFDELLMDTYAA
FT                   KYFNQGALTKGIELFPGYKVPDSTDVTDFRADIEALPLTESPEIFGLHPNADLTFRTLA
FT                   VSDMVSTIVDTMPKSGGGGGGKSPEEIVNAICADLLSKVPEPFVPEITKEMLKKLPGGP
FT                   TQPLTVHLRQEIDRLNIIIILATKTLKNLQLAIAGTIALAGDLVDALDKLFNAAIPAAW
FT                   LKKSWESATIGTWFQGLLMRHKQLDKWLREGRPKAYWLTGFFNPQGFLTAMKQEVNRQH
FT                   AKDKWALDDVVMTSQVTHPPKDVEQLKDGMSEGVYVYGLFLEGCRWDGKQNKLVDSDPK
FT                   KLFTPLPVLEVTGVLGKDKVTKGVYEAPTYRVKKRTGLNFISTFPLRTEDPPSKWVMRG
FT                   VALLCSVD"
FT   CDS_pept        83414..83920
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632920"
FT                   /orf_name="MICPUN_108847"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65403.1"
FT                   /db_xref="UniParc:UPI000199AF65"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED97"
FT                   /transl_table=1
FT                   /translation="MYGGGGHGHHGHHGQHGGAGMGGGDAHGYHGSIPVAHTVNHHGGP
FT                   GYPSGYPHNPYGGIGMDGVGLGMHGQTFPPMHAIHHGFGGGPYAHPSQHPHDAAGSGRH
FT                   GHAGMNGMQQVEMAGSGPRRQYSSDLSRLMSEFNANPSSSEDFLKSFLQRTASELDNLA
FT                   QLGSK"
FT   CDS_pept        complement(84322..85137)
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632921"
FT                   /orf_name="MICPUN_97814"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65714.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000199AF66"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED98"
FT                   /transl_table=1
FT                   /translation="MTQLIAALHDAGGAEGLSPVDALERERVGDPIPVSHVDLLAPIPN
FT                   PPSVVCVGKNYLEHVGEVDTHMPGISKTAPPELPIIFTKAPTAVTGPGGGIVFPRHVTD
FT                   QVDYEGELGVVIGKGGKAIAAEDAFDHVFGYTIVNDVTARDVQKRHQQWYLGKSFDGFA
FT                   PCGPWIVPKRALVDAEGGNDPQRLLIGTVVNGERRQGSDTSKMIFDIRTLIETVSRCMT
FT                   LRPGDIIATGTPAGVGAGMDPKGWLKVGDVCEVTVSGIGTLSNPVVDWE"
FT   CDS_pept        complement(85604..87562)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632922"
FT                   /orf_name="MICPUN_61055"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65715.1"
FT                   /db_xref="UniParc:UPI000199AF67"
FT                   /db_xref="UniProtKB/TrEMBL:C1ED99"
FT                   /transl_table=1
FT                   /translation="MFDEANIAAAISACASEGWTDAARNDAVADEFSTALEEICATYNF
FT                   GRCDDSEATDALVSLASLALSRDASAVASAVDHFDMSDATKKLLDVIGVEIFTPLMECA
FT                   DAVDDRIAEACACALVDACAEACGPRDMFVMALGALQSRVERAAKDLDGDDDDHDYAGH
FT                   HEPSVRHRGWRLTGAICAGLATWLRRAKNPASLAPDAIPIVASLAALCGRCARFVAEAE
FT                   GGAERAGCEPASRHHGPEAAYRGVGEFFKVACDAMHGERAAGHALADGMRALALDPRRL
FT                   FRPTPRGRLCTHPDHEWVLQRLGTLDHLLSFTDFATNDETSDETSQWLARDEATRQSLA
FT                   SSTTSHVAAALIAWRWLVEAEEQTPWPSIVNEGSPLGDGCSCLTLAKIAPLADALVGSE
FT                   RSPTHFVSGLELASLAFRRAPQGMEDGCVAGRELMRKLQVVMARTADAGARELARKAFV
FT                   RALALHRPRRRLDVLRQCLEAPAPSGAVAAMLVTLVKREMENAWPERPGEEQADEPARP
FT                   FLPAAVKAVESQIAIALDPGSRPSRGVGSTPAWLRDASAVADVVGAALNALRFVLMREG
FT                   GLGPEWKGSAPAGAWRRRRELLDAAVKPAAEWARERLAECDEKDGGWEALMGYHHVLEV
FT                   SERIVEFCEERDEREAP"
FT   CDS_pept        complement(87809..89320)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632923"
FT                   /orf_name="MICPUN_102113"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65716.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000199AF68"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA0"
FT                   /transl_table=1
FT                   /translation="MPLAHANIAAYAAPRAHAGRRTSTSRTRSPAPKMKCDVAARKARG
FT                   TVVPRAVVDPAAVVPALNSKPDEFAVLEATPNDTYVDVVFKDGASFRFHALWLRDACTD
FT                   PNHVVADAGERILSMLPVNTGCDADLRAASCEIDETGGLIVTWTNHEIQSTFGAKSLRA
FT                   FADVVAKPLVGSEIPPLAASETEWLDPFTGYPDAPGQPPSQIDYFKNEDGVVFPSYDHD
FT                   AVVRDPKLKLDVMRDLMRAGAVIIDDVPENEVDSTTLHAFVDDVLGGMQKDPCRDERNW
FT                   KIVKKADASSISYDPEKRLNNHTDQSVPPWGGTPALVLIMHYQKGSGCNTLVDGFKVAE
FT                   DIRATDPEAFEMLTAYGSNQTRDFVSSRKDTTQTLNASLCVHKREPIIQLDDTGNIVRI
FT                   QYNEVFRTPLELPFDVFPKWYAAYTKWVTMLHDTKYEVEVDMQAGKMLIFHNWRTLHGR
FT                   AGGKASKDRTLIGGTVTREAFYSRATELLEETAGYDMRVTGTKVK"
FT   CDS_pept        89966..91156
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632924"
FT                   /orf_name="MICPUN_108848"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65404.1"
FT                   /db_xref="HOGENOM:HBG527018"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="UniParc:UPI000199AF69"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA1"
FT                   /transl_table=1
FT                   /translation="MLRGDAADATDMRALAKVAKCVVSAAGPYGDNGDVLVGACAAEGT
FT                   HYADLTGEPGWMRSIIDAHDATAMSTGARIVPCAGFDSVPADVGAFIAATELAKRHPGV
FT                   RVVKVTSFLTKVLGGFSGGTLATGWRLAEDARERTSFCDVDGLVPGAIEGVTNAAQTPL
FT                   AFAELEPTYNSDLDAWATTSPFAPCDVKVVRRTVSLLEGAEVGAEVGADAGAEAGAEVG
FT                   ADRVMPYANLSRFCYEGKLAAFELGTPVGWISCKATASLVEAAVRGAADEGTRTSMKAA
FT                   LPKPGEGPPEWFRNAGFWEMRFCAEGEDGKARVWTAMRGGGDPGYSDTARILAEAGVLL
FT                   ASGGGSGPVRRGGVLTPAAAFGDAILRGLEPHGITYTVDGDEPKGVWFSLPKIAKT"
FT   CDS_pept        complement(91178..92305)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632925"
FT                   /orf_name="MICPUN_102115"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65717.1"
FT                   /db_xref="UniParc:UPI000199AF6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA2"
FT                   /transl_table=1
FT                   /translation="MALASNASGQSTRVGSSAFRRVPPLAPRAGAPASRCSNRVERARR
FT                   VVFRQKVDSDAARLRGRAAHLARAASSDDATPPAAAEQRAAGWCDEDTSECDASASWDE
FT                   DPAIDLEMSPAEDDAPDAWWVSLMNEGLDSDPAWTLVAFFICDLGSAMVLFALYTVAQV
FT                   NVDADFVLAYALAKGPLRAPRLALDAVVAADMTRRWPQLARVRVTSLIDAGTDALARFK
FT                   RFVDAKVGGRSDAEEGVTGGTAAVETGARESSRSDAKQSAGAKLAAEARSLTDKYGLAY
FT                   MAAKNIIGPVTMVIFYVALKSGIDVQALLERALGSAATEGGAAAAAGAAAGRVCLSSFT
FT                   STALFPWVVLGAGALGPVLGRAARGLKSGELSKAE"
FT   CDS_pept        92708..94819
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632926"
FT                   /orf_name="MICPUN_61059"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ACO65405.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199AF6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA3"
FT                   /transl_table=1
FT                   /translation="MGGYFTSDRAAKYGWGVPRLALVTLFAFEIVPRAFLAGSRAPVDA
FT                   LVSTPLPFTARAAAAPFAPLTLVPYLHSLRWIAHAYTGSIGAGVNVQVLGLLGNLAIMA
FT                   VAGGLCLWDLTKDISLVVYFLKTFCGDQLAGKLDTAEWKLVLAFTFALPLAMWGAAGAN
FT                   GAAFAMFLPYARIAPILFAIQAVCEFGDAHLEYHPVIGKFFRHRYGFEAFTLCALTMMP
FT                   GGITAPELRVVQFDLVICLFYRVANLGIILHKQGFAVAAAASLAVTIRKGCFRVFGALS
FT                   GQRIVNVTDAEVATAVMRASDVKGDALERHVATPAWRPLLSLESVDHELYRNMLRDFHA
FT                   VVKACPPPQRVGEIARAKVDELMYRTYSEEAEEASPVRGGAEPSPPPSPERPVVDVTLA
FT                   DSPVDSPHPHGGKGGDVGKCPFVQMQRTMRGGASGQSNAAGRSTPARSDAAPVIDADDV
FT                   ARLSLSVFIEYLFGREWEPKFETLLAASWEWRKEIAVRGRADPGVKKAAVELVVDDLIK
FT                   NSHLWDLFGEKWREPRYYSLIMQPFLVSPAINVGDIAVAMKAHPDLALEPAMRRMHPFP
FT                   IFERWVDKDVVVDGRIAVRADTQVIMFTSDFANSKHLWPAFGTGPRACAGTSMALGVLN
FT                   AIHQKMLGRPGFEPERGHKFSGRNNDGVTSLSEVWYFAKTVLPVVFGFGGEKTTEAAAL
FT                   ERAAAAALE"
FT   CDS_pept        complement(<95021..>95297)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632927"
FT                   /orf_name="MICPUN_74314"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65718.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199AF6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA4"
FT                   /transl_table=1
FT                   /translation="KELHLGGNQLTSVPAEIGQLTSLERLSLHGNQLMSVPAEIGQLTS
FT                   LESLDLGGNQLTSVPAEIGQLTSLVRLFLQHNKLTSLPAEIGQLTSL"
FT   CDS_pept        join(96187..96705,96830..97096)
FT                   /codon_start=1
FT                   /gene_family="HOG000229515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632928"
FT                   /orf_name="MICPUN_84970"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO65406.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AF6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA5"
FT                   /transl_table=1
FT                   /translation="MEYVSLEGLRLDGRRPKETRRMRCELTALPGSDGSAVFELGNTKV
FT                   LAAVHGPHECRRPSERLEDRLLVKCEVSMAAFSTGERRRRTKGDRRTNELSTFVRRCIE
FT                   TCVSAELLARSQLDVSIQVLQADGGVRAAAVNAAVLAIVDAGIPMQDTMACCSAGYLDD
FT                   TPLLDLNYMEEGGGGPEVHVAYMPQMDRVVAIVTENKASVDVFERAHELALDGCRVASK
FT                   LMRERMIEHAKHLWAMRQVTLRVKDDETGDEAKPISMET"
FT   CDS_pept        complement(97139..98695)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632929"
FT                   /orf_name="MICPUN_61062"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65719.1"
FT                   /db_xref="UniParc:UPI000199B017"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA6"
FT                   /transl_table=1
FT                   /translation="MREYEMETTFDVPARTFLRVVYGDDGFFFRRFHHETGECPDASVP
FT                   PWTARSSGDATRVVVFTKTMSLPSVIERLLGSGTSMATLRFEETQTFAWDPATSTACVR
FT                   STPTLVSPRSESFQTEVAVYVCPDGEDPTRRCAMRAVIKVTASGTWALQPVVEKLMETR
FT                   ASASFREWVRFADAFLEENYGGSHVGDRPFPKLSAMPGGEEDAVVRGIAPAPATTTPPS
FT                   SSHAALNAATEEEEFPSSRPRFSGEETPGASASSDFETDDDDFDDARSVGSTSSFHSVR
FT                   SAASSFGSGVGSWFGRRSSSGGGTDGGGDREAGENNQNGFDVGSPAPPSRTRSLPASPS
FT                   PGIPGDGTGVKTAPGKNRPKRSGSVPPGVEPGSSGTTPSGVPEISSRPRADDAFANSWF
FT                   MQTVLKDLAALRARDEDTGRLLASLEENVCAVRAENASLRAEVRRLVNGAGGAGAANRS
FT                   PSIRGSLRARADGKDAFDPMGGGGDVASGTWVAARWVTGLGIAVGVGYVAGQVLARNSK
FT                   T"
FT   CDS_pept        join(98871..98957,99116..101404)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632930"
FT                   /orf_name="MICPUN_61063"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65407.1"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniParc:UPI000199B018"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA7"
FT                   /transl_table=1
FT                   /translation="MSDQRWLAPLSVREEPLPDGQVPRAAPYREPVELASFSKSREVPN
FT                   IYDRSRLKRYVHPSVPFDLSEGHATFLDRDRNVPRPASLVPIFESLRVAGLDERELAAA
FT                   DVVTWRGNFAKILGTPWNARDAWHMEAELVHGVAVLNVLEPPASLARESQRQGRDALMA
FT                   YWGYSFEEACTGGMYDEPIDCLDAFCAVVRTGVGRHRLIMGGEVDCWDGERTGLAGYVE
FT                   LKTTRVMDNPSQVARFERDKLLKWWAQSFPIGVRRIVVGFRDDAGFCRKLQTLETLKLP
FT                   GYAARHPRAWDPKTALRFADRLLTWLRKHLEQLPEGTRVRLEYEPNGSGGRAPKEVRLR
FT                   VCDDGEVPDFVPATAREALLRAAAMRAASAAASSGGRGSSLRSGSKSDRANSGGSVGQT
FT                   RDKLGATKEGPAEVASRRSALKRPSPASSKDGDVGLVSGGLTAAAGAALESAKAVESSG
FT                   GAAGGGAGVGNRGGFDASGGANPSASDAPAGTVDDLNHHRRDDHHSHHHHSHLQQAPAT
FT                   RVAVHWAGAEPPAQHYNHRRRRRQERSQTPVPGARSLQHLYRFYQPIVAGPGFGDPLKM
FT                   AADKQAYARSLGPSAMSYLMGFVPGDQGWIGGGGDDDDDGDKDDDDDKADGIDSGINAD
FT                   KKGGGINGSSTKDRGYGLDPKAFAFDPMNPAASAKAAAAMTVAGSEGDGQQSSFVAAGS
FT                   GEEMGEDDGQEGGGGSGGAGSVGGRSTDSRSDASRRRSGGGGFGGGAGGGGEQREVGST
FT                   PQTATSANDGRGVGVGGVEGAADEEEGGGSGTKKPRSG"
FT   CDS_pept        join(complement(102969..103553),complement(101524..102927))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632931"
FT                   /orf_name="MICPUN_102120"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65720.1"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniParc:UPI000199B019"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA8"
FT                   /transl_table=1
FT                   /translation="MLPLAASLALEESSARGVVRRALVLSNGALGAEGQCVGLVRALGL
FT                   HGANGWTSPRGGDVFDVRLVGDAALMMSRRLGAAWSERLSHSMGARQLVKRGGPRQAPL
FT                   PSYLECIARLISRLPVALRVSLHALWDRIFSQSGVGDRVWLGADLAPMTRQAMEAYRRD
FT                   RTRTLVVSSGRSTVPASAALRRRCGPAVFTVHSPGLLARGMGGDGVTRGEVKEEKVCVT
FT                   RAVLHRLDSEALATAREKWRKEFATRPGPRLVVCIGGPTRHVNLGGWSRREESSPGTRF
FT                   GDEGADFWGCARFFLATAERRARRAIETARDWRGVRRNAAAEEEFAAEVADFVTRACAD
FT                   PVAARRAMGSGDDKKPKPFRFGSAFVTFSRRTPRSLRAALHRHLARRVVELAHIDSPRP
FT                   APVASMSTIDERDETNDETRGGKKTDHPSRLVFGPKIDPPRTDVPRDRCASPIHLPVSD
FT                   GLWVWDETGPNPYDGAMAWADAALVTADSASALAEASSLGVPVVVAGWRFATGEAAMSL
FT                   SSLATCGAVRAMEDVGLDGAPWLGAAARVGAFATTSSDDEFGFGADAFGFGSARRSRCR
FT                   HGDDVAKAAASVAAAVRVDAPPPPIASNERDGDRGDRGDENQKDENQKEQNQKDEDEDE
FT                   SPRPTSPLFRSVSAPPIGTVDPRRKLW"
FT   CDS_pept        join(104063..104519,104696..105900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632932"
FT                   /gene_name="CDC25"
FT                   /orf_name="MICPUN_61065"
FT                   /product="Predicted protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65408.1"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199B01A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDA9"
FT                   /transl_table=1
FT                   /translation="MQKKVRAQRALLGGGGEGSTGGPGDPGCRAMALGHGHDPGGLLSP
FT                   VSSIGVKLDSLHHWNGTPGAPAGHPAAIDGARVPNSAMIERARLAEPSSMSLSFSPGTA
FT                   EQAHELRPSGYYPPTTVAPATRGNVERDLEPVRSNDGMSFADMLARNGGDSAPVEPEHP
FT                   GAKRKAAAIGGPESPLASPPYSAVIRRVDSRDDRMCTPSSANSSPMDAREDFVSSGGRG
FT                   TLGGIGTLGGSGGGGEGGEGGRNTAVHGAFSPLQEGPESILPCVVDAEHGLPHVLDETL
FT                   ARVLQQCAAGAMRAHVIDCRYPHEFDAGHVRGAVNVHEPAALQRYLCAVLAEDADRAQF
FT                   LLANSSSRMGDGRAQNVGGVHTHDDDSVRRSLMAHAQNSAFILYCDFSGERAPRMWRHV
FT                   RNLDRRDHVMDYPCLSFPHMYVLRGGYASFAQRADLRGWCTGPHLRVDDPGAVELSRRC
FT                   ASGLRNCWHVARLSKGIGDVPRVGCGGGGDDDGFGVGGISAGGTTRMRSRVFGRDDDAF
FT                   EEEGEYGGSWRGGWGWRGRWEMRDEPRECFDDDMCE"
FT   CDS_pept        join(complement(107713..107774),complement(106078..107527))
FT                   /codon_start=1
FT                   /gene_family="HOG000196276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632933"
FT                   /gene_name="NTR2.3"
FT                   /orf_name="MICPUN_105997"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO65721.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG617617"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199B01B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB0"
FT                   /transl_table=1
FT                   /translation="MSASLAQPEWVPPTYSIPVDSENKAKSLNIFSFSHPHHAAFHMSW
FT                   MGFFVSFVSTFAAPPMIAIIREDLDLTKPDLGSAGLAAVTGTIGARVLMGSVCDVVGPR
FT                   YGLSIVLLLSAPFCFCMSYVTTPVGFLICRMGIGLGLATFVASQFWMSCMFNGKCVGLA
FT                   NATAAGWGNLGGGVTQFLMPLIFRAMTSATEGRVFSAWRWAYLVPGLLHTIMGVAVMFV
FT                   GQDLPEGNFKFLHTSGQIEKKSALNTQYLGITNYRMWCMVATYGFCFGVELTMNNIVAA
FT                   YLYDQFELDLVTAGTLASTYGLMNLFARSIGGYVSDLMSVKFGMRGRLWTLWVVQTVEG
FT                   VLCIFMGLAKDSLASTILLMVAFSICVQASEGASYGIVPYITRRALGVVSGYIGAGGNA
FT                   GSTICMALFFTSASIPVYQGIMYMGFTIIGVTLLVIPIHFPMWGSMFFPGDPNVSEEDY
FT                   YIAREFTEDEIKEGLALPVQKFCQNSYQERAPSMRPAESPVVAKV"
FT   CDS_pept        108477..109040
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632934"
FT                   /orf_name="MICPUN_102122"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65409.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B01C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB1"
FT                   /transl_table=1
FT                   /translation="MPRTTLAGRIRSSVHDAGADEREVDASLALLADVVLLKGLIDGAP
FT                   DKTRRLSREPCPHGAKYRSACRVCSACPHGRQRCRCKDCGGASICSHGRKRTTCRECGG
FT                   GGLCGAHARQRSLCKECGGGSICAHGRRRVICKDCGGAGLCPHGRQHHVCKPCGGASIC
FT                   AHGRRRDRCKPCVAKKFIAATSKS"
FT   CDS_pept        109194..109880
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632935"
FT                   /orf_name="MICPUN_61068"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65410.1"
FT                   /db_xref="UniParc:UPI000199B01D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB2"
FT                   /transl_table=1
FT                   /translation="MKVGTARARGRADWSGHDSPQSRHLGQTGRRREMCCCLPPCFWWL
FT                   CFTPRALHKIGGPRSLEEIERQRKRREERARRRRWWRCQRAPPDGERNGETATGQVASR
FT                   GGEIELGEIRVVEDDGRLQNDAEKEIGPADPGWHERIHSNPAFDAPVPPFVPLAVVSEP
FT                   PKTNKHHLYRRKDYLLSRKQSRERERAKRKVEKELARSGGGGGGGGTSSGNPGGEVTPS
FT                   PRESAG"
FT   CDS_pept        complement(109947..111623)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632936"
FT                   /orf_name="MICPUN_61069"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65722.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG447070"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000199B01E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB3"
FT                   /transl_table=1
FT                   /translation="MGRVTVFASAGCSHCARAKAFLDARGVPYAVIDLTTRPARLADQR
FT                   ALTGSSSVPQVLFNREVVGGADDLEALEAELGPDGFLERVREALAAPDPTTPRLALDAD
FT                   DPVATPTPSRPPMPRHDDDDDDDDDEPIVATLNGVRFGFVAMIRELRSIVRVGDSAPRG
FT                   LMRVVQRRCFTGADLVTALLRKHPSDLGREAAAAFAQRLCDAQVVREVGGSNPAHAFKI
FT                   RFRDERRALYRLQPDNHPGWLNPWRLAWINRRDDALARDDPAQLCAALRAEFTSLCDAH
FT                   ADVANPGAVRYDAVRATPDFERLRVSACALRQVRLDALGRKTRLAFLINAYNLTVGLAI
FT                   AAFGAPRTRAQRRTFFHDVQLCVGGDAYSLSDIEHGLLRGNRREPYRLFRPFAASDPRV
FT                   RFATVRIPGGDSPGGDSPGGDSPVDARIHFALNCGAKSCPPVSSYTSADVESELEAAAE
FT                   AFVEGSTFVDVPTRTVTTSAIFRWYARDFGGTDEEVLGRIRGWMPVGRPERSALEGMLA
FT                   DGRGGVRLAYASYDWTTNASDSTSDYDATATRSEYSWLLGG"
FT   CDS_pept        111722..112459
FT                   /codon_start=1
FT                   /gene_family="HOG000198001" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632937"
FT                   /orf_name="MICPUN_61070"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO65411.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B01F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB4"
FT                   /transl_table=1
FT                   /translation="MEETINRRCLGRGPVSVRRRRRRRRFSVDERHEIMRGVYLSTQYG
FT                   GSVRFALGFVAGILLRETHLLRKGRRPPKSVLVPVRGYKGTSSADRARETEGPDAGPLV
FT                   FVRRLEAGDYAKGFMELLAVLTTVGDVAEGDFIRRVRDVASGPEYVYVVEENGRIIATG
FT                   TLVVERKFARSCGVVGHIEDIAVLTSAQGRGLGKVIIHALMRVAERMGCYKVILDCAEK
FT                   NVAFYEKCGLTQKEIQMVKYFID"
FT   CDS_pept        complement(112620..113333)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632938"
FT                   /orf_name="MICPUN_61071"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65723.1"
FT                   /db_xref="InterPro:IPR018790"
FT                   /db_xref="UniParc:UPI000199B020"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB5"
FT                   /transl_table=1
FT                   /translation="MSAITTTTRTTAAATVSPRGPCRRTVTASASPRGDAEASSSSSTS
FT                   PSSPPVHLRRRHALVALVAAAVAPSGPEQRASALPLAPLGEVKRVGGDKRTDLTAEKVR
FT                   DQLERDLRDGQYFVTGNLTREIFADDCRFTDPTNDVVGLSRYLTALGLLFDPATSSVDL
FT                   YDIKVTSPNTVEADWQLQGYLRFPWKPRVDPYSGHTVYSLDPETKLVRSQFQTWNISGA
FT                   KAIAESFTPTTGPGT"
FT   CDS_pept        join(113505..113567,113738..117355)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632939"
FT                   /orf_name="MICPUN_61072"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65412.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000199B021"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB6"
FT                   /transl_table=1
FT                   /translation="MYKRDRGGFGPPKDRDDRYRRDDGRDGPDGGGAPGGWDRGRGGAP
FT                   GDRDRGDRGWGDRGGHGGPAPHRPSMMSGSHPNARPSLLTSPTGNQRPRMHMPMGRAND
FT                   QFYQSSNHFNDDFDEEGEIAAAPPQPAGPPPMTHPRMQGKTCHRCGGVGHFARDCPSSR
FT                   DNRTCRVCGEVGHIARDCPMNRQGGPPPVQKPSDRDWDTPRESNRDAARNRERGYNEPD
FT                   RAPPVPIRKSFSHERWGGGGATREDGELTAPSYAKNAQEGPHVSRAAAPVDVDRPPLSV
FT                   PPRGGGVETDGGGGYADRGEVAVTHRGESVNLGGLTRFSSAPPGPTSLDDFGAAGAAAS
FT                   TPTTHAAKKGGWGGGLGAKASASKGAWGKGLARSKSALPGVGGGGDDSNQPPTPADGAK
FT                   GVSSFAVPAPSPSFAFPDDASNPPLPGGPPPPGQEIRQDLRTPPPDWEDPTAKAARLAA
FT                   FRADAAAKKELVDDLAKKKGDIMTAMEETDAEIEKLELEIAELDERDVNDKEQAEEQAR
FT                   HQEARLDRELDNLKRSVERAERNAEKAAVEAEEAKTKAEKLRKKAGLNKAGEIDPAAAA
FT                   EAAARSRRCAEMIQEMVTGDEPRADVVARIVRANEQVANKSHDGLKHTCGLPLANELPR
FT                   VSVEEIAARNFATENDPSRAGVRDAVKDVLRRRRAAVADKQLTLAVTYLKRREKWRVRM
FT                   VAADRTRLEKMYGVKPGGKLPTPGSRGSGRLNSSMAGVAKSDYEEMQILQQLQRVEALK
FT                   SIIKLPPQVLDPEERRLAAFKSRNALVEDPVAEVDALKLVRPWTAEEKKTFHEKFASFG
FT                   KNFKRIAAFIDGRTTADCVVYYYQRQKTDDGFKGRRRALAKKKRAYAEAKRMTGGAWSN
FT                   NAAGQAAQAAQQRAQREAQQRAIEEQQEAERKARAEKRKQARAGTGKTPKSAKKAAKPE
FT                   AEAEGGDEGDEESNKPVSRSASEADLSTKGQAWTANEKKSFLAALAEHGKDFKAIAAAV
FT                   GSKSQTAAKAFFGKHKKSLSLEKIVDDHAKAKAKEEKKSAAAKKKAPAKDEPAEKPETP
FT                   APGGAQDHAAHAAAGAQLAAAHAAAAAAAMAAYQQAVAAGAAATDPMLQAMLAGQMPTS
FT                   GVAPDPAAMMAMFQQAMAAAAGGAGAGAPAVKAEETAAAAAAPSFFPSAETGAKRARDD
FT                   DDDGDKEKASKAAKKEDGASAQASAGPPLSTAAAAAAAQAAKEGELPTASLKWGEGGGE
FT                   D"
FT   CDS_pept        join(complement(117876..118394),complement(117499..117837))
FT                   /codon_start=1
FT                   /gene_family="HOG000243508" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632940"
FT                   /orf_name="MICPUN_61073"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="peptide deformylase activity"
FT                   /biological_process="translation"
FT                   /protein_id="ACO65724.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042586"
FT                   /db_xref="HOGENOM:HBG665227"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="UniParc:UPI000199B022"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB7"
FT                   /transl_table=1
FT                   /translation="MAVARSPRSNSRGTARRTPATAKHRRRGVPLHVRAAYGESKPDGT
FT                   WVEKPQNAFGNLINLAKGQREIVQAGTPVLRQMAEEIPLDRIDSATIQELIQEMISIMR
FT                   NRGVGLAAPQIGVPYRIFVMEDTEEGMSDVSKDDLVAQERAPFPAKVIINPTVTPVSNQ
FT                   SCAFFEGCLSVRVRGYGGDGKPVDFVAKGWQARIAQHEMDHLDGVLYVDRMDSRTFRRV
FT                   DLLDQPLPGAHPELGPAPVVGKCADFAGPRAGGGAGGEGGMAVEDVEGFIGKKKSKAGR
FT                   RKSR"
FT   CDS_pept        119182..120696
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632941"
FT                   /orf_name="MICPUN_61074"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65413.1"
FT                   /db_xref="HOGENOM:HBG562874"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI000199B0DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB8"
FT                   /transl_table=1
FT                   /translation="MSEADEVCADYADALKDLQVNSKPMITSLTMLAQELGAHDVSIAS
FT                   RIGELIERHIRTSAPKAKLCGFYLMDSIVKNVKGHYVNYFARGLSDLFISVYQISDPQT
FT                   QKSMAHLFDTWRAVFPQSTLEPIERTLPPRPQKIRLPPPPPAAGGFYNQQQGGYPLQAQ
FT                   GYGGGAYGHQPGINAMAPASAGAMLASMVQGGGDISALLNSIAAVKKATTGGSPAGSAG
FT                   APGVPRPPAPPAGAPKGLRGGDSPGASTGASKENQPPRLGVDFDPSRDDEAELRRRREY
FT                   LIDAMYADRPHQCASTGRRFDDRAELDAHLDLQALRRRKRKEGSSSRRWCVDSDAWIAG
FT                   AAAEAADDAPAFFEIEHAKKEEDARNAVDVNSSVAKEDDVTHCALSGEPFEVFYNEDED
FT                   EWHFKRATRLPRDYKGVPAGSIVLVTALPKDGNYDDEDDEEEDEEEEEEEEEVVEEPAP
FT                   EIKEEPEPATKKRKAAVKVKEEVKEEKVEAAVEPVATRRSKRRKSE"
FT   CDS_pept        complement(120979..122694)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632942"
FT                   /orf_name="MICPUN_61075"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65725.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI000199B0E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBH6"
FT                   /transl_table=1
FT                   /translation="MPADDAPAADDARAEPNAPPRRRLKREFDEHWLERCLGAPVERLL
FT                   RQRRIVGACVCVVKVPMDGAPGETTDAGVVREYIRTYGYASLDPPGGAGSDASGRTNAT
FT                   RRTDVAWSTDPHSPRARLANNYGAVVDPRTTLFDVGSCAKIFPAVAIARLRDDLGVPEL
FT                   TQDADDHLPPELALASKHQTPNTKRAVTVGDLLRHTSGLVDVPGCAATTKPTTTVAKAK
FT                   AKTGVVAAWPPGLNRAECDRNVALAAAVVERVSGHESYESYVLNELRVGVKDAVRGGRP
FT                   SSFRNAYAALAEAAAKPAAGPKTKTGEVVVGECAFGDGVRAGRYVTDVTDAGDGTRALV
FT                   RRAASRRADAADEGNESAGDSSVTPLWLTAWEMRAIVAGLLTPNGTLVRTEASVRDLIG
FT                   PDVAFRWHGVDGAFEAYGSGFVAETTASGLRRRPTRRFDSAGAQLCTGAQPSTRGCTAV
FT                   YVSSDDSTGADSLLALFPEHGIGVWIASNTREEWCRCGGGGGGGGGLGEVWDKPPAAGL
FT                   VDPARSDGAQHALKMRSGPGEGPGGQPRFAELVLSRFVDDFIPAPGDEGGDSPR"
FT   CDS_pept        122801..123097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632943"
FT                   /orf_name="MICPUN_61076"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65414.1"
FT                   /db_xref="UniParc:UPI000199B0E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBH7"
FT                   /transl_table=1
FT                   /translation="MGTDLEAEQLLGSRREARRFARVVKLLLAFMFVAIGLDYVLSRSN
FT                   DPDVRRAQEKRGVRGRIHRVEHRLEDAWEERYARHAVLDEDGEGRRRRTRHKP"
FT   CDS_pept        join(complement(124032..124571),complement(123174..123917))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632944"
FT                   /orf_name="MICPUN_61077"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO65726.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199B0E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBH8"
FT                   /transl_table=1
FT                   /translation="MFASSALVATQWAPPAGLTRARPARVRTERPRTSPREPHPLILSF
FT                   RNDSHADFRAAHLCAPITPPQASRATAQPVVAGKAKKAAKAADKKAAKADKKAAAKQAP
FT                   VSKQAKDAARKKAAAAMRDVVSRQGKAYDRIVKEMDRDEFREYILSVRHNSPEPVQQLC
FT                   DWLPIAEVVVADKQAYEAKKFFRSVGSDIPETEQQAVGADQIEGVPAIKAKLPGMREEA
FT                   VGMAYLMAGSVVKDVPFEELEFGVEDWGSFEMAVDAYEAQQSTSKRFAAAAATLGVAAD
FT                   DDPADVKRVYRKLIATEHPDRNPDSSLEKFNAIKEAYELLSDRGGQSGTTFEGLGDKAK
FT                   RDFRKLSDVHAGVTSKGGELVEADVGSKVEVVMRSLTIYDRIKTMFIARNVSLGARKAE
FT                   KTKASGKAAAEEETAVEEEVAAPEPVAA"
FT   CDS_pept        124906..128769
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632945"
FT                   /orf_name="MICPUN_61078"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular protein metabolic process "
FT                   /protein_id="ACO65415.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="GO:0044267"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI000199B0E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBH9"
FT                   /transl_table=1
FT                   /translation="MEDARSRAKDAAARAGANLRSAASWLRRRAEHHLLRQRPEFWVDE
FT                   RVVKSCYGCEREFPGSLPGFKHHCRACGKVFCGACSSRSLHLPRTDDDIREEGVEPSRV
FT                   CDFCFESRRGDDATGGHGASTPAPAAVGDGGESVGGSSSSRADSPANAAAPDRLDDGNV
FT                   PPRGASNADVERGRRAQMHHAILAPSPAAQLLGSAARNPARRRTDGDTVPSSGSDDDDD
FT                   DEEEEEEGNVRRAAEAPVADSLGDDDEQSIRPPSPPPSPPSPWRARGGRRARRGRRPPA
FT                   VSDRARRAVLEALRDPTLWTRPSSSRRRVSNKRDDERGDELPERGPDASTVDASRAALV
FT                   RRDANNALDQSDVDTWTPRVAQLATIASTRVAPERRYAKFFQSPGPGWMHPGAYVRCKK
FT                   IPGGHCDQSGVVERCGEMFAKNVAHKRMPSVRQGNVRVVLLRGALEYQRANAAPRLSSL
FT                   DTLLDQEHEHLRGAVARINGVKADVLVVERTVARFARELLLERGVSLVINVKSSCVRRL
FT                   ERVTGAVAVSALDQLREECVGRCETFKVETHDDVDTSGESSSNSGGTNNRPSGERTTTT
FT                   LMTFGGCANVGGGCCVLLRGASEDKLRVVKAAVRDVTLAEAHRRRGAHWRDSTGHAIRP
FT                   GLDPATAALSFRRLRIAACSFCATTGHLCDAPNDASETVAPYGEGDLPLGEFLREALDP
FT                   PVERERCSNPECDEPPESHIRVYYLAGGRATLRLRRTPGGDENDDKDGKDDDVIAHWTR
FT                   PRARARDEDGLGALGLRVATDYDSSPLNPALDPEALEMSLGRFLETAVASGDPAYLEHA
FT                   HFFATKDAIACFSFDAVAPLRVSPPTRIIAAATFKAVDAAAAENAAADVEASFVSNDAM
FT                   DADPAGCVARYMRASEYAVHLAAARWAAANHPAGASGSSGSTSNNIGGGGSGGSLSPVA
FT                   TSRSHSRKGSAMGGGVGDPAVAPVVDGPDAMLLPDRSHLRHVFAGNDAGMNSRANSSAP
FT                   PSARRTAVTAYYPLQFDALRKATLGDGDEGYAASLASVAKWDGGAKGGKSGSSFGKTRD
FT                   DRFIVKQLSRVELNAFLADFGPAYFKHARESLDRSNGSTCLARILGAYQVAVGEGADGE
FT                   DPAIIDFIVMENLFRGRDVFDPRWLTYDLKGSLRARYNVDDAGDDVGDDADADARDLGR
FT                   VAAVLLDENLQRRLATHPILCDVESKSELDCALARDTAFLANEGVMDYSLLAGVDRASG
FT                   ELVVGVVDYLRLYTWDKQLESYVKYTGVLGGGVAAEPTVISPVQYRRRFRKAMARYFVV
FT                   VPA"
FT   CDS_pept        complement(128856..131336)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632946"
FT                   /orf_name="MICPUN_61079"
FT                   /product="Predicted protein"
FT                   /function="3'-tRNA processing endoribonuclease activity "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="tRNA 3'-trailer cleavage"
FT                   /protein_id="ACO65727.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0042779"
FT                   /db_xref="GO:0042781"
FT                   /db_xref="HOGENOM:HBG648406"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="UniParc:UPI000199B0E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI0"
FT                   /transl_table=1
FT                   /translation="MSGAYRHVHAAPRVAVTAGASATTRRACGSSRLSRAPPGTIRVDN
FT                   RRPLPRHHRRALRVAAAASSGVNEALAEAGGNVVNVLNKKFKVGDLREELTRRGEASDG
FT                   KKAELIERLVALGPVAVESAAPEPEPPSGDDASKEDPRGDAKPRDRDAKPRPRQRSVMS
FT                   SRPAERVSGGEGIDEDGDSNFSGMEVTFLGTSSGSPSFTRNVSSYALRLTDEIWLFDCG
FT                   EATQHQLMRSHLKYSKITRIFITHMHGDHIFGLPGLICALSGARAELKRVHGREPEPLH
FT                   ITGPPGICDYVKAAIGCSRTVLGLNLVVTELTAPGNGVAGVGAGDDADPRGFAAQTHLA
FT                   ADARCRMFLGERWPDNGAAAAPDFRDRDAWQRAWDGSLELPYWTVHRERSNNPGGRGGE
FT                   KGAIVVRAAPLRHPVPCFGYVVDEPDQAGRLDADKCASMGLPPGRDYQRLKNGESVRTP
FT                   GGEWIHPADVVGPDRPGRRLCLLGDTCDSVGVAPLAMGCDVLVHESTFSEAKHGEAVFK
FT                   GHSTSAMAGEFARMIKARNLLLTHFSNRYGTANTRGDVPNNNGSAADHNAHRKVSPKDD
FT                   DVDDDDVLPEEAPDDPKAAAAAESSLVEGLVREASRAKGDSRVVAASDFFSFNVQRREN
FT                   FDEFDRAKGNREAVVEGPAVEPWLEDPGDARRRIDAELNGGGRGGGFGGGAGYGGGFYG
FT                   GDRFGGDSYGGDRRGSTGGPRGGGGGRGQYQRGGGGGGRGGGGRGGYETRGGRDGPGGY
FT                   RESRGGTSDRAGFSRDRERPRGFERAEDGSYQRRREVRGDKVQGGMGDYGVGLGADVGV
FT                   DSAELMREFQNRNK"
FT   CDS_pept        join(131525..131758,131869..132720)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632947"
FT                   /gene_name="YAL1"
FT                   /orf_name="MICPUN_107375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65416.1"
FT                   /db_xref="UniParc:UPI000199B0E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI1"
FT                   /transl_table=1
FT                   /translation="MPSHGSSTKILELGCRRGTCVVLRTAQTQGATMAKGAKQDPTTMR
FT                   RAGRPSVEPRKGPPSMTGFADQSARHRTMARSLAHPNFDPSTKAGAHVLSRVARAVDAM
FT                   EREQLSSAKLELESSRTFSHLSTQVAQLKRAMSALADAVVGELDEIRADHDAWRLKMER
FT                   YERVIEEKVAAVDATHADKDAVRRLAREEARSALYELKAEIGNATECVADARAALAETE
FT                   RRNAETGAALARLKDVARASDVKLQDQVDAIKARLAVMMSGGGVDGGVGSGAGGVGNNG
FT                   GGNNGGIAYASESDLVALRDWAREVATGHDARLRRVEGFGFGFGERGSSRDGTPTSAPP
FT                   LRGMSPYMSPRPPKAPGYPGY"
FT   CDS_pept        join(complement(133226..133333),complement(132776..133132))
FT                   /codon_start=1
FT                   /gene_family="HOG000170540" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632948"
FT                   /gene_name="THEM"
FT                   /orf_name="MICPUN_107376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65728.1"
FT                   /db_xref="HOGENOM:HBG749290"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199B0E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI2"
FT                   /transl_table=1
FT                   /translation="MAFSGGSFQAAEAFVKSFVLDGDSVTFDRTALEGLRDFKLEPGRC
FT                   VCVFPVTPRVQNRYGTLHGGCVATLVDVVSTVALLTVSADPGVSVNIGTNYIDPGPGGA
FT                   DVEVEARVTKVGRTLAFMDVTLRTAVGGKTVATGTHCKFLPNSRQTRSKL"
FT   CDS_pept        join(complement(134333..134389),complement(134061..134190),
FT                   complement(133688..133842))
FT                   /codon_start=1
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632949"
FT                   /orf_name="MICPUN_61082"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65729.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG744826"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI000199B0E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI3"
FT                   /transl_table=1
FT                   /translation="MPKKRRANGRNKPAGARGHVKRVFCEASGSMVPKDKAVKRFLVRN
FT                   IVESAAIRDLQESCVYDSYVLPKLYRKVYYCISAAIHSKVVRVRSVEARRIREPPKRVR
FT                   PQRKNDDKK"
FT   CDS_pept        134634..135245
FT                   /codon_start=1
FT                   /gene_family="HOG000247047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632950"
FT                   /gene_name="MOG1"
FT                   /orf_name="MICPUN_107378"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65417.1"
FT                   /db_xref="HOGENOM:HBG739096"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199B0E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI4"
FT                   /transl_table=1
FT                   /translation="MTTDASRKVPLFGGAISAHLPTRYVDVSDFRPVPDNQEVWTDASV
FT                   DESVIVEILERVEEGPSDAEGGAAGWFWEDLAAVSECGPNDAHLMSVTRLSSEHLPAMN
FT                   GRFAAASVAVGTMKMAKGRERGDERVNVVEVTLANIRLPEVGTDLLVTVNRPLVVAPGS
FT                   SAAATTGAGVIGTGGEGWSALRSILETFSVDDWSLFGYGD"
FT   CDS_pept        join(complement(137041..137173),complement(135404..136899))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632951"
FT                   /gene_name="TSHA"
FT                   /orf_name="MICPUN_107379"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="voltage-gated potassium channel
FT                   complex"
FT                   /protein_id="ACO65730.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0008076"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199B0E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI5"
FT                   /transl_table=1
FT                   /translation="METLRKAAGVSSEVHIFLATGNRMKRVKWQKSGTFADLLAAHKKA
FT                   FYTDEGREFPDAVKLDERSFMLRDREYGVAYEGFAIGEVDNGRVVEVRDPVMEAEAEVA
FT                   AAEARMLQADLQLGPEDYFTVTPASARTAKFTTNDVDDKSDENESEPVVDEKLQKESIE
FT                   WAKKMLGKGSPELDFREKTWRFLDDPSSSPWALRFTMFMLALIVFSTATFCIETLPQYY
FT                   EHEMAFTSKWFIMEASCIACFTLEFLLRLWSTPKRNEYFNDTMNCVDLVAILPFWLELI
FT                   LAGVAIPGLSVFRVVRLVRVFRLFKVSRGSLTVFATTMSRSSRPLYMLVFFTSIATIIF
FT                   SSLIYYVERGKWNDDLKMWMREYYYYCPVKADASVGPAVKGPTPWTLATSNWTLDSGLA
FT                   EPCKWIDPATYAPGEASYPAEAWFSCPYSYKKSGTCETVYEQSPYDSIPTSFWWCLVTM
FT                   TTVGYGDVVPTQPLGKILAAIVMIFGIVVIALPITVIGSNFSSIYAKFTEEAGMNASDL
FT                   EAEKLEGILEGDEDEDEDDDVPKTP"
FT   CDS_pept        join(137728..138026,138160..138391)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632952"
FT                   /gene_name="CCT1"
FT                   /orf_name="MICPUN_107380"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65418.1"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniParc:UPI000199B0EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI6"
FT                   /transl_table=1
FT                   /translation="MFTLTASAAHARAHAVPSASTSSPIRAPTRVVRVAPFARSPSTRY
FT                   ARSSHVAKMGMDTGNPFVDGWLDLTDTVSGGGKDLGVSELAEKLGKDIYMDINGWHLFL
FT                   RDAKYHVPLARIVQSTIANDGNRFEEPSIENILKNCPVKIGGGKSKVMLHDLMPNIVVQ
FT                   DFMKICERYADDL"
FT   CDS_pept        join(139659..142369,142427..145352)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632953"
FT                   /orf_name="MICPUN_61086"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65419.1"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199B19F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI7"
FT                   /transl_table=1
FT                   /translation="MGTWAAMAPAVALAPRRDGTPLPGTSSGIGGRPHVALRQPLPRYA
FT                   RRAVSPNRVRPGEAGGFTIVRSARRGDKYPWARDEDDPPRVDDVRVDDGSIARLPRARR
FT                   ATGARLVAARRSPSPDRARSVRLRCLPPSDDAAGHLAPDDDDAAAKDGAATPESGDATP
FT                   SKDAGSEAPSDAADSDASSSTTARISEEEKTKKQTGEKTKKDDEEERAGFEPATGGDAI
FT                   PFVIKGAAGPAPDAGGAPDAAADKESDADADAGSVVVDPPVDKELDRRSKVMAAAEANV
FT                   PPSQRDPRAQSTEEAAAEEAEAAAAAAREKEREKEKEREAEREGESAAAAESSLGISRE
FT                   TRREFAESGSFDEAELASVPNADPPSELPETETETDPASSSSKDSRSTTDLQSDDVVVR
FT                   EGVDLSGTVTAEYTFPSSLQGAPRADAADAFKRAFDKQDRRLKNEEEALREAFSQYADD
FT                   TPAVESDAPASATSSFARFDPADNDEYTPRRTPNANRSGTPTDKDAVVVLTALGAITLS
FT                   AQDAEEYKKTSAFYNGPEPKPNEPSKSVNSAPKPNKKAGLSDEGPVETAGKVPKGIARG
FT                   GITKPKPNPDLVGVPPSERVPQKKPDPAPSDADGEDAGRPEEDVDSEPVLVKKTGGAPV
FT                   VEEAAKDAEKLSDVKPADKPAKPAGSVEPPATATTATTATTAAEAPPKPSGNATAAQLR
FT                   ATGESAPKPKPQVVDAKVGAGDGSTAAVGGGGSGIGGGGGGGGGGGGGGGGGGGRGGGG
FT                   DDEEDPDEVDPEALPNQIVAFLRVALTSAEIAFDRVVKRILKLWVTRDPTLTGRLFFFT
FT                   AGAFLFGTLAKVLGPTNPLEFGKESLFSTVMGTSPQWVFNREQGPVQATMVTMTSACIA
FT                   AIAKIRLGNNMVPLSPFMHGVLGLPVGFMLVFRWNNAYERWWSGRTELGLLLMHAKNLG
FT                   GSFCTWVAGSDQQLATRALALICALKECVADRLNGTILADGRVMLNETTLTTPLHPDDL
FT                   EGLFAAENKVLYCIESLRKCIFKAHAQGLLPPPILGGMQNEDLFKIMEAYGECEKVVNQ
FT                   PPPGCIITHLKSTLMVYMCALPFILVHEVGVLAVVPTTAILSLALFGTEAAAEQIEQPF
FT                   GNRPYHLPVRALIRANTRDMGQTSRPVLGFSGYVNSPRAQPSSFEIPSIGTSANAASAE
FT                   EEEDKALDAGTGAPLLYGSADAWQGDGRVEDTAGGGNGGGGGLFGTRSSSASDAAGGSA
FT                   SSGPNGSRTGTITVVQPATPMEGERLTLPWTSRDADDAANLALGMEASEGERLGGDAAN
FT                   DLSSNTANLGQVFFAQTESKLNDLRRQTGFGVGGNKQANGGGGGGGGGGVGGGGGDRGS
FT                   EGVFSSDHGRARSQNGGSSNDSSNGHAKGGLDPSAQPWVPNYSPYSSAGNGAGAKKAMP
FT                   TWKTQTPIEVFGDNELGTWDGHGSVRSTSHRYHVGDKARRNVDSPNSKGNSAERNANSA
FT                   SGGSASAPGSPVRRGFDFGQFVTSPLGLAPVAMHGLDFGGGGFASKANGAPGSPARSSG
FT                   LGNGLARTSSLDRNALGGTAGGGSSSPSAGTAGGGFDFSNRSAAQSASTRTADTLFGTE
FT                   AAGASRSVFTAGSATTFGSSAAGSSSRDGSTSLGSSLGSQGLHSSGLDRRSAAGAGLEG
FT                   VSPTRSTADKGGPDKNGAVNGAMEHADSVRTWSGKDARRAASALSNSGLFSQREAAASQ
FT                   SARKSARRMARTQSVGNFARVSETEGGGPSSPGGGSSSRGDEDGSSSPGGDGVERSTTF
FT                   NNVIPRNASAASFLDADSSVRPAIWDVFGDDATLGGTTVSTTVTNGGTRANGSHANGSH
FT                   ANGGGGGATNGVVGASGGTESVKKSSKKSARSREAYVDGAAAVEAAAATPRRHKSGKPP
FT                   RWVN"
FT   CDS_pept        145550..146446
FT                   /codon_start=1
FT                   /gene_family="HOG000264529" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632954"
FT                   /orf_name="MICPUN_61087"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65420.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG562922"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000199B1A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI8"
FT                   /transl_table=1
FT                   /translation="MAMSVATPTAHAAARHIPVAAARRLAASRSAAVAPLRRALLAPRS
FT                   SRVQMPARHSRSNHGIVTAGWNDFTWGSGSVVTNEPAAPDGGLRSIVLKVDGEMAKGYA
FT                   KPGQFCQLRAADDGKPAFIAIASPPDADAGTFELLVKRSDGTAGEICDMSPGDVVQMSP
FT                   PMGPGFDMDKAPASECPNALLFATGSGISPIRALIRSGVLVGRNVTLYYGTASPTYTAF
FT                   MDEFEDWEARGVRVRHVQSRVGGPPTYVQDALKEDAENIDGASTCAVLVGQKEMTTAVI
FT                   EVLEGAGVAKERCIMNF"
FT   CDS_pept        complement(146521..147249)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632955"
FT                   /orf_name="MICPUN_61088"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65731.1"
FT                   /db_xref="UniParc:UPI000199B1A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBI9"
FT                   /transl_table=1
FT                   /translation="MAPMYSDAMGGAGRGDDRDRAPRGRSRSRSRDRDYGRRERRHDAS
FT                   SSSSSSSSFSSRSRDGRRGWDDDRRRERRGSRDAHRGRERDPRDSRPPEDRRRSGEGSR
FT                   DAGGGRDGSRDRHHHSHRDRRWEGTERRRRGDEYRDRSRDARGGGGGGGEETRAKDEKR
FT                   ESSHHHHHHKKHKKDKKDKKDRKDRKDKKHKRKSGDRDDHRISAVSGKRIKMKVDKSKQ
FT                   DLALEDQRANLLAYLNDLHD"
FT   CDS_pept        complement(147355..148479)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632956"
FT                   /orf_name="MICPUN_108852"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65732.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="UniParc:UPI000199B1A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ0"
FT                   /transl_table=1
FT                   /translation="MALAGSLARRALRWLKDVQDVAPASREVFVSFREAGDVESKWRAW
FT                   SDASHGGMSAASVSWRPRPEGAEDGDVGAMVLEGTLSTDIARPLPALEPAPGAEPQIDP
FT                   WSGATVTKAIDRGAEELEPSSSSGGGSSGGGADAPRVTKSLKRSGFAGCSTKDLPAGEF
FT                   IDLDAFTALRYRVRSDGRKYVASIRTDNWVTGGKEDLWQCFLFAPKDTWADVVLPIGRF
FT                   LKTWRGGVLEHEYEMSKSKVVGLGLAVAGGGVEPPGHFRIELASVQGLRLDREELAVAI
FT                   RRAEAGWGAAFGRSASAGSSPGTIGEGMGLAAEALRAEAFGRRSGNGGVAGSIPAGGGE
FT                   GSVDGDGFAAPKFRGETLPSFLGTREGGGERREE"
FT   CDS_pept        join(148668..148702,148971..149352)
FT                   /codon_start=1
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632957"
FT                   /orf_name="MICPUN_61090"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="RNA polymerase complex"
FT                   /protein_id="ACO65421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0030880"
FT                   /db_xref="HOGENOM:HBG646526"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniParc:UPI000199B1A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ1"
FT                   /transl_table=1
FT                   /translation="MDGDGDYDGGDGAYDYDEPAGGDDEPEAEDAEMPEGGVEVLEHAP
FT                   QQGGGAVTERTTTPYMTKYERARILGTRALQISMNAPVLVQLDGETDPLEIAGKELREK
FT                   RIPFTVRRYLPDGSWEDWGVDELIVEDPDRRRGL"
FT   CDS_pept        complement(149437..152223)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632958"
FT                   /orf_name="MICPUN_61091"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65733.1"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniParc:UPI000199B1A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ2"
FT                   /transl_table=1
FT                   /translation="MVATPRAPRAAADVARDIRAEMTSTSSSVDALRAHLASALASARD
FT                   ASARSSSDASSDEAVRDASSLRDPRALVARFRAVNDARETLARVARAEAALRDASAGAR
FT                   SVHPSSATRADLPRLREASASLLGASDALRDARDAQLCSDPPRAPAHDRFTASLAARIR
FT                   AECDRLRAVATRLAVDAAGRTGWPPPINPSAVDAFEWRVDPSSDESAADLCDACAVLGA
FT                   LQAAAENTAKLDGDGIEPATLFESWIANALASPVRDAVERHFVADASSPANDPSRPERL
FT                   FACVTRVAARCAPLVDAALRHGIEPATFESRAGGSDAGIRSKASVQRLATGFAVALARI
FT                   ARDVVEGHFIPATETAETEEGYVGARAYSRENSRASDARWLHLADECERFDVEVRALVT
FT                   RLSSNPKVGRSIPTAAGANFLVDADSLPAGCSALAALASSGRDRAVRWMRAELTDCLRE
FT                   IDVVAADTNAGATNDSWSPAGIGAIGVGYEEGDPDPSLAAEVSNPRPSGSGSDGVTAPP
FT                   VAEKAAECFNRAVDRALSLPKETFVPDTSTSDPAIWDPTHPMYEPPVNARLAYLANVAS
FT                   EFIGVFCDQTLTYRVKAADAYHAMISTVSPTAAANGALRVGDCVCVARRLAGATRDRGE
FT                   DAAALAAAGGNDNLFGDAVAKLDAFADEWTRKIAETFADAFERSAVSYLSNAHLAGRFG
FT                   ARDDATSDGNGNGDEKSAPGDGDDGDDGDENRNQNQNQNDPRDPRGLGAEVMASPALVR
FT                   PLRVLRDGLAVVRAALVAADAVDDGGGSCVQSATRVVAQIVCDTILRRVVLGNKAGFTR
FT                   TGASYFQRDVDAIRACFAPHLRRADNYLGVLNECAVLLNLDASDARAVVAAVDAELRVG
FT                   AASRGVGETQRNSALASGSVNAAVERLREAHGVHRLTASQVARVLSKRRDAGRGGGL"
FT   CDS_pept        complement(152359..153825)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632959"
FT                   /orf_name="MICPUN_61092"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65734.1"
FT                   /db_xref="UniParc:UPI000199B1A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ3"
FT                   /transl_table=1
FT                   /translation="MPPKKKDAKGGGDDDKPPPPPELPELTSHQLEMNERALHAARLQI
FT                   SLDAFRTRTTSLERTNAALKAAVADTTRATSDVEEYLTWELAARREIVDELQARIDAKT
FT                   RECEGETRGMEVRVRSARERADGETRELTARVDALRETEPDISRRRDDKTRILDGLAEV
FT                   SETVARELHEMKTNLHDLESALARDRERLRAESAARIKATRLALMRLTDEELENTTKRV
FT                   IARNERAAVELESQSRDSDALVAKTIELTAEHERTRRELELQRALVRASARREGDLRAC
FT                   ADALAREVGRSDIAIASANEGVGTRSNSEDADFDFDGAVAEAAELERETDALRLGLERH
FT                   VGATRALARRAAAFGTGTGIGTKSRHPGAGTVGGGAGDDVDCNVNWNGDGRDVDARAFE
FT                   AVYGSLRGFVVNNETRSSNGGGGRGAGVSLDDLDARRRAAALDVLHDDLAAASAAKQAA
FT                   TEQAEHATSVPASTKRRFAPSPPAAPPRWK"
FT   CDS_pept        join(154155..154250,154396..155835)
FT                   /codon_start=1
FT                   /gene_family="HOG000241803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632960"
FT                   /orf_name="MICPUN_61093"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO65422.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG562927"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="UniParc:UPI000199B1A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ4"
FT                   /transl_table=1
FT                   /translation="MASAVMSSARAAITSRPIAPKRGAKPLRAVRSVHPTVTVAAAADE
FT                   VTVKQHDLGDCKVRLEVAVPISVQNEAYQACLEGFAEKCQIPGFNYKKGGGRKKGDAKL
FT                   PPASVIVNFVGAKEFASACVEEVLQMSIPVAMETVAATALQDSERIETAFDDLKKAFSG
FT                   SDCAPIGDLTYSIGVEVVPTIKWTGDYRKLKVTVQSPGDDVTDAAEAESIFNAALRNLG
FT                   TMRVVADRGLEVGDQVVMDLSAVNKATGEEIEGIKQEKFNLDTGAARLNLPGLVDGIVG
FT                   MKTGETREVPITMPDDWPQAFIRGVEATFTVTLRELFQNDVPEATDAVASKIFPDASTI
FT                   DDAKAKILESQKATTAAMLEQATNEALVDALAAICDAPLPASIVEETGRQMYSQKMLEM
FT                   QVGSGLSMEVVNQLASPEMVEKFLETDRKEIELVVRRTIACEELFRLENIQVSEEEFKA
FT                   EVVAAKEEFERYGTEYDVQRLVEQAGEAIEARKSMEWLRAHAEVTVLPPAGTA"
FT   CDS_pept        156173..157810
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632961"
FT                   /orf_name="MICPUN_61094"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65423.1"
FT                   /db_xref="UniParc:UPI000199B1A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ5"
FT                   /transl_table=1
FT                   /translation="MSGGPTRVASRALARALSRPLHTSGTKDKAAHALNLASAAAHPPP
FT                   AASSASALPFFARFIGAILDVALTPAQRAAMLDRTTNDDGRGFAAAGVARGDSDALAAV
FT                   AAARRERDVALDRVADLESTTASLRASVTKLEGKTWSDSDQMRLLRDQLWQANQDAADA
FT                   RVALNAVREDLEHAVRREADLAVRVVAAKDEAVAEVVTRAKTEFDQLRTSMEEKHTSLL
FT                   ASVECKVAKLEATEAKARGLEAALAAAETRLAETSALEKKVASHELYGTMLRDFGYKKI
FT                   YAMPAKNLVCKDKVGIYDQQRAFRAERAQVIAAEKAKEAVFSLPGVVTLAEGTAAVRGK
FT                   KTKKKSSLLFGSSSANNTGAHILDGQHRVGALEILLSQGVIAPDHTVLVEVFENVDDAR
FT                   ASEIFTEINAAQPIRFVDMPGVAPADVKWMLEGAAQRIKERYRAMFSASERCKIPNINL
FT                   DVLREELFSAEVVTRFGIADEDAFVAWLESENAKLAQRTEKEWLEARPKRGRGSTGSEE
FT                   TYLKALAKAKEHGFYLGMDFSWLDVTDA"
FT   CDS_pept        complement(158025..159032)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632962"
FT                   /orf_name="MICPUN_61095"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO65735.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199B1A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ6"
FT                   /transl_table=1
FT                   /translation="MSASLAAATRRPVARIDTRCIRDARLASSSRASTSTRPPPRTPSI
FT                   VAKVHRPNHPIQPSADDDVGRSRRDVLAIAALFTQCAVGTPLAFAAADDDDDLDEEAAQ
FT                   AAIEASMKDVLSKNSGEVSYPRRAAFDGAFGVDGVKAASFEVSNLWTVAPVVQDVTGES
FT                   GFPAMARWGEIVDPVNGKVAVEARVFVTKGFAKPSIADLGKPENVPVAKALGLDKYDDS
FT                   YRRADMLGSYKRVDVTDGDRVYYDWEMVASPPPKECPSAVGCLYPQHIYLMSATVVDGD
FT                   LYVLSLDAYPENWRLAGNSLKRIRNSFRVAAPEIVEPVDPNEVMLGEVPVGAMS"
FT   CDS_pept        join(159329..159794,159918..161554)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633393"
FT                   /orf_name="MICPUN_61096"
FT                   /product="Predicted protein"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65424.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="UniParc:UPI000199B24D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ7"
FT                   /transl_table=1
FT                   /translation="MRRTRDRVAGEPHRAVARSPVGVLLLALAMLTGCASAADLAPAAS
FT                   DEPRVAGPSRGGFKEALAASARPSTIVQTAASTIPSVADRAGLPPPASRAVTARERLPS
FT                   EHSREFLAWARRYDKLLEYCPDGAVPCAESLRREAVWRINARHIEEHNRRSGSLMKKGL
FT                   TRFADMTSEEFTTNAATYSTPLLSVSSKAELRAELPVDVRRGERAAASAKERYLASHAA
FT                   DGDGTSLSLKLATDAAAAAGERLPSERGAHAEDDGHVEDGIFGSVFPALGSSRTTDATS
FT                   KRGERAERKVRKTSRGVDVATSARPRVGSAPSSGTSASEGAGPLGTNLPTHFDWSDVVD
FT                   FGDVVHQGKCAGCWAYSTAAVIEAARLIDARATAARSGDADAASRLTTERLSPHALIDC
FT                   DDLDRGCATGNMASAYSWIQTSAKGIPTMAAYPRRGRDGVCDTAALGAIRDENVVRTEG
FT                   YCDLPSLGDATEAQTLQALAQQPVAVGVNVHALQFYESGVVDVHDCPPASDDPLRAINH
FT                   AAVLTGWGKDEATGKWYWILRNTYGEHWGEGGYARLAFGKLPGTNFGTCALYTEGNYPV
FT                   LGDLQCTEGAVRKEAVKHGKHVWLYPGGYNMGPRDAKWRWPSWEEMRMMLASGGWPAGS
FT                   EDGVAAVAVLGVACAVIVAALVAARYGRRGAGAGVGGAGGEGGEEVEGLLSAADGGAAY
FT                   GAAASP"
FT   CDS_pept        join(complement(162188..162308),complement(161782..162077))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633394"
FT                   /orf_name="MICPUN_61097"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65736.1"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000199B24E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ8"
FT                   /transl_table=1
FT                   /translation="MSDKWSTGLCGCCSDCETCCISCITPSVALGQQNKIINSGEFCSP
FT                   SCCLYSYFGGLPIGCLIAGCCCIGPNQTALKSKLGITQSDCLGDRCCAVCCQCCVLARM
FT                   GRELKARGIYSMEQLNGQLPATLAPSNMTMVTPK"
FT   CDS_pept        complement(162589..164322)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633395"
FT                   /gene_name="URB"
FT                   /orf_name="MICPUN_107382"
FT                   /product="Nuclear envelope protein okuribin distant "
FT                   /protein_id="ACO65737.1"
FT                   /db_xref="UniParc:UPI000199B24F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBJ9"
FT                   /transl_table=1
FT                   /translation="MRRRARVSRPESTHPPARVLLASGERERDGAGSPSPPPPATRTTT
FT                   TTSRTFAVDAVDAAALVADLVVARADADLADVLSTSLTVAIAVEEAGAREAGGVGDGER
FT                   TAVLCELVLDPTNRWRPSAPDCTATRVVDVDDADADETADGGARVDVLRVEASLPPPRH
FT                   PPVRLAAVTLTLTTTQTAASTNTNKFPSLPPPPLDVRGVAVVTGEDVDALARAWLARAA
FT                   RCAEDALPATVDACGADEVPFPFPAPGFGPGGDALVVAVVDDARLRGCCAATRVYHAEE
FT                   CACALDVFDVASDVASDVASDAAGEEGPFNRDEKLDDAGLINGVPLTTFPPPGAVAAED
FT                   RTLAAALHRLCAASDATSDATSDARRLRDVAYGAAAKSCVQSSAVMTAVSASAARLLSG
FT                   TRGDHSTSLDAQSSGAASDVESGVAYDVASDVASFLSWLDGDARESRPEVFTQSTASAA
FT                   PPPRPRPPPSPLIPLIPPPTMTTTTNTTTSTITTNTTTNTTTRAWRPDSAFFAVVVAAL
FT                   LVAGLFVVVVCVRLARRWRGTGGGDDVGGTGAADEGGEGGDEGAAGGEVLLIRRRATGK
FT                   P"
FT   CDS_pept        join(164709..164796,165114..166093)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633396"
FT                   /gene_name="WALI"
FT                   /orf_name="MICPUN_107383"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65425.1"
FT                   /db_xref="UniParc:UPI000199B250"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK0"
FT                   /transl_table=1
FT                   /translation="MFAAVERGTARTPWEFSIPRSSLENEGCTEEHLRRHLDHMVTGFE
FT                   RSTRVRIPKNDAKTYHDFVTRDPAFEASDKSLAVVVHRKGQPEDAMDADENAHAILAAW
FT                   EGFPAVSYADDERVSVAMHGHISNAPEIRELYGLPPAEPATLVDPPTPDNSHGPRRSRR
FT                   ISGNKATMDAANANANADGPHAGAANVPRIEGARLVLELYQRRFEDKDGDPSDQPVTAL
FT                   TACEGSFSFVLVDKDRDAILIARSCESDTHPLFWGTAPGNPDGEDWDGSMLIAHTIESI
FT                   DELCGGAAVAFPLGAFYYVDASMDYGVIQRMVTSAPKRKVKPLHRVNSSGQVCGLGFYT
FT                   ESGQNLASLHSKFIA"
FT   CDS_pept        join(complement(166644..167965),complement(166240..166579))
FT                   /codon_start=1
FT                   /gene_family="HOG000264548" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633397"
FT                   /gene_name="CUP201"
FT                   /orf_name="MICPUN_107384"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65738.1"
FT                   /db_xref="HOGENOM:HBG562935"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI000199B251"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK1"
FT                   /transl_table=1
FT                   /translation="MATPPTLAAAPAAPSAAAADLIPDADDYDAQLDVVRSLKSAGASP
FT                   ARVKSAAMKLAQLKRATWVPSGTASRRKKRRAAIEAAKEGLDPREVERMEAARDAAAVA
FT                   EYPAMDPPPMDADGFVVSFPPPRVSFSSSSSTTTTTAREDDTAAREDDAAALAFFRRYG
FT                   FVVYRDVLTREECAATRAEIWDYLERVQFPPAPGASRALSRHDVTTWDLMDNRDTYGLA
FT                   PEPSVFTRQCVRNRQNPRVIACLAKVLTREDDSVCGHHDGDPSPTAAHRHGGDAAPLRE
FT                   EALREVIVSQDRWCVYRPTVNVRTRRDAIDGTDGGDGTAGDTAGDTAGASLTDDAFCLL
FT                   DKPQWRTRPNVHLDLHPWNFAAPADVLPTEHLTFDELRDFSRETNAVSSATGPHCQGVV
FT                   ALMDNRTEDGGTVLVPGFHAVFDRWRDALGDPTRYADAHEDWDKNRLVWRGAGAGSFKF
FT                   GSNDGVHRLKVRVPMREGSFLIWDQRVAHGSAPNASDRPRMAQFVKGFMRRGAGAARLA
FT                   RRGARIKVELARAGTSEEVSALGWRVFGLDAVGTAE"
FT   CDS_pept        168067..169443
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633398"
FT                   /orf_name="MICPUN_102143"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65426.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG562936"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199B252"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK2"
FT                   /transl_table=1
FT                   /translation="MAEDANAAGGSVLVAEVLRQRAVRERARWEEFNRRAREEEEEGAE
FT                   RGRTRRAPARGGDNGDDDSRAAGARNDEVDETPTAATVARTEPTDGDDDDDDEPMCRIC
FT                   FGGEEDGAKGADRLFAPCQCRGSQGLVHVRCLNQWRARSRNNASYFECNTCHYRYHLER
FT                   AAWAGRLEDPRVLAATSGCLVFFAVLSVGIFVRLAATRVLVPLFARLAAVAKRAGVPHG
FT                   AVVDAFANLGNPRPSHSWRDSVRAAYEACTAGKKAKSLTCDSPALRSSLMEAHRVVTRA
FT                   VALVDASPLHLEFAFYRVVEWLPPWWCVGALDGWNDHFRNGITIDQLVGGSAGGGGSSS
FT                   ADVGSWRRRWWWWSPRHCAGDVADALDTVVAGLVVLGFTAFGWNLGRRLRGNFRFNFEH
FT                   LLLPLAMMVSSHGARTARLIVPLGVMGGYYEVYRAVRVWSKELLTRFGERVLEVRPRPG
FT                   "
FT   CDS_pept        complement(169661..170416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633399"
FT                   /orf_name="MICPUN_108855"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65739.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B253"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK3"
FT                   /transl_table=1
FT                   /translation="MVLKHCDTMKPEDFIARQLRWTRDPMQMRRYNEERVEIFEDIVKE
FT                   SGAVDELQPGVERFLELLQRANVPMAVMDGKKRFSQLCVTLDDLGVARYFENSDSPTGE
FT                   PNVVSGEDVSDWLPDPLPIERACTAMGRTTKRCVVFGNNTTVTEACMECGAKSVLLLGR
FT                   QPRYELQGADTVVERLTDLSIENLKRLFTEETSDAAEPEREKVEIFPSKFTAPVVAERP
FT                   RWEPEAKSDDAGGKEPPDYLRRRRRRPDN"
FT   CDS_pept        171389..174781
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633400"
FT                   /orf_name="MICPUN_61103"
FT                   /product="Chloride Carrier/Channel family "
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65427.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG412636"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000199B254"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK4"
FT                   /transl_table=1
FT                   /translation="MPVHPPMVPRREGHTLRAPLLVPEVASFEDEDPLDVEAGDPGRRS
FT                   SLDDDTARANSGDSASPSSDDTDALWPQPAVPSHRNPGLETLDYEPVHNDVLHEIFADD
FT                   RRNRSLTKHFYGYTGLTLAKYALTIVVGVCTGLCAAFIDFLVDEVYALKQWLILENFSK
FT                   DPSNAATDEAAAAHRSAHYVAEYVTGYTALCLALVLGAASLCLFWAPQAQGGGVTSVMA
FT                   YLNGTAIPGLLSWKSLVAKIFGVAAACGSSLAVGPEGPMVHIGAAMASVVTLAMPRAWL
FT                   GEVRGGEAYDDDDGDDSDFDSDHDSGAGARRAHTKASREKDEDEDLFDAIDDAASLEES
FT                   RRRGDLLAGSIAGNNGNGGNDESAGRSSGGPRGSNGRDGRRRGRRLSRGGSSAFSAHHA
FT                   HNGNSAGNNSSARQPTRRSTQLSRLLLDLASNATQREFVSAGAAAGLAAAFGAPIGGVL
FT                   FSLEEASSYWSRKVMWRSFVCAAAATIVLALCMERGNAGMLFFGGVRPVAPRDYLHQLP
FT                   FFVVAAAAAGVCGVVFNQLSHWLTAHVRPRNTAVHLRLLECAAVSVSTVALRFFAAQRF
FT                   GSCVDASPAWEADDFGVRFLCPPGKVNDVATAFFSSPNKAIGWMLSMGEHAWGEPYGFT
FT                   PAGLGACCGFYLVMMIAAYGTAVPGGIFMPSIFLGACGGGALGLCFRELLPESWDVQPG
FT                   LYALIGATAMLGGVFRSSISLVVIMVEGTGGITFVFCIIVAVVVSNAVSSWLQKHGVYH
FT                   MDLHRNDNVAYLSGEPPRKFALLTARDLMASPVSCVAETERRSRVLSLLTETSHNGFPV
FT                   VDPRGRLVGMCLRSQLSVLIHGDKHARPGSHPGVRRALDTYMRVAHLRRRPMPRPLLPR
FT                   RYPPATALSAAALAEYDREMSRRERETSGRDGGRNQSPGEDRVGLLLNDAFAAMHAGEG
FT                   RRAYDDEEPSEEDERPLSPPLERPRDSGGFGSEFGGSARGSAPLSQVAQLEQDSESNAH
FT                   GSTSASESVDGGVPSRPSSRGVPHPQQSRFAQFQEEVAAGGGQFPSHHASYRPPVFELG
FT                   QIRDSSNEDDDDERCDEGAASLDVASFMHRAPLAVQADFPATRVYSVFTTLALRHLTVT
FT                   DAGNRVLGIITRKDVMAAVDGAH"
FT   CDS_pept        complement(174955..176415)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633401"
FT                   /orf_name="MICPUN_50475"
FT                   /product="Thioredoxin/glycogen binding domain family fusion
FT                   protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65740.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199B255"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK5"
FT                   /transl_table=1
FT                   /translation="MRAAYGNARASTLLVVEFYAKWCNSCRRLYPRLCRLAAQESDVLF
FT                   VKVEFDECKDLCRKLGVVKLPYFHVYNGSGSRLADFASSLDPTKFKRLTDAIEANRGIR
FT                   CALPANKSETQEQWQDDAYLSSLVKLHHVTFVWRGGGDDVMITGDPAGGWTHTLTMTKV
FT                   NDIGGDGPLDDRSSATHVATCILPTGTFRFKFIVDGSWIVDPNYPIIADEAENVNNEIF
FT                   VGAAHWPFQWVQMPTAAPPGPPGVGVNYSPVALDMHAPDRETAAAAGVSGGRVGSGARA
FT                   RGGSRDRRVRDYAESDADEVRERMAEKRRADAERARSLYASSKNRSGIVTSSIDKFRPP
FT                   SSDEDGDEDGDGDGDGDEGESPELPPPSAVANNTVSTIGADSSFPKKVEVSKGSYTTKS
FT                   EHETAVEQERAAAFERLKFMRKEREAQASNPSAPGYKLSPSEGAGVVAASPAVATQSDL
FT                   LTLEERVARVERILNSNNLTEEQWLNEG"
FT   CDS_pept        join(177191..177337,177600..177986)
FT                   /codon_start=1
FT                   /gene_family="HOG000140414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633402"
FT                   /orf_name="MICPUN_102147"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on NADH or NADPH"
FT                   /biological_process="electron transport chain"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO65428.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016651"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="HOGENOM:HBG600003"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="UniParc:UPI000199B256"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK6"
FT                   /transl_table=1
FT                   /translation="MALLELARKGAGLVARVDSQPALQTFARAMTAKVNQVTGAPMELY
FT                   EKRKVVIFRPARAACQQGKALLNTWKIHPGEQQKWENPLMGWTSTGDAMAHQFNSILSF
FT                   DSKEAAVAFCEKHGWQFEVQEPQLMGKGASTIPGAGKAGVRPKSYGDNFAVARKGIPVW
FT                   PHPGFEGASQRAKK"
FT   CDS_pept        178330..180381
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633403"
FT                   /orf_name="MICPUN_61106"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="nucleic acid binding"
FT                   /function="unfolded protein binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65429.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000199B257"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK7"
FT                   /transl_table=1
FT                   /translation="MPPKYKMRCHYDVLGVNRDADDAELKRAYRKLALEWHPDKNAHRQ
FT                   EEAEERFKEVRGAYETLSDPNERAWYDSHREAILRAGKHAAGGEDMRPEDEIDLMPYFT
FT                   SNAFRGFGDDPGGFYQTYETLFAALDKQEQAASLAAGKDHFKASPAFGASDAPWTQVKS
FT                   FYQHWGLFATMKTFAWADEYNLAEAQNRKVRRLMDEENKKLRRGEAREFNDTVRQLIAF
FT                   VRKRDKRFIAHSAEQAKLEKARAAAAERKRLAAKKAKAEAASAYVEADWAQAEAPEWLA
FT                   REIEKEEEAKARKEARKQDLYCPVCKKKFKSQKQWENHEQSKQHKAAVQRLKEQMMEDE
FT                   EVVKAALEDEDSQGESDDEESEGESDDEARRNLRENLRNLNLDENDENDEAEKDEETED
FT                   ETDDEEERKDLYRNWVPKDKSKNPRLASEDEEESEDESGSDEDEDAALARMMGHARTKA
FT                   ATPRANTDSDNGDGSSSEDESEDEDDALGRMMRTKRRVAFKEPVAADAGELSSGSGSDS
FT                   ETESVTTVGRAERLARNKPRALLKKGKLNARKKDVEAPVVPSNPLHLLDSDSDAIAEGD
FT                   EDEDDEGAARAAAQRASMFDVLDAEVVDDGAGVTPAPDDDDDDDGAQEEAAAKKPNRRA
FT                   KKKGFEKPDADAGANKIRCQLCKMTFASGNALHKHLKDAHSGVHKKKR"
FT   CDS_pept        complement(180476..184588)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633404"
FT                   /orf_name="MICPUN_61107"
FT                   /product="DEAD/DEAH box helicase"
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65741.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG562941"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B30C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK8"
FT                   /transl_table=1
FT                   /translation="MGDERKRRRDESLEPHASCDEPFDPDSFDWEVSAHGTPADARSLT
FT                   LVVGTTAENSPRVIASSQNADRPPNTIPPQARYEALSRVFHTPRDAYPRGCPEERELRD
FT                   FVPKAARFNARLRAASSVARSGLDDADATRATTNGGDDGPLNLPRRYDPRYKVNAAVLT
FT                   APRPELERAARRERLPPAAVDEYRSVLAHYEDFRQRRSLAKLVKLAKDKSKLPIAAEMD
FT                   AIVRSVTEHPVTLIAGDTGCGKSTQVPQYLLRAGFRRVALTQPRRVAATALARRVSHET
FT                   LNEWGGEIAYKIRFDTTNDGARTRVLFMTEGVLLRQLCADPDLHEFDVVVIDEAHERHL
FT                   NTDLALGLLKSITERRAEFRLVIMSATIDLEMFARYFGGCPAISVPGRLHPIKLTYLDA
FT                   NLAGGRRVDRADEKPTVVGSNPSRRGFRNRDTGERFERIDPHPYLVLLQRIDAKYPRNQ
FT                   RGDLLVFLPGMAEIGAVAEHVRPYAVESKRWIILPLHSALSAEEQDKVFDAAPEGVRKC
FT                   VLSTNVAETSVTIDGVRFVCDSGRHKEMQHDPRTGAGSLQEGWISKASADQRKGRAGRT
FT                   GPGVCFRLYSEVEYERFRKNTPPEISRANLQGLVLQLKNIAGGTCDARYFPWLEPPPRD
FT                   ALESATWALREHGALTSAETLTPLGGLLASLPVDVNAGKLLALASLFGLTGPATSLAAA
FT                   LAVKSPFARKPGGSASGNTREARFDFESPHGDPFTALTAYARWLDVRDGRRENSRKWCR
FT                   RMGLEEQRLVEMAKLQRQFSDACEGSGLTRKNGGGGGESGKGGDGEVGGSNPRGGGVER
FT                   GRHSVLRHKRRLLRDMQRARERERGRRVLAPDGDGGAGGSDPDPDDDDDDEKSPSTVFE
FT                   DEIRALDLAVHVDLRAARRAARGGALGRGETSLMKAILAQALYPRVAAPDSNNASRERE
FT                   SDWRFHCREVRDAVLHPTSSLCAPDHAPAPTEVVLFGEMLETHRVFLCNCARAPAHALL
FT                   LSASNVECDVYAERILVDRWLMLRVSTAGGGESLLVAASRLRLATRALLRERLRVSKGS
FT                   RRRSSNGGRRRGGGVRSDEDVFEEADAPPADLLAAVRAAPVPEAARLIAEETVSACGGV
FT                   LDVDPSHPSRPSRSPWGEHGVRGDDLADDLAKFIEWPVRYDVEVVSKSALLRNLPPEHE
FT                   PVADGVGDGARKTNASSFVGIAVAPWLRWAGLREKEDDLADHAAAPHLRKRWKCPACGK
FT                   TMMAFYQEIDRHRERCGLPEEERDPAALPANFGKGGGSGPSLQEELAGGANLGLPREAL
FT                   SLRPPATTSTSEFADAPKPRDDPGGNRSPDLKYDPGGHVNLFDGASVAQGGDAPSGPTR
FT                   SFGCEKCGKTLELTTVGILKHRRSCRG"
FT   CDS_pept        184742..186085
FT                   /codon_start=1
FT                   /gene_family="HOG000276711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633405"
FT                   /orf_name="MICPUN_61108"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65430.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316689"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199B30D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBK9"
FT                   /transl_table=1
FT                   /translation="MATRIAKKIVVVGGGNSAGYFARAVVAAGRGADLTVISAEDVLPY
FT                   ERPALTKAFLNETGPARLPGFHTSVGGGGERQNQEWYDANGVEVHLGTRVVSWDAASKT
FT                   VTTDTSASFGYEKLIVAIGCTALKLPASMGGDLPGVHYVRDHADALALYDAMSKARAPV
FT                   VIGGGYIGLEAAAAFAARGAKPAVVMMEPHVMARLWTPTIAAHYETLYESKGCVFHKNA
FT                   KVSAIARGEDGRVESVELEGGVTLPADLVVVGVGAGAVTAPFDALDTTPDARNPGGILV
FT                   DHTFAASGVNVEPKSVYAIGDVAAFPLAFDDNQTVRMEHVAHARASAAHCARCILAADD
FT                   DDTQTANAPYRYTPYFYSRVFEQSDSTRKVAWVFYGLQRGDVVCVGDFAPKLAAFWVNE
FT                   GVCVGAMLESGTPDEVKAVQAIAEGRPSVDVEKLRACATAEAALALFA"
FT   CDS_pept        join(complement(188739..188819),complement(186240..188576))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633406"
FT                   /orf_name="MICPUN_102151"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65742.1"
FT                   /db_xref="UniParc:UPI000199B30E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL0"
FT                   /transl_table=1
FT                   /translation="MVFGSPSGLVPDYNPASRYRQHAKVSTDEALRNNDPYARMSDSYG
FT                   SHADQKAYPRGTPYKKNPNIIDAWDPDEKPKRPGEGARVSDVYGAHYRDPKYKVPRGGV
FT                   ALSAHGIPDPLDDDDEAERLSSASRNTAARTLKPKAGKGIAGIDYLGGHDQETFGKYFT
FT                   NGQEFEGYYQGLHAGKKNASQFTGSGLNDKNWVDPYENYRGGVPRLEQRPLPKTMDMDD
FT                   GLLMHMAPQRREHAAPKVGEKRQELERFRRQQATLQGVNDMSIQDSNRLGVGKKDPRAR
FT                   PDDQRLIKSLLPEKEGGEYKIDHTTRAKTEHSGRDFESHFSGVTFAPEAKDIDDGIFQE
FT                   GRFKEEIRDARSHMAFKDGVLQAEKGNTDDGIFQEKGEKRGGLKPGMYDREGRRIKPGE
FT                   RGATEKGQIGRGFIANESATNEGIFDKNHVNKWAAKRAQSSLSGAGMKLDNKYTDDGIF
FT                   DDRHKLRGGDAGKSQRSAMGRGIGGLMADESATNEGIFDSRHKNRFAGRGQAGNLRVGK
FT                   GGMMAEGNKVDEGIFQSGRKIQGAGLDTKSSLKFSEAGIVGDETGTQVDMFHGPKQGKS
FT                   EYELKGQASSFQAGFMPKQKNANDGIFREGRVTKFGGKDNETGLGPGLVPTAERAADGI
FT                   FQEGRTNKFAGKDNETGLGPGMIPRKECASDGIFSEDRTLAGGFAGKDTYSQIGSDFMA
FT                   KEGTYLREDFASAYSEEFANKDTEDHFEAGLIPQVQWKGGSEAKAAFERRTQLKEYYTN
FT                   AAKATAEGKKLDFYKRRGANDEAPAAGLGGNRFSRGGNQIARTAGTAPFGTG"
FT   CDS_pept        join(189187..189225,189431..191281)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633407"
FT                   /orf_name="MICPUN_61110"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65431.1"
FT                   /db_xref="UniParc:UPI000199B30F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL1"
FT                   /transl_table=1
FT                   /translation="MASMIRIAPITRPIIARVFGPGAARDPFEEPPMPHFADPAEDLES
FT                   TLPSEVDLPRERYTRVAADDDANVFFNQVVARPKPPVEPPATRERLVEVETAAEEARLL
FT                   AQRAAADLYDAAAQVELARAPLADATNIQRECADDLEAAAQRLSHAQVENERLVKTTGT
FT                   NSSTAWDARRDEADAVAATDAKMEAGARMRRASETVKKAEEFVVESTVNLERQRAADEA
FT                   AVQASFDAIDVANELAASMDAVDQALMEADSRHKDAVRMTLECNEELRTSRDAKDADGV
FT                   AEASSALAAWQRELDLSKNALDRARKAQADLLERTEGAVAAAEAAEEAKAEASQRAKGA
FT                   EVKLAAARELLGKARQNFREAMAAASAKKTEVRVVEERRETAVETKIRVQAAVITARSA
FT                   FEHALTRKLWADDRLDKESNRAEMLALKRDMAQSISQQSEQRAKALKKEALAYAKRVLE
FT                   VEAAREAEAEEEARLAREQAAAVAKESEERAKARREEAWELVARLAEAEAAAEEAASRE
FT                   FEARKTAKVAKDELASIAEFEPVTSASKREEAKRLAEQLAYAEAVAEAERLVEEERVRI
FT                   LQMQEAAKQNRARTVGEARRLVSEQYGVATLANNAKAFKASAKEASPSWLLWE"
FT   CDS_pept        join(complement(191963..195972),complement(191411..191762))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633408"
FT                   /orf_name="MICPUN_61111"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65743.1"
FT                   /db_xref="UniParc:UPI000199B310"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL2"
FT                   /transl_table=1
FT                   /translation="MSPTTVLVPLDGESLPTHAESSSLPALLTQPHARPIRCVASMPGH
FT                   IALAVSGSTYVHACSARPGDAKSAEAAMRRALSQKNGPAGGVARTASSDLRAAFGSGEF
FT                   GGVVDGAGDVGGDDRRRDSQLSFHGASPVAKLMFLPQDDSRNVPCVLVAVQENGAVAAW
FT                   CRVSRAGDDDDDAVGWTEMAEPSVPGGPPEIAPPLRGYRKGAHGVVIDAALAVTEAADG
FT                   DTAGGGKSGLWGGCVVRVVTLVDSVGSDRSDPYGSASNASFGSKRVPSLIAREVRMPSV
FT                   ESVARAVRSPFSFVRDSTPTTPSTTPAADPLKDRTETATIAVEYPGAIALLGAGGSDLW
FT                   VVCAGGGGEGGGGAGGGGGGTHGHKGEGGGGGGGMRRANGCEAYRWNAALGVATARVNV
FT                   VAAAAAADAVAARIDGDRDWELPNREASTPAVALTAPGRELLAVTPRGEVIVASPPLQR
FT                   CPVGTPSAPPSAPHGPPEPIAWRHLATLGGFREEFAPHAGGAGRRWACVGSVAARGSFL
FT                   HIAWCFANDARGDRAGGDAVSGLDAAPGKSAVTTYHLSTGVAVGTAPMPSLPPPRGSLP
FT                   LADDDDGEGGDGDDDDDDDAGRRRRRRRRRRRGLVVVAPGVGAFPEIIVTAYETGGTAG
FT                   VFRLEQRVPASLAASIDAVVDGSLVDPLSVIEPPPSAVRRAARTLRLLANECAGWGGSA
FT                   EGARRRASLALAELEAIAAARGFELDLDDGDDDEGGGALSAGGTLRAALLLRERDAGAV
FT                   NAESWRSAAAKCVESVRSPASASSSFQGYLSSSADVRVVEDALRDAEAVDVEKYPSNDE
FT                   VSGEVSESKWKRLGTPAMARRLDPAEWDDATWYDLEDDVPVHADMRVGLAVMESAEASS
FT                   AAAVPESKALDADDGDALIKCRNAIHLATQAARARTEPTAALSAGTMFDNHAAETVADL
FT                   CDGSFDGGNVIRATGDAFDDAFRLAVDHISTATLGAEERVANSRGGKTGHSSDADPGQR
FT                   DYGVFESTCAVLHACWPRALPSFARAYAFKRGVPAKKIATVALRRLAPTKLELSDWPAG
FT                   GVSCVARACLLHVAGHTRVATWMLLTGVRCTNDPEAALNEMMERCARVNAEKEVSGDVP
FT                   EKFDTPGARRSTLVRHSSEEDDSSDSSGDDDDDAGDGAPMSARAFAAFGGSSIKAGLHR
FT                   ERPGKELRSTPLGWRLATELLRACASVDDVQATADVFDVLRASFTASAGAASAWQSPQS
FT                   RSQSQSQSPPSAAPPKQTCVDVAEDGLCTAEGAAAAFLAAAGVAARCWAGGAVAEAARA
FT                   FEKLTNVDPNEGIDERHDAPRLVTWDSARVDALERLAGEAASRLREMAANVRADEGSAP
FT                   MSTRRGLVNNLFLGAGVGVNLYGAYFVLAFQGHLPPDWLPGAVLGYDEAVARGDDRRSA
FT                   RAGEGAGGVRGSTSAEGGVGGLGMSKVATPPPPKRGWWGTKRPGDGSSTAR"
FT   CDS_pept        join(196223..196352,196443..199135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633409"
FT                   /orf_name="MICPUN_61112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65432.1"
FT                   /db_xref="UniParc:UPI000199B311"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL3"
FT                   /transl_table=1
FT                   /translation="MSFAKPGTKPPKPVPIRGRGAARRKPSKEDEVSERERRYLEELGK
FT                   EVDRNTAYLQREKDALDVLQRERSANSPVPKQRPMPPGAYPNATEEANHVVVDPAQIPG
FT                   LGGGGHGERRHFASPNDGGIRAYPSWDDNVGGYTIPAGGVAKMAALSEEMDHLDAAEYE
FT                   RLAGAGGVETLAPDHAVHAAAVAHARRPLAPSPGAFPGHLPENPDYFNVRRMKRTPGPV
FT                   SFSVAGVDPVEFSRDPRAAAEARIRQEKRDRLRAELDEQVRLKKERERLIKEADDAREK
FT                   AEVGRVSHYDRWGKRGGGGEPLVDDRGHLIAELKGVDIRSPANAQAAAAAASNAMNESL
FT                   SPGRVAEIVGYPGGDQRAPMAGVPRRGVNPGAGEYSSPFRRAGGGPSSFYLGGEVNAGP
FT                   NDLGKVTGAHHTAAELSMAEVKRLQLIKDLDEQVRIKKEQERIRALEEAIQEAKIERRI
FT                   QETIEEERRVLALKEAQMAAMNGGEYDEHGDVGFTGDAAVTTVTTAGGGRVMNSPPAPP
FT                   RPLTGTEPEPGMPGEDFGDFVGDVVLDDGLEDFEPPPPASDEAVTTVTTAGGSEAAAAC
FT                   DDDAFIPASASPAPAPRPSKVIHSPPASVDPKPIANRQLDFGDVPGLEGHVPSRVVHSP
FT                   PPGSPPPSPPRADRDLGSLRSSRQFDRDRNFEMDRYHHRSNRPTSAHTPQLRDMVAELE
FT                   ADKRRLQEELDGKRRQLHEAQWEAAHAVRERDLAERERDLEAQLAAVRAQLAAAPRGAG
FT                   GSRGSSRPVSAAPSLRASRDKPPVRLSAEGIREPVRVSMDDYDAPTVTIDRYNRPYAPA
FT                   SAADAGVTDLNALEEFVVSSKFVRADAPLGAVPGGGNVNVVAKGHTVRPSELARARKMG
FT                   DVGAGAAAKTPPPQRAIGPNYTVPDRAPRVAGLQRRAVRGVRPKRDENEPVGKPVWGAN
FT                   RPKSRAIRWT"
FT   CDS_pept        join(199626..202033,202136..203348)
FT                   /codon_start=1
FT                   /gene_family="HOG000264523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633410"
FT                   /orf_name="MICPUN_113371"
FT                   /product="ABC transporter"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65433.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG562946"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199B3BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL4"
FT                   /transl_table=1
FT                   /translation="MSAQSANDADERSAADITKAKEAVLESDHASFVAAVVSGDIASSP
FT                   VAVATGDVAEEVRVAALSIARAALSGDAAEGKSAEILSALAKMVEDKVVAAEAATQARS
FT                   EDHRRGALVALYGHCASTSLPAGDAGREPALKLILKSLGTLGDHGCFVAAPALAPLAAD
FT                   LGVASNALVKQLMTDATTSASESERRAGAAGVAGLFSGFGGSSIAKFGAVTHVEEALDA
FT                   KKDAIARAGACAMYAHMCATAGRAFEPFAVKLAPKVFALQGDASAEVRAAADAGQTALV
FT                   KSLPLTAMKLLSPALVFAMGHKSWQAKCGALGTCGDLAQRVPQYFMRTIPEIFPAFLEC
FT                   VFDTHPKVSALAGHVMEPICRCVKNAEVLGMLHLVMDAIREPQKETETCLDKLMETTFV
FT                   NSMDAPSLAVVLPIILRGLRERTKELKQKAAVTCGNICALVDDVRDLNPFIPSLKPELE
FT                   KCEEHSHPDLRECAAKAKGSLLKGLEGQGASGDRKDATTCVVKALESVQGGVDAETKAY
FT                   AASLGGWVIESAPMRIPPSILANDVKHELLALLEGMMDEEQLKSAAEGAVLEYKGLDAA
FT                   ALLDDEQKDYIVDLQGIILAFAGRVLLQRTNFSLERGKTYGIVGQNGTGKTTLLNRVAA
FT                   KDIAGFPPDVSVYYIQHEILSEKEETIVDFMVQMVPEGVSRETVVNTLKEVGFDDVKMA
FT                   ATIQSLSGGWRMKLAIARAMLWDAEVLLLDEPTNHLDTAAIAWLTNYLKSLTNTTICLV
FT                   SHDYDFLADVLTDVIHLHDKNLTYYPMGFKDFQSLKPEIVAALPSPNNAISESPAPVKY
FT                   AFDSIGDNQPAHIKPIRFPEPGPLEGVKSRNKCVMYMKEVAFTYPGTDRKILTNANVKI
FT                   TQDSRAALIGANGAGKTTLMKLLIGELSPDEGVGEVWQHHNLRLAYIAQHSMHHLEESI
FT                   ENTPLEYLQNRFYLGRDKEIAKRSSHNLSKDELKQSMERGQISEIIGRQERGKTLFYEC
FT                   RRSGREDKDTEWEPITSLMKKDEYVMKMVRNFDEKLKAMQSGMDLRPLTKEEVRLHLEQ
FT                   FGIDQDLAMGKIKRMSGGQKSRLVLAAAMWINPHIIALDEPTNYLDNDTLAALTKALKD
FT                   FQGGVLTISHNQAFINELCNETWTVGDGMVVAKAIEGKEKKMSVAERRALKKGGEDAAA
FT                   DVALKGAKENKKLTSKEKKAQKEAALKAKGPIKDAYYKGI"
FT   CDS_pept        203686..206358
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633411"
FT                   /orf_name="MICPUN_106004"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65434.1"
FT                   /db_xref="UniParc:UPI000199B3BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL5"
FT                   /transl_table=1
FT                   /translation="MMSKDLEWGAEAGASQPGSSRWAPSRSARAQSSSQQWHRPVYGAT
FT                   AEKDDDDSYDGYPAAPSHHSLGVDEQGRPVYKESTLAWFFRASEPIVFWAACTLIAAFS
FT                   CISIVRITRSPHFPASLPEGRDGRSIQVGYIANSTEAVNAFKGCRQGAGGDVLRSDMGR
FT                   DRFPDFIVAGSRGAPTMELHTLLDEKSVACAAASPFDDFFSDPKWRTPGAIPLKDQRAY
FT                   VKDNYARCTREDKYLGAPRFQTNEDLLYSGWAPRRMCETMGPDETRALLLLGNPVENAL
FT                   TVFAGTLENTPEREFNGWIRRSEAALAEEAAEKASKSHSKAPSKAGFSKTSKEPSKAAP
FT                   SASAAADGAKDAEGGGDASKLGGDPDASSGETTASKAKEEPKEEPKEEEEAAWITYDAE
FT                   GFRKVLDVDLAIAEVCGSDFMLPEDHPEFKRNAECCAKVALEQGYERWPGCGAERGCAT
FT                   VKHSGSSDVSPGTSSGTSSASGTSTSSTLGGATRRKRIGRPSSVYESDACARKGELAFS
FT                   PVRAGVYVNQLKRFYEYVPPQNVLVVTADQAFSSGMATLAVVLIEWRMLGLPLVDPVSV
FT                   TSDLMLATAAASTGAGLSGLENSGLEHRGRRIEDGDEAGLSLPRPDVVHQSALRTYPHW
FT                   RGGGNGGVGDSDRKTFAAPRIRSYPYPNPGGLTPLTRAASVDVASTTARRTWRDALRFV
FT                   EHIGARGFHSWGWTGGVSHATRKASELIGRARRGAELVDASKVSVARRLLGGDAAGALG
FT                   KPHLHGGEGADAGADAGADAGAAAGVGDVDDAFFEDFSFSPGLRYFAELPRGFAVDTAI
FT                   DPPTRQKLHRFYDPHVAALNALIGNGEIRWWDEDGRDVAALQEETLLGGIREYETEQDE
FT                   RASSTVAGGAVDEANFAEE"
FT   CDS_pept        208854..209897
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633412"
FT                   /orf_name="MICPUN_85051"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65435.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199B3BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL6"
FT                   /transl_table=1
FT                   /translation="MELCEGGSLDVLLRDVDEVLDRATTARIAAETATGIAYLHLPDVS
FT                   IVHGDMKAGNVLLTKNRSVKICDFGMSEAKNRSKTMTAANVGRSGAALTVAWSAPELFE
FT                   DSPKSNATDVYALGVTLWEIYERRVPFGNMPEAAVVSQVMQGKRPGFLEPEDGDGVEEP
FT                   GTPRPVRRIIEACWSAKAKERPPANKIAYILSELADPSAGGGGGDDDVFADGRTRWWRR
FT                   GNNKVAAADAAVNAVRSFEDARETLGDAIESRAAESKGKLEERMRAGGRGRVAPEKVPE
FT                   PEPEPEPEKVPEPEPEPEPEPEKVPEPEPEPEPEPEKVPEPESEPEKVPEPERAPEPAE
FT                   PKPDDER"
FT   CDS_pept        join(complement(210621..210728),complement(210139..210525))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633413"
FT                   /gene_name="DNAJ"
FT                   /orf_name="MICPUN_107385"
FT                   /product="DnaJ chaperone"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO65744.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG748874"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199B3BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL7"
FT                   /transl_table=1
FT                   /translation="MSGQGDPPRTHYDILGVDPTTSTTEDIKHAYRQKARALTTHPDKN
FT                   KGEDEEFVRVKRAWEVLSDPDERKKYDAQLASRRVETVIDEHLDLNDLQSEEGYFTEDE
FT                   LDMNYTPPQLGRRLTCRYWHPCRCGGGFEVMADELHQDFDHVDLPCFNCSLHVRVTYGC
FT                   E"
FT   CDS_pept        join(210870..210953,211059..212150)
FT                   /codon_start=1
FT                   /gene_family="HOG000157694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633414"
FT                   /gene_name="STK16"
FT                   /orf_name="MICPUN_113373"
FT                   /product="Serine/threonine-protein kinase "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65436.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B3C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL8"
FT                   /transl_table=1
FT                   /translation="MEPLRRLLGDGAQANGAVDDLQSICSPSRLMKMVGDWGRSMLPPE
FT                   EVTVQGRRFQVQQQLGEGGFSYVFLAREVPDSRGVDVALKRMLIHEREQEDDALREMET
FT                   MRRIDHPNLLPLILGEIEEEPHPPSTSYVIASPARTRPAGGAGGGPRRCHMVFPAFPEG
FT                   TALDRCVSRPVAKAFTPLQLLGIGCQLCRGLEHMHALGIAHYDVKPGNVLLESVMDSMD
FT                   GAEGSCPGGFRAVLMDFGSARTATRAVASRQEALRVQECAERESTAPFRAPELWDCPSG
FT                   GDATIDGGACDVWSLGCALFSLTSGGKSPFESASGETGGSLALAVLSGKYRWGESARLA
FT                   YGTETRAAIDSMISRDASSRPNAVAARLALERAMTSASAERGATNTVTTGE"
FT   CDS_pept        complement(212266..215970)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633415"
FT                   /orf_name="MICPUN_61117"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65745.1"
FT                   /db_xref="UniParc:UPI000199B3C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBL9"
FT                   /transl_table=1
FT                   /translation="MASDEPSTSALAKTPGKTFSANLPASWMNSAKTPSGKTPGGAKTP
FT                   ARLSLAKTPAGKPKTPGVSSMFSQAPERVVVDAKPKPKTPGAYHRQLMLPARKTPGKKG
FT                   APVANPAPSMLSSLPNATRAEFWLNKAIREEERSGDLAQALYHIDAGIKRGAEPVQSLR
FT                   EAKTALEARMRTDASPPEAAPAPPAGDDGDDVEGSVVVMEAVRVPTRMLDSVRGRETAV
FT                   TQVRRSARMTPDSSGARRHSPSVRAAMTHNSIQRTLSANDYAYVPNEALENTHANGADD
FT                   VDDAVASLEAFRGDIRNAPPLTLTNDDDDDDDDARGNVENRPRDDGVAGTDEASRRLMG
FT                   VTPGVTTRTTPRSFTVNSSGKKSRGVVYVDSRGSSGGRNGRNGSLSKARSLDAPAPRKM
FT                   SFSSHSGDAAGNDEARGVTLDSDSVTPGGGASVPSVELTPNSEFAAMEAAAEAEAAAEA
FT                   AAARARATGGFLARTSSVPANYSPMKPPQSPQSTKKSAAAAIARTRGEDPKEEEEEEEE
FT                   HDVATVAVPRFEPATYDSPASMVSPTVLLPNLPTPTLRPAAGSTPTLAQEAAMARTPAP
FT                   APVAIGTFGPSPGRAAREAAEARGESPTDAVAAAVAAATPFSCVDTSRRDRAAKRRDRG
FT                   AAVSPVAFEGRSPRGEEETTQQETPGAEFARLEAEAAAEARAEALAAAELAADLADEID
FT                   DFVFPPDRGEDGELSRRAASPLAFADEDVTVALPTVGFAAAAAAGADVDADEDADEDAD
FT                   ATVSIPTVGFRPVPITPGGYLDRYRRTPAASTAAAPAGITPAFKALAARAQSPAIAKMA
FT                   ALSASVAAESAAVKSALAEAPRSPVKFTTVPVPAFIARDDEEHAGQEEEEHAGQEEEED
FT                   FLEAAPSPAAEEVKALATEDPAPMPSPPAPPRSPSIEEIAPNAAKLIATPGSEKETSPL
FT                   SVFARMMAKVIRDTKEELTKSAVKARATELMVLAGEMPSPPKSAASLPSPAARTPTTGP
FT                   VAGLSPVDVTAVTAVTAVDAASDKTPEAVPVAADKDDDADVETPPATLPSPMGSIKGSP
FT                   AVRVPVGHPAHPTASTGLTPALARLGIGSSAAPATPTETKDDQEGEEDEEDEEEATPLG
FT                   VVMTGARVTRGSVARGRHEMRSVDRLHAGVAPRVAGTPASAKRGGDGRETGTGKKKPPS
FT                   GSSPAGSAAKRSGGGGGRGSKKSSLGAAAAAAAAGATPGSVPPGGLRRSKRLSQGADTP
FT                   TSARKPWEN"
FT   CDS_pept        join(216343..216522,216687..216941)
FT                   /codon_start=1
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633416"
FT                   /gene_name="ODALC6"
FT                   /orf_name="MICPUN_61118"
FT                   /product="Flagellar outer dynein arm light chain 6 "
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="flagellum"
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="ACO65437.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="UniParc:UPI000199B3C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM0"
FT                   /transl_table=1
FT                   /translation="MAEEKPTEAAAPADAATGAPPKEEGAEGAEGEAGEPKKKEHVVSI
FT                   VLSYMNDEHEKAAIEVTIDAFDKYTKYKDVAQHIKKTYDARYPSSGKSTDGVYHAVVGK
FT                   HFGASFSHETSNYIHLKCDLHNVIIFKSKDSPFDLDAANV"
FT   CDS_pept        217114..217929
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633417"
FT                   /orf_name="MICPUN_61119"
FT                   /product="WRKY family transcription factor "
FT                   /function="enzyme inhibitor activity"
FT                   /function="pectinesterase activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO65438.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004857"
FT                   /db_xref="GO:0030599"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR006501"
FT                   /db_xref="UniParc:UPI000199B3C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM1"
FT                   /transl_table=1
FT                   /translation="MGRRRSDIEEDGYVWHKYGAKNVRGRKVGYFKCAHRGCEARKKVW
FT                   RQANGDEAVEREGTHTHAAGEAARVSEVVDEISTDNADAVPMPVNRAASGGSAGGGWGG
FT                   ADVPPGTSGIFGGFGLGLPRELVRAAADVSTERQEARAAKSRPTNVPKATRDEPFEQDL
FT                   RHERLIQLVQDLANKSRQKMTTVVALKEDSETCIETCIENTQEALRRLPKLPAEMETMT
FT                   GTELRTWIETLQESLQEPFRRLQETLRRHLESLAALDDVMTRDGPFGDS"
FT   CDS_pept        join(complement(220762..221077),complement(218041..220652))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633418"
FT                   /gene_name="MSH4"
FT                   /orf_name="MICPUN_61120"
FT                   /product="MutS 4"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO65746.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="UniParc:UPI000199B3C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM2"
FT                   /transl_table=1
FT                   /translation="MAAPTNEGAGPPSPPACTVIAAVLQNRAREVGVALFDKRGGPSLD
FT                   LEQHVEVGESHATTLCELQRARPGVILTLAGDRGGALGDALARFARAHDCALVELPRKQ
FT                   FDDIVGADLVARCARRGSRLAPNPKDAYLAFAAAAAVLQFVEHGGVERATNDAENSLEP
FT                   LVGRRRHRWEPFPLHEAARASPGTVVVTCCRSEHFIALDPAAARVLEIARPLGPTGEPV
FT                   AEPKRSNPNRSSKPINPRTDPVGAANARDSRARPHARRSLLGLLDTCATRGGSRLMKAS
FT                   LLQPLRDHATINARLDAVEELLRSGGLAHECRRRLAATTGGKDVEAVTSMFAEPRRRPS
FT                   APHSAPHSAPEGGPPSSEVRPIDANPGRVAARIRTLLDTRRALEEVPKLGDALKNTNAG
FT                   LLREIGEVLRDPFFAGFLHRIDGVFEPDVVDGRSSFSAKTRQVFAVKSGVDAFLDIARR
FT                   NFCEATEAAHELIRALRERTGLESPRLDYTATGMFQIKVTRSDFGRYSVNASHFDASLP
FT                   TLHAIDTLGDDATRPIRRDDDDAAGVRNDRVVRCTCDGLDVINRRCVDSADEAMRRSAA
FT                   AVESVAASVRANVAALGALSSALSLLDVLCAFAVRVMTSKGPYVRPVFGDRESPLAIEA
FT                   GRHPVLEELPGVDFVANSAYLSPAFNLSVVTGPNGGGKSTYLRQVAVLVVLAHSGCFVP
FT                   ATFFSAPPVDAIFTRVGTSDSMETDASTFAVECRECARILSRATCHSLVLVDELGRSTD
FT                   SEEGERFAWATAEALLERGCKTLFATHARRLGKLAQLYPNVRTSTMAVDLVGGRRRVAV
FT                   DDPNRNGNGDDQNRRMECRYRLVDGACEAPHYGLRAAEALGGFPAEMMRDAWAIARRVE
FT                   TAAAAAAAAAAAAASDGGTAGGGFLPGHSRRDAAGDDATRIAVERAARTAKVAERARRL
FT                   FEIEAGGGTEGAEGRGGREKREAALASLRATAADVAGFGGGGACA"
FT   CDS_pept        complement(221406..222104)
FT                   /codon_start=1
FT                   /gene_family="HOG000265461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633419"
FT                   /gene_name="CBR/ELIP4"
FT                   /orf_name="MICPUN_61121"
FT                   /product="Carotene biosynthesis related or early light
FT                   induced-like protein"
FT                   /protein_id="ACO65747.1"
FT                   /db_xref="HOGENOM:HBG562551"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B3C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM3"
FT                   /transl_table=1
FT                   /translation="MHAVTNAVSLKLTGVTARVSAKVARFAQKVALRASVDDEAVTFTA
FT                   DDLSKGLKAADAAWEEKAAEPAAAPVAFSAAIDPADGSVAEAAPLGDDMSMLNDAMIAF
FT                   KEPRAVEIINGRVAMIGWMAALYAEISNDQSLTRQVINTRTFTLADGVVKTSTMPAAGM
FT                   FLIPVTVLFVLAASLAPVLRGNEESGLEKAPKDFGPFRAESEMTNGRGAMVGLVALLLA
FT                   EKFTNGAALF"
FT   CDS_pept        222491..223177
FT                   /codon_start=1
FT                   /gene_family="HOG000265461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633420"
FT                   /gene_name="CBR/ELIP2"
FT                   /orf_name="MICPUN_61122"
FT                   /product="Carotene biosynthesis related or early light
FT                   induced-like protein, chloroplast percursor "
FT                   /protein_id="ACO65439.1"
FT                   /db_xref="HOGENOM:HBG562551"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B3C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM4"
FT                   /transl_table=1
FT                   /translation="MFALSASRITGSAVKLSVKSRAVRARRAASIRVRAEGEAEKVAVA
FT                   DEVKAADAAWEEKAAEPAAAPVAFSAAIDPADGSVAEAAPLGDDMSMLNDAMIAFKEPR
FT                   AVEIINGRVAMIGWMVALYTEIEKNTSLFHQVINTRTFTLADGVVKSSTFPAPGMFLIP
FT                   VTVLFVLAASLAPVLRGNEESGLEKAPKDFGPFRAESEMTNGRGAMVGLVALLLAEKFT
FT                   NGAALF"
FT   CDS_pept        join(complement(224831..225694),complement(223874..224728),
FT                   complement(223379..223822))
FT                   /codon_start=1
FT                   /gene_family="HOG000264524" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633421"
FT                   /orf_name="MICPUN_112642"
FT                   /product="mRNA capping enzyme"
FT                   /function="mRNA guanylyltransferase activity"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="mRNA capping"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="ACO65748.1"
FT                   /db_xref="GO:0004484"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG378983"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000199B478"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM5"
FT                   /transl_table=1
FT                   /translation="MKKLGIGKFENQVRARTGGHVATLDPRSRTLSGGHPRGIPASRLT
FT                   PPPSLAAPRPRQDDHDDDDDDAPGTAPAPENAGAGITKDAWCPPDGWIEAPPQGAIVRD
FT                   VFVPSKAPLSDTWHADGRVPDDRRYGPNEALAMAKTASGGRDVELVVDLTNSSRYYDPK
FT                   AFDARGCSYVKIACVGKDAPPDAVAVQQFVYEVGKFLSERAARGGKGLVLVHCTHGFNR
FT                   TGAMLVHFAQRTAAWPKLNENLKAFAAARPPGIYKPEYVKELFDEYLERRFSTTLDPPV
FT                   PEWKRGVSLAPRPGSGATDELASSRSKTTADGNLDGTPMRHDDVLGTAVYEGQAREIRN
FT                   VVCYLCGVDGARFPGSQPVSLARDNMDTISRHEYHVTWKADGTRYMVLLMRDGTYLIDR
FT                   KFEIRRVTMRFPAPLKTHGVSVHNATLLDGEMVVDDIAPGRQRRRFLAYDCVALHGERL
FT                   GERAFVDRLAAVQRHVVDPRNVFLTEAGKSRAYDFTKEPFSVRVKDFTPLAGTENFIRS
FT                   FIPKLCHECDGLIFQPSRSRYESGTMDTLLKWKFTHLNSVDFRLKLSLRDGRAILYFAM
FT                   RDAEDIDTAGGFDPDVAPDGTKLADLDGKIVECTWDKRGGVAKAGAWKYLRVRTDKDAP
FT                   NFVTVYRHTLASILDDITDAEIISYVGGVLAKGAGGNRAPREGARRSSGGDTAVGGGDT
FT                   AGGYESTAPAAHVSGAERQQPVIDDI"
FT   CDS_pept        226095..227501
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633422"
FT                   /gene_name="TGT"
FT                   /orf_name="MICPUN_102163"
FT                   /product="Queuine tRNA-ribosyltransferase "
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="ACO65440.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="UniParc:UPI000199B479"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM6"
FT                   /transl_table=1
FT                   /translation="MGGIVWELDPRFAPAEGESTARPGPRLGTLTTTPWDHPGPVGVPT
FT                   PMALTYTRRGEPAHLTPDNVDLLPREARTFHVSLAHFMDHLGPDHVSNMPGGGRRYFGC
FT                   RPTCMLVTARDPLTFDQDAKQSNTDAHTFVASPTGTTKITTDDYARWIEAIQPDAFVAL
FT                   ADESPSWRDGVALKKTKQASARTEKWLAALLEKTKDLPTKPSVFASLQGGADVQERRAC
FT                   AEGIVERHGTQLAGFAIGSLGAGETPGEHRRSLLRASIEPTPWDKPRYVAGLGAPLDVL
FT                   DAVEAGVDLLEASFCHQCTTQGYALTFPVKPPTTKDSKKRKRGDGKDGDGREEGDAVDK
FT                   KSAPGDGDGAGDEKSAPGVGEEEDANRRLLTGGDAFKSNMWALAYRADKRPLLPGCECY
FT                   TCERYMRAYVHHLLQCHEMTAAVLLDIHNYFHFNKFMEAAREAIGAGTFAEFAAFHRER
FT                   AARMDGDDET"
FT   CDS_pept        join(complement(229060..229089),complement(228632..228925),
FT                   complement(227686..228510))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633423"
FT                   /orf_name="MICPUN_61125"
FT                   /product="Transaldolase"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO65749.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199B47A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM7"
FT                   /transl_table=1
FT                   /translation="MSSLPGLRVTASARKGRVPKAKANDVEPCEAADFKGIKTREYSSN
FT                   IISRGSELEQLKKLSHLVLETAAVGASTFEELGPQAATVSPSVLLHTLHENTTADVGAL
FT                   EGAMVYEPCSVDFTGSEDARLECVIDKAFVNLGGMMAERVGGLVSIEIVEDKVTALNSD
FT                   KIIAKARHMRAMFDEINVDREKYLFKIPGTWAGVEAVRALEAEGVRCHVTQVHCLEQAA
FT                   AFGRAGATVVQLYVGRLQAWYKKHPVHQLSNKLHEASNHGVEFVRQVKATFKNESLDTK
FT                   IIASSVLDRDNALSLAGVDYMLLSDRVVSTLNNADACDQIGTGVVARGGNVPSVGEITQ
FT                   ASFEAALGMSPAYEEIEAHLELLHKDEEALKAFVKTSVMRND"
FT   CDS_pept        join(complement(229845..229922),complement(229388..229759))
FT                   /codon_start=1
FT                   /gene_family="HOG000217152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633424"
FT                   /orf_name="MICPUN_61126"
FT                   /product="Ferredoxin, chloroplast "
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="ACO65750.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG748855"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniParc:UPI000199B47B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM8"
FT                   /transl_table=1
FT                   /translation="MSATVTMSAVAAKTGARLSSRAISKQARALAATPRVAAKPRASLT
FT                   AKAMLVTIEHEGKTYEVECDGHDNILDAALDAGIENLSYDCKMGVCMTCPSRVTAGKVD
FT                   QQGSMLSDDVEEKGFALLCCAKPLGEGVVIKTVTEEELLDEQLCA"
FT   CDS_pept        join(230168..230269,230371..231039)
FT                   /codon_start=1
FT                   /gene_family="HOG000189346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633425"
FT                   /gene_name="Mpu1"
FT                   /orf_name="MICPUN_107390"
FT                   /product="Lysosomal cystine transporter family "
FT                   /protein_id="ACO65441.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="InterPro:IPR016817"
FT                   /db_xref="UniParc:UPI000199B47C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBM9"
FT                   /transl_table=1
FT                   /translation="MALSIERCANEVLGVFTGAVPSADCVKFAVSKGLSAGIIGGAAMV
FT                   KVPQIRRIIAAKSAQGLQFNMFLSEVVAGTVSIAYFAHNDMALASYAEMFFVLFQNLAI
FT                   LALMLILGRKGGQRKSIVSGVPGLIPHAAGYAFAAMIIAIAPGDFLETLYNCTTAVLVL
FT                   GRAPQIWGNHKAKSTGELSATTQFLMTAGSAARVFTTQQEGGSSSMVFAFALSAGMNAL
FT                   LLLQMFLYRPKKAKGTVMKGGVRKSTRTPKKKQY"
FT   CDS_pept        join(231390..231769,231844..232405)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633426"
FT                   /gene_name="LYPA"
FT                   /orf_name="MICPUN_107391"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO65442.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI000199B47D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN0"
FT                   /transl_table=1
FT                   /translation="MSCHACLGKYAPEAQPLLAAKKEEAAGRSPARIFKDYVHNAALMA
FT                   IPAALVLVVTACVCLGLGYDLPTITGGVEPGLEFPEPLVVNPPGNARAEAAVVFLHGLG
FT                   GHARGVDGVGIAANLIQLPGVKWIFPDAPVMPVTVEGGRNIPSWYDIERFTDSIEDFVD
FT                   DKTRIIQSAQFVTGIVQELVAKDGIAPEKIVLGGFSQGGAVALTAALHGASALGPGVSL
FT                   GGVFALSSYLPMRDMYPSPMMPDPSVAARTKVLIAHGDEDAILPLEFGQVTAQKLSAMG
FT                   ANVEFHEMYGVGHERLGDEETAILRRWLAQLV"
FT   CDS_pept        233026..234495
FT                   /codon_start=1
FT                   /gene_family="HOG000264552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633427"
FT                   /gene_name="STT7"
FT                   /orf_name="MICPUN_107392"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65443.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG562556"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B47E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN1"
FT                   /transl_table=1
FT                   /translation="MFGGMFGGNKTTTADPKDKKADAPLTAANCKIATGEKERLTVTID
FT                   RPMGMVLEPLDEKGKGAIVTELVDGGNADKSGMIQACDILVAVSFAGGETQSLENRWYE
FT                   SILDELAGEPDCPNVTLTLERAVLEDDEDMLTITADAKRYWEEKRELKARGGPKTLRRT
FT                   PGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYH
FT                   VHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLA
FT                   TAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLG
FT                   AAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFD
FT                   SWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANG
FT                   GAGWDLCQRLMEAERDARASCEAALSHAFFD"
FT   CDS_pept        join(complement(235058..235097),complement(234683..234945))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633428"
FT                   /gene_name="HYP354"
FT                   /orf_name="MICPUN_107393"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65751.1"
FT                   /db_xref="UniParc:UPI000199B47F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN2"
FT                   /transl_table=1
FT                   /translation="MGGTTSRLHDSLGAVPPPPAPSMPRLSDASAVGSAGPTPRASANL
FT                   SGGGVTAPAQIPSAHGRSSLDSVGGSSTQSEQSEFSKSWERQRDLTRDRLQERLY"
FT   CDS_pept        235307..237520
FT                   /codon_start=1
FT                   /gene_family="HOG000162379" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633429"
FT                   /gene_name="APG7"
FT                   /orf_name="MICPUN_107394"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65444.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG619497"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR006285"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B480"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN3"
FT                   /transl_table=1
FT                   /translation="MAADADTLRFEPWQSAVDPGFWAELARRKLDNAGLSEDPWLITAL
FT                   YTPAQNAVVSSPCQLDARAFGAGDESELAARARDVAASGRLEMPGTLVNVNTLERFRAF
FT                   DRGTLMSNAAKKLVEDIRSGRADDDAALLTPFIALTYADLKKWSFYYWFAFPALKLDVP
FT                   AKVISCGPLAEHVELGAVADEISRGCEATLRRDANDPARTWWIVDNVSGECEPPSSIAT
FT                   VRTRDFSTWTLAFVDPCASEAHPGWALRNLLSWLAVRTRETETAGEAAGETAGAAGADA
FT                   PRRVRVLAVRKSAGRVCPRASRVFECVLPVTTDGNLENPTGVGWEVNASGRPGPRLANL
FT                   GSSMDPTRLASQAVDLNLKLMRWRLLPQLRVAQVASTRCLLLGAGTLGCAVARCLLGWG
FT                   VRKITFVDGGDVSFSNPVRQSLFEFGDCLGGGKPKAEAAAEALRRIFPGVDAQGVRMMI
FT                   PMPGHPVPDAELPRVLDDTRRLEDLIDAHDCVYLLTDTRESRWLPTLTCAAKGKLLINA
FT                   ALGFDSYLVMRHGGGLLRADERSGTDGTTTDERGGAFAGRLGCYFCNDVVAPGDSTTDR
FT                   TLDQQCTVTRPGLAPIAGALAVEMMVSTAHGCVEGDDPTRMPAHTHESFASSRSGSGSG
FT                   SGSGSTGDRDDGTTALGIVPHQIRGGVFDLSQRLFAAPAFDRCVACSEKVVAAFLKPDG
FT                   RDEFLRRAFDDPAYLENATGLAAMKEEVDDAAWLGEDSDGDDF"
FT   CDS_pept        237680..238804
FT                   /codon_start=1
FT                   /gene_family="HOG000100112" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633430"
FT                   /gene_name="PRM1"
FT                   /orf_name="MICPUN_107395"
FT                   /product="4-toluene sulfonate uptake permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65445.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG562558"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniParc:UPI000199B481"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN4"
FT                   /transl_table=1
FT                   /translation="MSFQAMRRALIRAAEVSVRGGPPVGTVATGRGRWTAARIHEVERS
FT                   YASPFARSARRRVHTDDPYTPAHRAKAVAMAGPLGLVAGMFGSVVGVGGGVLIVPAITS
FT                   AVPIPQRVVTGTSLIAVLSTAGVATYNFSHAGLVDPTAAAILGGSAMLSAPFGARLTTR
FT                   LDCVQLRRILAYFLLCAAPLVPLKAAVFHYRGDGTEGGDGEQGGGTNGDGHWTDGGGGG
FT                   IRSGDLTKGEEDAASPPSASVVQKFDAVEAAPKLAAIGVTAGLASGLLGIGGGTIVTPL
FT                   LALVSPLPQAAVLGTSLLAMLPPSAVALLQHRALGNVDFRMGAALAAGTALGGAVGSGM
FT                   AVDAPRGALEAVFFCGMLFLSRRTFATIRPKAKN"
FT   CDS_pept        complement(238944..240935)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633431"
FT                   /orf_name="MICPUN_61133"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65752.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniParc:UPI000199B482"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN5"
FT                   /transl_table=1
FT                   /translation="MGTAADRIANAAVVAGAALYVSLLAFAFMSTAGDAFLRGFMVDQT
FT                   PANFVFVALTQVVGCAWLLAGTLRVFELSRGRVMARALLGHASWERPPVTARDVAVLAS
FT                   IGTKTVVGFIGLYSGLCWDESRDGAGSEKTCVGAVGSLFDGSPVVIEFFACVAVASLLV
FT                   LPWPLPAHRARRAFLRVLWECLGYAFCFPAFGPFASKTTTDGDARDAAAMRRQNSVRER
FT                   LLAAGGGGEGEVDETSSAMDVHENRNVLGHRNGNGNDPDRDDVASVADSVMTQSSPWWS
FT                   ERSPVDLAHVLVADALTSAGLMLWQGEFTACLFVTSSWSASRTPGVGVGKQGEQCAGFG
FT                   NANSLLAKPIAIALPFWIRLWQCVAQARHAAKTKARPSGHVSSSARDSSTLHLLNAVKY
FT                   ASCLAVIGCSVCIQMAELDGIRRGVGAWHGTFWNVSEDAWWKTWICLLCLKTAFTFAWD
FT                   VVVDWGLARVGCDGRAARVGCLCPCCDDGLDSDMDTDGGGGDSDDERYSGDADAAGDSP
FT                   APAPGAPNRRPRRYPPFLRKELLFVKPARYYAAVAFNLVGRTTWGLAISPHVCEGACVL
FT                   SLGIVELVRRAAWTTLRVENEVIRTHAERRRRRRLGIRNAERYARAFRNSPLNRSRRVS
FT                   SVTSIGNEIETPEPPASPASFVGTPASP"
FT   CDS_pept        complement(241393..242121)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633432"
FT                   /orf_name="MICPUN_102171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65753.1"
FT                   /db_xref="UniParc:UPI000199B483"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN6"
FT                   /transl_table=1
FT                   /translation="MTPRGPVTTRDRTYAVYYVPDVSGHWHHDQVVYAHPNGLCVVCLA
FT                   ERHPIVTGEAVPSSGDDDGGEGRAAATGDETDAAGGTSNGAAAATGDKRKREGDGEGGD
FT                   GPGPEPGARGGRPSRHRPKGKYSPIASVDYTCGKGEGKGNEVNIRGKKKRGAKTLQENS
FT                   GLCWLVDEAGMYWIARACVRGKLIETNERLAKEPQLCTRFPTASGFLAIISAAPADMQR
FT                   LRETGMNREAYEALRAIEAR"
FT   CDS_pept        join(242880..244947,245138..245487)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633433"
FT                   /gene_name="HYP302"
FT                   /orf_name="MICPUN_107396"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65446.1"
FT                   /db_xref="InterPro:IPR022228"
FT                   /db_xref="UniParc:UPI000199B484"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN7"
FT                   /transl_table=1
FT                   /translation="MNATARDRSAAGAVRRRASRAESPRPGTRHLPNARHNFANTPTDA
FT                   VPPSSPLSALQVWRQPPYRRAMTDPLDPSAAHDHHVGLDLHDDHHHGMEKFELPNLDEN
FT                   MAHFPDFDDDDFGVPDMKHADALHANGDHHHDLNGVRAEMNGGAMARMNGSAMPPPANK
FT                   TEEPNRVATIDRRSDVRSPVGRMDGDAAAEAVASGSHAGTAGTNLYDAQWSAEEQAVLE
FT                   RGMETYGADEHKSLWRYIKIAATLPAKGVRDVALRMRWMSRRAGKNGDGARGSKRKGVA
FT                   NGGGGDGDGGGKGGGGGGKGKKKASTKPPSVFSVGLTSPPARANGGVVNGHHGAANGVA
FT                   NGHHHHAQHHSHLNGGYAQQTPMRQPPGTDGGGGGRMSMGYAHMVDHMGNVVQTPGGGM
FT                   MMQSPVPTGMNTARYSENMGPPRSMTNAIIGGGGDAGSHGRSNHGAMMSGSMMSAGGYG
FT                   MSGGGNGMNVGYVSAPVVYDGVYGHQTAGGGMVQQHGGVMQQGSWGGPSQDGGGGYVAF
FT                   NPSGGMGMHPPSHHGGMVMVDPTGARLVHYPTMQINQLEEHGGPGRVTGVVGDILAENV
FT                   GLVSQIRGNMDAMKPPRGNLELLARFRDNLMAAKEHLAQEEGASQMPPLPVDIDHQLAN
FT                   QILPAPDTNARVDVKQAAAKSPAKGAKGAKGGGAGGGRGGRGGRGGRGGRGGRGAAMYE
FT                   MHAGQCLERGPTKTGGLYMLGQEGWYDFFAQSVNQDNEGYCDSTTVGFKHVACRDDGRE
FT                   TAYKPNVANINRQPGWKPTKSNTQKSSLMVIPTDKYDQQYLGGRIPNYELNG"
FT   CDS_pept        join(complement(248917..248971),complement(246761..248745),
FT                   complement(246037..246396))
FT                   /codon_start=1
FT                   /gene_family="HOG000174247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633434"
FT                   /orf_name="MICPUN_102173"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65754.1"
FT                   /db_xref="HOGENOM:HBG395734"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B542"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN8"
FT                   /transl_table=1
FT                   /translation="MSEYKLRSDCKGHEDDVRGVAVCAADVFATCSRDKTVRVWREAIG
FT                   GVGFACSTVCVGHESFVTALAFAPNDASSVVSGGRDRTLVAWDPASGDARGRMRGHALD
FT                   VTAVCILSDGRVVSGSMDKSIKIFDPSKAFECVETFDDAHDSSVLALVALPDAFGGGFL
FT                   SGSADATIRAWKNASADDGAVFGRHADTVRGLALNATANLVLSASHDTTARAWTPAGDV
FT                   VATYRGHSALVYAVASSACGTRVVTGSEDDTARLWLASSGECAQVVPHPGCVWSVAYLP
FT                   PPPGGGGGGGGGGKGDGKDVGDFVTCCADGSVRVWTASPDRVDAAAAKALEDFLVARAA
FT                   ERAARQLADAQSKLKLEPPSVLAAPGDRDGATKVIKEEGGSIAAYSWSAAGSTWERLGE
FT                   VTGVGDGAGKKTYAGQEYDYVFDVDFKDGAPPLKLPFNDGDNPYAAAEQFLETSGLPME
FT                   YREQVVNFIVQNVGSANVAQGANVDPFTGAGAYVPGGVPTGGGAFGAGGGGYGGSHDPF
FT                   TGGGAYVPSAPSATTAAPVNGSTFKYLPMRTPVAFETAKYDGILRKLSEFGAEEGAAGD
FT                   VAAACNGGDPPGASSIAALAAYLESWPVDKLFPLLDLCRMAALRGDAAGVSREVASAMA
FT                   AACARSVAEAPRLPANLLTAGRLFCNAFRHEVARDAFVLRASEILDGLAAAASPDAKTP
FT                   ARLALATAVLNVSTRVHVSDASLAECAPRAVSVGAELLLSCPAEEDDARFRTLVALAQI
FT                   AADGGAECKSLAKDLGLGDVAEALRVSGGSERVRDAAGDLKLAMSR"
FT   CDS_pept        249316..252132
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633435"
FT                   /orf_name="MICPUN_61138"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65447.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000199B543"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBN9"
FT                   /transl_table=1
FT                   /translation="MADDDEGLYDELYGDDDDDVPMAPPQIIPPEEPAPEEPTPAPEEP
FT                   APVAANAPGDGDGGDDDDSDDDFDIALNEPEERGSDEEPDEFMIQLDDTEQKQQLYQQQ
FT                   YGAEEEDAGAGDELEAQLDGMPGAAPDDAAAQSDPIHYRSKTYVRGSAPPPPAPPPGAP
FT                   SNPAAARAGGPPPPAPPPGRPSFAAGGSAPAGVPRGTALASDLTGRSGPPPPPPPPGAP
FT                   SVPRYVGPAVRPPPPLQMEDGTWNTYNRQPPNARYNEKGQRMMPGGEGGSRFIPPEEYK
FT                   EFLQLGHGGIFDVDLDNIDVAPWRKPGADVSAYFNFGMNEHTWRQYASDVRHARLELAL
FT                   QEKIQTVGDDDDIAYPHGPPPEMLMQRAMDAPGGSFGGPPGPGGGFAPPPPAGPPPPDQ
FT                   PMGRGGFPPHGSPMGPPPPTGPPGADFGGPGAMLDPKDMPRWMRATMGVALEDAPAEEI
FT                   EEEITEEVTDDEEEEEYGLVLAGDDDEDEADAGDGDGRPKEKKKKTVTRTVKRVVEKSE
FT                   EERAAIAEERELLESDPIAAMAIDRDSVSKDVVKALDEMAVMSWMQALQMRHMRLMQAG
FT                   MMQPDRVQELQGHVADGQALMMTVRECVMEMQSRGKWTELNNMMNGGGGQGGVHGGYGG
FT                   DWGGAQAPRTCHKCGMPGHIARECPNAPGEQRTCHVCGEGGHIARDCPQGPSRPEERAC
FT                   HVCGESGHLARDCPQSTCHNCGKPGHRAAECPEARCRRCGEKGHMARDCVNPPMSRGGG
FT                   GGGGGGGGRDADEKARDSPRDRRDEPPRRDRRERSPNRRDERDDRDRERDRERDRDRDR
FT                   DRDRDRGGGGSRRVVVVRRTGGGGGDRGRDRGRDESRDRGGGDRGGARESGWGFDRGGG
FT                   GGRDLRDRVGGKDDRGRDSPREGGGRSREQRDEKERNVRDRAPAEKRKSGGGGGGGEDS
FT                   GRGKRSRR"
FT   CDS_pept        complement(252222..253097)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633436"
FT                   /orf_name="MICPUN_61139"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65755.1"
FT                   /db_xref="UniParc:UPI000199B544"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP0"
FT                   /transl_table=1
FT                   /translation="MGGDEALAPLTEAQAADLDRVVAELRVVLPDPTARDIHDYIEENM
FT                   AASMGEWATANRVKKVNTRMNKAARAKAGVDRDMLEPDETDGPVVLEELGTWPDDTSLE
FT                   EHLAEDEDTCIFSPDEHRAPVEGEDVAGGPSTALAYRRSLVACGGFWDGKLKVWRLHDA
FT                   DDGAGAGAGGDPDELLVLCRAVRWWQSEKGGDDDGEIRAVFEVDFRRGNPRTGAHKRLV
FT                   SALIAKHEEAGSHACTKEVRDVWCAHLLRNRYWDEKYGGGGGDGDGSKETMLSSYVVTP
FT                   APEWFRREEA"
FT   CDS_pept        253509..253937
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633437"
FT                   /orf_name="MICPUN_102175"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65448.1"
FT                   /db_xref="UniParc:UPI000199B545"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP1"
FT                   /transl_table=1
FT                   /translation="MRARGSQGRVPRSATVGTVARREIITLDLAPTALLRFLSVPYATL
FT                   RPPDLKPFGAYCCWDFVPVRQGLMNFLAPNSPCTAALAMCTLLPPFRSNPAALDASFAV
FT                   LSSVDSHPSGSAKRSFIVTGRLMVRVEVGDGRRRGASP"
FT   CDS_pept        complement(254183..255100)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633438"
FT                   /orf_name="MICPUN_61141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65756.1"
FT                   /db_xref="UniParc:UPI000199B546"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP2"
FT                   /transl_table=1
FT                   /translation="MSGSTAAATNPAASSPARANADDAPSGDGLGAAAKAKLKGLLAAA
FT                   FGSSVTTVRIDVQAPRLTRERRQRKAYGGWGDAPARAADGDDGFTRGGITSHNFSVEQT
FT                   RLQVKQKWETGLFEQQQTGGGTVIKSRLDLGAGLDVGLLRAEVVPDLRVRCRLGNGDNA
FT                   PSVYLRALPEREIVARGRIPLANTGVFLALRLEVPLRFITEGGGSNPFTPKPVIAAQLC
FT                   RPSGTGPHLSTGGLEFDETLLTIGRDCALRVAANLDFPREYPPSTRGGGPRLDVRNLGV
FT                   KFRKRWYEERDRRKAEENGRGKGR"
FT   CDS_pept        255386..256093
FT                   /codon_start=1
FT                   /gene_family="HOG000157121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633439"
FT                   /orf_name="MICPUN_84635"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO65449.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG673102"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000199B547"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP3"
FT                   /transl_table=1
FT                   /translation="MQKVTFGDAQIPGYECGDKSSPAVIVIQEWWGVTENIQRQALKLS
FT                   EDGGFRCIVPDLYKGKLGVDVEEAHHLMTSLDWPNAKDELVECAKYLRASGSPKVGVVG
FT                   FCMGGALALIAAQHADDVTCAAPFYGTPDPAICQTDKITKPVQAHFGELDNLAGFSDPD
FT                   AAKKLLANLRAAGSDCELHMYPNVGHAFMNDLPAPYPDWDAREKTQGFPRFDSAQVNAA
FT                   WSRLLEFFRKHLA"
FT   CDS_pept        join(complement(257057..257123),complement(256261..256868))
FT                   /codon_start=1
FT                   /gene_family="HOG000217519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633440"
FT                   /gene_name="SNF"
FT                   /orf_name="MICPUN_107397"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65757.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG329120"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B548"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP4"
FT                   /transl_table=1
FT                   /translation="MGDIPPCATIYVNNLNEKTKKDELVKSLQAIFGQFGKIIDIVASK
FT                   SYKLRGQAWVVFADVASATAAMRAMQEFPFYDKPMRIAYAKTKSDATAKAEGTFDPSAR
FT                   DPEMRAKRKAESQAAEKESQAAKAERDAASGVTAKVRTDPSAPPNEILFVQGLPGATTA
FT                   AMLSMLFQQFPGFKEVRMVEAKPGIAFVEFETDAQASVALSGLQGFKINPTHSMTLAFA
FT                   AK"
FT   CDS_pept        257208..258557
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633441"
FT                   /orf_name="MICPUN_61144"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65450.1"
FT                   /db_xref="UniParc:UPI000199B549"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP5"
FT                   /transl_table=1
FT                   /translation="MADQHTVAASPRLLTFRPIASGVRDTMAALAFHAAVARVASLTGP
FT                   RRRDAARSSSSAAAATTTTTCRAGRDDDYYRDGYRDEPIPAAERRRSDERRYYDGGRRS
FT                   SRVSDYYDRRARPTGDSRPAMEPPRRRVGPEDDAAGPTPRRRRERDDGFRAREAAMRAE
FT                   ADARAAREESMWRDAYARRVREKRQRWDEWDDMAAEEDSARKDRVARARSAKPAFKTPE
FT                   QRRDRLARYRDISRRADETWASAIERRWSADEEYARATGQRPRGDSLDRTMDWLFTPLA
FT                   GAARRIDRWLEEDPYNPLTNPEYYGGYDAPPLPPPGVVYDQYDYPGGSAMNAMGWGGRR
FT                   PPPPTQPAPRSQRDGLDEDAYYPSRAAAPFPPSPPPPPRRRGDGPNPLRDAFRGGGASG
FT                   RQGRDDDPITPEEFERLRGGGGGGGGGGSEPDFDRYRGTVSGRRGRRGRY"
FT   CDS_pept        join(258998..261667,261705..261710)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633442"
FT                   /orf_name="MICPUN_61145"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65451.1"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniParc:UPI000199B54A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP6"
FT                   /transl_table=1
FT                   /translation="MQQRGRSFSSMWRVALAFLLGVAAVDGLCGENQRVVQTWTPADSY
FT                   KYACQDCPVNTVRVAGDDPAAGYETYCTCPAGFFVTTYYAIGGYCAACPADSTSFAREL
FT                   RYSAGSQSSCFCKENFRAVIGDGSKITCEPCPAGTTNAARDEVCIRGGHCYASTTYCDA
FT                   PPCAEDEYATSSYTCAACPEHSTNPAGDDPGRGATSCKCKRNYRVSSNACVPCDAGYKR
FT                   AAGDDVTGADTECEVSVPCAENEYVDTTVCKPCPGNSKRAAGDDPAGDDTFCVCDENQR
FT                   VVRDWNSGGTYVCRDCPMNTFRDARDNPADGQTYCTCPAGFLVSGYYSFAGVGCAPCPA
FT                   NSDSSAREFDETKRHQQSSCYCKENFHAVFSDSWTSTCEPCPAGLTNAAGDEVCIKDPD
FT                   YWECGYRGETTYCDAGPPCAEDEYVTSSYTCAACPEHSTNPAGDNPGAGATSCKCKRNY
FT                   RVSGNACVPCDAGYKRAAGDDVTGADTECEVAVPCAENEYVHDSSCKPCPTGSVNPAGD
FT                   DPAGTDSFCNCTENKHVHNNACVDCSTYLPGYGDSGAVRAAGDQVPGPNTLCSCRENMH
FT                   PYINSFKTRYCRQCPGNSTSDGGQVGPNVIGWLNGPYTCKCKENFRVQNDRSPYSTDPE
FT                   YQWKPKCVPCESGLQNSAGDEVGYARIDPSSSYGHWTPTQETICDGLDSPPPPPPSAKP
FT                   PSPTSGPSGDKSGGPSPLPSPLPSPSAKPSRPTSGPSGDKSGGSSEGAKEEREKAKKTG
FT                   EALVKGIKDKRRQKQAQLLIDAAINGTKVKRMSARLTAADEDSACSDYYSKSKLDTSIG
FT                   ACVATLSSSRRLRSLASGTYDVSLFFSETEVDDAMLTAATSALEAEGVSVEVGEVDPVA
FT                   ELGTIDGVDSSTMETFKTAG"
FT   CDS_pept        join(complement(262978..>263904),
FT                   complement(262607..262851),complement(262484..262555),
FT                   complement(<261928..262399))
FT                   /codon_start=1
FT                   /gene_family="HOG000255119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633443"
FT                   /orf_name="MICPUN_66343"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65758.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG555665"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199B54B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP7"
FT                   /transl_table=1
FT                   /translation="LLLIVVVCMTLGTTAISVGFNFLGRDFYNSIAEKNPEDFDRLLKT
FT                   YIAAIAGAIPVFVFRDYYQQVLTLKWRGWMTERYVEKYLDDRNFYHIQTGSVIDNPDQR
FT                   IVDDISAFTSQTLGLAFTLLNAGIDLVSFSGILFGIYKPLVGVLFVYAAGGTLISAKLG
FT                   QPLVGLNFNQERREADFRYGLVRVRENAESIAFYGGEAAERSGLVGRLRAALDNLGDLL
FT                   VATRNVDFFTSCYRYLVTFLPAAVVAPLYFKGEIEFGVINQSSSAFSHILGDVSLVVYQ
FT                   IERLASFSAVTDRLGQMTEVLNGPASRLRIDRESPERLRLAGLTVRTPGAYGAQRPPLV
FT                   TDLDLTLTSRSSVLIMGPSGAGKTSLLRAVAGLWEQGAGEVRWAAAAPRDPGLYFLPQR
FT                   PYLVLGTLRQQLLYPTMMEFQCGVAGCAPKPDDAALIDALDRVNLGYLLRRGTSTNAHP
FT                   KEGETRLGSDVDEWSELAAGLDAVGDWSSILSLGEQQRLAFARVLLARPPVALLDEATS
FT                   ALDAANEARMYSLLRDLDDVAYVSVGHRGSLLGFHEQVLRLEGDSSWRVVSAEAY"
FT   CDS_pept        264540..265646
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633444"
FT                   /orf_name="MICPUN_61147"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO65452.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199B54C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP8"
FT                   /transl_table=1
FT                   /translation="MTAFAILAPAHGAPRATRACASDRPTTAPRARGAIAPSRPTTARR
FT                   RRHVPPHRATETTTLVDSSDDAPSTSAGVTDVRVRTLRDERDIPRVATLCSAVFKETAV
FT                   PLPKDLADDDVMRDVAAFFETRYESAMIRDLTGITTRNLREKRRCENQTRAEYGRTRAR
FT                   ATARELAALQRTRTSVDQLTTAQLREMRARITDEVELELDRERKVPNADYLRRVRSRQW
FT                   MQLIADAIVPGGVATGLVSMPSEYEPPAPGAREIVGSATLQVCVPDAPLPPPFPTRRPY
FT                   RSYLANVAVCPEARRVGVASKIIAEAERVSRAWGYTEMWLHVNIDNPGARALYEGLGYA
FT                   IVGEDPPWYLDRRYLMVRKFGSSGVVVP"
FT   CDS_pept        complement(265733..266839)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633445"
FT                   /orf_name="MICPUN_61148"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65759.1"
FT                   /db_xref="UniParc:UPI000199B54D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBP9"
FT                   /transl_table=1
FT                   /translation="MPRQRGRVTPHASGKGLRLIGEVDDIASPTRRPPGPLASPPPQPS
FT                   AWGDERERIYASSAERRRGLDAAYGRATPRRSRRVRASDLLRAGWHACPGLLTVWILRT
FT                   HCATRPLRRWRAVDIALALVPFTVACWLLEWARLVGPLRHRDRVPLLTALLRADERTRV
FT                   HGTAWYLLGVAFALCAFPADVAACAICQLAFADPAASLAGRSLGDVAWTGGTYRRGRKS
FT                   VAGSVVCAVVSACVTWFLYCGVYVVMPEVNEELAWPHFLGGAALAAATAVEDEENAGRM
FT                   CALCVASGVATAVVEALAGDGSWGGAEGAEGSRGSIGKGKGGGGYAGDATSSSFAAMVR
FT                   RGFTNDNLAIPALGGAALYAARLALLGS"
FT   CDS_pept        join(267258..267769,267918..268380)
FT                   /codon_start=1
FT                   /gene_family="HOG000264584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633446"
FT                   /orf_name="MICPUN_106010"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65453.1"
FT                   /db_xref="HOGENOM:HBG562572"
FT                   /db_xref="UniParc:UPI000199B54E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ0"
FT                   /transl_table=1
FT                   /translation="MVVDAFSTKVAGAIKPVLDKAAPAFAVLSQVFAIVYPYIEMAFTY
FT                   LAVVWEKLQPYHPQEFMPAIAGFVLVFFGGNFFTLAAAVEAYRMVGFDDTKTALIALHK
FT                   SYKVALEASKKDDEVDDDGDGIADVKQISSKELVQRKIGVVAKAIDPELVADAVTAINA
FT                   GLMAVVATLKVKFAKCVTIGVTVGGIAHNVVSTNFEPVLLELTPGEYKKWVSPGVKYAC
FT                   KLFGVSIAWWLQMTISAFHSASRGAQLFARGSLAYAVRHKYLSPSAIDEKGKVFNFFIV
FT                   GLGCLGFWWQFWNGFSLPFPVNILLLPVTFAEYGMRFLVFMLG"
FT   CDS_pept        complement(268581..269960)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633447"
FT                   /orf_name="MICPUN_50489"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65760.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B602"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ1"
FT                   /transl_table=1
FT                   /translation="MDLGGSVISGGAGAQSELRAHTNARKPIAIQEDSDDSDDDVVDGV
FT                   GDAPPPTVPTESEDGTHDDGTQDGTGDAVPNKPFRKSVPIVEEDSSDDEDDGDAPPAEA
FT                   AEAATMEPSVAPEGAEGAEAVASDVHRANPAADPTESAEAAKDRGNALFKSGDFKSAEV
FT                   AYTEAIALDPSSAAYHANRAAARLKLHDHANALADATAALALDATHTKARHRRAMALAK
FT                   LGRHDEAAAEYDFVERAYPGHAGVRAEAKAARDAAETARVQSKAAAATEREKAKAMAAA
FT                   VAEEEGVSAPSSPANTSRDSSRNASNASSPRSMGSTPEKSRQAVEAKAAAAAAILREKQ
FT                   SSKKPRTATELERGCKSMRGKPDELSAFLRTVTDDELVKTLKASVSADVLGAYAEVWEK
FT                   HEVPAGQFASVAGTARALASLPRFAFAAMMMKPADKKSAAAVFNRLDAEGVANARKDWK
FT                   V"
FT   CDS_pept        join(complement(271563..271964),complement(271360..271481),
FT                   complement(<269985..270234))
FT                   /codon_start=1
FT                   /gene_family="HOG000100144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633448"
FT                   /orf_name="MICPUN_84881"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65761.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199B603"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ2"
FT                   /transl_table=1
FT                   /translation="MRGASEKEKKWVAMREKEKGNELFKAKEFRSAIEAYTLSLKLDPD
FT                   SPAVHSNRAAALMKQGRWHDAIADCTCALDLDPKFFKALMRRGAAYLETGEAGSEQRAL
FT                   DDLTAAAAIDPANKEVRRLHERARRAVVDNTTNAAGAAEEAKSRGNDLFKAKRYADAVV
FT                   AYTEALATDPTMTKAILLANRAATRLKVGKHADAEMDASSAIECDGTYVKGYHRRAQAR
FT                   TNLGLFEPALEDFERVVRATPDSKTLQAEVNACMQK"
FT   CDS_pept        273162..275219
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633449"
FT                   /orf_name="MICPUN_102183"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65454.1"
FT                   /db_xref="UniParc:UPI000199B604"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ3"
FT                   /transl_table=1
FT                   /translation="MSSTRALLAPTAAPTAARRAVTAARASRAEKSAASAFNRHRRRRP
FT                   PVAPTRAAAGKDASASSSSSSSSSPEERDDGGVGEFREFPRDEQGRVLDMDGNVVVSPE
FT                   NNWVREMEREWAATGYDDRFFDDDWDDVKPGPKPPPKEKYPFKDIEDEEWRETVTWEDE
FT                   AADGTISESEAAAGRRAAARTASSSDASADPRLDPGPGFTPPVMDLTYDEEAAMLGFDA
FT                   RGGGGGGGDEIYEEPEGPPAVLLAGFRAEEIPRVRELLDELGGHDVPVAPVPQEYLRRP
FT                   LYAALQIREPDWESPRAHERFNQGGEFGSQRCVVFSGLDRGEMATVVSAIESRGLPRLI
FT                   TVVVTSENVEQSLGEALATAVKESRAEAKRADEHRRKDYVAELKKLELKAAKEGLSVEQ
FT                   MVRREIERQDALEADEAARDAARDENVTRAEARMRELREEYAKKELERREAAAVAGGTK
FT                   HDPTGHVPNVPDWPTAADTVDVDDEGDRYDGYDDLGVDPARLADAMAETAAEAADAADA
FT                   VEAAARERRHERSVDALASAVGVNVVGGSLHGSAEDGDLDGDLDEDDGCYEVDPTRWAE
FT                   RVDESYRSSPAPVSPADAPPTSAIEEPASAEANPMARSRNGRNGQASERASTETFAGKN
FT                   PSAPPREKVETVEGQVMTKKMLRELAARRGLSYTDMLAQARASGVDLPDE"
FT   CDS_pept        complement(275262..276476)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633450"
FT                   /orf_name="MICPUN_61152"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65762.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199B605"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ4"
FT                   /transl_table=1
FT                   /translation="MPASALVASGCAASAAPPHRAGIARTRRRRETSGPSFTSSAARIS
FT                   VATLAIHCVVVAASDGGERDGGSRRVPRPDPGKSSSRTCVGPPDTETTALAVVRDTPLS
FT                   PLMGRLRQKHREFDYPTIGLITLDQEWDRSGVGTGAAVWDSAELLARYMATSGAARAFN
FT                   PDALRDETHGHGGSSSEDPSETRMDADAAALARDWWAGAVVVELGGGLGLASMVAARMG
FT                   ATVLCTDGDDMVVDMCARNVRANGLAAADSIDPSIDSSTRRGSVEVARLAWGDEEDVAA
FT                   AEAWVAAARGIEPGTKGCAKAYPDVLLLADVVYGEHPDAWRGLVRTIAALAGPGTAVLL
FT                   SHTRRGDVKGAQRKFFDWLKDAGFVVEAVERWKGTRDGFASLTLLYRAYRYGSTTLGRS
FT                   YSVVK"
FT   CDS_pept        276627..279788
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633451"
FT                   /orf_name="MICPUN_61153"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65455.1"
FT                   /db_xref="UniParc:UPI000199B606"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ5"
FT                   /transl_table=1
FT                   /translation="MAAARALLSPGDPATLVAADAHLRAVNDSPDGWRIGRALLSCAET
FT                   PGDVLAPRVRVMGAAMLRAKAHADGFAMTPPDAASMTSELLAMLGTPEGSGELGPHLAQ
FT                   IAAAVATAGGAETLASLVNASISLAAPDSNGGWARVQDPNAPCPCGPNAHAAVALLAAC
FT                   AEEALHRVKAHPPETTAAAQDLLDDVTWTLQAVACGGGGDASGGGGVTVVTDAARADVF
FT                   RALRLWIPAGITASELVVERNALFTHLVDVAIRCTRVDPRVTLAAAETLAELCGASDPL
FT                   PGRAAAVDAVLRTLESEADACDEMAATRLGWNLSHHAGGGDGDGGERERIRAHAWSVAS
FT                   VCGALGVTEPRALATHGHGKLLKFLTDVVGRADASAAPIALAAMRTPPPRGLLAHVRSP
FT                   TALDAVFDALARRLAERTAGAAWRAFVGESASRLIAERGWGGGFDANADVVLPAVGPAS
FT                   VSPDDDDELAVVGDVEATIGALHAAMGTSTFMRIVFDRLSKASGDPAVVAAELVMLADS
FT                   GYPLAPDAPEERVCVDIANYLVGLPACDLAPVKALVARVFRGPFKRLLTSDPDSFSRAL
FT                   RYLVRAPIPTGPDAAYTAGADEAAACARACVQTIASLVEDVCVGGHDVVRSMRGGIDAV
FT                   LDETRLLASVDRGAFAAAMCHFYLAARDVDAVNELAIKRLDNLTSDARSRSFREGTDEE
FT                   VTYAAESAGELRVLRDWCESGARAAARPETIDAIWRASWRFTELAVARGRSYGGVAREC
FT                   CELWRTLPLAQARVSDVDVATALGMVDQTLRLLSTRRFDPDSFARVVSVPAAFLEENVG
FT                   VDEATALLNTAIELLWREGDKVPVQARTHGVDDRFAHAPDAAAAAFAAMTTSATRSLTS
FT                   PPATDACLRQAALLCRGQGVEPATSALKLIEHVWSRAPWVDLRGDDGPSSGGGSAMGSL
FT                   ATACVAGGAAAAAECANPALLDPIALVLWSQSARCAEEGGEDASAWLFGAIRDALVRGT
FT                   GLSVPVESSAIRRGAVAESDVDAFAYAVAMRRPQHPARRVAELVDVFGRACRGHGPASA
FT                   LEEFR"
FT   CDS_pept        join(280233..280610,280714..280790,280920..280981,
FT                   281191..282182)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633452"
FT                   /orf_name="MICPUN_61154"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65456.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199B607"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ6"
FT                   /transl_table=1
FT                   /translation="MGVTTRGGARACVVGTGSTAARAHVPPARGTRGVVRAEPGRRQSR
FT                   GLAAAAEGAVATGAAAPVRGRGAKRSAPAAPDALEGASTARRRAGEAVTDVASLPVRAT
FT                   DSSRNEPAIHFAVPLRSFCSCSDDVLEVVFGHLARDASPAQYFDAMLTSKRFRDAGMSK
FT                   RALSNVGEKVLSRATAENWNEGASAFAEAAVDAGSVFAAFLVGSVDFYCRDAVGETTEL
FT                   AAARRTRGASLLARAAVAGSSDAHHTLAIMHFNGSGGKRKDKDPETGAAFCARGNILFG
FT                   SADAKRELGHCLQDGFGVEQDVPLGRKLLAEAAAADVATPAMDAAVVAATVAAAAAEER
FT                   LRKRNDINTLNAAVAAAAEVSAAAKHAAEQHLTAPPVARFLLDWYDPNVCGNVLQPGTH
FT                   ACSHPLCGRVETRRHEFRRCSCCGRTRYCSRSCQSLDWRLQHKFACLPLLELYGWIESD
FT                   TESQDTTAGALGVHGGDDEASQLASGASSNNLVAMPADDAAAAR"
FT   CDS_pept        complement(<282982..>283248)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633453"
FT                   /orf_name="MICPUN_74177"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65763.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199B608"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ7"
FT                   /transl_table=1
FT                   /translation="EPQGRPDTSTPKQRELVARVNRAKDYYDIFECDKSASEADLKKAY
FT                   RKLALQLHPDKNTAPGAEEAFKKVNKAWDVLSDKNKRSTYDMFG"
FT   CDS_pept        complement(283870..285741)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633454"
FT                   /orf_name="MICPUN_61156"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO65764.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199B609"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ8"
FT                   /transl_table=1
FT                   /translation="MSGYDRRSSRDSGRVSGFSDGYGARESDRGAGRDEPRASRYDDRG
FT                   RNDDGYGYGRGGDDHGRSPYPPPPDARGPPAPSSGGRRDRPDSGFGDRDRADYGFDRRG
FT                   GQASDGYGAEPKRARRDSPSRGGYDRSPGGYDRGYDRERGYNEPDRRAPPRSPPRDSRG
FT                   APPQSRGGGDGYGGGFDDRAPPSSYDRGRGRDAGYPPPPRRDASRDRAPNSGGGTAGDD
FT                   RDEHQMEVPAEVAKIVIGAGGNSIKDLQDRTGAHVMIYKPQPGARESGYRPVMIRGSRR
FT                   AVDLATDELRRVVRDYEDGVVGGKAGRDRGHDRGGFGDRYGGGYERDAAQRGGGGGGRY
FT                   DRYDDRGPKKPYDARGGYDDRRGSFPPFGANDGADHVQERIECPVENRGIVIGKNGKQV
FT                   HRIERDTGAKVSSQGDEPFLIIRGTPTSVRNARSQIASILDAADMPPLPPPPPEGAQHA
FT                   LEVHVEREHIGKVMGYGGMTIKRAQADTQCVMKWDKENQRIQLWGSPDIVEAGRRRIED
FT                   LVEQAKVEIAKENADATTVEVPTRGHTGFIIGGGGQNVKRMERETGARLRMDDRAQIMV
FT                   ITGRSAAVEKAARMVEDAVERAEAIERGEPPERREGGDDRYRDDFRR"
FT   CDS_pept        join(285926..286055,286177..287999)
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633455"
FT                   /gene_name="SRPA"
FT                   /orf_name="MICPUN_107398"
FT                   /product="Type II secretory pathway family "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="ACO65457.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000199B60A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBQ9"
FT                   /transl_table=1
FT                   /translation="MLDAVQIFTKGGLVLFSWSLGMTTLKGNPVDALIRTQLLEERGGE
FT                   TEFAYSSGNASYTLKWSFHNELGLVFVAVYQRILALTYVDDLLESAKRSFVAGYFDKSD
FT                   PGRASYAGFGDELTRLTKKAEASAAARKAPKGAPKAFDAAKKAAKRNDASGKARIADAD
FT                   DDAESAKGGAGKGGDTRDGDGGDSAARAKQTAAATAAFDISKLKKKGGKGSRDSSRENS
FT                   GADLKSMGGDGSDAGAKSPDAKQPKKPKEKRVWAGEGGGGGKASKELDFSEGSAAPSDE
FT                   VVERVDISKPSRIDDEDDDVTYSDEEDVDEEGDDGDDTDEGSQLGKEKGGKKKRSWLSG
FT                   VLGNSLVQGVVGKSALDDEDLEPVLEKLKTNFMNKNVAEDIAERLCESVAASLRGRKLA
FT                   SFSSLSAMVRTAMEEALTRILTPKRSVDILREVRAAKDAGRPYTIVFVGVNGVGKSTNL
FT                   SKVAYWLLQHDVKVMIAACDTFRAGAVEQLRTHCKRLGVPLFERGYEKDPANVASEAIK
FT                   AAQRQGCDAVLVDTAGRMQDNEPLMRALSKLINMNDPDLTLFVGEALVGNDAVDQLSKF
FT                   NERLADLNANARRTKLIDGIVLSKFDTIDDKVGAALSMVYTSGAPVVFVGCGQTYTDLR
FT                   RLNVKSVVKILLSAK"
FT   CDS_pept        complement(288108..288620)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633456"
FT                   /orf_name="MICPUN_61158"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65765.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B60B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR0"
FT                   /transl_table=1
FT                   /translation="MGLFTGREVPNPRPPSRTLMDAVRDNDLDLIDKTLASGESVTQTN
FT                   AYGRTPLHKAAYYSGEPNVIKSLIERGADVNARDKGSWTALHLAARNHHNDALALLLDA
FT                   GAETHWRDVKHGWTPLHLAVIAGNVRGARMLVERGADPGALDRSGANVRTLLEENDVDP
FT                   ASVLGDP"
FT   CDS_pept        join(complement(289437..289504),complement(288952..289303))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633457"
FT                   /orf_name="MICPUN_61159"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65766.1"
FT                   /db_xref="UniParc:UPI000199B60C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR1"
FT                   /transl_table=1
FT                   /translation="MPVQLASSFASFVKPVASLKNRGTRARAVLCQAATQCPSCGGTHP
FT                   DCGNGRCDKCGNAACNCSHASAATRRAMMAQFTFVPVALLLGAKPAAAGGLPSPTNQDD
FT                   MEKRKMAREEMLKAARAKAAAQAAAEAPPPPPPSN"
FT   CDS_pept        join(289878..290707,290747..291131)
FT                   /codon_start=1
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633458"
FT                   /orf_name="MICPUN_84628"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65458.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199B60D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR2"
FT                   /transl_table=1
FT                   /translation="MATVKRNTELKKVKFGTTDMMVTQVCAGTMTWGSFNADESQAHAQ
FT                   LDKLWQLGVNFIDTAELYPVAWNYGALTERWIGNWLTKRVADGTVERSKLYIATKVNPG
FT                   GVGNEHPTRAKKVHGYDEEIVEWSCRKSIERMNCGYIDLYQIHWPSRDTPLMSTPTFRP
FT                   ADENGKIKNRPMGWHDRGAQEDFDRTIKSIMKLFELGLIRHWGVSNENAFGITMLCQTA
FT                   TRLGCPLPVSCQNDFSILNQTYEEDTWEAAYRFNIVGLPYGALAGGTLSGKYFDKPLDK
FT                   CRHRVSAGFQPRYGCAQAMAATRECVELAERWNITPTELAIAWSIARPCNANGSVIIGT
FT                   TTVRQVEECVGAALLELPDELMKEVDVIHEKYRNPCMYYTEKEIWKSLPGLPPPASEPE
FT                   PEREQ"
FT   CDS_pept        complement(291332..291904)
FT                   /codon_start=1
FT                   /gene_family="HOG000190729" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633459"
FT                   /gene_name="FRA"
FT                   /orf_name="MICPUN_107399"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65767.1"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI000199B60E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR3"
FT                   /transl_table=1
FT                   /translation="MSRRLLSSLARGAGRLAAPRSTRLAPIASGAASSVEAFTRRDRMS
FT                   TSRVCDWMPAKSESAGLVEQRRGVKTESKEEMVFHKVADEMLHNLQDAVEAWGEDNAGD
FT                   DFDLSHEMGVVTIAMGSGKGTYVINKQAPNRQIWVSSPVSGPLRYDYDPARKAWFYHRD
FT                   GHLLHERLREELLGMFGGDLDLEGLNE"
FT   CDS_pept        complement(292000..294108)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633460"
FT                   /orf_name="MICPUN_50494"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65768.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000199B6D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR4"
FT                   /transl_table=1
FT                   /translation="MARSGAASRPSSSLHVATAALALAASVVVVGADRDGVAPVLLISL
FT                   DGFRASYLDAQPESALPNLNALWREGVRASLYPQFVSKTFPNHYSIVTGLHEEHHGIVA
FT                   NHMWDPKLGSEFTMASTGTEWWSEGEPIWVTASRADVRTKTYFWPGSESVIKNRRPDVF
FT                   FPYDPETTFERRVDVVGQWVRDAVAKTDPNTRRPSPSFMALYLEEPDHAGHRHGPHSMQ
FT                   VQAAVRRVDEALGRLRDAAGADAWNRTNVLIVADHGMAPLSPTRVVNLGDDACGLNFTS
FT                   LFVTGDGVAAHLWRRRGPAEQTPADGSHPRSREGDDDDSSSDDLAGGMTVTEARAMART
FT                   ITACHPNVTAWAREDVPARLRYSANARIGPVVVAADVGYLMCGYASFDAKVRRKLNIFD
FT                   DGVDLSTARASDPANWALAHVADAGCAPVCVTPSDGETNDCGGAHGYDNVAPEMRAVFL
FT                   ARGPLFRSDGARLVGELGYESSEAEALVGEDAATSSGSLHAGTIKDAERWQARTLAFDN
FT                   VVVHSIVAAGLGLDLDPGSVMLDGAPPPRVDGYLDEELANLLFRDGVGVRSGPSGDGAR
FT                   GALTPDEDDDDDDEGGGGGGGDGMAWVAAVGVVAIVVGAIVVAARGYVRRGDANSAYVK
FT                   LGSMFEPGGGETEAEIELPEVRVTGDASGAPAVFASLTEGNDGEGETSGGATSAGTSQK
FT                   LREGDENA"
FT   CDS_pept        294281..294997
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633461"
FT                   /orf_name="MICPUN_61163"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65459.1"
FT                   /db_xref="UniParc:UPI000199B6D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR5"
FT                   /transl_table=1
FT                   /translation="MTFRGHLNAGPLMELIEDTHPLGRKRELAGITPDTHRAEYDFLVG
FT                   EPGAPSAPDAPGALALPKQQPFKVGWKGKARAEEPAKDRFEKIEQRFQKREAFLPIRRE
FT                   YIRDNNDKTGLHPITGEVVDANKHVKCNGRDIDPDVRSRGPRHLPERTPAMSAFDERRA
FT                   LRAETRRPIREDFILKEGLANAPPDRLSARDNFVPPSSRLPDGRWATGHELVDVGGDAR
FT                   RSPPKIYTPYALDEEE"
FT   CDS_pept        complement(295065..296144)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633462"
FT                   /orf_name="MICPUN_61164"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ACO65769.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000199B6D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR6"
FT                   /transl_table=1
FT                   /translation="MSIATACHGARPAVAASPRRSISSSGARGALVVVDKAGCRANRRG
FT                   RSFVARASNDATECAAAVPLESRSSATVASRRGALASALASALASAVATRPALADGDDR
FT                   DVAAPTMDVEPAPAPAPAASAPVPPVRYKGSSPGNWSVVVPGEYRRMSTEKPRRIYEQR
FT                   TDCEPNCRDLQAKRTEETPLVARFGSVDEREDVSVSVRGANTLKLTFLSMKDVTEFGAI
FT                   EEATPLFVPPGAKIIDANARTGESGKGYYQWDFEYGAARVLLTAAVEQGNCYLLGATSS
FT                   SERWASSEAGFRRASASFRVGADAVANANANAASVSAKDREPPAGEVRLDDGSGDAKRK
FT                   PPGTLDCKGPLPILCSVED"
FT   CDS_pept        296357..297421
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633463"
FT                   /gene_name="PEX19"
FT                   /orf_name="MICPUN_61165"
FT                   /product="Integral membrane peroxisomal protein importer-2
FT                   family"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="ACO65460.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="UniParc:UPI000199B6D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR7"
FT                   /transl_table=1
FT                   /translation="MDNKAEAILDQALGEFNDGLGGAKSGGKSKKKGSKKKAEPAGLGG
FT                   LGLPSKAEKAPPQPKGMGSLGLPAKDKVGAKEGGKGKGKKKKGAGAQPAFNPFDPFGAM
FT                   AGAGAMGGNPYAMGGNPYGNPYGNQADPFADLMPGGGGGGAAGANPWAPNPDAEKYANE
FT                   LAEHMQKMFADFPKPSPEEEAEAQKKMQEAIASLSGAAGDESGDPAKQEEAMKGFMDAM
FT                   AQGQKGMQEMMDTMLQQLLSKDVLYEPMVEIAAMYPPWIKKNKKKLPAEEIVRYEAQLA
FT                   KVKSIVEEFEKPEGETQFQTVVTLLQEMQSFGQPPEEIMKELQAKKGGGYELPPWMQPG
FT                   AAGAEGMPPGCTVM"
FT   CDS_pept        297620..298294
FT                   /codon_start=1
FT                   /gene_family="HOG000264298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633464"
FT                   /orf_name="MICPUN_61166"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65461.1"
FT                   /db_xref="HOGENOM:HBG562589"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="UniParc:UPI000199B6D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR8"
FT                   /transl_table=1
FT                   /translation="MASSSAPRASFVVIAGRHKGGKRASSSSSKRGAKGRPEGVATDLK
FT                   PSSVAGVTEDHAFEQFFYDDATQDRIMRLVQNHERPLFLCNPSLAVRAERAGMDYLLLD
FT                   RDPRWKKVLPKGRFRQFELSSPRQMRFQYDAVFVDPPFANVQLHDLRRTVDLLASNATQ
FT                   AAAPVYLAFISDREDAVLAAFDGYGLERKGPALGYASVKQSTQERIYLYGPRADWNPDG
FT                   AC"
FT   CDS_pept        complement(298398..301136)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633465"
FT                   /orf_name="MICPUN_61167"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65770.1"
FT                   /db_xref="UniParc:UPI000199B6D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBR9"
FT                   /transl_table=1
FT                   /translation="MTSGREGSTTSGATTTPHVVLCDPPVTFARAEAPDDPSGANSSGA
FT                   GSSGAPSFFFDEANDWVIAHEEDDDATTASLRCHPLPPRGLARAASGAAGAVPPRPVSI
FT                   RVPRGPALDARVSPQWKPGLDRRDFRSAPRLVAIKRSDVAIDVYRVDVVDDGDDDDGVA
FT                   ARGGTQLSSARYELRRAGETILSFFWSLAPGVDLVVVTTRGLEQYALNAGCWDYVAEDD
FT                   AAPAEPLALVSVGEKRMKGERPVGWCAYDFDSKLVVLGSGPGHARLNAWQFAATGAIKL
FT                   PRFELPSSVAGMGLGSPPASPPSLSRSLRGEDVRLLTLYGRVFLAVADRPRGELVLHRV
FT                   HRDAIVKERVANLSPMLLYTEGALPRGVPLNLSVVDNLLCVHASGSGFVSAIDVAQANS
FT                   HEPNDENDDDDGGVRSGDLPGGEVKPLVATPSRIGGAPENVRGLTCVGADVVVDVATGR
FT                   AWKLALDLRVASDVAGGGAGGDVAASVAFLQRRSQAPWAGEGLGLGFGDDGERGREIQL
FT                   TRRGAATPPFSPPFSPPASPTPRRVVPPADASSRASFHAINDADESPRSLTLDAMRRAL
FT                   DRGGDNLGTLRSVFAAVCGSYVEARSRGAAAAAGARFRASFRARGGVVVGGEDDPSSPE
FT                   PHRATPSSPRRRDIPPSSPAVSPSDAYALVFRPHVHALLVPGVVTGGRRVRRRALRAAR
FT                   AAVVEYLLAAEQSGASREFGAGRHLSSSGSSLGSSLGSSRGVAMCARLCVAASVALGEA
FT                   RRTSAWETLLVDAGYDDEEEEAADFLRRETSSVSIRGRCRGDDDADDCDADDCDAGDTE
FT                   RQAAGRGTAATVRIPARDGQSPVASNPAEAFASLAGRPVRLAAAHRWYEETSPGSLRGT
FT                   PLGAKYRRAFDPDAGGSDGAGTDEEERGEVHPGDTDTTPRG"
FT   CDS_pept        complement(301237..301542)
FT                   /codon_start=1
FT                   /gene_family="HOG000007355" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633466"
FT                   /orf_name="MICPUN_61168"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65771.1"
FT                   /db_xref="HOGENOM:HBG396842"
FT                   /db_xref="InterPro:IPR018783"
FT                   /db_xref="UniParc:UPI000199B6D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS0"
FT                   /transl_table=1
FT                   /translation="MNDQQAGVGNDRTQQSLQEAINQRLVETGERERLKQLLRERLIEC
FT                   GWRDELKERCKRVVKERGFENVTADELAREIAPLGRATVPDAVKAELLKNIRTFLK"
FT   CDS_pept        301674..302069
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633467"
FT                   /orf_name="MICPUN_61169"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65462.1"
FT                   /db_xref="UniParc:UPI000199B6D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS1"
FT                   /transl_table=1
FT                   /translation="MSAPSAANGAWRGTLRRVLRAVDAHVTSHTGSPTWRDHVLAEFRS
FT                   GNRDTMALADRVAARLRAADEWATLANAVQRHKAMIMDYGHSLEKEREQLKKASNTANY
FT                   VGLSMPDAYDHAAHDLAAANKKKDGDE"
FT   CDS_pept        complement(302199..303587)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633468"
FT                   /orf_name="MICPUN_61170"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO65772.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199B6D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS2"
FT                   /transl_table=1
FT                   /translation="MSGAAVAQREIPGRGVGLVAARDIDAGETVVAEHALLVGVSEEFR
FT                   RVCCASCLAHGAATPCSGCGEVVLCDTCRDPASPWHHGAGHGAVVCAAERVASAWRPPL
FT                   SAPDRERLRFLGACAELRRAHVVNGDARARARLDAVLRLCPDVGPAGEGIDPREASAAE
FT                   RVRPALEAAVQATIATTEANTAGGGLLRAIAGDAIENAALLAKETKNAFGVMAATRGGD
FT                   GSHPNDGSDDDRRVRGGAVYELASRVNHACFPNVARFDNFDGVLSSPSHEFYVPHRDGP
FT                   NPPGPTELRLVAIDKIPAGCEVLMSYLPVSESCARRRRRLRNTFGFGCECERCVIECAW
FT                   ATEDGAATGDEGAYRDASRRAREARDEAAELEADAIADALDRECDEKEEVANQSLDAAE
FT                   LTRRADRIPPTYALWFVRNMCPVDGCGGTLAPPHARADHMTCNYCGERRSDEEFFRRLD
FT                   AGAG"
FT   CDS_pept        <304107..>305297
FT                   /codon_start=1
FT                   /gene_family="HOG000030512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633469"
FT                   /orf_name="MICPUN_68629"
FT                   /product="Hydroxy/Aromatic amino acid permease family "
FT                   /protein_id="ACO65463.1"
FT                   /db_xref="HOGENOM:HBG617818"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniParc:UPI000199B6D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS3"
FT                   /transl_table=1
FT                   /translation="PGSLPGAIALVAGTTVGAGMLALPAVCQRSGFVPSTCTLAVCWLY
FT                   MVATGLLLLEVNLDTMCDAGGGGVSLISMTERTLGRNGTRFAWCAYVFLHYALLVAYVS
FT                   RVGEIVGEATHLDRSICSVAFAAGLGGFVYAAPDKTLENVNNALVAAVIGTFLPLLLIA
FT                   SRNVDVANLTSVSDWSAVPGTVAVIALAFVYHNVIPVVATQLEGDRNRSRLALIAGTAI
FT                   PFVMFTLWDGAVLGGVSAEDLAAGVNLDPLSTLQGMSPAASGLVKSFSVFAISTSFLGF
FT                   VLGLVDFLSDGFGWREEGDARPYAATLIPPTIFAVSNPDVFLSALDTAGAFGVLTLFGC
FT                   LPPAMAWANRHGEGLGDACAARREEMCGVLDPLVPGGRVSLGLLFGAAAAVVASEAV"
FT   CDS_pept        join(complement(305527..306982),complement(305440..305459))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633470"
FT                   /orf_name="MICPUN_102196"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65773.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000199B6DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS4"
FT                   /transl_table=1
FT                   /translation="MRTLVECRARIAHHRACPRASKSTRRAVRAASAARRAPAPAVDDD
FT                   NVCDVAIVGAGPGGLAAALALQRQGLDVRVFEQREEFRPAGVAIFIWPHGLNALKSFDP
FT                   ETTERVVDAGAVIDTIAIEQLQPGGTEAEELVRIDVAGWSRRMDLPPQIGITWARLTNA
FT                   LRAGLRPDTVRLAHRLACIYDDDDGVALGPSSGGVTLTFEPPRNGGDAPPPVRARMCVV
FT                   GADGRNSRVRELTFGEEDASSSAAASSPASSAAAPEANVYYALSPNPPPGANGAGSFNE
FT                   LRFSLCDGSGISLLDVGRGNLDIDGGDSPGGDSPGGGQLMFGTTRFSEPARTFDTPERR
FT                   LAHLESLFENTTPLLKAAIASTSPAAVVQTRLYERDGASRWSKGRVTLLGDAAHCMYPS
FT                   LGLGISTAFQDAVELANCLSSDGSLGLGNPNSDVREALATYERRRIPPCWALQTGSRLM
FT                   HRVLAATSERAPAGGERGTGGGERGGSGRRSEP"
FT   CDS_pept        complement(307189..307758)
FT                   /codon_start=1
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633471"
FT                   /orf_name="MICPUN_97830"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65774.1"
FT                   /db_xref="HOGENOM:HBG317909"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="UniParc:UPI000199B6DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS5"
FT                   /transl_table=1
FT                   /translation="MVLVLCIGDMHIPHRVADLPPKFRSLLVPGKIQHVLCTGDVCVKE
FT                   THDYLRSLCADVHAVRGNYDDAGPDGFARQWPDSKVVTIGDFKFGLVHGHQVVPHGDVN
FT                   ALAAAQRAMNVDVLVAGQAKRWGAHKVEDRLIVNPGSATGAFRDEDPEAHPSFVLVDVD
FT                   GPRATCYVYELRGEEVKVDKVEYSKA"
FT   CDS_pept        308166..309575
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633472"
FT                   /orf_name="MICPUN_61174"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO65464.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015754"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199B6DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS6"
FT                   /transl_table=1
FT                   /translation="MTSGMVFGWGGLRDVWRIPAYVREVNADPRELRALEDLQRTRSRP
FT                   EFNPSHVSAMTSLGFWYYYLVGALASWILPAPAMPLAYACAAWAMGTAGWAVMSCGRRV
FT                   ACRYWITTGSTVVAAVAASYVPSMPTVLAAQAVCAVAATTTRRWRRDGVFGKEDRPITF
FT                   RAASLVLLALLALAALSGVAMYKWAIDLDVYSPDPETGEWRMDGEEFAFRLRRGVHSTW
FT                   TKRGFAGFGDLDHFNSGITAAEARALLSLDRGASAEDVRAAFRRESLRWHPDKYRGDDP
FT                   EGAREMQHKLAMARDALLPGRVAFDEDLAPFVRYTEYTEVEVPDEREGWGESGEGARTR
FT                   EPEPAREPEPTPEPEPEPEPEKVKYYREEEPDDDDGGEYDPKMLEEELRRAFATYDRDE
FT                   DGKMARGEFRFAMSKAGLRYTNDEFEKVWSTEFNGKPSLDFDDFARFVAKHDVEPPAGP
FT                   EHAGGHDATEL"
FT   CDS_pept        join(complement(310940..311066),complement(309688..310808))
FT                   /codon_start=1
FT                   /gene_family="HOG000165163" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633473"
FT                   /orf_name="MICPUN_61175"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65775.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG747088"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI000199B6DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS7"
FT                   /transl_table=1
FT                   /translation="MASSLGLRAAAPARARVATQSSRSMVVRAAVSTPAPVVVKREDVI
FT                   TSDPFNNVTDHIFEKIGTNLHKRPDHPLGIIKSVIESYFDEKYGKDVFTSYDDLYPVVS
FT                   TYANFDSVLVPPDHVSRSQNDTYYVDNDTVLRCHTSAHQLEMLKEGARKFLVTGDVYRR
FT                   DSIDATHFPVFHQMEGFRVFEPQEWEEAGKESVDLAAEELKDCLEGLARHLFGDVEMRW
FT                   VDAYFPFTEPSFELEIFFKGEWLEVLGCGVTEMKILEEAGLGDKRAWAFGLGLERLAMV
FT                   LFDIPDIRLFWSDDKRFSKQFKEGMFKAGGVDMQKFKPYSKYPPCLKDVSFWLPKEGDT
FT                   FTENNLCEVVRDVAGSLVEEVKLIDEFTNPKKGLTSNCYRIVYRSMERSLTDDEINALQ
FT                   EKVREDMVSKLGVELR"
FT   CDS_pept        join(<311581..311720,311896..>312070)
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633474"
FT                   /orf_name="MICPUN_76997"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65465.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199B6DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS8"
FT                   /transl_table=1
FT                   /translation="GGLEEQVTTAILHAAFIPFGPIKDVDIPMDHQTQAHRGFGFVTFE
FT                   ETEDAAEAMDNMHNAELYGKVLRCNYAQPRAIKGGNQGWSMQPVWADADKYKEDVEEAK
FT                   K"
FT   CDS_pept        312279..313571
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633475"
FT                   /orf_name="MICPUN_61177"
FT                   /product="Histone deacetylase"
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="ACO65466.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI000199B796"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBS9"
FT                   /transl_table=1
FT                   /translation="MAPSKDRICYFYDSDVGTSYYGNNHPMKPHRLAMTHHLVLSYDLH
FT                   RRMEVYRPRRSYPVEMTQYHAEDYVEFLSRITPDTASEHMQSMQRFNLGEDCPIFDGLF
FT                   DFCKLYTGGSIDGAVRLNHGMSDIAINWSGGLHHAKKAEASGFCYINDLVLAILELLKH
FT                   HARVVYIDIDIHHGDGVEEAFYMTDRVMCVSFHKYGDLFFPGTGGLNDIGKNAGKYYSV
FT                   NVPLRDGIHDDGFQDIFQTVMQKVMDVYRPGAIVLQCGADSLAADRLGCFNLSLDGHAD
FT                   CVKFMKKFGVPLLVTGGGGYTKSNVSRCWTNETAVLLDRKLPKDIPEHDFYYEYYADQD
FT                   YKLKVEPTNYIENLNNKTYVHEVKKEVMENLRAIEHAPGVAMHEVPPDSMIPEFDEDDL
FT                   NYDERYGGQFGLDKIVDRDDEYYDGDKDQDR"
FT   CDS_pept        complement(313667..315340)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633476"
FT                   /orf_name="MICPUN_50499"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65776.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B797"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT0"
FT                   /transl_table=1
FT                   /translation="MRRVGRLVRDLGLRARAARGARAPPPSAGGASRPAIRGAGGVGPV
FT                   GTPTARSSAAVVLSMGFAASSIVAAAVGVASMDDDAAQQQTAFGENVSVDPATLRRLAA
FT                   DVVGADSDDVGSVDVERRRARALRILARVTLFLDHHDAIVAVPEVVDALIRCLERGAVV
FT                   AIDDDDDDKRHDTVGPASTADAIRCLADLAKEPAVREAICASPGALVALAAAMDLTRWE
FT                   PRRRTAGKGASSSSSAQLADVPGTAGVVHATRLAAELAGDPTAHAALIRADVPAAVVRA
FT                   GRTRGGALGAIRRRLGALTARVIGRRQLIADGEKDAKARRSETTRNVAAFAYNLVSSSS
FT                   VGREAFIATDGGLEWCRARALAQKDRVAHRYAVGALAVLAANSLKVTENRRGRLDPLSL
FT                   RLALEAAVVGGLRSGDSQAACFACGMLREVAREGDEPTRRFVASLGAAGALLRLLGASE
FT                   VCPGVSGWAAEEEVAGAPDASAAGRIRRRQRKGDDGARACALRALEAFALVRPPTSALR
FT                   WSVLKAKNGLAVLAETADGTNGESASVRKLASDVLAALGK"
FT   CDS_pept        315452..316405
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633477"
FT                   /orf_name="MICPUN_61179"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65467.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199B798"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT1"
FT                   /transl_table=1
FT                   /translation="MPSIWRPNVRVSLDENGEVEDAEKGGEELAKKGTKRKGAPYTKGP
FT                   CEHGVKPRSRCKVCGACPHGKQRSRCKECGGSGICEHGRVRSLCKECGGSRICEHGRRR
FT                   YECKACGGSQICEHGRERCRCKECGGGSICEHGRQRYRCKECGGSSICEHGRQRYRCKE
FT                   CGGSQICKHGRERSKCKECGGSQICEHGRERCRCKECGGGSICEHGRQRSQCKECGGSA
FT                   ICEHGRHRSYCKECGGSAFCEHGRQRSQCKECGGSQICEHGRIRSKCKECGGGSICEHG
FT                   RMRSQCRECGGGSICEHGRRRSRCKECGGPRISTPP"
FT   CDS_pept        complement(316507..317736)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633478"
FT                   /orf_name="MICPUN_102201"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65777.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199B799"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT2"
FT                   /transl_table=1
FT                   /translation="MVSSQTEAIGVTAAAFTPLLGALGLFIWNKVWTGDAYTLNLVKCS
FT                   VGSLGFVFMGLCTRGATWLGGADDVAVFWLIVSSFVGIVIGDNLWLHSLSVLGARRVIL
FT                   IDILKPFIALIFAHLLLFEGIGYATVLGMCITLAGVLTVALEREGDAKERTDGRGESPG
FT                   GESPGTVELSDVAADDGSELLPADSPRSGRDDVTGVTAVTAASTTEAVASSALRDSRMR
FT                   WGYVAAALNVAFDTWGTVLTKEHGVGLNTWEINVVRFGFAALALALGAVFRAYAQPRIH
FT                   AAMRRRRENEPDFDDVEDGGRRRARGWHGVKPGGSNAFRLPDLTRSQWGQVLVGIMFTT
FT                   FLAPGLGNFALFKVPSLAVFSTLMCVGPIYALPLGYLIKGEEVSARAVGGSVLAVVGVI
FT                   PMFFWDHIIA"
FT   CDS_pept        318277..>318954
FT                   /codon_start=1
FT                   /gene_family="HOG000030128" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633479"
FT                   /orf_name="MICPUN_70458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65468.1"
FT                   /db_xref="HOGENOM:HBG747304"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniParc:UPI000199B79A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT3"
FT                   /transl_table=1
FT                   /translation="MFLPEDYPNSVSDDYAAFQAWDTAQGLSSYVRGSLTTKALLEGVG
FT                   VGATGATAASAAAQFIARDMCGMVGGLVFTLAKGRHLDAEAKQWRLFADLANNVGMAME
FT                   LAAPLANDRWWFLALACAGSVARSLCGCAAGATRAALTQHFARARNAADIAAKEGSQET
FT                   AVTLVGMSLGVAVTTSTDGKTAWQWAVFVALTVAHVYCNVRAVRSLVIDSLNRERVVRL
FT                   LARY"
FT   CDS_pept        complement(319614..320687)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633480"
FT                   /orf_name="MICPUN_61182"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65778.1"
FT                   /db_xref="UniParc:UPI000199B79B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT4"
FT                   /transl_table=1
FT                   /translation="MASTHTSVAFNAANPAARRGVASSSPSRPIPIRPKHNRHRWSSSP
FT                   SSARRPDVVARAVATAEPDAEFRAAASGEWEGHRVYFDAQGAPQLLPDRVVPPAFKEYG
FT                   VDLVDWQSQCAMNVTAEDGMYARELRFLPTQGCEADASTVESEEIRTVPLARVTPASNA
FT                   SGLAPGSFSSDTGDFPRSNDDNDAEPVTVEHCVGIDTVKKDGDVSRARVRVQQTIEGRD
FT                   ADVTGVCAWKEFYYEPFANAKSLCASCGGPNKWGEYPPRTQAEYVGPEWEGDAWDGFNG
FT                   DGGDVVMLPSGVWCERCENDLGGVTLSAGWLVPDREAAYLPPVRDVDTHLVSVRVYDGE
FT                   GKLAETRFIKRTRKPAA"
FT   CDS_pept        join(320804..321368,321507..321646)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633481"
FT                   /orf_name="MICPUN_61183"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65469.1"
FT                   /db_xref="UniParc:UPI000199B79C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT5"
FT                   /transl_table=1
FT                   /translation="MGWPSFGAPRLPVRRARGPRGFEDANPKKADGRRSCERARVARSG
FT                   PGGRPRHTRHTRRAGRFGESRTPMTKTVTCISLAVLALLASAVAPTLAIGGNPRAHRSS
FT                   SVLLGNGMHVDMSRTPSPLTTSLVFSGADSLRGSRHVLRQELQGFPDSDAPRGRPESDE
FT                   GGPARRSALEVAAEGLFDVFGFEVGASASFDPLCEFVNPLLPVEDQLECGQGVDEDEEP
FT                   APYEDEYGEYEA"
FT   CDS_pept        join(321798..322115,322302..322460)
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633482"
FT                   /orf_name="MICPUN_95021"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="ACO65470.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199B79D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT6"
FT                   /transl_table=1
FT                   /translation="MASLCRASVVASAPVRAANRDRRTRASAVPAPRRLKISDDSTRRG
FT                   DACVTRATKETYASFDDMIERSPVPVLVDFYATWCGPCQMLSRDVLPKVAGAVGKDRVK
FT                   LVKINTEKYPNIASKYKVEALPTIMLFKEGKVADRIEGMPNAPQLIDRLLYFLQ"
FT   CDS_pept        complement(322519..323682)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633483"
FT                   /orf_name="MICPUN_102205"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65779.1"
FT                   /db_xref="UniParc:UPI000199B79E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT7"
FT                   /transl_table=1
FT                   /translation="MAAGDAPGMREDDAVSFSGDEDIDGSMDAGCIDAEDVAALLDDRE
FT                   AAAPDETLSLATIARRNLPDDFLELAEPEAIARAVAKLDQVRLDRCRLASFVGGVSVEV
FT                   RRASFANVTALYLQHNRLTSTRGVDGETLPRLRFLALQGNRLRAVAELGTLRHLALLDL
FT                   SENPNLSRLDELVSAMPSSMRFLSCAGCGCAADGDYRAALVASLPRLKKLDGVDVTGRE
FT                   RDDAMAAFGEDEDEGEREGEGEDEGNRGDRTRSSGGGARRERRSAAKAVGWSSARNEST
FT                   AASSSFGDAARSREIRAMLPMLEDPEMLVDAMGAAVRSLALDAVGEMDARADDVRSNAR
FT                   NARATRDDDADLTMEARVRAARRRQDASITEAGTMMPFDEFAGPEVL"
FT   CDS_pept        323852..324916
FT                   /codon_start=1
FT                   /gene_family="HOG000191633" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633484"
FT                   /gene_name="XAB1"
FT                   /orf_name="MICPUN_107400"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65471.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG460599"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI000199B79F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT8"
FT                   /transl_table=1
FT                   /translation="MSDAEVECQPCDPAPETQELPSSAAAGPGPITDADMEKMPSVCIV
FT                   IGMAGSGKTSLMQRINAYQHTKGEVPYIVNLDPAVGKLPYEANIDIQDTVNYKEVMKEY
FT                   NLGPNGGILTAANLFATRFDQVVGLCEKRAADIDHVFVDTPGQIEIFTWSASGAIVTES
FT                   FASTFPTCVLFVVDTPRAQNPQAFMSNMLQAVSILYKTRLPMVVVFNKIDVVRHEQMLE
FT                   WMDDFEKFHEVVDQDKSFASDLSRSLSLVLDEFYKTLRRAGVSAMSGEGMEELFDAIGR
FT                   CRKDYLAEYWPDLRRRKEKLKAEDEKRRADALERMRRDLKSGGERVVLDMERLKVNEAV
FT                   LAADEPPAPGSELD"
FT   CDS_pept        325193..326491
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633485"
FT                   /gene_name="TMPP"
FT                   /orf_name="MICPUN_107401"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO65472.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI000199B7A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBT9"
FT                   /transl_table=1
FT                   /translation="MEAWEAIVEPGARVFVRTARHPTLEGLPPHVSLTTFDHVYEATKR
FT                   LEDVYPAIAAELLDVAKIAATTAAATADDDGEDDAGDGVDDGEDDGIFGDGQDDDIFAS
FT                   FALEDGSDVVTSHRTPRSRRIVYAVPGDPCVAENSVAILRERANAAGVKVTTLPGVSFL
FT                   EPTLAAIGVDVMPSLSIVDAIDVARSAHAVGVNCDSPTLLCQLHSNAVASDVKLTLMAQ
FT                   FPEDHPCVLVHAAGTAEQVVERVPLHEMDRSEHVGILSSAYLPAINVGSSSDGDDDGTP
FT                   GAGGFGGASVEALLDAVGRVRGLDVDSEPAPPSYMMGEGDAVGDDGDDGDDGDGDEEAR
FT                   FVDDFEGRGFLTQADDVWLSADHADPTAVEALRAAANEAVRCAEDDADPEDRARAMGRL
FT                   LAHVSLHVSMASEAGEYAMRDVVRHAVEAVREA"
FT   CDS_pept        join(complement(329536..329605),complement(326570..329361))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633486"
FT                   /orf_name="MICPUN_61188"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65780.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000199B7A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU0"
FT                   /transl_table=1
FT                   /translation="MATPADSVILEEEIDENYEPTHDEMIDYAKWLGMDLETEKDLMWI
FT                   AREGLKAPLPEHWKPCKAPDTGDIYYFNFQTGESVWDHPCDEYYKNLYATEKANLERRR
FT                   AAERERPASAAAGARPTTAGVVRPGTAAGIRPVTAGPAGANPLDRQRLGSLAPLGGSLA
FT                   PLSRPITAARPLGGEPASAMRPDESDSGSEGSRGGFGGIDSPSAAGGSESTNVWKLEED
FT                   ADDDAAREAYKVKLTTAREAWENEMDKEDAAARRRRELERDKEQLRLDQEEAKIRREME
FT                   EKFERLAIELKKAAKRREEEAEVEATALEKEATERKAKAEEMMREATEKIADAKAKSAA
FT                   AAALVADAEETRHAKERAVRFLDAENERITEEEEGKIRAEMEPQIAALRAKLDAEREEL
FT                   KKQIAAAAEETSKAKSRDDGSRVAALMSATEHLTDPKIEEMYATAAEASSVRRIEMAEA
FT                   RAQAAEDAARSRISLAEEAVVKADREAMAAIEASRAQTREAEDGALAMEPYGEDSSGRR
FT                   RRGGGVGRSSGDASSFASFGSAASDGDSESDGGFESLRGDDEATIERYDPDENPAIASP
FT                   GGKMAVSSLRAAVAAGDDDALLARAEEFLKVQKRLAGAKRQALQRASSEWRAAEKALMD
FT                   PRMDEDLRERRGAMVRAIRAALDVSMSAFTAEMRVTRALRVATRSAAYPTANWAAVFSS
FT                   TVMADVGWDPSEFDPKAVFARLRPAPGAARAAARERLTADASFKDLQSFQRSSSYVADV
FT                   DDGSPIGSPGESPTTSPRASGRNSSAAAAFDPRGRVGASREPSAADLPRRAYSTRIGED
FT                   PLDRVFGRLKKTVATGAYSSKPHPVFADTSGMSETFLKRTEEWAKAAEKERRLIEDHVE
FT                   WMSKFQASLEVGAAKLLRPRKMFKPAPPMPAFAPTIPPPGDEPRPPLDVRRAEQRAVEA
FT                   INALDAQSEAKPVDKPKVEGASD"
FT   CDS_pept        complement(329984..332431)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633487"
FT                   /orf_name="MICPUN_61189"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65781.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199B7A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU1"
FT                   /transl_table=1
FT                   /translation="MEDCCAICAEPLTHVAYGPCGHRDACVECVARLRFVMEDRRCVIC
FT                   QVPCERVFATRHMGEYTETIGADGFEQLPKRARAKQLHHDDKLDMFFDDDAVCGKVKSL
FT                   RSLVCGECVRDAGGDASAVSQHQSVKALKAHLRERHGKFFCEVCLEGRKVFLSEQVLYT
FT                   RTQLDKHRYGASADVDNAFGQAGFKGHPSCKYCRKFFYDEGQLYTHMQTAHETCHICRR
FT                   QCPDKHVYYRDYEELERHFRKDHHACLHPECLAKKFVVFTSAQELKNHEGLEHGRAMTK
FT                   AERQAALRVDVGFTVGDNGGGNQPGERTAVGISSRGGANNATDVERMRAQARAHAQEQL
FT                   RQARVNSVESAQLEAVLRASREESELPRVASAEDFPDLASNSRGGGGGGGGLIGGGWAG
FT                   RAGSGRSSPGLSASGGSVGRNLDDAEAFPTLGGANPNRGLKKQPRHMQPRGGNPAGSAK
FT                   VPAPVPARAAEVLAARLRGLANAGGGGGGGVGSFVGGSNPPSLASDEEHFPTLGPSRPN
FT                   VQSSFAAPPGFNADGEATARPLPARDVSIGGGGFERVASKRGKGRWSAADGGLATSALN
FT                   PPPSRQVSKKAQAKTEEDASLAKEAADAEVAARSDALVARVRRTLDAKGGSFNSFASLS
FT                   SQFKSGQCSGASYVAKLRVMGLDLAIVNELAALMPDGDKRDELERAAAAAARLMGGGVG
FT                   GGGGGAGGDSIGAAAAIMFGAGKRDGNAWDCPACTYHNAGGNVRCDVCDGLRPGAAVGP
FT                   VVGGGASSSGGGGAVSGGGGGGGKKGKVKGRKVSLTAVGGGGVRGIDEIVDPGRSSRSA
FT                   WGA"
FT   CDS_pept        332849..334816
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633488"
FT                   /orf_name="MICPUN_61190"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65473.1"
FT                   /db_xref="UniParc:UPI000199B864"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU2"
FT                   /transl_table=1
FT                   /translation="MSGGMGVPIPPPGAGGRFGPNDAKKSGRRDRRGGGNSRRASRGAT
FT                   GKGGSGGDASASSNGDASAPRDPRARYDPKYDSFTRGLGAPGSSSWNAGSTGFSSQWPN
FT                   LPPAGGARSPATPSVSSQTGPSSSSKFPDILRDTYKPQPQTIRTGKWPYNYVNVATGGL
FT                   TGAPPAGAPTPPAPGSASSPAGVQSGPSATFRSALQSGRYPVPSRSGADALRSIATGGG
FT                   AGGGKTGSPVASPATTTKTAPSRPPGSSAASSQSSTPSTNKPPSNATNKPPRLNGTNGR
FT                   APRVGSRARGPAKRFTIKSADGLGYPLGPVPVIAMIGAPLCWIGYNSTPKMAVVDRKEF
FT                   NRKGGASASASGAGDGDGAKKLRRAGDAIAAAAGAALGAAPAGASGGAPDFSKAKKELA
FT                   KAKAKVEAKAAPPGKAKVETSDCGGGPPVGVMAALVGVAGAAAAVGAAVVKSGVDAAAK
FT                   QKAQDDAKAAQDAKAAAKAKAQEAEEKKKAKLEASLSPHAAAPTPDAPKGANAGTKKTA
FT                   PRTGPEGEAAAKAEADKKAQEAAVSKVEADKAAKAEAEAKAKAEADAEAERKREEARKR
FT                   KEQVKHEVEQKEKAIEAEAAAQKQKQAVEAKLNDIAASQTKAEDKKKEDKKAKMKEEKK
FT                   EEKKAAKQAAKQAETANAGG"
FT   CDS_pept        complement(334942..335502)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633489"
FT                   /orf_name="MICPUN_61191"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65782.1"
FT                   /db_xref="UniParc:UPI000199B865"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU3"
FT                   /transl_table=1
FT                   /translation="MGEEKEDELPWLHPGGTPVVFKKRQEGQKRPFLCHPGQLPKVGER
FT                   FEIDCTGDNQWFRMCGLVTRAYSCDLAAMNGGQVEANVTAIGTVFPLFRHDACAPCDED
FT                   EVYVVHLAMFTHAQGDKRWLLEHVEVASDHQRGGAEIDADEWLRKNVGFVVSNSYYHEY
FT                   AEGNLNGVHGGTRSLTPESRAKI"
FT   CDS_pept        335718..339281
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633490"
FT                   /orf_name="MICPUN_61192"
FT                   /product="Transient receptor potential Ca2+ channel family "
FT                   /function="receptor activity"
FT                   /protein_id="ACO65474.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B866"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU4"
FT                   /transl_table=1
FT                   /translation="MPKKRGGDDVVRSDDAVAEQARSFDTPGTPWYAVKHGTLEDLMDI
FT                   WPATRCARPHHAGVTADDPCELCGCRADVFDTGAVGENILHICVLFHTTETLRMARYLV
FT                   LKFGAALVNAPYQQRRRVTDPPGLYEGETALHIAIVHRDAELVSFLLNHGARLDVHAIG
FT                   TFFAPGRVYFGETPLAFAASTGATELVDILLKHAFDRGGKKLRDAVLNDADALGNTAAH
FT                   MAVVNNRLDCYDHLVDQCGASESVENNAGLTPFLIAARDGNAHAFNRVLRRKFAAVWRF
FT                   GPVTSYNLNLTGIDTVGARASDRPENAVDVLVRSHRIELLSHPVLVAVLDLKWRRFAKA
FT                   AFLRHLACYAAFLALFAWLVAEHVGRRERSEWRSGRRIAAEWCCFAGVAAMSYLHVRDL
FT                   RFYARKYYRSLTVRNGKSSDVPTYSLPGRGVDGRCNPRQRPVQVRWVGRGTRIGRDWTQ
FT                   GRGGPVPEPSDSTVVATVSTTSIDEEADFAATDADTKTPPGSPPPNSSKTLRKQDSTRS
FT                   IGRFRAFDAGQGGTGAESGDSARRKARRRGGFFGRMLSGSGGIVHSRSSNHFLFDSLGS
FT                   TGCGGGGDDDGFAFGGVVDVRSAIARGRWRLLRERWMERNWPGVARKRLGLSHSLSRAD
FT                   DFDDRVVVLLRVNVLGARGLPAADANGASDPYCVVHAAPGVIARTQPVMETLEPLWHRS
FT                   FSFTAPPGLRRSGNCVFLSVIDYDGYDEADEDGDDRLGFAAVPHHDVQYVGSGIAAPGP
FT                   TWLDLMPTRREAESRALEHSRRSRAAESAAVAEGTPSSSPSSRPVGQILAEVYYEVVNK
FT                   SKGGVHTDFYPRDEAAIDGNNQRRLVGPQPPLRKRLGALGYEVVGGDARAVLTGKTSDK
FT                   NVADGFPFGEDGDGDGFGSDSGEEGEGEAETTVAEAVAEVRRAIKNSKRGARHAFLAIK
FT                   CWITSVFVPQPLMWLNLAHLILHAFHFVDWNLSEAPSARDDVVFSLAALAAWGFFMYFV
FT                   ATSRRVGFFVVIVARCIKDVVKFSALWIIAMLAFSQAFYILGAGWLGDPALKPASFGAV
FT                   AWKLFAVATAAEGFFDDVMPDTDVSSGGVEFTYTALVVAYQVLMSVLMLNVIIAMFNQT
FT                   FSRVSDRSRDEWTLQWALKVLLAEARLEPVERFRHRLGAEVDGPGSERAQNFEINFAEG
FT                   MQEKGSVEAAIRELLSEDPKR"
FT   CDS_pept        complement(339395..341572)
FT                   /codon_start=1
FT                   /gene_family="HOG000100113" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633491"
FT                   /orf_name="MICPUN_102212"
FT                   /product="Sterile alpha motif domain-containing protein "
FT                   /function="binding"
FT                   /function="transmembrane receptor activity"
FT                   /biological_process="innate immune response"
FT                   /cellular_component="intrinsic to membrane"
FT                   /protein_id="ACO65783.1"
FT                   /db_xref="GO:0004888"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0031224"
FT                   /db_xref="GO:0045087"
FT                   /db_xref="HOGENOM:HBG562607"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI000199B867"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU5"
FT                   /transl_table=1
FT                   /translation="MRTARRCQYSRSAIRASRGSASRRSVAVNVAAEPAKAIEPAPAPN
FT                   LLQREQYPPHLRWPETLYDEARVGGKKEFDARLADASAVIHAWAEAVEGGECDTVSEEA
FT                   SEAADWIRQALTMKIELGDKDLAVKQSKAAGNSGENQSDLVLMAQYGSVHALLALQAMC
FT                   HKNSVVCGRLVKGDDVFKIVKETLEHSPYDQVRCAAMSLASSILGFNEETHKIAAKNTM
FT                   GVLVTQELARWCNVDDDGNATCNFEVGFRDLRGMDTCDHASVALRYLSANAANHNMLKK
FT                   MGCVELLLNLMAARPDSSVRINAAVCVADIVGRDEMDSRIQSDPTIVEETLSALEAILD
FT                   GNAADSGITFEAHELIQGLANLANVDATKRRFADAGAVPLITRALLEPQYKWDLVMLHS
FT                   SAAIWNLAFDESIREEIKACPGALDGLEEANKVGSEMTKAKARGALWMINSDAEEAVDH
FT                   KISEDKVKLLTSGGSTAATQVMLSYEWHSQAQAKALRDELVEEGFTVWMDVDRMMGSTL
FT                   EAMAAAIESSDAIIMCVTNRYRESQACRTEAEYAYTRKKLMIPAMLQKNYKPDGWLGIL
FT                   MGSKLYYNMHNQEDIRNAMPAIKAEVAKSMGEKKAIGGEIDGANGAAQATPNLSSQAAS
FT                   KEIKVPDNKDTMTLWLENHGLGQYSAAFKKEHMYGKALLKLHEEIGHGDPEKATYHDLF
FT                   QSVLGITSYGHRLLFLAELEELIGPIKWKRR"
FT   CDS_pept        342222..342767
FT                   /codon_start=1
FT                   /gene_family="HOG000214428" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633492"
FT                   /gene_name="COPZ"
FT                   /orf_name="MICPUN_107402"
FT                   /product="Predicted protein"
FT                   /biological_process="transport"
FT                   /protein_id="ACO65475.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG326766"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199B868"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU6"
FT                   /transl_table=1
FT                   /translation="MSGLGEIPGVLNVLLLDSDGKRVAVKYYDQKMKTLAQQMKFEKEV
FT                   FTKTQRNNARGEAEIALLDHHVVVYKFCADLHFFVTAHVDENEIIVATVLNAFFDAVSL
FT                   LLRGVVEKRAALENLDLVLLTIDELIDGGIILETDPNAIANRVTMRGCESEATPLAEQS
FT                   LSSALAIAREQLTRNLLR"
FT   CDS_pept        342934..344163
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633493"
FT                   /orf_name="MICPUN_97836"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65476.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI000199B869"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU7"
FT                   /transl_table=1
FT                   /translation="MGILEKIKDIELEMSRTQKNKATEGHLGILKSKLAKLRTELLAPS
FT                   KSGGGEGDGFEVSKYGHGRVALIGFPSVGKSTLLTQLTGTDSEAAAYEFTTLTCIPGVI
FT                   HYNDAKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLILMVLDATKSEAANSRYAHKE
FT                   ILTRELEAVGLRLNQTPPRVYIKKKHSGGVQVNNTVPGGLTRIDESTVLKVLAEYKIHH
FT                   CELLIREDIDVDQLIDVLEGNRKYIRCLYVYNKVDALTIEEVDSLSRRADSVCISCYLE
FT                   LGMDQLLRRMWAAMGLVRVYTKKTGNKPDFDEPVVLAEHRGGTSVKDFCDQIHNTIAKN
FT                   LKYAQVWGTSAKHMGQRVGVKHALEDEDVVQLVKGDKVDKDELKGRFSVTKKNDPARIA
FT                   DRVKKAKLKT"
FT   CDS_pept        join(complement(346865..346903),complement(346358..346699),
FT                   complement(344357..346126))
FT                   /codon_start=1
FT                   /gene_family="HOG000029694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633494"
FT                   /gene_name="TOC75-1"
FT                   /orf_name="MICPUN_102215"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO65784.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG317894"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="UniParc:UPI000199B86A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU8"
FT                   /transl_table=1
FT                   /translation="MASFACSTLTTAQGRIAPARRAGSMRAKPVTAFSIRKQARKERSV
FT                   VVMAADRADAPEEGFVASTDGPASGGFALPSVKTVALAVTGATAAFIAQPMHILQMAFA
FT                   GNGGNGAQGGDGGDGGSGGSGWGAELFGGLNARKGNEVSKDDLSNDLEALLNTGLFANV
FT                   DANVTPKGKNGYAVEFVFREKIWPNVQTFKVQGATVLPPSIEREVLTTVRKQGQCTVRV
FT                   LATMKNIIEGYYTSKGITFGTISHFDGMETGDVVAHVIEGEITRVKAVFLDDQMQPITR
FT                   GRTHPRVIQREHNFKVGQLYNVEDAKTALRDIFLLQLFDNVQVVPRPDDRDQSKVQVDI
FT                   VLRERPVKTAESELEWSIAPGEGGKPDLVSIKPGGSVFFEHRNLDGWGRQLYGSVSTAN
FT                   FLQPQDDLGFKLEYHHPYCLGDGDPDKTNFKTSVFNSRKLSPVFAGGPLMEEVPSIWVD
FT                   RAGAKATVTQNFTRQSKATASVIVEEVTTRDESGAVVGAGSKQGAQGQLSSDGPPTTHS
FT                   GNGTDRLMFFQGGLTRDTTHFVNGTPVGARDIFNVAQSVGLGSAFPVYNRFSAECTRFI
FT                   QLRPEHKKRNTPPPVLVTHAKAGTIVGNCASYDAFTLGGPHSCRGYNVGELGAARSFLE
FT                   YAAEIRVPIPKLDTHAFAFWERCTDLGSSASVPGNPTEYYRRAGSGTSMGAGIKLGPVR
FT                   AEYATDGNQANGNWFVRFGERF"
FT   CDS_pept        join(347187..347262,347387..348027)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633495"
FT                   /orf_name="MICPUN_61197"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65477.1"
FT                   /db_xref="HOGENOM:HBG562608"
FT                   /db_xref="InterPro:IPR021606"
FT                   /db_xref="UniParc:UPI000199B86B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBU9"
FT                   /transl_table=1
FT                   /translation="MTASMSEEPGSPQSFNELKLQESEFAEEMSHGEDEDAMDECEFEI
FT                   TSTEGPVDAETQKFDTIIGALEDLLMSDGFSERQAEFCRAKCHVFEDTEENKLEYTSIF
FT                   DEYTETLEAAMMGHLDESVEGFDAAEFFDMLEQREGQLDGDVFDLLMTLTSFEAFKELM
FT                   LDYKREADGVGGVGDEGEGEGGEAGEGKNIFGLGLGMGFSVAPAPAVGEEQLDGDERPD
FT                   LDDSLIITPGPGADSP"
FT   CDS_pept        complement(348121..348972)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633496"
FT                   /orf_name="MICPUN_50504"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65785.1"
FT                   /db_xref="UniParc:UPI000199B86C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV0"
FT                   /transl_table=1
FT                   /translation="MSSSALRAACRRLSPAASTSYRQWVGGSACHLHTSRATLDDQHRT
FT                   GELGPKEGKTLSFAERVAREAGLNATGSVRKAIIEREDAAMLMAIADRWNRTMLHNDSL
FT                   WPLLKRLADPISNYWAVVVATREVGLMGARHRRCKFDDGPAAMCGPCVMRHRNETQNDP
FT                   AEKDHEPCFHRSLGGRAISCHDWQEWTYAALYCQLWVAGCAATYALVSWSLVGLEKDWL
FT                   QFQVARPKTVGREFVLMSWAILLNLAVLEYARVWLAGTTYRAIGWRIVKYGARWRRYMR
FT                   WL"
FT   CDS_pept        349384..350397
FT                   /codon_start=1
FT                   /gene_family="HOG000242064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633497"
FT                   /orf_name="MICPUN_102217"
FT                   /product="Prephenate/arogenate dehydrogenase "
FT                   /function="binding"
FT                   /function="prephenate dehydrogenase (NADP+) activity "
FT                   /biological_process="tyrosine biosynthetic process "
FT                   /protein_id="ACO65478.1"
FT                   /db_xref="GO:0004665"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006571"
FT                   /db_xref="HOGENOM:HBG562610"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199B86D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV1"
FT                   /transl_table=1
FT                   /translation="MPFDNEARAAKRLRKLKIGIVGFGNFGQFLARRFIQNEHTVIATS
FT                   RGDYEDAAKKMGARYYRDPDDFCEQHPDVVIFATSILSTEATINSFPVQRLRRNTLVAD
FT                   VLSVKQFPKQLFLQRLPDDFDILCLHPMFGPDSGKGTWKALPLVYDKVRVGDEQSRRDR
FT                   VDNLLGIFADEGCRMVEMSCEEHDRQAASSQFITHTVGRMLGSMELEDTTINTKGYESL
FT                   LNLVNNTSNDSFDLYYGLFMYNKNATQELNRLELAFSQVKAQLFDRLHTLIRDDIFDTD
FT                   GSSPEQLKKAWEKAGESMNERGYKERLIDQVNSTGVIGGSRDEHAGKGAESEAPSR"
FT   CDS_pept        complement(350595..351503)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633498"
FT                   /orf_name="MICPUN_108867"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65786.1"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniParc:UPI000199B86E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV2"
FT                   /transl_table=1
FT                   /translation="MSSSGVLSLSASARVAPRATSVRRARAPVRATQLARSRADTAAWG
FT                   KKFMSVERGSRAVGVRSLVEAANTEPGASYDDGDDHVDTTYDAEDLAHPDVAMMKASRE
FT                   VRKPFREFSLIEKVEYVFVRFTLISACIFVLLGVLASLLLSALLFSMGMKEVLFDAVQA
FT                   WAGYSPVGLVSSAVGALDRFLLGMVCLVFGLGSFELFLARSNRAGQVRDRRLKKLAWLK
FT                   VSSIDDLEQKVGEIIVAVMVVNLLEMSLHMTYAAPLDLVWAALAAVMSAGALALLHYAA
FT                   GHGDHNHKDKGGHDSGAGLLH"
FT   CDS_pept        join(351882..352175,352260..353069,353124..353795)
FT                   /codon_start=1
FT                   /gene_family="HOG000043078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633499"
FT                   /orf_name="MICPUN_91574"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="ACO65479.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG320483"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199B86F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV3"
FT                   /transl_table=1
FT                   /translation="MFRKPLPTTGAHKLGGSDEKKLRKQIVAAFPCAGEDDAMALVPKK
FT                   AELSLQKLAAPSRTQIYVGDGQPVFYDTSGKGDLFPTVFALWRAPGMLGEPVSFGRGRL
FT                   FAVVVPGNPAPIAVGEAEMSSAEVRDAGGAGGKGRFLKILTTYRDALWDYAASHASRPQ
FT                   LVPNEGFLEKGVVPLGSAAHDDAEDVEEDDVEDDVEVDEEVDEEASGKGVGDVNDAVAG
FT                   LSIDAEAADEGADEGVDEDVDEGSGVVADQTPHQLTVAEMDALIESAVLQALSRDKTVT
FT                   DKSLPMLGTAFWSRHVNPCRPAGAPPLDIKRSSHKKMSALLRHVHKMGWATCKEDKRTK
FT                   ETAVTAIVRSHPDLRNHVPHETAADADAGAAAAAGAVEGGKPQPLRLEEHYKPHVNLTR
FT                   VLEAIDAPTDALYTGPEARELVVKYVAVKALDAGKSVTLDPQLCDALFKGVLKKGDAFP
FT                   THMSKSDVTKAWLNRFHPQTAVVRGGTRSVKKGALQPVRVESDRRGGDRRITRVTGTEA
FT                   YLIDPEELARTLGSKLATACATGELEGIKNVGKREVVAQGNAVEKVARILAEWYGVPSR
FT                   FIDTADKLKGKGKNK"
FT   CDS_pept        354673..356772
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633500"
FT                   /orf_name="MICPUN_102220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65480.1"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniParc:UPI000199AD22"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV4"
FT                   /transl_table=1
FT                   /translation="MAFIDVPVGTRLNSMLAGYFSKTVACLVSRRQGECVAWFQANPRF
FT                   VDRLVEHVGVLAVAEVLLRLVGADDPGSMMPMQSMLLSAMGASGDQSAWLVDTPLLDRL
FT                   LDALDAESSSFAVGASDVQSEGSSPEDAAATRTTRQANAAEVLVGIARGAPSALAAKLS
FT                   GKEAMSKLFERGLNASPPGYGDGAEGKGGNPDGSRVTAHDGASSSPLVNVLDIAIAIID
FT                   AKRAASGPMQTMRAMLAAETGSAPAASPPPPPEALDACVRYLEPLVAQLDVANDGSSQR
FT                   TTWGTITPPLGMRRVKIVDMIATIVGCKDDAAATRILETGALVKCAELFVRYPFNNFLH
FT                   HHFENAVAAILDWGHPALVSHLFASRADGGVDLVDVIVNAPRFAETTRGPVRAGNAGHV
FT                   TRMANRLVAVALGESLSPAPKTTRVGVGVGGFDDPDDDDDDEEESEEAKARREDREAAA
FT                   ERSRSIAVAALDADARWRAYVEGELGDRNQIENVYKWACGRPAGMDDLGLNEDDEEDGD
FT                   FDIGLGAGFSRDSYHRYGGADDDDDDDEEEDGADSDDADDDDLDPLTARGAALLFQGDA
FT                   NARLASLTLGRNNHPDVMIEELGEEMDSAGGDPDDDADTVEVPASVVSLFGRSSLGGEG
FT                   GGAAGDDDDVVLADSDDEGQTLSPKSPDARSEKVEHDAPELMREYGSSNFWGSAIDDSL
FT                   VPDDI"
FT   CDS_pept        join(357003..359257,359292..359310)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633501"
FT                   /orf_name="MICPUN_61202"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65481.1"
FT                   /db_xref="UniParc:UPI000199AD23"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV5"
FT                   /transl_table=1
FT                   /translation="MPKKVKKFIDKKNAVTYALMARPGDEDEMEPPPSSKDSMLSGVSA
FT                   RTTRSTKSDGAQVWMRKDNNHHARDVMAEAVDDGSVFNDAMTETMSQMSGMSQWSNVTW
FT                   VMGPNGPVPRRERLSREKRRELRELGFDPNEGYDYTRHLRQVGEGGGTMFVPTRKDHVK
FT                   GIRERDGEVAEHKLTAGGSGKKGTDSELVYLKEDVERDGDAARAINDERSDTAQARAAS
FT                   EEDERWTHERVKAVTREKVYVAKDTSAANAVVARAVRARPKGGASAKELDDMIDTMEAA
FT                   ELAADEELPNLDDEFGDGGLGDLQDDFILRAMLGDGEAVADAHDERHFPPVVLRYDETE
FT                   VERQLEAIEEELEEEALEEEEEELAANGGFFGYGKRGPGSDAGTDRDEDFDEQDWDAAD
FT                   QALAQRRRDGPGAALRDLDTQFEALAMGYDSDEIGELDDDDPRIFGHAELDRFGHVMEE
FT                   FRRDHVHRETYKTAADILEDGADVPDIDEEEGSDEEGSDDGEYGRRLVGPAKAKEFRVT
FT                   EEDVEDARGAMIAMRKRAGLPMPEHLAREMTLGDGTAGLGADDEVARRYELVEEGEGVG
FT                   DDSIDAVKREIAYLNVEDKDDTWDVETVVSTFNNWENHPAEIDVGPALNKPKKKRGKPN
FT                   VGAAEGGGDGAANVIRLSEVNGLPVDYVQSRRGKGRGGNGLTAANLAAIGEAAEGEWGS
FT                   DEGDEEDEEFEGTDFGGEEWRSNIRRKGETAEEKKARKAAVKLGRREARAAKKGLKTTG
FT                   PPAT"
FT   CDS_pept        complement(359370..360890)
FT                   /codon_start=1
FT                   /gene_family="HOG000242790" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633502"
FT                   /gene_name="TYRS"
FT                   /orf_name="MICPUN_107403"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65787.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG288125"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199AD24"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV6"
FT                   /transl_table=1
FT                   /translation="MSCQRVALRLRARAASAATPAGRHFVFTPQTSPLRAVAFLAHRRP
FT                   AWQPASRAALQMRLHASSATATEPAAAPLSKADVVDVLKERGLLDACTNEDELRKACAE
FT                   GSLSVYCGFDPTADSLHLGNLLGIVVLAWFQRCGHTPVALLGGATGRVGDPSGKSAERP
FT                   VLDDDTINANTAGIKAILERVLANGAADADTDVPPAVVMNNLDWFGSMGFLEFLREVGK
FT                   YARVGTMMAKDSVKTRLDSEQGMSFTEFSYQLLQGYDFCHLFKEHDVRVQVGGSDQWGN
FT                   ITAGTDLIRRLADKEGAWGVTFPLLLKADGRKFGKSEDGAVWLSPERLSPYKFYQYMLQ
FT                   STDADVVRFMRMLTFVPLAEIEAIEASMSADGYVPNTAQKRLAEEVTRFVHGKEGLTQA
FT                   LKATEGLKPGADTVLDAATLEALAGDIPTAELARDEVVGKTVVDVMAATGLQKSKGEAK
FT                   RMIKGGGARLNNVKVEDEEATIGEDDVIEGRVLLLAAGKKNKLLVRVV"
FT   CDS_pept        361458..362678
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633503"
FT                   /orf_name="MICPUN_102222"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65482.1"
FT                   /db_xref="UniParc:UPI000199AD25"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV7"
FT                   /transl_table=1
FT                   /translation="MAEARAVVRAGGGGEGQKAAVKGQLDGAAHGREVMAKAHAVVRAG
FT                   GGDEGQKATVKGQLDGSALGGDTLAAASADRRAGIAKPGQQDMLDKNLAWRTMGSAEER
FT                   EEAKKKNRRERQSRYRTKKKDMAAATAAALRLRPPSTPVADEAAAALEVPVADEEAAVI
FT                   EAAAALEAALEAPVALEAPVAEEAAVALKAPVAEEAAAALETAAALEAPVADEAAAALE
FT                   AAASDEAAAAALEAVAALEAALEAPVALEAPVAEEAAVALKAPVAEEAAAALETAAALE
FT                   APVADEAAAALEAAAADEAAAAALEAVAALEAVGTDEAAAALEAAAELSAPPPLSAPVH
FT                   DSPAANAAAPAITTKSNMDDILRHLRARQVTGLSKLNKADLVKVLHRTNACDAQTRSIT
FT                   SFFPKRS"
FT   CDS_pept        363023..363637
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633504"
FT                   /orf_name="MICPUN_108868"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65483.1"
FT                   /db_xref="UniParc:UPI000199AD26"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV8"
FT                   /transl_table=1
FT                   /translation="MRLVRLYGCTSHMKGAWDGANTYVKHSLRKYLLTDEAKNDPEKGI
FT                   RTAEEACQWCRESLNTVMGKRSSKKSRRSATKLDERRFLFVGLKDIDRSGNLAKLEWET
FT                   KDRVQALHELHLEPGEVDLKGRDLVCRCPPCQQTMEGPCMYQNWVGAPRHISIQLKKVT
FT                   GDQMEALRDHCKCRRGRRDRCLICTHVHEVHSKLQSGSGPA"
FT   CDS_pept        364296..364625
FT                   /codon_start=1
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633505"
FT                   /orf_name="MICPUN_85068"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65484.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000199AD27"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBV9"
FT                   /transl_table=1
FT                   /translation="MTRLTGLVSGKIESNDVVVWAKSWCPYCDKVKALFQTMEVTHLAV
FT                   DLDKFNEEKALVKVLTEMTGQRTVPNVFIGGAHVGGCDDTMALKESGELQRMLKDLGVS
FT                   FKDDA"
FT   CDS_pept        complement(364675..365310)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633506"
FT                   /orf_name="MICPUN_108869"
FT                   /product="Predicted protein"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO65788.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniParc:UPI000199AD28"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW0"
FT                   /transl_table=1
FT                   /translation="MAHRFDGTGVAILEVRMARDFKLAHVRWTVHDDGDSRAAAHALRR
FT                   NAAALKTMAGKMLGSKHTPRLEFIDDGATSRKEAELDKAFELAEARRLDTEAHVERLAR
FT                   RDAETRRMKAAGSYRPGPYEHLLDDEHAHAHDDDTAGDDDEFESSEWYAPGERDEEFED
FT                   LLEELMADVDDDADDADDDWPEEIDADDDDERAGADAWVKPGAGERDD"
FT   CDS_pept        365952..366728
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633507"
FT                   /orf_name="MICPUN_61207"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65485.1"
FT                   /db_xref="UniParc:UPI000199AD29"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW1"
FT                   /transl_table=1
FT                   /translation="MSEETGTEVADSEAAVTQRFRRFKDDLRRERASEGATPDDGPNPL
FT                   DQPDARVDWSDLPDGILHRVFQMLYREKGGRELVGVCGQVCRGWHDDALDVLMQDTAAT
FT                   RRPVPGVAPEHDGDDDDDETDPGGETGAGGRRRGRGGGGRRTTAREGDEEDTTAAAKRE
FT                   TSDTSSADDDEVGSKRRRLPDESEAASAGADDDGSGFNVGGGGATAVPAIAATAVHAAT
FT                   HHRRASGASGAPADQAGSGAQDSAHCQHSDGSVRPA"
FT   CDS_pept        complement(366839..367459)
FT                   /codon_start=1
FT                   /gene_family="HOG000039891" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633508"
FT                   /orf_name="MICPUN_106019"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65789.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG588578"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI000199AD2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW2"
FT                   /transl_table=1
FT                   /translation="MSPLSGYQMWKAGQAKARHKVKNWAARILTKQARKVQNHLIERWR
FT                   IYRGDQVMVVAGKDKGQVGTVSKVYRKENRLLVEGLNLVKKHVKRSGDNPGGIITMEAP
FT                   IHYSNVNLVDPVTGASVRARTRFLDDGTKVRYTVGRNASGSIVPKPDVAAGRTKPRKTD
FT                   VGSRDTGWEHATANTYAPAPESRGFFGSGSAAAARSFASSALR"
FT   CDS_pept        <368148..>369104
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633509"
FT                   /orf_name="MICPUN_68453"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO65486.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199AD2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW3"
FT                   /transl_table=1
FT                   /translation="DAVFGERDGNATVYESAAQPVVRAVLRGVNGTVMAYGQTSSGKTH
FT                   TMSGSDADPGVMSLALRDIFDAVRADEHTRRYDVRCSYMEIYNEEIRDLLSRDPDGNRS
FT                   HIKLVNGHNGLTQVLNLEERVVKSSEEVNDVVAAGLKRRQVGRTAMNHVSSRSHAVLRI
FT                   KVASAPLIEGDPSAAPATVSTLYVVDLAGSERAAQNTSKTTKKEGAAINQSLLTLRLCV
FT                   QRLAKDAEDGTENTSHVPYRDSKLTRILQPALAGPGRTAIVAAVTPAAGNAQETYSTLN
FT                   FVGTAKSVKMDAKVNVVNHGSGANLTSEERKVLADLRA"
FT   CDS_pept        371301..373013
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633510"
FT                   /orf_name="MICPUN_50513"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO65487.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199AD2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW4"
FT                   /transl_table=1
FT                   /translation="MRSNFPRTKRFLPKSRHEGFVTCALARHPVASPRTRGGRPRAADM
FT                   TCEGAVDALETCESPIAPERDSPARTAPPPSKDADSAADAGEETSKRPVDHVPGDDEPD
FT                   ELLCPITKVMMRDPVFVAGSGNTYEREAIETYWRQTATRPVRGVRGAVVGVRRDPLTNL
FT                   DLANDAIFTNWDKRREVQAWLAKHPTLTPEGWPDRDVPPPLEERRKAAGGRDGDGNGER
FT                   SDAVGRMELLAQTAKLAAMGGVGLAVIAALFVATTSPAPSSDGLLSRWEFVDGHTGDGT
FT                   ARDATAGAVGFTLTPPLTELRVGSYAWRKRANPSKPPNDGDHNQNQNQNQHAGEAAAIA
FT                   SFGEDAYRSLTPVRAPSGSRIAARRGDGGALELVVPPKGILSPAAMTELGFAAVWTSFT
FT                   AVWTWGAMQTPNPFFALFSLPFWGIGATIGRSTAAAAMETTRLVIAPRRLNPTTGEVMA
FT                   PGRFHVSWEALGRVLSVAEGPLEDVAGVDVVTHAYVNGVPQTALELTAGVKSHNLGRGL
FT                   HSSEQRFVAELVRECLVEAAKAGETGSSGTGDGGGRRAVGEPARRPEPIKSRL"
FT   CDS_pept        complement(373093..375126)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633511"
FT                   /orf_name="MICPUN_61210"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65790.1"
FT                   /db_xref="UniParc:UPI000199AD2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW5"
FT                   /transl_table=1
FT                   /translation="MSTLASSGTHARCRLVRWTLSAASADPRRGVAAVVRKPWPSRLAI
FT                   GGAGEPRTRSRATRGVDDDGRGGGAGASGAPSVRTAEPERPRGGADGASKSPKAPSSET
FT                   PSARPKRRRGRPVSRKPAKAPVPGDAMGVASLLWQLAREDEQILGRARIQPHGLEAVVP
FT                   ARADPTSSRASSSREPLRSTARTKIDLDELAALVAAGRSTADIAARFGVTRAAVRKATA
FT                   RLPRRPGDEAAAGDSPTGDSPGGDSPGASDGSDADDDGSHTSVPLYKRAGRRKNAAGDE
FT                   ERRAMAARHAGVARTSDTRRRISATARERWRAAREKATADKTAEVAAAVDKLRREAATA
FT                   MVRLKLDADSGANDGTKPEESSAASDPRGRRREVAATHSSALPSYNPSAPWEWLAQGAG
FT                   TASVEDYALGDSPADRAAAFAALLNDKHGGIGNVLASGDFENSVDEGDFESPEHANAFP
FT                   GAYIPGVKGMPGMSFDEDEDEDDEELRETKRKMKNKLKELAARRAEVVGDGTPKTAKVT
FT                   VAKFTNELKAFTQLRDDLSDWSDNFLARNGRRPTVKDAERTGIDFLIKSFKEYVELRDR
FT                   LMSQTPYLRGQMEDVAKETLPTPRVTRDGARRGRAAGVRDGIEKASGVLGGATARPKPT
FT                   MIFSSPPQGGGILGASGYGNGRTLPPATPPERRNRSHQPRNK"
FT   CDS_pept        join(375444..375479,375616..375711,375791..377092)
FT                   /codon_start=1
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633512"
FT                   /gene_name="CBF5"
FT                   /orf_name="MICPUN_107404"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO65488.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199AD2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW6"
FT                   /transl_table=1
FT                   /translation="MGKDKKDVGSKQVTEDFAIAPEKITPTLDASKWPLLLKNYDKLMR
FT                   EFARVSHPPPSDRRPVAAPRSPQVRTGHYTPIPCGHSPLKRPLQEYIRYGVINLDKPAN
FT                   PSSHEVVAWLKRMLRVEKTGHSGTLDPKVTGGLIVCIDRATRLVKAQQGAGKEYVCICR
FT                   LHGAPEGGKTAVQRAIETLTGALFQRPPLISAVKRQLRIRTIYESKMYEYDEERNLVVF
FT                   WISCEAGTYVRTMCVHLGLLLGVGGHMQELRRVRSGILGEKDNLVTMHDVMDAMWVHDN
FT                   LKQEDYLRRVVMPLEVLLTNYKRVVVKDSAVNAICYGAKLMIPGLLRYEAGIEVGEEVV
FT                   LMTTKGEAIAVGIAQMNTAVMATCDHGCVAKIKRVVMERDTYPRRWGLGPTAQAKKKLI
FT                   AEGKLDKFGKPNDKTPAEYLRAVPDANGAKAKDAGERDKRERSPGADVSGDSPEKKKDK
FT                   KEKKEKKEKKEKKEKKDKS"
FT   CDS_pept        complement(377275..377850)
FT                   /codon_start=1
FT                   /gene_family="HOG000236520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633513"
FT                   /gene_name="HPT"
FT                   /orf_name="MICPUN_107405"
FT                   /product="Predicted protein"
FT                   /function="hypoxanthine phosphoribosyltransferase activity "
FT                   /biological_process="purine ribonucleoside salvage "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65791.1"
FT                   /db_xref="GO:0004422"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006166"
FT                   /db_xref="HOGENOM:HBG536385"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="UniParc:UPI000199AD2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW7"
FT                   /transl_table=1
FT                   /translation="MSKPVPECDVDVLKVILDEGDIAAKVSELGAKIAQDYKDLKPILL
FT                   PVMTGAFVFSADLVRAIRPPPQGMRIESLRASSYLGTTTLSNGEVAIAPLSIDVKGQHV
FT                   LLVEDIIDTGHTLEKIRTKVMGEGAASCKVVALLNKRERRENGLQPEYEGFDCPNEFVI
FT                   GYGLDFDSKYRELPYVGVLKEELYAHIL"
FT   CDS_pept        378082..379218
FT                   /codon_start=1
FT                   /gene_family="HOG000078427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633514"
FT                   /gene_name="PANB"
FT                   /orf_name="MICPUN_107406"
FT                   /product="Predicted protein"
FT                   /function="3-methyl-2-oxobutanoate hydroxymethyltransferase
FT                   activity"
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65489.1"
FT                   /db_xref="GO:0003864"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="HOGENOM:HBG299908"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000199AD30"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW8"
FT                   /transl_table=1
FT                   /translation="MALRRAAQRLQGVAASLTRREMGLDATRIAVASSLRGVPHRESPA
FT                   PRAHQRRGMSHRPEDTVYGGPRPSEPRMTLKRLRAKYDAGERISVVTAYDYPSAVHVDM
FT                   AGIDVALVGDSAAMVVHGHDTTLPITLDEMLSHCKAVSRGATRPLLVGDLPFGSYEQSS
FT                   AQAIDAATRMLKEGGMDAVKLEGGSPSRVQTAKALVDSGIAVMGHVGLTPQSISVLGGF
FT                   RPQGRSFETAAQVVERAMELERAGCFAIVIECVPRTVAAAVTAAVSVPTIGIGAGDATS
FT                   GQVLVYHDLLGFMQHPHHAKVTPKFCKQYANVGEVITGALERFKTEVEGGEFPGMSYSP
FT                   YRVSDEDSNRLVRLLEQKGLDAAAEAVLDLRYREDGGK"
FT   CDS_pept        complement(379318..381897)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633515"
FT                   /orf_name="MICPUN_61214"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65792.1"
FT                   /db_xref="UniParc:UPI000199ADEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBW9"
FT                   /transl_table=1
FT                   /translation="MRRGIETLRALLRTVPSTPTHVHPTRTLLADPPALRGWRIVAPRP
FT                   TRVEPGRGIIRGLARWAATGDGGWTRVRSERDRADRDRRRSETGADGVPIGPDTRGAHR
FT                   RREGGASSQGSHASGPSKEHVRLNGDLAHARGVDALLAIVDARGDEMNAVNVATAVNSL
FT                   WKQAKREARDIAKEQRRHLRQAHRRGEEGHRRGETRDSEAARDRVGTELSHDPRLPKLL
FT                   RLVREKVDELHARAVSGVMHGLGVLHSDLRALPTARWTTRFEKSFTAKLADVLSSRVEV
FT                   TAADMNAQEVAIAYNACAKYDALGERLTPNAWLALASAASKESDRFTSQGLAMTLNALS
FT                   KTPAMEATAAAAVPQRGWETLARAVVRAYVPARGAWRPNDDGDMQSVAVIFNALAKLDH
FT                   AALAIAGEDGWRVLVAAAVTCARTRTGRDELGFDGQALAMVLNAFANCHAASSELARIK
FT                   GGWSALSDNFVAVAPRDTRAQGACMILNASWKLIKEHGFETSAEFRRAAADFAARIAED
FT                   VPPKTTGLLVNSLAKLKDVAAEVTPEGWRRIAACVHRAYASVGDANFERDREKIRDLHR
FT                   GNERGSFAERFADSGFEVGQFDGDELTATFQSVCACDPLVDVLGDDTWRVISAAVADFA
FT                   RTGAMSPDSVFATTASYNALRKRAPRAFAAADACDVWEPLATCALSRLHDMNPVFVIQT
FT                   LDAAKKLPELREALEKVGGSVSGWARLAERLGETAGELDAVNIVNAVSALGWMPFLAVH
FT                   MSDKGWNTVLDRLRSHETVLGDRRLSVEAAMSHGHDVSGAAASAAAETKYAEKSVSGLR
FT                   LIQSHGGYDSYGKAVREKIAECIERIEGKMDDETRAKVHKRFEKLSR"
FT   CDS_pept        381982..383166
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633516"
FT                   /orf_name="MICPUN_102230"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65490.1"
FT                   /db_xref="HOGENOM:HBG608200"
FT                   /db_xref="UniParc:UPI000199ADEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX0"
FT                   /transl_table=1
FT                   /translation="MSRAAAASHRALAALVVASPWRQRASCPRRRHVPWIRCDAADARD
FT                   ASTESASPSSSPHAGLTRAQRRALRQPYVPTAAERGLARAILETSSVEDDDVAFLVAPS
FT                   SGDADAPSVVWFATSRKTSPPWDSALVRLVLGAREAGGRANGNRWARARMLTTRALSDL
FT                   DRAVVKVAAQRATAFDLEDHDDDATADAPASPDDPRALERRDATPWARAAIRRGAMTSR
FT                   VGLLPPKTLPVNDDDAAFRWASARASDVSENTQTQLWERDRGVVAALVSPRGEVTDAAR
FT                   NVNADNKCLHAEWNLLAPTLWGEWVLSPTEDDEIANRPGAGPEEAGPLEEGTRVLVTLQ
FT                   CCKMCAALVCAAADRPGRRGPIEVVYLNPDDGSLARDTQLRRRGWESRHAAPCE"
FT   CDS_pept        join(complement(384030..384342),complement(383287..383870))
FT                   /codon_start=1
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633517"
FT                   /gene_name="PSB7"
FT                   /orf_name="MICPUN_107407"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO65793.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG316821"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI000199ADEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX1"
FT                   /transl_table=1
FT                   /translation="MALLASGNVSAAYIPDRDERGGFNFDNVARNEMMSQNGLKFKAAM
FT                   KTGTTITGVCFKGGVVLGADTRSTNGETVADKNCEKIHYIAPNIYCCGAGTAADTEAVT
FT                   GMIASALELHRLATKRKSRVVTALTMLKSHLFKYQGHVGAALVLGGVDINGPHLFSVHP
FT                   HGSSDSLPFATMGSGSLAAMAVFEADFKEDMTEEEAKEIVARSIRAGIFNDLGSGSNVD
FT                   LCVITADKVDYLRNYECPNERTYVRSKGYDFPPGTTVLNRRNFMTATAATLPVNQIVDI
FT                   IDGAPEDVASGDAMQTD"
FT   CDS_pept        join(384714..384781,384897..385449)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633518"
FT                   /orf_name="MICPUN_61217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65491.1"
FT                   /db_xref="UniParc:UPI000199ADED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX2"
FT                   /transl_table=1
FT                   /translation="MEPSSSGSLVRDMRAAMRSTHDRGSRIDAALRAKEEAASRSDAAY
FT                   AGGTEPHSASGGDDVDSMLSRPAPTPPRAPPTQDGRRRPRPGAAPPTQPPTTYAERVER
FT                   ERAAALEDAELRRVALQARGVDLFVPAVRPGREPTVRNTRGGESLRPTVRGGVGVDETT
FT                   AAAIERGARELSARRRGAKGAAETGTWHDKFLARYGLDKTAGR"
FT   CDS_pept        complement(385535..388030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633519"
FT                   /orf_name="MICPUN_102232"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO65794.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199ADEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX3"
FT                   /transl_table=1
FT                   /translation="MARVSRLLGGPSRRGGSRAVAFTALALVFCAIGGALADGDDDAID
FT                   SVDPDDDSFPTSEDVPLWQFETEVVTIGKASGKEKRNDVPAFFLRGDDPAQAATRFVYL
FT                   NALPMNHLPHFVSVFAHEWRHNVREELKPRTRAHKRRAAVLGPRSYWKRGAEHARAGRD
FT                   GEAHFDYARAVAGVGLDEIDDPGAKAEETLSNGEVDEIYQLLNAHHRRHSRALNAADKT
FT                   REQRAAAHERNAWVFERRKEARRRVEEDEADFRAALSGVQSRDDTSDSEATSEANDETT
FT                   TRVAIVAGLAVSLSLDDDAASATSAHFATIGNSDARLACSVALELHSKLNRPPLACVAG
FT                   NASEESKTSSAGDDSRTPEACGNAAKKALLGSEDDGSLASTLLLRAFILAGGAVDDRAF
FT                   FDDLTKALVTAHAYASMRAAVDAEDWEAVARAAQTGDAAAVAGRKPDARRKLAAARAHF
FT                   ELGNWRECERAANAAVAASVTRGDWRRGQVRALAVSYGARCAIARGDGDAALRSFAVAM
FT                   RADPDNSLFKNTYKLIKDAGKLVTDAGVKLDRGESRLALESADKASANLRAVGADEKSA
FT                   MFAEIDARRCVAHAQMRAFESALEHCARAAKAIGCYDDGSHDSEEDFKRLCDRADARVY
FT                   ARVMMSRAEVHLRDDYPEGAIGDLRDAVERIAPNAERGSSEGARILEEARGRLHEAERA
FT                   KHKHDNDRDHAKMLNLPENLAELSKDRRCDFVKKAYKKAALKWHPDKAAESGKLRAARK
FT                   MNEMTEARDHVNERLGCVAPKKPDENDPRAQQQRQHPHFRNFHHGGFPGGGGFGGGGYQ
FT                   QRQRQYQRRPGGQRMHWEF"
FT   CDS_pept        388544..389974
FT                   /codon_start=1
FT                   /gene_family="HOG000165714" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633520"
FT                   /gene_name="TUBG"
FT                   /orf_name="MICPUN_84777"
FT                   /product="Tubulin gamma chain"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="microtubule-based process "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ACO65492.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI000199ADEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX4"
FT                   /transl_table=1
FT                   /translation="MPREVITLQVGQCGNQIGTEFWKQLCAEHGISKDGILEEYAANGN
FT                   AGDRKDVFFYQADDEHYVPRALLLDLEPRVINAIQNSEYRNLYNQENVYISNSGGGAGN
FT                   NWASGYAQAESVQEEIMDMIDREADGSDSLEGFVLCHSIAGGTGSGMGSYLLEALNDRY
FT                   GKKLVQTYSVFPNQNETSDVVVQPYNSLLTLKRLTLNADSVVVLDNTALNRIAVDRLHI
FT                   ENPTFAQTNALVSTVMAASTTTLRYPGYMNNDLVGLVASLIPTPRCHFLMTGYTPLTLE
FT                   TAAAAPAVRKTTVLDVMRRLLQTKNIMVSSHSRSKDFSQSKYISILNIIQGDVDPTQVH
FT                   KSLQRIRERKLANFIEWAPASIQVALSRKSPYVQTAHRVSGLMLANHTSIRHLFTKCLT
FT                   QYDKLMRRKAFLDQYEQHPMFSDGLDEFDDAREIVEGLAEEYAACESPDYIKWASGKEN
FT                   ERMPGEGLVNPRRAAADY"
FT   CDS_pept        join(complement(391062..391193),complement(390069..390959))
FT                   /codon_start=1
FT                   /gene_family="HOG000239973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633521"
FT                   /orf_name="MICPUN_95034"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65795.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG316811"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199ADF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX5"
FT                   /transl_table=1
FT                   /translation="MASVYTLSVIAAWYFSNIGVILLNKYLLSVYGFRYPIFLTMMHMV
FT                   MCAFLSMTVRASGIVPKQAIKGRKHAIKIAVLAVVFVASVVGGNISLRFIPVSFNQAIG
FT                   ATTPFFTALLSLFIMRHKESTQTYMTLIPIVLGIMIASKAEPLFHPVGFVACFSATFAR
FT                   ALKSVLQGLLLTSDNEKLDSLNLLMYMSPVALFVLVASANIMEPDAFGVFYQNCLDSPQ
FT                   FFFTLTLNCVLAFSVNLTNFLVTKCTSPLTLQVLGNAKGAVAVVVSIILFRNPVSGIGM
FT                   VGYGITIAGVVAYSEAKKRGKEAAAKRMGRGASSGVLELLGNEGEADRQRSGSKLSQMA
FT                   "
FT   CDS_pept        complement(391574..397573)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633522"
FT                   /orf_name="MICPUN_104934"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ACO65796.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199ADF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX6"
FT                   /transl_table=1
FT                   /translation="METLQEELDRAPLDPDAVRAEVSALEKESEIPVHMLLKRYGAPKE
FT                   EVEAASVKAESEAGGDDEDEDTADDSEGSFNEDDDSDDDEDDDDEDDEDDEDDDDDDAM
FT                   PPPGSQPDSRRVSLTINGVERPPDKVGALPVVFETPEEAKAAAIEEGKRIRYEDGVMDR
FT                   AWDIMARPPLMKPVPPFPEPARNKTHWDHLLEEMKWLSGDFVRERKFRAKLARKAVYAV
FT                   ARSNLDLESRVIKREQDLLAAQRKTARNIGNEIMHFWIKIEKVVRFKAQAKVDSKRKQV
FT                   MDKHLDFLLGQTERYSTMLAGKLTGEEEGALEGGEMKALPAPAQKSKPNPMPSVPEVKE
FT                   EEDEDGDDFVAPDEDDMDDEETLEEEMRRAQAEGDDEDNDKEMADLAADAEVPIEELLR
FT                   RYREMEEAEEKEKASKVSKKSVEIEDHEPTPMDTTCSPGEETRETTFADIVGEAGAVTG
FT                   TSKRGQRGGKPAPAAAEALDDNDDFKIGDGEEEEDDEETLEEEMRRAQAEGDDDDHEKE
FT                   MNDLAADAEIPIEELMRRYREMEAAHGGGEDLEEAEEEEGDDEEEDEEEEVEEEEEEDE
FT                   PGVDALGGDDEPPMTEEQKAASRERRRVLDSLAGDAGSLQPKGHTLESADVKCRVPFLL
FT                   KHSLREYQHVGLNWLVSCYDKALNGILADEMGLGKTIQTISLLAYLACNHGIWGPHLIV
FT                   VPTSVMLNWEVEFKKWCPAFKLLTYFGTAKERKLKRQGWSKPNSFHVCITTYRLITQDQ
FT                   KVFRRKKWKYLILDEAHMIKNWRSQRWQTLLNFNSKRRLLITGTPLQNDLMELWSLMHF
FT                   LMPHVFQSHSEFKNWFSSPLSGMVEGGEGINMDLVSRLHGVLRPFLLRRLKSEVEKNLP
FT                   GKTEHVVHCGLSKRQRRLYEEYMASSDTSTTLSSGNLLGIINCLMQLRKVCNHPDLFAG
FT                   RPIVSAFDMLPGVSIAVPSVVQNAARTLHEDPFRSKWFAPRGLHLLTIEDVNADAGGYG
FT                   YASGDGWGCREALRRMAPVHEVEAALAQVTPKPSQRLGRMTQNADAAVRLFAEARAAAA
FT                   KVERREVARRLALAAADAASRIPTYGTDLRRACVVRHPVHHCHLIERTFGVGPFATAPA
FT                   LLSAVKTYEARASDGADLVTAFMFAIPKARAPTPTMTCSAPSASVRAASRRIDAWAQKV
FT                   GAPALAPLRLAQVRQQLFFPDRRLVQFDCGKLQALATLLRMKKSGGHKVLIFTQMTKML
FT                   DILEAFLNLYGYPYCRLDGTTRPEQRQIMMQRFNTDPRLFAFILSTRSGGFGINLTGAD
FT                   TVVFYDSDWNPAMDQQAQDRAHRIGQTREVHIYRLVCKGTIEENILRKSMQKRELDHFA
FT                   IQAGNFNTEQFKKIAEAKARGETAPDGSGPGDEDEDKKRRADVVGGDAGFAAMNIFDKA
FT                   MGAMGKSKPDNNKNGGGGGGDGTNEDDEVARLMDEAQDDADKAAAAAEAAGDADEAAEF
FT                   GDDIREKDNPDTEDDDKSGGTSDQKSNKLKRVASASDGRSLAKASANKDEVTPATPTQK
FT                   VGDADNGVGGDLSMVAINTSLEGDDQFAQDMMRKVQMSASKGEAIEQQLRPVERYAVRY
FT                   LEETVRILDDVGIDADAVVDIEEKAWELDQLEKQKAAAEREVDDDEEGLVVEGWETGAA
FT                   DEEYRKKVEQAQEEARLQAEWERLEAERWAAMYAVPSAEDRSAAAAAAAATGAGGGGGL
FT                   AGAIIGAKVPKGKRSSRDNTPGGTPRAGSPAPEGAAPALKVKFKLGPSLLGGGVKRECE
FT                   ESTDPELAHAHKKHKHKHKDETPEERAERKRMRKLTKEGAIAGGPQAQTPVKPNLTTAA
FT                   AGAAVLQQSPTMTNPMEVSPGAGNNPMGYPAGMIPADFTIKEDAVISTLVLTMGDRAFS
FT                   LGSELLSNNGPFIRPPAACKDRFRKLIALHGSSLAADVGSTWMASGQLRVTPELARALA
FT                   SKVANDAFPGDASSASPTGDGGPRRAPGPIRALLGAVQAMKASGDDATGVGKQGVVESV
FT                   RNIFKVV"
FT   CDS_pept        398645..398974
FT                   /codon_start=1
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633523"
FT                   /orf_name="MICPUN_61221"
FT                   /product="Glutaredoxin family protein "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65493.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000199ADF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX7"
FT                   /transl_table=1
FT                   /translation="MAAELARIIAKDDVVIFSYGGCPYCRRVTRALDAAGVPYNEVDYD
FT                   DCDDGEAVRAEIRATHKQRSVPAVFVKGKFVGGCNDGPEPWMGVLPLLNSGKLTEWIRN
FT                   GAAEA"
FT   CDS_pept        complement(399060..402527)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633524"
FT                   /orf_name="MICPUN_61222"
FT                   /product="Superfamily I helicase"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65797.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199AEAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX8"
FT                   /transl_table=1
FT                   /translation="MAPGEDAARRRAIAVLREEEAKAAAAKAKGTKRPRGFVNRVAREG
FT                   TAAGTGKGDLPERGQQGTKEWFERAALGPLLWRRTTREELGMIPREFANINSYVRSFEP
FT                   VMMEEARETIRKAWKESLAEKSQFACSMASELKATGGGWRRVRFHIRDQADAEMFKALC
FT                   PDDGVVIACVSTMNEADDPWPHDESGLDLPIAAAGLCKGINAKEQTVDFSFWISAEVDT
FT                   ATNPSTPGWREWHERSRVRERLTLEAFEGVRRLVRGDRGDALIGGHAVAEEGEMDARPP
FT                   PVSPHDRTWFLAPAGKLHSWYNAYEALHHVRRLHGPMRQAMLKPPKDGMPRVRNVPAPP
FT                   LSVEIAGNQKFVDFLVKNFNEPQLAAIKWAAAHTLRSYEREGDQSHEDPFPFTLVQGPP
FT                   GTGKTQTVWGILNTLHCLLFQRYYKSIHDAIARGTSRATGTEFTAALDDDDAEWLRSAR
FT                   EDGEEDEDKDGGGFTVRDLYTFLRDTTGVERGQTYGVYKPRILVCAPSNAAVDNLLERV
FT                   ITKRFHQLTGELYTPAVVRVTASETVVSDAVGPVTTSRLVEDLIEMGKSDGKKFDGARW
FT                   NAEFHKHAKFVKEAGNFIKYKEHELVELTMASAEPRTVPAEGDDVEPGEEIDTRNQKSH
FT                   GIIAEILGMNENRNRAVTEMARLAYLLDNLGPNAHHVTRNQRIDGKVDRQMKYDQQRAI
FT                   RKVRAALEASFVDDAEIVFTTLTSSSRKVFRQLTHGFDTVLIDEAAQANEMATLIPFLH
FT                   GARRCVLVGDPQQLPSTVISKHAQQVSFQRSLFERFNELGAEALLLSVQYRMHPEIREF
FT                   PSEEFYEGRLMDSACVIKRRPEPYQQKESGLGTYRIFDAHGLEERTTSNSVINHFEAIL
FT                   VVCLYKKIDKVLRDGTGESAEGKVSVVTPYKEQVTVIRKAFEQLCGGEGAASRLRVQIN
FT                   TIDGYQGQESDVIIFSTVRGSGDGGIGFLSDIRRLNVAITRAKKALYIVGRVGKLRAAQ
FT                   AGGEFTVWRDLVQNAMDRGCIVDDADPRVTFADVVPVEEQERAMSKLTKGNRRGVGFKP
FT                   LKPRHPENPQPDNQRVCREWLAGKCLYGSDCRFAHEKRYDAKSKKLCRDFMMGKCHRGA
FT                   ECVFSHDTAMGGGGGGGGVSKYSALPPPPSTSARRDGDERQQPVIDDI"
FT   CDS_pept        join(complement(404313..404357),complement(404034..404126),
FT                   complement(402923..403711))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633525"
FT                   /orf_name="MICPUN_107410"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65798.1"
FT                   /db_xref="UniParc:UPI000199AEB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBX9"
FT                   /transl_table=1
FT                   /translation="MSNQARIDDMTMQIKNAHLRVGSGFIQYPPQRPFAQPVQVQPPTL
FT                   SQNEYPEEWKNVNAKPAAPPQRPPQQQAPPQQQQQQQQYGGYGYPSQNQPPAQNGYGQY
FT                   GQQPAANGYAQNGYGQYGQQPAANGYAQNGYGNYGQQPPQQPQQMYGGYQQNGYQQNGY
FT                   QQQPPQQAPPQQQYQQQRPTTAAAPSGGGIGGAPAMAMPGRRGNIPAPKVATPNANGAP
FT                   ARGAKPAHGGRQQQQQRAPPPQAAQKPKKFMPGMIVGSLVQQPPARPAPATMAPPQSVI
FT                   RAAETGEKISKSQAKRNRKKAREAGMH"
FT   CDS_pept        join(404672..404761,404857..406707)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633526"
FT                   /gene_name="HYP356"
FT                   /orf_name="MICPUN_107411"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65494.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AEB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY0"
FT                   /transl_table=1
FT                   /translation="MPPKKKKKDDGPVEEVCPEGMDPDYFALTQNMGGLVDIAKNGNKG
FT                   SGPVLMDRTQALTQLWTHAVARNGARKDEVVTAGALDAAATVCSPKFAADPPAQGAAAG
FT                   LLAVLAKDPELCPRMIELKVDKFALDLCHCDSTAANDAAVSLLARLAENPNTRPAVVKT
FT                   TMQRIAGWECVVRILRTPGCTIEAKTDAMRFFNLACEHGRDEPPPEGGYPEGVDPPQST
FT                   APEVRRHVAYWCPTAVAHLLDRACDDTVSGGTGPDDPPVQAPEFVTLRSLAATTIASLS
FT                   REEAIKDWITRDKHRVRVFVDALKSTVATLKVRAQLATALYNACDVTASVLEKLRLSDD
FT                   GAGNDGGGEEGEGGGGGGGGGGAGASSSDSAAASMFPGGFGSAMVQSPPHDEELRRLGL
FT                   LVDAGAMTPLVRMCAGAKGYSPPKDPVPPSPAKGESSHAEEEKEEVARDEASANEGGET
FT                   AEGDADDDAKAEGEGGDVDADVDADMDGDGADGDEKADADADADGDGGGGGEEEGGGKK
FT                   KKKGQKKGGKKKAASKPPAGMGAGQLAAAGLLRAFTREPEWAALVARSDGARMLVQLSK
FT                   VKEDQTRWHAQAALYAIAADIDRNGRYLDHAKCPEYITRVSAIRRRQPMRPSAKFMPAP
FT                   VESAWLKTGAA"
FT   CDS_pept        join(complement(407512..407558),complement(406775..407381))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633527"
FT                   /orf_name="MICPUN_61225"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65799.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG597096"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000199AEB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY1"
FT                   /transl_table=1
FT                   /translation="MAMGTGKLRAATNRVRTSAANNTSEIWTELIGVQQNKDAGSNTAI
FT                   EASIKAPGRIGGAGVGTGFHRRRKGTAGDEAVIHPTEALVALARLNAAKARSDGNPEGS
FT                   RGFCAKCGGSGHLSTQCTNQYSLLKDDDDEGGVEGGLSSSSSSSDSGRKKRKKSKKSKK
FT                   SRSKGKKKRKKSDYSSSSEDRRRKRRRSKKKKSKKRSRSSSSSDSSSDSSSDSD"
FT   CDS_pept        407852..408847
FT                   /codon_start=1
FT                   /gene_family="HOG000230844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633528"
FT                   /gene_name="RPB3"
FT                   /orf_name="MICPUN_107412"
FT                   /product="Dna-directed RNA polymerase II polypeptide a "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ACO65495.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI000199AEB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY2"
FT                   /transl_table=1
FT                   /translation="MSKADGDPRQRRPNIVVQEMTEDTIKFVLTGTDTSIANALRRVII
FT                   AEVPTIAIDLVEVIENSSCLCDEFIAHRLGLIPLVSHKAADMEFPYDYAGDDETVTDVP
FT                   IELRVKCVSDQTEDVTSNDLLINGDYTQYDTVKPVHYRPSGRAFGDATASGAPADGSQA
FT                   DGDKHPILILKLRKNQEINMRCVARKGVGRDHAKWQPVATAVYRFEPEITINEDLMATL
FT                   TEEEKIKFVESSPTPVFRYNDQTRKVEVNMPESYTYDGECLKWAEDMGKPGLVDIRAKE
FT                   DTFLFTVESTGALPPETIVLNALKVLDTKLEMTKSELDIVKSEMDTAGVE"
FT   CDS_pept        complement(408965..409837)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633529"
FT                   /orf_name="MICPUN_61227"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65800.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG409990"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AEB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY3"
FT                   /transl_table=1
FT                   /translation="MAKSKAGDDGSAMKKRKAPSNPDVGGAKSKKVAGASAKKRGGATA
FT                   EQRWRPMPVRLDFGSAFCRHVFLRAPSKGADGAEEGTALFVAAVPPGWSKSTLREFMSR
FT                   FGDVADASLVTLDSAPDVAGGLVRFADARGTKKALAAAVRGGAPLDPPDSTARAVGLES
FT                   WVADFRDAAPPPEVLQSRIDEWFVEFEAEAARKEAAARATGGDDGWTVVEAKRGRRKTT
FT                   DGEGTSVGGIRAATADARRTDGPKIRENFYRFQQREKRRNELFELKRAFAADKDRVAKL
FT                   KASRKFKPM"
FT   CDS_pept        join(410057..410301,410630..411735,412017..413380)
FT                   /codon_start=1
FT                   /gene_family="HOG000160363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633530"
FT                   /gene_name="PWP2"
FT                   /orf_name="MICPUN_107413"
FT                   /product="U3 snoRNA-associated protein 1 Pwp2 "
FT                   /protein_id="ACO65496.1"
FT                   /db_xref="HOGENOM:HBG721153"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AEB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY4"
FT                   /transl_table=1
FT                   /translation="MAHYRFNNLLGAPYRGGNLCMSGNHLLTSVGNRVMEVDLQMSSSQ
FT                   TLPCENLTEIRCIAVSPTGSHMISFDTDGRALLVNLRKRVVLHHMNFKGKVSHCEFSPC
FT                   GRSFAVCVGKLVQIWATPTMLKEFAPFRLLRTYGGMYDEATCLAWSPDSRWIIVGSKDL
FT                   TARIYSANHMEGYVPPTLAGHREQLCYVSFAGAGGDAAYTVSKDGALFEWRLVDEEVDD
FT                   DVSRRGDKGQRGGRDSLRGGDGVTVRRWRMEGKHFFHMPAKLTCAAYHPGTGMLCAGFG
FT                   HGVFTLHRLSPGSFEVVHTLSISQQKVSACQWNETGDWIALGCARLGQVVVWEWQSEAY
FT                   VYKQQGHYFDVNMCAYAPDGSMIATAADDNKVKVWSTATGSCFITFTEHKAPVAAVTFA
FT                   PSGHAVVSASLDGTVRAFDLMRYRNFRTLTSPEPAQFISLAVDPSGEVVCAGSQDTFQI
FT                   HIWSMKTGRMLDILSGHQGPVTSLSFSPESALLASGSWDKSVRLWDVYEGRGQTDILPH
FT                   AHDVLAVAFRPDGKQVAVSTLDGQVFLWNPNDAQLQGTIEGRRDMAGGKVIGDLRSATA
FT                   KAGKSFKTLAYSADGALLLAGGNGKYVCMYDVDGRALLKKFPLSKSKALDGTIERLDSN
FT                   RVTDAGPMDLLPASDSEEDDEGYRRGDRGRGAVGSGGPGGNLPGTGSLGGAGSSRSQGL
FT                   DKKKRPVIRCKHVTFAPTGQGWAASTTEGVMVFTRDNGASFDPTDLGEDVTPNAARRAL
FT                   RHGDARLALLMALRLRGADDDETLVAETLEAVAPDAVASALRDFPTSLLAPLLEAIAER
FT                   VTKGPHAHLMLRWTRELCVAHGRAIHSAAHGGGGGAGALVGAAAGCDQRLLPALRRLAK
FT                   AFATLHDDLEQTAEASVFLLDYVCAAPSAVAKA"
FT   CDS_pept        join(complement(414282..415758),complement(413888..414090))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633531"
FT                   /orf_name="MICPUN_50521"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65801.1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199AEB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY5"
FT                   /transl_table=1
FT                   /translation="MPGNLTVTSIALGSSHTCAVLADASLWCWGWNIYGQLGDETYDDS
FT                   HTPTAVKTLGPGTTSSVACGSDFTCAILKGVGSVKCWGTTRTSTGTSTVPTSTVPIALD
FT                   IGSGRTALNITTGHSHACVLLDDRSVKCWGDNTEGQVGNGGPNVISTPTAIDVGGAGVV
FT                   SNITAGGFSTCAIRVGGTVMCWGDNDSGQLGIDAIDQQEHTDKADRIVPTESAASDLVT
FT                   QISMGSAGTACAVLKNGKADCWGAYISEGPYGTNWNQQGSGVRRRLLQNFALVEIQYSE
FT                   HGKAVSVSVGSGHACVVLEDESIWCWGRDDAGQVGDGPGSQTGNGYHPRMVTCGTNKYA
FT                   GSTSCTSCPSGKVNPAGDAVYGSYAGTCKLPPSPAPVPQSERECGSVAPTSYSLLTDSC
FT                   AACFAGFYTSNSSVYYDCGTSWIYYFSPKYVTFDGSQPTWNGGAYLHHNYGRSDSAGSW
FT                   LYQSSWMYAASATFKGFDCTTGDLSGGLTPSSFAAIGAAAIGFHSCGEEGSCRDEGESR
FT                   EDPRRYAHRRHERKAEEEGQAPRRRGNQREEGEEDVRQADSR"
FT   CDS_pept        416327..417040
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633532"
FT                   /orf_name="MICPUN_108874"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65497.1"
FT                   /db_xref="HOGENOM:HBG607802"
FT                   /db_xref="InterPro:IPR003435"
FT                   /db_xref="UniParc:UPI000199AEB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY6"
FT                   /transl_table=1
FT                   /translation="MLATATLGLGSIPSTAARVHSRAAPHLRARASVSLGAPRVLLANR
FT                   RKPRDSRDSRHRRRSSSLRLVAEFDCDDKMSVPPGAFGGTTPEKKAAMMMESMFTYIAC
FT                   WIVIDQTENAAPKINTKDGTDGADQEAHDVDSDSATREVRRVVNVHEFLLNFLEENPVK
FT                   DADAFMRLLSKASPEIAMRVMEVRAAYAEDDFEWQNSRRLALENMRKVNGDVMREHATA
FT                   ALAASMVTSEDPGAL"
FT   CDS_pept        complement(<417171..>420081)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(420735..427828,428140..430558)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633533"
FT                   /gene_name="UTP20"
FT                   /orf_name="MICPUN_107415"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65498.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000199BB05"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY7"
FT                   /transl_table=1
FT                   /translation="MPPKAGGKKKSKAAKSVTNKRRRGFIDPDLKVSKKQQKKDDAKFV
FT                   KAKFGNFFDGREEDRKNRRAAAADAGDGSDSDGSYVSSDDEDARNALGRKPPKVRKRHF
FT                   KTFAERVGEVDVDVHRTSGELRTAPLDGSSNFTHETLLKWAELNCGADFGDYSREVMQL
FT                   CQSLPQLVLHQDAVLDALLRRLTMGARHSLEALLACLSALARDLRGDFLKRLGDVTGAL
FT                   SRLLMDGAEREPELLEHVFACLARVLKWLQRQLAADLPLALRHTRSLRRHRSRHVRQFA
FT                   AQAAAFLLRAAPDAAVEDGVRAILAEATSEDTTVTVEAGASADGDGEEDGDGEEDGEGK
FT                   IPRSVVDARPRRFEERTRAATKKEMLNNSDAAGALLAEAMKGAAHGLHSRAPRLLARIL
FT                   RPPKLAPTVGAGDETDGTKPLATSSSDERLARAYTVAEGAVDSLAKHTRRGKCGVMWEH
FT                   VLRAARHACADAGGEKRGGEEYEEEEEDDESDSDKEHGEDGEDDAEEATERAARSLGVV
FT                   AAAVEVYNGARVEDYEPVFDLIRRSAMPALKTAANAGDDAAASLLASRTHRLCLACVDA
FT                   HDKVAGASRGPDSIARAAGDWGVALARAPPGDSYAFVSSLRSRAVDGSPAAAAALSALL
FT                   PAAAPTIARLLDLGWSASGDGSSKDDSKDSSRVVDADAAAALLGDVCDVLSRLDGGEGE
FT                   IVLRAAPAAAAKIAARCESSNKRGGSESGQTPARRRWALLRALPHCAARDGVRRATADA
FT                   IAWALGAMGADAVDGLPAADAGYAAASSSGDAAAVLAAAMAARAAAGPEPRSENVDVRI
FT                   AARVGDLEGEYPAALVAAADLLAGASDPSAIGSFGEAVTRHSRRLKSPSRHQRVGALRY
FT                   LCAVADASGECDAADARAAGANDTPRSLAECLHRWLKVNEVDVHDVTGGPNVMEFAKTA
FT                   QVSIAAMRRAVEQEVLGPDAAEALSTCALGALHIRLATVWPETHKLFGALTERKEFEPA
FT                   WTALFEDLKSYQTRCLDAHDAAAINAAAHGRKKGEWHDDRPGAARLAGASDEAAEALQR
FT                   RMERETFPTEAGTERWQRLGLLLRSVASSPAAASRHPAPLASLFLAYNAPKPDGSTRAG
FT                   KAWRGGLREWLKVVKDGLSGGKAVRAMAGTGDGVRAILERCVGADEPDLATLAVRCLGQ
FT                   WRLPHLTPDIADRLARVTDPNTMKDELIALRVEPGESEDQRAVVDPENRPAFAALVVRC
FT                   LLPRLKRRTGRFAPHRVAALRWISRLDPPEIVPLIHSVISPMEPRHGRVDGAVVPTIGT
FT                   PWLDALVVTASGHGGEEMATTWLGMAREAKVAGLVGSGSKVPSGFLRAAGDLLKVMAEH
FT                   TKAYLHPLLAMTVEMLAASSDICESAARAREARLNEPDPAVDDDDVDEDDDVNGEDEED
FT                   ANDARRALAPGQAHRDAREVRSLAVRFLGALFQRHPDFDYSPYWDAMLSAVKPMAERMA
FT                   AESAASHPPPALSIVAALAEDDDLAPLLERADAISLLPQLWRALGAPFASPATRAAALS
FT                   TAESLIERAEEAKFKAHGTHDGDGDGKGGGEAVEREHVASRLLRAHAPSLLDALQAALA
FT                   ARAARGRRAQTPGSKIAAATEKGAARNAGVSAGASGRELAVLKRLGPLLGRAAASAAIA
FT                   DTLVPVLALKRLDESAAAEVLGALAAVIPPRSDEMSREDATAATAAAARHRSALAPLFG
FT                   RLRSRTARRALCNAWSAVAVHDEAADACAGILQGFHADARDSIDGVDYDARLGAYDECT
FT                   AEWFFGVPSASVVPVLNHVIHELRGQDMALRHAAAAALGRFLDAAVRSGGTGDAPMKVV
FT                   DDDDDDDDDDVDDDDDDADEAEEAAGEDDEDAAAGGDDGDDFDPVAGMSTAAERAAAAA
FT                   RASEASLAGAVAGVLAPGIRGLLRSPEATTRQEAIAAFRRLALSWPSAAPGAAKLADDA
FT                   DNGDQDFFANMGHLQAHRRCRALRKMAKACEDGTIPFATINGYLAPLAVASLGDGGADV
FT                   ASTAAAAIGSLASALPWASYRDLLLWMLRKAGGNRAARRGFNVEGSKALHIRAAATVLE
FT                   SFHEFEDEAEGEEATNVVCKPIHPAVVATLRADILPHLEKLTVVEDKEGKGGTVRPAAS
FT                   AAVVSLLRLLPEQDLDADIGRVLGKIANCLRSRAQGVRDSARAALAAAAKGLGCRTLPQ
FT                   VVQLLSNRLDRGFMTHVLGATLFSLVDACVHGAAPDDVETALDEIVPLLDADIFGRAAE
FT                   ERNVDAIRGAYQEAKRCRSHEVLTILAANAPCPRSLPALLSPVTRRLHAADAPSLKRQL
FT                   EACLTSVQKGLLNNPHASPEETLVLVHSVVNDGISQEERQAEYDEAVAQGHLEVDTYTL
FT                   GMKQRGEKEMGNRVWENGWYLIKLPAAGSDKYLKEDKGPEAGDRYKKAKYGGDSDDDAP
FT                   PEEESAGGKSKKKVGVAAVIAHARSDEEVPPNFDLLVTFALGLLRALLRKMSGEKGVGG
FT                   GGAALGERREAILEGVVPLAVRALSSKRSSIPPLAVRCLAQLSTMKLAAFDSSTGALAR
FT                   RIMALLRECNSPNQQLAQDCLKLLNNLLKRHAAFTPTDAQFRFIITFAFGDLEGDHREE
FT                   QRSTTFSLMRAVLARRPLLPEVYDCMKTVSSLVVRANAKDVRELCAQALVQFLLDYPLG
FT                   ERRLQQHLEALAANLEYQHASGRLSAMNCLRDVVSRFPAEAVEAQATFLFVPMVARLGA
FT                   DEDANCRRAAGEALTALLKRVAGTSAGRKLLALAVGWCARSSYSTVSSTTAATADPRLR
FT                   RAAMQTLGLAVTAAPREAARAVATARPHVASALHEHDPENGGDEDDDDDTVRGWQTAYY
FT                   ALLLVEKTAARCPEALTSVTPVTPDDDDDRVASDAVTGPAGRFDAPDAVWSGAQALLLH
FT                   RHQWVQHAASRVVGHRLATEGRAMASALAAGKAEDGPLRLERVARSCVAVLEQGTGAGA
FT                   VELDAGLAEQTVKNLTFATVVLLQTAAASEYESEDGSEDGSEDDDDDAEKVPSDAKGEK
FT                   EDANGEKDDASQRPPYPWLFRRMGKVGAGGVGAARAASLRWCAAVAASLGAEGFKAKPA
FT                   CAAPLLLPAVLCADDAVVGVAEEHRELAREALEVMRSNLPAGAFGVAYATVQKRIAGRR
FT                   ERRRKMKALEAVTDPEKAARARLAKAEKRTAARKRKIQEYRAGKGSSQSTKKRAREV"
FT   CDS_pept        join(complement(431743..431898),complement(431420..431483),
FT                   complement(431228..431283),complement(430827..430976))
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633534"
FT                   /gene_name="H2A"
FT                   /orf_name="MICPUN_107416"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65802.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199BB06"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY8"
FT                   /transl_table=1
FT                   /translation="MSGKGAKGLSGKGLSGKGAKGTMKGGDKKKPTSRSVKAGLQFPVG
FT                   RIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLA
FT                   IRGDEELDTLIKATIAGGGVIPHIHKSLINKSSKKSD"
FT   CDS_pept        432264..433838
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633535"
FT                   /gene_name="ARBK"
FT                   /orf_name="MICPUN_107417"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65499.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BB07"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBY9"
FT                   /transl_table=1
FT                   /translation="MAVKMTRRITQETFDECVQGNIDDFEMEPDEAVEEAVKEFELQGV
FT                   DLSQIDRTYAGPDGRGEHPAAAAARAHDAAVEKGDLRGIADTARALRECVSGEGATPGW
FT                   GSACVGAGAVQACWRACERVADGAAGASSDDVVDAMQTLALVLSCDEGRDTFVALRHPM
FT                   NFVTALWPAFASTHPKSVADCCAVVAAACTKNEACKGAFMKAGVETSLVAVFVDAAASD
FT                   PHALRHACAAVKALTTGDDPREPASGAFTHARAFAKAGAASALCVSLTAVDASEDPVLC
FT                   ASLAVALKHVAVNDDICKEIAERGGVARLLELLPASCASGDAKLARACAACLRQLAGSD
FT                   GNKSLIVNASGLAVLVHVVNVFGARAGDATSGDADANRFHSVQEQCVGCLAALLLKNPD
FT                   GAARCGAEGVFEHVVDAMSRARSHKGLQRQCAMFLRNAVVRNPENVPLILNNTDAEALL
FT                   RLSKKMHPKECVDVASAAMRDLGCDNYNEGWKPTTAVMGADGVVRTPEELGDEPLGVNG
FT                   PIPEDDE"
FT   CDS_pept        join(complement(435128..435172),complement(434848..434970),
FT                   complement(433971..434747))
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633536"
FT                   /gene_name="PP2A2"
FT                   /orf_name="MICPUN_107418"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO65803.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI000199BB08"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ0"
FT                   /transl_table=1
FT                   /translation="MAGLLNNPYAQLDSQIEQLLRGEIIPEDEVRVICEKTKEVLSKEE
FT                   NVVPVRAPVTVVGDIHGQFADLVELFQIGGRAPETNYLFLGDYVDRGYDSVETVCTVIA
FT                   MKARWPDRVTLLRGNHESRQITQVYGFYDECLRKYGNANVWKYITDMFDHLPLAATVEN
FT                   EIFCPHGGLSPSLDTLEHIRELARTQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTF
FT                   GQDISEQFNHSNGLNLIARAHQLVQDGYEWAHDQAVVTVFSAPNYCYRCGNQAAIMEVD
FT                   EGMNRDFLQFDQFRRAVNPELRRAQHKMPDYFL"
FT   CDS_pept        join(435614..435661,435812..435862,436013..436654)
FT                   /codon_start=1
FT                   /gene_family="HOG000090301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633537"
FT                   /gene_name="IDLC"
FT                   /orf_name="MICPUN_107419"
FT                   /product="Inner dynein arm light chain p28 "
FT                   /protein_id="ACO65500.1"
FT                   /db_xref="HOGENOM:HBG444499"
FT                   /db_xref="InterPro:IPR019347"
FT                   /db_xref="UniParc:UPI000199BB09"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ1"
FT                   /transl_table=1
FT                   /translation="MIPPVSTLVKYDAAQSITTTNDKRAMMSTGTMKKGTLAPIEGAKT
FT                   GASQTEDILNSILPPRSHESDGTLWVQNVSATPATRLDVINLQEKLDAQLQARQARETG
FT                   ICPVREELYAQCFDELIRQVTINCAERGLLLLRVRDEARMSIAAYQTLYESSVAFGMRK
FT                   ALGGEQGKSDAEARIAHLEGREADLERQVAELKARCESIERREAERREEEEKRHAEEVG
FT                   FMQKSNKQLKQQLEKFLSAEKNAK"
FT   CDS_pept        complement(436795..437745)
FT                   /codon_start=1
FT                   /gene_family="HOG000199476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633972"
FT                   /gene_name="EIF2A"
FT                   /orf_name="MICPUN_107420"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 2 complex"
FT                   /protein_id="ACO65804.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005850"
FT                   /db_xref="HOGENOM:HBG499933"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199BB0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ2"
FT                   /transl_table=1
FT                   /translation="MYEAKFPEVDEVVMVQVKSIAEMGAYVQLLEYNNIEGMILLSELT
FT                   RRRIRSVSKLIKVGRVEPVMVLRVDKEKGYIDLSKRRVSPEDVAACEEKYNKSKMVHSI
FT                   MRHTAETTTATLVDLYEHMAWPLYAKYGHCFEAFKHMVGDPNKVLDELKKPDGSPAVDD
FT                   EVKNALVKDIRRRMTPQPLKIRADVELTCFAYDGVLHIKEAMRAAEAVSTEECKVKISL
FT                   VASPLYVVSAQTLDKDFGVKLVDQAVEACAAAIAKRDGKIVVKEAARAVSERDDRLLAE
FT                   KMEKLQKAQEENSDSDSEDETMGDVDIEKQTGLTV"
FT   CDS_pept        join(438584..438710,438927..439375)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633973"
FT                   /orf_name="MICPUN_107421"
FT                   /product="Predicted protein"
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="ACO65501.1"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniParc:UPI000199BB0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ3"
FT                   /transl_table=1
FT                   /translation="MGGRGGGRGFGGRSPGGRGGFGGRGGRGGRGGFDEGPPDTVIEVG
FT                   EFIHACEGEAVCKLTNPKVPYFNGPIFLENKTQVGKVEEIFGPINASMFTIKMAEGVVA
FT                   SSYSKGDKFHISPDKLLPMERFLGGGGGGGGGRGGGRGGRGGRGGGRGGGRGGGRGGGR
FT                   GGGRFGGGGRGGGRSFGGGGRGRGRGRG"
FT   CDS_pept        join(440049..440116,440510..440852)
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633974"
FT                   /gene_name="BTF3"
FT                   /orf_name="MICPUN_107422"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65502.1"
FT                   /db_xref="HOGENOM:HBG629031"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI000199BB0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ4"
FT                   /transl_table=1
FT                   /translation="MDVERLKKLAGSVRTGGKGTMRRKKKAVHKTTSTDDKRLQNTLKR
FT                   LGVNTIPGIEEVNIFKDDDVVHFTNPKVQASIAANTYVVSGPSQTKKLQDMLPGIINQL
FT                   GQDNLDYLKKIAQAYQAGGDDVPAVENFEAGK"
FT   CDS_pept        complement(441087..441497)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633975"
FT                   /orf_name="MICPUN_102249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65805.1"
FT                   /db_xref="UniParc:UPI000199BB0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ5"
FT                   /transl_table=1
FT                   /translation="MYASPALHRAVAFPKATKPAEASKAGRVATRAAAPEDKPAAAARP
FT                   TGRRSFSVATLAAVVAAASAPDAALAFGSGIPGYDINEKARDAQRKAINDELAEQRELA
FT                   RKEKERRRLLKEAEEAEECARNPESCPAPAES"
FT   CDS_pept        complement(441580..443664)
FT                   /codon_start=1
FT                   /gene_family="HOG000238553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633976"
FT                   /gene_name="SRP72"
FT                   /orf_name="MICPUN_61240"
FT                   /product="Type II secretory pathway family "
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="ACO65806.1"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG320435"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="UniParc:UPI000199BB0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ6"
FT                   /transl_table=1
FT                   /translation="MSSWRGGKDTGGEPSVDAQLEDLFTKLSQAVEQGLHKRALKCADD
FT                   VLKISPGDADAIRCRVTALIELQRFADCAATIEKDVADDALRKDLAFERAYALYKCGKV
FT                   DESLRILQTETSQDERESTRAMQLEAQLMYRAGRHDEAATIYEALFRDRADDVGESPNT
FT                   AVNLAAALVAAGRGSDLAAALKRLKMSPKDSFELAFNFACALLETGNLADAADYLTLAK
FT                   NQGAETLMDEDLDEEAIADELVPIDAQRARVAEMLGRKEEAAEGYRAAMAIKSTDAATQ
FT                   AIAANNLAALVGPRGEGGADAMRQTQRFCDKDGKLNDALVGKLTEAQRRVLVINRAKAL
FT                   LHSNHLDRCRDALGTLRKLPGADGAREAAMLEAALFMRERKPEKAVKSLTDLIASGANG
FT                   DVGAVRDARLALAQIHASAGDYAAAIEALKGVKELEGTAAGAATLVALHELAGDASGAD
FT                   AVLDGSGAVGAEGAAGAEVALRAAERKLTRGAHGEAKAIFESVMDDAAADDDDKLAARA
FT                   GVALAKALGGDVVGAEADAAALFERVAAAAGGATDADSLEETLPASVLARAAELERRMR
FT                   GKRGKRGEDGDGAHKPKTRKKRKKKVIYPKGFDPSNPGPAPDPERWLPLRERSTWKGKR
FT                   KKVNIRGAQGASSAKAIDQLGKTEFSGGDAKKVDAEAMREKVLSVAGGKGKKKGGKGRR
FT                   "
FT   CDS_pept        443842..445095
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633977"
FT                   /orf_name="MICPUN_61241"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65503.1"
FT                   /db_xref="UniParc:UPI000199BB0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ7"
FT                   /transl_table=1
FT                   /translation="MAPSTSTKPPDEPRRRPKPRGGVESFDEAALLAELEDDQEGTQHA
FT                   EREETHEELERRLMRDIAAMPDQMALEEAALMRDLASMREEPDEGDVLMAALLAEEEAE
FT                   RRAKEAKARTRTSAPASAALKVPDASEIAALRDACLQEKHEAVRLKRAGDIDGAKAALR
FT                   RAKDIAARADAAEATQPAARASTPNAASTSSAETIEELTRAVDAARREAVARKRAGDMA
FT                   AARAALTESKELRAKLEAAVAAAEAAKNADSAPTEPDSAPPEPPPTDVDAMIAEAIGTV
FT                   VKIISDDPDSKVTARKKKLNRDDDDEAPDRLGRESDEDEGGDEGDDALLRRELGDDYEA
FT                   QREHWGGDYRHPEPTSERELIASRVEELERLVDSEKRTALARKRGGDHEGARNALRAMK
FT                   AAQAELADASAMLAALED"
FT   CDS_pept        join(complement(445281..448133),complement(445198..445242))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633978"
FT                   /orf_name="MICPUN_61242"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65807.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199BBA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ8"
FT                   /transl_table=1
FT                   /translation="MADLGLTLESVREAITENLALTNRLRELWHLAKEWLHFIITLCFV
FT                   AYLVARREQRRYARRLRAAKSAMSFARQRDATYTSVETGMLEWINHALRHEWRAVIGSY
FT                   VDQIATESLEETLRASETSTAGVTIGATVEELTFGVVPPDLKMYCSRYNPTEDYLHFEF
FT                   DLTWQTVSSLIVLRAGVKPSPYLPRMSVPVSVTDLSITGRLLVGFRLANRSPGVSGVDI
FT                   SFDNKPEIHVAIKPAGFAVSDLPGVHEWVSGKIAEVFATSYVEPKRYTYDFENAYLRSL
FT                   DGSIAAASGPGGALVVDVAGAQRLPATNKESRTSNPYCELTYGGVTRRTATRINTTSPE
FT                   WNVRVVFPLPSTEDLLRRSSNGDKGDGGGFGSPVGVSRGGGGNDEGVAPSDPSDARVGD
FT                   GRTLPLRVRVMDWSPLGEPRCIGEASYAVDVRRLRREASDVGKMKAGKRKSDAGGPLGM
FT                   REVSLPLRRTKGGFVKLLLGAAGPCGKAGRQSPATHAASKPVGRRASTDGGLARQAIVR
FT                   QASGEGRGLTRQDSLTPKELERGNRDWPEKYVEDDEEPIDDWSPRDSPLTTPTSTIGTP
FT                   RTPTPGVDGEGENEDDGAEGGLHMAQTAAHILQMAKIQRSRREDALRHRETLDAMQHKI
FT                   TAAKEDLRMERDRREFELRRALVEGAVFTCHTKRSPGFTPGTYRIWFNSKLKRIMWSSG
FT                   RAPGRASKLHQFVPVALIKECVVGSGAFTLGAEPEGQVTRAEAKELWRLGMKAKSPTTL
FT                   TMSAAASARAMMTKKIGTHDPLRCFSIVLWKPEHVQGGPNDNVMASGAASLGLATIDLE
FT                   LPQEGNGRSVREWCEAIYAAAREHGGGKNDDEDEQDEQDEQEDASVRDGKYWEAQKDAS
FT                   AGDDLRATPPKSASRRTQSKELIQHAELVRDATHGGKLKGQHAKRGSMGIPLLDVDDSF
FT                   EDLVAAAEKGGGGDGRASPQTRRVGDERRAAPAAA"
FT   CDS_pept        <448632..>448817
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633979"
FT                   /orf_name="MICPUN_74819"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65504.1"
FT                   /db_xref="UniParc:UPI000199BBA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EBZ9"
FT                   /transl_table=1
FT                   /translation="KNRAKPHRCNDRVEDVIQAMFEGNPFLTVPPTVTLLRRCLNSEIG
FT                   QEPEEPYLFLDLPPPVR"
FT   CDS_pept        join(complement(451281..451409),complement(448915..451176))
FT                   /codon_start=1
FT                   /gene_family="HOG000249811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633980"
FT                   /orf_name="MICPUN_61244"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65808.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG293434"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR004106"
FT                   /db_xref="UniParc:UPI000199BBAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC00"
FT                   /transl_table=1
FT                   /translation="MVNIVKVAPIAIGAAVAARAIIRRGRGGARAASASASPPVPPVAK
FT                   RVPHKVLFGVVEGENRGAKPMDPPVERNDDLFWLRDDDRKDPSIVAHLEAENAYTEAHL
FT                   AHAQPLAKKVYDEIVGSIQETDDDVPFPWGDKGHTYMVRTVKGKAYPIVVRTLNDKDWE
FT                   TVLDVNEVAAPLKYCSVGAFRPDPSHDILAYSIDPSGYETYEVRFKDLVTGEDMPDVIK
FT                   GTAGGVSWGHCDASTGHREVYYSTQDDAHRPDKVWRHVIGTDQSADTCVLHEPDELFNV
FT                   GFGRTSSGRFMLIESESTETNEVHYVDITAGPGANQSLALMQPRRMGHRYYPEHRGDHW
FT                   FILTNRDGKINFDLVRARLTLPSEDHWQTVPGAPGGGGEGCDGVGGGDGRPFQWSEGRT
FT                   LESMCAFKDFLVLEGREGGFSAAWVLRLTEHPADSEIDDGDAHACIASWHKTSWPSQNC
FT                   CVYTSVASSNLSCVGANQVFDTDVVMFSYQSLTTPKTVYAYDMRTAKSKIVKPTPVRGY
FT                   NADRYATTRMEVTVRDGTKVPVSIAWRKDAKTPKGPMLLSGYGSYGVSNDPTFSREDVP
FT                   LMDRGVVMAVAHIRGGGEMGRHWYEKEGKYLTKKNTFNDFVDVAEHLVATGWTSTSKLA
FT                   ISGRSAGGLLMGNAVNMRPELFKCVVAAVPFVDMIVSMCDPSIPLTTGEWEEWGNPNEE
FT                   EYYEYMLSYGPMENIKKGPKPEVLITAGLHDPRVAYWEAAKYAARLRAANETKDSRILL
FT                   KTDLAAGHFSASDRYQLYKERAYEHAFVLDSLGLSNAKPGWAK"
FT   CDS_pept        complement(451479..452330)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633981"
FT                   /orf_name="MICPUN_61245"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65809.1"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BBAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC01"
FT                   /transl_table=1
FT                   /translation="MKTARCEALIDQQVRAAARFIRRPHAAVDSRTNRSLCPARGTAQT
FT                   SSMLRAHRAAVAIDRPPTPRRAAVGGACTASASMTRAGGGGASRASPRPGRCPRHGPCR
FT                   SGGSRARVRAADAAAASSSPSADTNAPARLVLYTKPGCCLCDGLKERLDEVLASDAMLA
FT                   SAPALRGASLELRDVSTNEEWATKHAMEVPVLRLLLDDDDEGGGEREIPLPRPAPRLSA
FT                   ARLAIRLGQDVDAARGGHGGSSRKGWSVRTGGGAGIGAAGTAPSSPSSSGGGWSVVSDK
FT                   GW"
FT   CDS_pept        452335..454275
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633982"
FT                   /orf_name="MICPUN_50528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65505.1"
FT                   /db_xref="UniParc:UPI000199BBAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC02"
FT                   /transl_table=1
FT                   /translation="MSTGADALSQELRDAIRAKHRLVEKMKESVVEASDRSTPGRNKIS
FT                   FGAFAWWKAVLVSAFVALCVVAVQQAATSDRAAEIRANIRARARLAAWEHEEKKRWSSE
FT                   RMLRHFGLRRASSLRFTEPVYTFADLWDAVRDPDTHVITVEVAIDAQTAQPAVRTSTYA
FT                   KPERFAMSLDKLLTSFARFGSNKGLRFVFRDPRAIAPATRAIGERVDNGKIASPVILEA
FT                   EVASGPEGYLPEMSVITADALDWQAKDAGEARPPRSYTLAQLANTHPDAEFVPFDPKEL
FT                   LEAAKRDVPGAILSLSAATHVSCALEQAIRVDSRIEKRLIKEQLLRGLTRVKMFGQKRG
FT                   GMLRGAGPDIPPMFVKAVARVKQSEAAAKVAAAHAAAVSAAKKAAALAGGGDASADEGD
FT                   ASADESDAPAGGDERRRRLLQLDADMSAFAAEEAAKRAAMRETDLDQVEDTAGDTAGAH
FT                   ADAGDGPKSVSEESARHDVRAQAARLTDQRGYGWRTHRAVVDLVDDAGWDGDVWFPMHA
FT                   CVMPRTDPGFVRALLDVSFGNAAMIRGPALLTKGLRLWILEELSVARTFLADDFVRLPE
FT                   GEPVTEKEVFLDPVTENPEATLEGLMSGDGAGTGTDQAKVVRGWKETLQNLKSFTSNYY
FT                   HRNQMKAEDGN"
FT   CDS_pept        join(454512..454700,454905..454985,455144..455263)
FT                   /codon_start=1
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633983"
FT                   /orf_name="MICPUN_91602"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65506.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI000199BBAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC03"
FT                   /transl_table=1
FT                   /translation="MVLKTEVCRFSGLKIYPGHGMRLTKTDSQTFLFLNAKCKRLFNLR
FT                   LRPAKLAWTTQYRKAHKKDTNIVVARKKKRSIKTGKRSLVGASLEVIQKKRTEKTEVRA
FT                   AARDAALREIKERQRKAKDAKKGKK"
FT   CDS_pept        complement(455518..456357)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633984"
FT                   /orf_name="MICPUN_108880"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO65810.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BBAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC04"
FT                   /transl_table=1
FT                   /translation="MGSDHDPDDVPPPPGTPPDSESDGEPAAAVVEDASPAGTIPPHDP
FT                   HALAPAPEPEPSTPPAARPAPSARAGAKYDGSLVFAVPPPEALDARKGATGAAIVQDLV
FT                   NCALELTEDQIAEFKECFALFDEDGSGAVDTAELGSVMKSLGQKMTDEELQTMITYVDA
FT                   DGSGTVDFAEFLGMMARQMKDHDSDLILQRAFDLLDSDGSGKVSKGALCYVLGALCDKM
FT                   TCAEIEELVDEAGGGGDALTLSQFMGIMKITASTGADRAVELSRRASSRANGLNLPA"
FT   CDS_pept        456794..457828
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633985"
FT                   /orf_name="MICPUN_61249"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /protein_id="ACO65507.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199BBAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC05"
FT                   /transl_table=1
FT                   /translation="MAATCTAVSAARVTAPTVTRSRNGAGTNNLRAAVARPASRRASHA
FT                   RVAPRAVATETATSAPATAAGDTALIDSLRPTSAECAKTLVAIANTGTISTACEDGIPL
FT                   GTFASYVVSKEGEVILRMRADALHTANVTRDPRCSLYVQPATQPPGVLSRATLIGSLSR
FT                   LDDEAATKASKQYNETHGENVGVDAVAGSDVYYKFDVDRVFYVGGLGSDKRAEVVSAAD
FT                   FDAALSDPLARIANSVVDAMNGERYEDVMNFARASLPDEAEPAEARMLWVDQLGFDVRV
FT                   ITSAGDGAVGKVLDVRVPFPAPATTQQQVLSSLTMLAQVMWEEEKQYQPQPVPQETTSG
FT                   EGSD"
FT   CDS_pept        complement(458020..458988)
FT                   /codon_start=1
FT                   /gene_family="HOG000264999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633986"
FT                   /orf_name="MICPUN_61250"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65811.1"
FT                   /db_xref="HOGENOM:HBG562641"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199BBB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC06"
FT                   /transl_table=1
FT                   /translation="MSVASMPGTTLTATTFRGRGVERRAMTSTRSRCRSSSTRVVALFD
FT                   RVRAATVSSKAQAPPLTSADVTPGQGAGSPKWPEIHDRCLAMGVKTVEAADLPSVVSDP
FT                   RRAILVDVRQTIEYDEWRVPPAVNVPYAIPDPNVIRRAVGYAISIKGGLKVRNPEFVQA
FT                   LRSAATARLSSRRAEDGVVVLIDTKGGDLTSPPVREGSGQLDPTDSQCLRAAFELKQAG
FT                   FKDVRYVRGGLPGAIDVAGMRYESEKWGGFLNWLDDTGQGKRRRLLMYSRLLPDPTNLP
FT                   GVLGQLAVFTLIGLAYYDVGGVGSWAATSVPGACSLLPVCL"
FT   CDS_pept        join(complement(460027..460100),complement(459151..459958))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633987"
FT                   /orf_name="MICPUN_61251"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65812.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BBB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC07"
FT                   /transl_table=1
FT                   /translation="MDFHFAKAVFQLISVRAGEPCNTKSPPSSSGCRRRLALFVGTLAL
FT                   RRKRSKSGGEVLTERRASRDRTGRAFRHTPALPPVRHTPGSDMGFGNAEELPYVDGTDP
FT                   IYRAAENGDALKLKRALAGIASKRDRWAAANVRNEDAGDKSPLHIAASRGYMLMATDLL
FT                   DAGAELLPDEKGRTPLHLAAANDDKDMVTLLLKRTKDKFKAKTQFCEGYSRPAAPVHLC
FT                   KRPDIRKMLIFKGCGDEDGGKARVVLGEAMEFKLSTPVKAFIGLFGTATILFVRSRIQI
FT                   AQGYQRPTRYVR"
FT   CDS_pept        460488..460937
FT                   /codon_start=1
FT                   /gene_family="HOG000233101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633988"
FT                   /orf_name="MICPUN_84803"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO65508.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG394659"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001032"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000199BBB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC08"
FT                   /transl_table=1
FT                   /translation="MSVEPNHVQEVENSWNKVAALGVENVGVLLFKNIFTIAPEALELF
FT                   SFRNEPNLYDSLTLKAHGVNVVNTVGKAVAGLREFYTLVPALAALGERHVEYGILEPHY
FT                   DVVGKALLMTLEQGLGDAFTPQVKEAWTIVYEAVAVTMKGDNYKK"
FT   CDS_pept        complement(461019..462329)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633989"
FT                   /orf_name="MICPUN_61253"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65813.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199BBB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC09"
FT                   /transl_table=1
FT                   /translation="MDPYHVLGVPPGATDSEIKAAYRKAAMRWHPDRNTASGPEAAAMA
FT                   ERQFKAVNDAYDYLSNSGGRGPGSGSSSSGGGGASSSQGSGRWRRRPWSSYAASGGHAG
FT                   GGGGAYAGDDPFGFRTGRGTVGDHMRRIDRNLRVLYVSLALLAGLVYVAPPAPSPMEAA
FT                   KARRRRERTAHARGETHRFTERANVSLAPGSPLYGRRHGSHTAQQPWLDRAAGDAAWGG
FT                   DATYERFAAAATQLATFETSAESDRPGRRWRTRSLGEAEQRAALHAGWQRARFGAKVVA
FT                   GGGGGGGGDTAGGDGEVSSRSSSTGDATPEWASGGFAGVGISRRVLPYQQRDGRGDEGS
FT                   RGWSGGSEIQCANCGYDVARAARYCAACGVRVTSPGSVVRRLRADPQDTGTSVGRGRER
FT                   AKAAALAAAARAESESGVKAVGVVVAADGASSDGVPS"
FT   CDS_pept        complement(462641..464131)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633990"
FT                   /gene_name="BZIP1"
FT                   /orf_name="MICPUN_107423"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO65814.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI000199BBB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC10"
FT                   /transl_table=1
FT                   /translation="MPATRGASGRSPKDESYGENLKAMDASDPAAGDLGTLASGSSDDA
FT                   LVIDPAAVSAAFADQLDDSVMRDALFTLGFDDIPPMSFTPSVGGDDADGDGKDGKKART
FT                   TGSNQRAVQKRYRERKKQHTAALEAKVAELQSRIDELESEKREMNDQTDRRAAQGGDES
FT                   GIASTACGLVDAASIGGDGRMSSACEKARKEYLLKFGERVRHMRSALERGASDGELRQA
FT                   LRGMVAHCLGKNPDSSPSGPALKSMMTSNARMLNREAASQQADAQQGPVSTHSGGSEGS
FT                   DGFMAHTDLKTALMRSNEGIVRANGVCSQSVCQSVCGGPLRVTIDGSNPTEEEASAHWI
FT                   TVAGALRDSVPPSEVTKLIRWRDEYVAAISNIYEERQRIGAKLAGVGQPFARTGLKGDD
FT                   SPPSDESTRGDGTSPIVAETTQGEAFVDTIAVAEALRESVTRELELKMRSHPTLVLKTL
FT                   SPRTSAAIIVSSYPFLPDAVAVASLMKTWRDDGNSVKV"
FT   CDS_pept        complement(464344..466029)
FT                   /codon_start=1
FT                   /gene_family="HOG000236725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633991"
FT                   /orf_name="MICPUN_107067"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65815.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG285678"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniParc:UPI000199BBB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC11"
FT                   /transl_table=1
FT                   /translation="MSIVDDIPDAIKTVPKAAVERDLGKEVESRRTFAIISHPDAGKTT
FT                   LTEKLLYYGGAIQEAGAVRARRGAKSATSDWMEMEKQRGISISSTALSFAYKNFTLNLL
FT                   DTPGHADFSEDTYRTVSAADNAVMLIDSAKGLEPQTRKLFEVCRLNGLPIFTFCNKMDR
FT                   PALEPLELLDQIESEFNLPTYAVNWPIGSGDTFKGVYHRPRREVHLFNAEAKDGKAKKG
FT                   EDKSTKGLEVLSVDDEKLESLIGAELHAQLMEDIELLDELGGELDLQAVHDGELTPVFF
FT                   GSGMNNFGVQLFLDSFLGYSVRPRGRDLLGGDRVEPTDEGFTGFVFKLQANMDPRHRDK
FT                   VAFVRVVSGRFERGMRVTNARTKKAVLLSRPSQMFGQDKTVLDEGFAGDVIGLNNPGSF
FT                   AIGDTLYMGSRKVLPPIPTFSPELFAYLRNSDTGKYKQFQKGVQELLGEGAVQVMYSRD
FT                   AVKQDPILAAVGQLQFEVVQARMLAEYGVETTLEPLPFAVARWVVGGWDAIDAAGRIFN
FT                   AQCVKDIWGQPVLLFKNQWNVDQIVADTPEIGELSPFSIPPAAE"
FT   CDS_pept        join(complement(469184..469399),complement(468695..468955),
FT                   complement(468444..468578),complement(466658..468298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633992"
FT                   /orf_name="MICPUN_61256"
FT                   /product="JmjN/JmjC protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65816.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR001739"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199BC50"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC12"
FT                   /transl_table=1
FT                   /translation="MAAGKNSSPRISNAWFQTVLSIGRFTEDQRKACGQLTTTARRQRA
FT                   KSRGNAQVARTRARHASRAARRKDTQKAIVPSQCAGMDAKMQPVGPDGKRPRREPPVFY
FT                   PTMADMRGSFEKYIESIEEDLEEFGIGRIVPPAGWTPRQEGYDDIDFTVDHPIKQHATG
FT                   RKGLFRTLLVEQKPLSIKNDFKPAAMLKENLPSEAALKDTSILEREFWKKVTYNPPTYC
FT                   ADVAGSLFDKSNWGWDVSRLDSLLSRTLKRKNITLKGVNSAYLYFGMWRSLFAWHTEDL
FT                   DLYSVNYLHFGAPKFWYAIAPEDRERFEILAQGMVPEMWRACPEFLRHKELLISPTLLE
FT                   QNGIPFTRMIQHPGEFVVTYPGSYHSGFNTGFNCAESCNFATEAWVEYGECAGSCECVP
FT                   DSVKLDMSIFEDEENGVCKLVDEDDYTRVKRSRVGEPRRRPTNEEDAARRREEAKKEKE
FT                   EAREEAAREAAAKGCGRATPPLPRLRVPAAGDKGVLVPEGWKRTVVKKRGDKEGARETT
FT                   YKSPDGKTLRSKQELTRYLGSNPRCGATLRDFYFETNAEDLPPTRLLAPGTPSPTASGD
FT                   DKGAGEGKRKGGSQGASSAGARAALKVKNGGVSKPSVAKRGSASSTPNARDSLGGFLGL
FT                   DSIRKTLKMEPVAAGKKPAVANASNAKSTKAPLSRNARANAVPVEEDTFRRWKSGGLLE
FT                   GAIAKVMKRASGVGKSIRGSSLVLQVEQALGVGTGSLRSHGNQIQTMSKTISRRAR"
FT   CDS_pept        469811..472972
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633993"
FT                   /gene_name="SYT1"
FT                   /orf_name="MICPUN_107424"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65509.1"
FT                   /db_xref="UniParc:UPI000199BC51"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC13"
FT                   /transl_table=1
FT                   /translation="MRRGAMASPAVFSSTCARASSGSGRHEVRVPRTTRSTPRLVRITA
FT                   TERHGARRPGARVVVVVRASRDERDEDDAASAHNTSGRRVAVGAALAATLVGPATALAS
FT                   PGSAHAPTDATGAPPLPSASSGSARAAPDPRERYGPGDAGERERAEITLAGDAFRFLTV
FT                   EDAPDPAAAADAPSSTTTTLGGIGEDILAAKDGPSLPEQVAAAVVAFVKPLFGELGAAV
FT                   LGFGGGAVASGFFMGWQQSKKSKAKGKTASRQALADLATLDESEIQELVGELPAWLAFR
FT                   DVERAGWLNKVLAAAWPYLDQATSNVIVAALDPILKATRPSFLTTLSFERFSFGNIPAS
FT                   FEGVKVYETTGDGSVEIDLRVFWAGDPDVVLGVRAAQDSLSVPVSLTEFECSFTLRLIF
FT                   APLLGVFPCFGALTIALMEEPQLDFDLRVVGGDVTLVPGLKAPLKQYILALIASWMVWP
FT                   RCITVAIPGTGYTLPVDEDAEKPTAGLLHITVVGHDGAAVNPGEVGLQVRWPVADLLVD
FT                   KNQSEARVKALPGGGMLSSKEITLPVEDPKAQLLCVRWYTRAVVDEDTGKIVRPEVLDG
FT                   EASVVLDELRAQALRARGDDAEVFASVSRWGPVPVAAELEPPVGADIKSVGGAGNDGES
FT                   RGLVGRVWGGVKGVGRGVGGIFSKSASGVVRGYKTVRQEGFGGVSKVPGAVVSGYKQKA
FT                   AERGEGGKGDKGETQATQVDALPPLDVPTAKLVRLRVRYQPLDDSLTAAADDDDANEGD
FT                   VANDGAASGFVASTTAASDVGGSELINGRYASRSRWPAPAPSNRASGDGVQTGSRRVPD
FT                   SSTGLTDAYEDELDALRQVLREKEREIAGMRTERSLMEKELAMAAADRERIRRIFGAEG
FT                   EKRENDASRQASSSSLIADRTPTPAGMKLEALKSAARQTIAVINAARALPEGDRRELDL
FT                   ALRRADSLVAKAAQVVRESTAREEVEAAAAEAELQKLKATIAAAKVAEAEPGEPSEDED
FT                   EDRHFGTVHSKSEVQRAIDESAHAEHDSRERDEEKEKDKAEFLEALDSAPGPATSDEEQ
FT                   PSKPR"
FT   CDS_pept        complement(473039..474823)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633994"
FT                   /orf_name="MICPUN_50537"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65817.1"
FT                   /db_xref="UniParc:UPI000199BC52"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC14"
FT                   /transl_table=1
FT                   /translation="MDEVRSIRAAVKSLAPVVGAPSATAPPSPIKDGPNETEEAKEAIT
FT                   AALRTELDALKRRVENLAGIASTSKSAEAAANEASKMAKSSMRAVENIEGEMKKLAVKA
FT                   DDAIASAASALAAAAAAAEDAAAAAESADTADQPKTDGSSIALSVDDVAARVDALQHEL
FT                   KETAVIVQTNAEGIAFLGQQTMHTAKKDDVEELRASVNKTAERARKETDALKAATQASL
FT                   EELEGRTKKLERGARRQSENREATPSAPAPAVETVSPQAVSALEKRMAALEASTAATPL
FT                   SSEAKDVAAGGDVKERVEKFESVASELTARVERLQEAVGVEMLAHMKRLDAKLKTVEQS
FT                   LGEVKQQGTPTNAAAKHESGKPGKLDRANAARLASAEKTAAESRSTAEDAAEKAKLASE
FT                   KAKAALAAVAEHAATTERVKEAEAKMRELAGEIEKFRADVAEMEMSSATNTADVVAIEG
FT                   EWASARRHLKDLEQSVWKSMVMIREEAGVGTPSSDAGAATPATPATAPAVTAGTPLGGS
FT                   TGRTPETPMSSFRALFSRGRRTSTVPRSTESDSARRLRARRTESPERRDVARSEAVIEA
FT                   LDMGSPTRPARRSANRER"
FT   CDS_pept        complement(476466..476894)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633995"
FT                   /orf_name="MICPUN_61259"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65818.1"
FT                   /db_xref="HOGENOM:HBG562648"
FT                   /db_xref="UniParc:UPI000199BC53"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC15"
FT                   /transl_table=1
FT                   /translation="MFAISTQTLTARPVALRARSAASRSPRAFRIATAAAKKDAPKEEP
FT                   KEEAGIDFKGLKQLISMGLGTISGDITEINLKDPTRTVVMELEANNFEDKDGNPLWKPD
FT                   DKGYVAESGEATPVMNYVVPVVLGIGAIGGVVATLNAL"
FT   CDS_pept        477040..478785
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633996"
FT                   /gene_name="TIC55-5"
FT                   /orf_name="MICPUN_61260"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65510.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199BC54"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC16"
FT                   /transl_table=1
FT                   /translation="MRIPVWIFTGPLGAGKSTVINAVLDALPKSSNPACITHHFAMSYG
FT                   CESTPVRRDPASTGRSKSHANETAARLNLAFYDEVYDFGSGCICCSPKGDFARRLWALA
FT                   RWNDEDLTQKVTHLFVETTGLGEPDAFAKLFFHDDVVAAAFELRCVVAVVNPANVAPAL
FT                   DEVPPAGLANKPAAQLAPASVLCVNPRAGADGANGADGADGADGADGAADGLERARRAA
FT                   APGAVVVDASALTSDPRTFGRCCLDALADAPAFDQSAAARRDPSFADADADATVPLVQT
FT                   SLALGSAHDGRVVTACCAERGALNRVAFVEWIQSVHAAAGGGLARCKGDVELAGEGGRR
FT                   LVVDGVGGALTLREEAGREERSRGAAGDGTDQRDGTEGWGGDGPKAPLCGDASCQISEH
FT                   RHGDRPSRVFFAGKSMKVSKLRAGFRACFVPKGFEWAADIEVDFPGRGDMGKEVEVRGE
FT                   RVALWRVDGQFKAIAAICPHAGGELAKGSVLSMGEGGQKLLSCPVHFFTFDMESGECVT
FT                   AKSCSRAKVYETRVALGGIYVRVQGAGVDGDEAGARDGDDGEEDGYRPLAVVDFDANGN
FT                   VVRVG"
FT   CDS_pept        complement(478905..480917)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633997"
FT                   /orf_name="MICPUN_61261"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65819.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="UniParc:UPI000199BC55"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC17"
FT                   /transl_table=1
FT                   /translation="MPAMSTPRVALAFLLACILTVCQGIDVAPSSPRAQRLREVRRRGR
FT                   EVTAESRNLVSERDSGKHPKTLRFTLHAFEEQFDIHLERNDALFHQDYRETVYQADGSL
FT                   ADAPVSSVNCHYHGRVKDADGWSAVAMTLCEGMRGHIMVDGHRITLDPAGSNHDGDHVA
FT                   TARIHGDDEEPEVDVDHIISARGDNGNRFSFVDNLAHIAGQNPAFASIARRRLNAAYAV
FT                   GTNAKMEMVVVNDLNRVNMYKAGARSTNDGSMRATGKTKEELFAMNATTPSNDALSALQ
FT                   ADNVMMFNVVNLIFLELSSPRLEIILRQQISFTTTEPDEIRNACIDGCLGEVNKWWMSY
FT                   ARENSIPHDAMHFLQGNIVSKYAGVAYMRSVCSPRYSASVTVSAGKNGDGLFFLGVTWN
FT                   DITTIAHEVGHQVGFPHDHDEGGNIAGLSCIQDQKLPGLPIMHYGSNWGNSDCFYDYNK
FT                   TGDKNVTDCWSPCSRAWYDYYMSRHSFWCLNYDNVCLNISGTMDCFAGGPPAPPSPPPS
FT                   PPPPPPEVWIEQPENIAIVSVSTIAFAALLAGAGYIMYRRRKQGKKMIPPLPKWMKLPP
FT                   LPKWMKDWKWRRGAKVGVAQANATSPKRSTDPSTKRQTKSSGSKRPWKLKFKLPSMGPC
FT                   LASCKSAAVVVKNAGVQKKKAKVKKNKVVPKRPPV"
FT   CDS_pept        complement(481031..482905)
FT                   /codon_start=1
FT                   /gene_family="HOG000271641" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633998"
FT                   /orf_name="MICPUN_107068"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65820.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG298887"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI000199BC56"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC18"
FT                   /transl_table=1
FT                   /translation="MAAVAEPVGEFIDAFNSDYARIHKAYEDNFWATKMNLKGNSTDAL
FT                   TESFNALEAFLGDRDTLDKVRGYLAGADATDAQVVVLKHIEKTLGCYIVESAEAKKVRE
FT                   EAVALENKMNSARNKLGLTYVESDGTVTDATPTVLRTKIRSASDESVRKSCWEATRKVG
FT                   PFLLSNGFPKIIAERNRFARTLGFVDFYDMKVTQAEGFSKARCFEMLDGLETATRPILD
FT                   AALAKLKADKGEDALKPWNISYALSGELSREMDPYFPFENAPEVWGRSFAAMGIRYRDT
FT                   KMQLDLCDRKGKYPNGFCHWPIAPHKAQDGTWNASQANFTSLATPDEVGSGNTALTTLM
FT                   HEGGHAAHFANIEQGSPLFSQERAPFSVSLAETQSMFLDSLCGDAAWLGRYAKDRAGSP
FT                   IPWDLLERSIREKHPFEVFMLRGMIAVPYFEKALYELDEADLTAENIERIADEIEHKIQ
FT                   GGLAARPLLSVPHITSDESSCYYHGYVFAEMAVHQTRAHFLGKYGVIVDNPEIGPEMLR
FT                   SYWLAGSGEPGFLKMVQDLTGKPLGHDAWVAELSKPTEDVVRDEKEEYAKAVNAGAYAG
FT                   EVDLGMHAVFVHGDEVISDSKVEDGYAAACAKFKKWVNENWPKTAVTA"
FT   CDS_pept        join(483223..483371,483491..485555)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633999"
FT                   /orf_name="MICPUN_102263"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65511.1"
FT                   /db_xref="UniParc:UPI000199BC57"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC19"
FT                   /transl_table=1
FT                   /translation="MPPRKKPPTPGSAGKGRQLGLFESFQRDTPSKRRRKSAGGDIHLE
FT                   YSKSRAGYDTFTVKFIETEGKCGVGYATGANEEDTRRSEAEFVSAFDDLLRNQRDQVPP
FT                   HHFYERLLSILVRPREAMRFDIVGEMADDDADGGDADDPRHPPGRGSPAEDRRLVRAAA
FT                   DVFTRIQRQHPTARVAVVDIPVANQTSPRREPVPYVESCDATWTPLDSDKRAGSSADAH
FT                   VDAQQSQEIGIGKEVTARGGGADWRRFRALVKCVGGDPEMLDVLCLGAEKKSTRRSSRK
FT                   NDTAGAGDDLDLDLDEKEDEVGDVARGRKGKGKKGGKSAVNSSEGADAGPYPGYVPPRL
FT                   GAVLLFQHSVDVLAADAAARIAVFERRVAMQNEVDAAAKSSNVQRPNEPTPSRLGRPSV
FT                   PSSAGAFSPDRPVPDSQDSDVVPESPDAGVGTQSQKQAPPVDLNARGNWALGVLQNSLL
FT                   YRLVGLAPTPAEGAALIRDVFELAGFAAENAFRRHADHSSAIGRQPPSEPPPGCEDAGV
FT                   DAIGASAHLFLSRLGDLLDLAEPASGTSDRRLTQLRLTVDEAAAKFWRCTGGLMGASCP
FT                   EALRETEAKRAFMASMCGGATDGGTTSGARRRLRLVRSALRQCVVARQAPGIMIAGLGR
FT                   EKDGEGARDVFDYVARDAKTAIKSQKISEGSADFRESVGRLGLMIGAAAQAAAALSDPG
FT                   KRTYEGSLRAGVKAFVAEAIANDGLRPEIAACVTAAIGTVTAA"
FT   CDS_pept        join(complement(486626..486706),complement(485692..486498))
FT                   /codon_start=1
FT                   /gene_family="HOG000038120" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634000"
FT                   /gene_name="ELO1"
FT                   /orf_name="MICPUN_107425"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65821.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG524386"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI000199BC58"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC20"
FT                   /transl_table=1
FT                   /translation="MAMPQQLVQAWTAWDQKVSGTTFAVLKAINWDVHPLSPVTKDWIA
FT                   VASPTILLTSLMAYLIIVGTGVRVLKDKPKDPTKKDPAWVRGLVIFHNVFLVALSLYMC
FT                   GGCLLEAYKNGYSVWGNVYNPKETAMAHYIWVFYVSKMYEFLDTFIMLIKNNLKQVSFL
FT                   HVYHHATISFVWWMIAHRAPGGDAYFSAALNSWVHVCMYSYYLLAVLVGKDEKRRKKYL
FT                   WWGRYLTQMQMFQFFLNLCQSVYLLAYPSYPKFISQILFYYMISLLGLFGHFYYSKHVS
FT                   PKAIKAKAAEKKKQ"
FT   CDS_pept        join(complement(490191..490283),complement(487002..490064))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634001"
FT                   /orf_name="MICPUN_61265"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65822.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199BCED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC21"
FT                   /transl_table=1
FT                   /translation="MSEEEAANPDGEAEAPEDAGPPPFTINVAIKAVSPLVAPWVKPEG
FT                   EEEAEPPPPEPVKVSFTFPGEEGPVETEPVEPGEDGACVFDYVKALEGRTPGPALVSAL
FT                   MATPMVVTVHRGEAAIGTVSVDMLAFTTGVESIGGSYALTKIPFEGDLPKPEPEAPADG
FT                   DEAAEAEPEAGGEGAPEEEEDVRPKNPMIDGASVELSVTPTFPPDEGPTLVSEHDALNG
FT                   GILTITAVAIAPVPKTLIDVQAANDNHWEFAVAMPLEGLDPATIRGGEVIVEKDDDGEI
FT                   VASRVEFAPETSTARTWMPAATFAAFRDSIRGKGPAKARMEVCRVSKSGAFDAIAESYR
FT                   AIADATFDGLLNPGATESAETAPLRAPPFGQYAASCVAKLCPKENPGGGEGPAEEAAPE
FT                   GQTHWAATPTECGVTFHVTVSAPVLPPWRAPLPPKMAVADLLPGRDPLGPHEADVRATE
FT                   AFRAEVTKSAAVLSKEYAAMFTGEPKDADGKATRRKSLVFELNRSGKYHAMKERLKSAA
FT                   SAIIAERFYKGGEGVQGKYNELYVHLVQEMHAALKKLGSSEEEPEDPRDGVDHAKLARF
FT                   KALADEYEIAGDQSNADKWHRERLVLTRRLPEIWAEYGAFLARCERYGKSEEAYKEALM
FT                   LDEGHVPSLIALCALMLHDEEYERAEVYGQAVTSREEGDPVAWSLLAATYNAMERDEDA
FT                   TNCNYEARRLAAEVMSRVTAGSPGSQPEKPPEAFVSTSLLLLDMHMPAEACAILEQSRT
FT                   HAAFIRSICLARAAMLEGMPQNAHAFLMDALAVDATDPRPFELLGDLHTKEGNFADAVE
FT                   AYTHAMACTGEANGRPPASLKLILNLGRALTENGDLADARATFEAGCEMCPCASTWLGA
FT                   GIAMLRQGDLESAEAALAEANIQDHTNARVWGYLCLVALLSDRAPEAEQAIGSAFRCGL
FT                   SNDEWPLLGEIGKLFLEHGRWKHAEGALRRSVKHGGGADVRYALGRALHEQGDAAAARD
FT                   QMLAAVEQAEEAGDAETKRLLLESLRAVHSELGENEAAAAAVGKLKVMGVPTSPPPKKW
FT                   RDC"
FT   CDS_pept        join(490575..490625,490794..490849,491043..491085,
FT                   491223..491693)
FT                   /codon_start=1
FT                   /gene_family="HOG000233808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634002"
FT                   /gene_name="PSAL"
FT                   /orf_name="MICPUN_95054"
FT                   /product="Photosystem I subunit XI, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I reaction center "
FT                   /protein_id="ACO65512.1"
FT                   /db_xref="GO:0009538"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="HOGENOM:HBG440775"
FT                   /db_xref="InterPro:IPR003757"
FT                   /db_xref="UniParc:UPI000199BCEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC22"
FT                   /transl_table=1
FT                   /translation="MAAIASINAVARVAAPKVTARRSFLGKGVAGLAPVRPAVRSVVVR
FT                   AAAEKAQVIKPLNGDPFIGMLETPVTSAPIVANFLSNLPAYRTGVSPLTRGVEVGLAHG
FT                   FFLTGPFIKLGPLRSTDAAELAGCLSGAGLVLILTACLSIYGATAFQTPDVVGVKTLSG
FT                   RDIARDPVQSSEGWAKFTSGWLVGGLSGVAWSYFLTQVLPYYS"
FT   CDS_pept        492036..493532
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634003"
FT                   /orf_name="MICPUN_61267"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO65513.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199BCEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC23"
FT                   /transl_table=1
FT                   /translation="MPAPRDYVVVNGLRYVQPYFHTFDIRVSDKRVGSSVLAALDEQVR
FT                   FQGRVGDGREHWARELASGRVRLASDVRRRLPTGGEIPEEWFAAPVSLDAPVPPDSFFR
FT                   VVRHVHEPCVGCEVPRVLLEDSKLVFVDKPAGVPTLAGCGPKLQGENNATRLLNRTRAE
FT                   NATGADDGELFAVNRIDKPVSGVWILAKGSRLAARCRAALAKPGHETKTYLARVRGAVV
FT                   GPIRIDAPLSVGADGRATTSGGADAKPAVTLVHPVARYPPPWDDCTLVACRLERSGRFH
FT                   QIRCHLASVGVPIANDATYNESGAEESTNDSSTRAIDDGGGTEVYADDDDGTLLASITE
FT                   PGVFAATCLECGWAAAAAAGDRRAFDPRLRAACAAEWCDRVGRDGGTEWERAQDVKRRG
FT                   NVKRRRRERDGDGSGDDGSGDDGFGDGSAAERPRAGTSIDLHSAEYRIWFDGAEYKVRS
FT                   EALPAFAIRALGADATIDGVVDALPWAGEGLEAAGRARRK"
FT   CDS_pept        complement(493616..494704)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634004"
FT                   /orf_name="MICPUN_61268"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65823.1"
FT                   /db_xref="UniParc:UPI000199BCF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC24"
FT                   /transl_table=1
FT                   /translation="MGGMNADALLSRNAEILKLLDAATRARGDGAPTERELALAAEAEA
FT                   NIAALASAAPPRALMPGCSTSSTAPSESSNGAAPFKTFVEVARAEGLLRLPCDVPPRAH
FT                   VAPVANGQLPGVPVVPMVSGVEDVDDDVPGYVPRAADGTAFRKDETTGRLYYDGPNGDV
FT                   PRGDARVTYFAPAAGPPAGFQWHLVPGANRLRSRDEVRFYTRADVVSQDPLDAGAVFRF
FT                   DVRRPKLGHGVSFNIGAGEDGSPLLSYSKLRALYELPDGSKWCEHVDYYDLDDVRQTAR
FT                   AVGHKVWRRTVLLPDHDEERELVRVRGRRHTRMSKCEYESWIYTAEEYNREASSGGLTG
FT                   KEAFYWRVGFDPETIRQVEVRD"
FT   CDS_pept        join(complement(498025..498156),complement(494870..497920))
FT                   /codon_start=1
FT                   /gene_family="HOG000018865" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634005"
FT                   /orf_name="MICPUN_95059"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65824.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG385755"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BCF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC25"
FT                   /transl_table=1
FT                   /translation="MQSLPELEQLCNVLYNGHDPSERAHAENALRPFSVNVDYIPQCKA
FT                   ILDSATSPYAQLFATSSLTKLLTDNAGLGGQLKIDMRNYVINFLANKGNSLEGFVVTSL
FT                   VQLLSRITKTAWLDADNDAHREIVTEVMNFLKQQNNTHYHIGLKIFNQLVTEMNQQSPG
FT                   TSLIAQRKIAVSFRHNALLQIFQVSLQALQELQASQSSEARLKEQAASLVLACLSYDFV
FT                   GTSLDESTEDIGTIQVPSSWRSLIEEPATMQLMFDVYRDSAPPVSNVALECLVRMASVR
FT                   RSLFASETERNAYLQRLISGTAEVLARNQGLGEHANYHEFCRLLSRLKTNYQLSELVAV
FT                   PGYQAWINAVAEFTLTSLQSWQWASASVYYLLALWSRLISSVPYLKGETPSMLDAYVPR
FT                   ITETFITSRLDSVTAVARGEAEEDPLDDEERLQDQLESLPHLCRFKYDTTVAFLVRMLD
FT                   PAIAEFNQCTNMPLGSHPGNLEIVEGRLTWLVYIVGAVIRGRLSCSSAEPQETLDGDLA
FT                   FRVFQLIQVMDMGFHATRYGAESRQRLDLAVLNFFGNFRKVYVGEQAMHSSKVYVQLSE
FT                   RMGLHDHLMVMNLTVTKITMNLKSFAQCSKVVESSLNLLQDLAVGFMSGKLLLRLDAIK
FT                   GTLVAHTPEHFPFLAQYANTRNRTIFYATLGRLLFMDDSAEKFHEFMAPFGDLCDRLAA
FT                   TDAHTFRTHEVKHTLIGLFRDLRGIASAANSRRTYGLLFDWMYPRHTGLLLRAMENFAD
FT                   DPQVSTPLLKFVAEFVLNKTQRLTFEPSSVNGILLFREISKLIVAYGQRIMQVPPPKPG
FT                   SSEAYPLRFKGIWIALTVLMRALSGNYVNFGVFELYGDNALKDALAVAIQLSLSMPLEE
FT                   VLTYRKVAKSYFALVEVLCHSHMAVVAACDAPTFGHIARSLEAGLRSLDVSISSQCASA
FT                   IDNLAGFYFKAMNLVAGENPQRGSEELARHVQAQPGIFPDMLRTLFDIVLFEDCANQWS
FT                   LSRPMLSLILVCEHQYVELKAQIAATMPPAKRGKMEGCFEKLMSEVTRSLESRNRDRFT
FT                   QNLTVFRHDAKA"
FT   CDS_pept        498503..499879
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634006"
FT                   /orf_name="MICPUN_61270"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65514.1"
FT                   /db_xref="UniParc:UPI000199BCF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC26"
FT                   /transl_table=1
FT                   /translation="MTSTSLPKPRLLMPRYTDAQVFRVISAFLSRREFTFTQSMLAKEA
FT                   VAKGLVSAGDGDGDDDLGDEALGEHLAFLLAQLADEGGDEDAGEEDETGTDADHLERVA
FT                   EDAGGDDDHDHDHDSERDGEDREDDEHEGDAFAADAATEATEIDRKSIEPESNDGSRRV
FT                   RRKKTLAKEADEAAADAPDDEEPAEDDAIGDILADDEVDDLEDIDDDATHGANDADEDK
FT                   NTTATATTTVTKTTVAKPAASDAPTDATGAITNVGGDGGGEEDEVAQLRAAAARTRVGG
FT                   NKSGGGGRGGGGGRERGSRGSPKPEPPRGSQGGSAGGGGRRPSNLGGGRPNSGFHGPPL
FT                   PNGPPPMGREPPHMQRRGPPPAGGPRGPGPMGGRGPMPMGGPRNDPPPRAFPPMDDPGW
FT                   GPAVGRGRGGRGGRGPPMRGGGRGPPPGPHQGGRAQQGGRGGRGNLGGRGQKRKMAGGY
FT                   "
FT   CDS_pept        complement(500491..501303)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634007"
FT                   /orf_name="MICPUN_108885"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65825.1"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI000199BCF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC27"
FT                   /transl_table=1
FT                   /translation="MASLKMKVDELSRELAAKEAELSVKEAQAAEAAGNQSAINEANEL
FT                   IDALKAEQDKASAETARLRSELESVTEQLDAAKKNLEENESAAASLAEVTARVVTLESE
FT                   RNAAAAEIVTLRGELEAMRGKDDGASAEDLMYLKNVVVKLLEMPGHKDHLEVLPVLATL
FT                   LKFTPDETRRCRDGIMNGLAAEEDIIADTVGQGLEAVGSAVSSVTSMFSIFGSSSNSAA
FT                   AVPASPRAAPAAGGEGGGLRRVASRDASSPVAARPDGTGDAFNPFARR"
FT   CDS_pept        503830..505347
FT                   /codon_start=1
FT                   /gene_family="HOG000030600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634008"
FT                   /gene_name="CHP1"
FT                   /orf_name="MICPUN_107426"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65515.1"
FT                   /db_xref="HOGENOM:HBG608934"
FT                   /db_xref="InterPro:IPR007871"
FT                   /db_xref="UniParc:UPI000199BCF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC28"
FT                   /transl_table=1
FT                   /translation="MAGAAEGAPPAGDSDPTEPPRCTHVIVKRGKTKTCRQYAKPGTSP
FT                   PICGNHLHAVHPSDRIPCEHCGTPVLTREMKKHVGKCPAYLRVADAESMPYFARDANLG
FT                   SDDENVGAEPSSSSLPENEAVRLPRGEELRALVAKVRRACSDAGIDANTPTLEPMSDAR
FT                   CDAAVARLAAAAARASGGGGGVGGRATRIAPFNPRHARQQASIVSHMAAAGLVRVRSSD
FT                   VPHDDASRSPAYVELGAGRGYLSHFLMDAYGPNDLVLVERRAYRFKAERNIRGGTSVGG
FT                   GRAGTSGDGSAPASAPGASPGTKVERLRVDIKDLDIAGVEAVKGRDVVVTGKHLCGSAT
FT                   DLALRCCLANTNGGCDGDKSSAAACRVTGVALATCCHHRSDWRSYVNKPFLRDLGFGRD
FT                   DFPRLARMSSWACDGAAPGVGSVKRPRSPTGDVDEDEHQQPIEEADDGEMSKAEKHEIG
FT                   GMIKTLIDVGRLRWLNERGLSGRLVGYVDTGVSPENRLIVVSRGEGR"
FT   CDS_pept        join(complement(509864..509935),complement(505392..509741))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634009"
FT                   /gene_name="THO2"
FT                   /orf_name="MICPUN_107427"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65826.1"
FT                   /db_xref="HOGENOM:HBG315902"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="UniParc:UPI000199BCF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC29"
FT                   /transl_table=1
FT                   /translation="MASYPGIKATLVTGDVIGKIKAGKAVTGVDATKARRYLVELCWSV
FT                   LRDELDPSDVAPAIRGAFQDHAVASSNFADVIWLASLETEMLPDVRSKLVELAKALCDG
FT                   DRGGGEPLLTRELLIERCEGEFLEECGLIPSSVGWKKKEVRINTRLVYTQNKFNLLREE
FT                   SEGYSKLITALAEFGRSGDGVAAAAVRSVQSLIGYFDLDPNRALDLVLDAYEHAPTQDG
FT                   FMELLGLFRKGAHAQVLGFKFQNHAKASEAAANAAANRAEADDSDGEEGEEGEEGEEGE
FT                   EEEGEAAAGDAKDGGNRRKTADDKGDKPMRAKRRENEAEPIPETPASLYALAAKLVGAG
FT                   VVDLDALYAHLSPTDDAAVERHVANVETRLNAAKRIGAVNLLAKADDSKAESSAPDPYT
FT                   VAITPPNDPRDQKLGLLRGFLAVGDVDGATAMIGRLKNLGLDPAEDPEVQRALCETLKA
FT                   TIAECYGLAAPAGAKAAVEARGDTAGMEAPDAKGALMPDEAFERLRLLGPYVASDVALH
FT                   TRLVRCVRHHMIAASLAGDKEAAAKGEEAMGSSLIPALGLIHANPGAVFETWSVLELLP
FT                   VTTRFRLYSEWKSSFERDPGSALETRRPQFAAAKRVAEQDTMKVMRRLSKENVKEFGRK
FT                   LAKSAHGNPLAVMSSIAVQIEAYTNMIAPVCDAFKYLTPLGYDVLTFVIIEKLAEGREK
FT                   LKDDGQNVSLWLSALATFCGHLAKKYSAIELSALLQYLVNTLKDNQSLDLLVLKELITR
FT                   MTGKESLEDMSDAQVEAMAGGETLRSEAINFNNDMAPKARAKGVARLKEALQKGTLGGD
FT                   PLTVPLLVLIAQTRQAIIFKTDSKHLKLVSQLYDGCQETFFHYCDFLEQAFDDQEYAAT
FT                   VPSLKALVHDYGLEPGVAFHIYRPVLRHLKPRPTPSKDKSVDECNESVALDIGGVKMTW
FT                   KELLETVRGMLPEETWADISPELYLAFWSLTLYDLYVPRARYEAEVDKCRAALDVLDNQ
FT                   RDSGTRDEQAKRKKEKDRLKDLIDKLQKELDAQERAVAARTKRLMIEKDQYLVDLPNHG
FT                   NTVGRLVEQCVFPRCVFSHADAMYCARFVERLHLLDTPYFATVQHYNLTLTVVAQLVFS
FT                   CTEYEAGRLGKFLNETLTQLSVWKGDEATYEKECTAVSGFNMKFADPSSKKVSYEEFVK
FT                   LVYKWHLRIAKSFLSCLEGDNYLEIRNSLMVLTKVVKVFPAISRIGAHILRKVEKIKEN
FT                   DERGDLKTMAARYLAMLQREKPGWKADNHFNPYLPPDPKEKEKEERERKAKEEAASKGG
FT                   GGSKRGRGGDGKGGKDASLNADAQEFTPGKDNAKKEEKKKDERSDRNVRGGSSKTSDAS
FT                   NKKDDVGSKGSGGGGGGRGGDRDRNTRDVRGGSKDTVDNKGADNKRRRDDDRGEDNGDN
FT                   KRPRKSEDVSRGGGGRGRGRDEEPPPRGGRGGGRDTSRDRGGHQDDRRTGGGRNVRGGG
FT                   GGGGRPAPRGRR"
FT   CDS_pept        510524..511906
FT                   /codon_start=1
FT                   /gene_family="HOG000281563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634010"
FT                   /gene_name="DLST"
FT                   /orf_name="MICPUN_104943"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase "
FT                   /function="dihydrolipoyllysine-residue succinyltransferase
FT                   activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="oxoglutarate dehydrogenase complex "
FT                   /protein_id="ACO65516.1"
FT                   /db_xref="GO:0004149"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0045252"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000199BCF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC30"
FT                   /transl_table=1
FT                   /translation="MGDSITEGSIASVLKQPGDSVEVDEVIAQIETDKVTIDVRAPAAG
FT                   IVKDVLVKEGDSVNVGQAVCTLEEGGAAPAKKGGKKAAAKEAPAAAAGPTADIEVPPMG
FT                   DSITEGAIAALVKKPGEACAADEVIAQIETDKVTIDVRAPSAGIVEGWSVNEGDTVTVG
FT                   QAIARFTPGAAGAEPAAPKGAAAPAAPKADAAVLPAAKSLKPATPAPAAPPAVSPAASS
FT                   APAVGSRGETRVKMTRLRMRVAERLKSAQNTYAMLTTFNEIDMSNLMSMRTQYKDQFME
FT                   KHGVKLGFMSAFIKASARALKAEPAVNAIIDGDEIVYRDYVDVSVAVSAPKGLVVPVLR
FT                   NVDAMTFADVERSIATYGKKAKDGTLSIDEMTGGTFTISNGGVFGSLNGTPIINPPQSA
FT                   ILGMHSIVQRPVVINGEIVARPMMNVALTYDHRLVDGREAVTFLKMIKEAVEDPRRLLL
FT                   DL"
FT   CDS_pept        512252..515071
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634011"
FT                   /orf_name="MICPUN_102272"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65517.1"
FT                   /db_xref="UniParc:UPI000199BD88"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC31"
FT                   /transl_table=1
FT                   /translation="MRVLPAMLLALLGLASPFGINAQTYPNAATYPVQNSDGLGPGPDN
FT                   RAFGAAVHASDGKLFAAVNNTCGELFTTIPTSAGVTPTSSTLCLTESTDIDATQVTDRA
FT                   NHFAFANGVVVIGTPNRALKKGGADVWRWDDATATIQGPSALGSGDGRVGHMGTAAATS
FT                   GGDVIVLGAPKDDSSKGAAYVFVDYDKDNAWTRVPGRLLDPNGAAGDEFGAVVAVHNGV
FT                   GTGNGWIVVASLKSDSNKGAVHAFARAGSPGAYQWFHNQTLTPTPSSGTAPLGYGAGLA
FT                   ITGRYLMISTRPSAVGGTDVDAWGEVYYMAGPNAANRVLSVDAATPPTFVSDTGHWVRD
FT                   AELTASSSAATSSGACAVDGEMAVMGAVGAGDADGAAFVWRRQHAPDTGDVKWNLETTL
FT                   VSSAWTGAGAGWTFKGFGRAVAVDDGVVTVGVAQPLDGSADGKGEGRAVRFAGSIPTPP
FT                   SPPPPPQPPPLPSPPPPSSPSPPPSSPSPPPPPPPPSPPSPPPPPSPPPSSPPPSPPPF
FT                   PPRPPPLPPPAPSTRTGTHVDLQVRGAFITDGLNADETELLRQAIASTLGLMPGVEALD
FT                   VKIKTISYNATVEVGLVGIDSADWYDSSYASTAGNALRSAFANLTKTWEGDITVGTAPR
FT                   DYELRRRRRLLAFENAASTPYSATTGAGKKGKGPRRSLAQLSGSSSPLPSQVPFPPPPP
FT                   PAAPFPFPPPVPAPPSPPPSPPPPPSPPPSPPPSPPPSPLSVPLHVKLLTDAEIGEFKT
FT                   RAADALNPTRADGDHVTPDLAPLARLLNSSIAAGAFPGPLIDTYLAEPVDTGAVLGVEV
FT                   ARPPSELREDDAVIAAEVKAKILTNGGASLKSHLQRLGLATEGFDAFVLEKEITIFGPP
FT                   EPPMPPFPPPAPVSPPSPPRKDSAGISTGMIGPLIGTLAAAAFLFVLSKLAGGKKNRVG
FT                   DEKKARKRR"
FT   CDS_pept        515271..516341
FT                   /codon_start=1
FT                   /gene_family="HOG000082888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634012"
FT                   /gene_name="NMT1"
FT                   /orf_name="MICPUN_102273"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /protein_id="ACO65518.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG678689"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniParc:UPI000199BD89"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC32"
FT                   /transl_table=1
FT                   /translation="MSTKITVALDWTPNGNHLGFFVAKDKGLYDAAGLDVKIVSPADAE
FT                   YNGSYNPGDRDADAPGAPKYVTPCSKVAEGSAHFAMNSPEGVVGWNTAPGRPQLKAVAA
FT                   LLRDRNSSAIVALKSSGINSMKDLDGKRYASYAARFEGRIVQRMIQHAGGAGDYVEDTP
FT                   PMLGIWNTLLEGDADATWVFMQWEGVEAKLKGVELNAFPVCDFGVPYAYAPCLCAHPDW
FT                   LVANASAAKAFLKATAEGYAIASAEPAYAADALVRIAKRDHSFDIDPELAKGSAEFLAD
FT                   KFLDPDTKRWGRMDGAVWSEYVNWLWESGLLTTGMQSRHPDGGRTFSLDDLRAGNAGER
FT                   IALESVPVVFTNDYLP"
FT   CDS_pept        complement(516586..517356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634013"
FT                   /orf_name="MICPUN_50545"
FT                   /product="Copper/zinc superoxide dismutase "
FT                   /protein_id="ACO65827.1"
FT                   /db_xref="UniParc:UPI000199BD8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC33"
FT                   /transl_table=1
FT                   /translation="MLTHSEMPRVPVGALALTAGCATGFAAVHIALERACGRHYECDAS
FT                   HPTLSMTLRHSDVRRTVVPLLLASAACLLMADCALWATCVSDPRGGGLVSTHAALLAGI
FT                   ASLPAMVLTIDKDPRGQAHLDAAVAWSALRMVQGALALPAVWLCTRGSAPFAVVNAGRS
FT                   VLAVSLMCVGAKLCADAPSGDMDGELQFVAVRAVLAFHLSLLPEVAGTRLVLFGGGAGG
FT                   RRSCASIEASTRYIPGWNKDAGGSYSVRDEDASG"
FT   CDS_pept        join(517462..517524,517675..518202)
FT                   /codon_start=1
FT                   /gene_family="HOG000038832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634014"
FT                   /orf_name="MICPUN_61278"
FT                   /product="Flagellar basal body component "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO65519.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG562661"
FT                   /db_xref="InterPro:IPR010796"
FT                   /db_xref="UniParc:UPI000199BD8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC34"
FT                   /transl_table=1
FT                   /translation="MAKAEASFFTVIVTGQIEFADIPSCDNAYCKYAIVHGDDWTHLDG
FT                   PEDGISQITRKTSSGPEQKLVWNFPVEVTYKATNAFGWPQLILSVYEIDAMGRDIIKGY
FT                   GCVHLPIASGNFVRTVPLYKPLSASIAQQFINWATGRPAEFSNPKFPAMGEGREVTRVQ
FT                   STGHASVALNVITKDMATFGYSEAKGAAVRVAI"
FT   CDS_pept        complement(518327..520378)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634015"
FT                   /orf_name="MICPUN_61279"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65828.1"
FT                   /db_xref="UniParc:UPI000199BD8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC35"
FT                   /transl_table=1
FT                   /translation="MSAASPAPAFGQKSSRAMLKEEVQRHHLSAWRLHIKNVKTRRVRL
FT                   QSMRTRIFIRAWRRALHRWSRYAAARGAARRATHKSAEVSSAKVASRGVTEVFRTWRAR
FT                   VASSAQEARRVERATNRFRAVMARSARRALNTWRERVAFRKHVARAAAQLTPEQLAAAA
FT                   QAALAEPARVAAQRKLVAYTAGAGLVGWAVSWQSTGEETARARRELAKARDNHDKCRSL
FT                   REAEVDDLRARFRHAEAHAADLAKACESAGSTDARLESELKECLDRKHAEADAHAASIE
FT                   ALTQARDESVLLYRNQEYRANECQRRYVEAVTTTRVGVPNLAHLAKASLGVNLPSVGGG
FT                   ELVVPLSPGTVVLAMAGVIVVMLAWIVKMASRRSRLASTEAKLRAAEADSSRLRDAISE
FT                   MDMAAAANESERSRIVSAEVRAHVKDELDAATEVMSKLAMATEEAEAAAKTADARADLA
FT                   EAKLRNAEFELAETRKDLARLMEATSPDRRRPERDGAALDPDTPPPNGEPASPRSPRTA
FT                   VRRRGPRAKVFNPHRDFELLAELRGSIPTLQSRWREDEAYEDWEGVVIGWDGAEAGRVV
FT                   ELSLAECGIGERLPSQVFELAALRELDVSGNGIVSLADDVVKLASLRVLNAEDNDLDGL
FT                   PTCLVELTELKALRVERNEYVNLLASRKSSSAAALIEELRRRGCVVTA"
FT   CDS_pept        join(complement(521488..521563),complement(520845..521365))
FT                   /codon_start=1
FT                   /gene_family="HOG000264372" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634016"
FT                   /orf_name="MICPUN_113985"
FT                   /product="Bromodomain-containing protein "
FT                   /protein_id="ACO65829.1"
FT                   /db_xref="HOGENOM:HBG562663"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI000199BD8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC36"
FT                   /transl_table=1
FT                   /translation="MMAAPPVKVDPEVFVPPPARPGCDCQVCNPPGYTGQPDAPNSRER
FT                   LSSFQAYKLVKLEPDGTRRPLSSTEIKEFEKSHASQCEWNSSRGGQKQWQKQCLAIIKK
FT                   LRSQRKQAWAFNEPVDPVALNIPDYPDIIKHPMDLATLEGLLVSGAIETPDQFVAEMRT
FT                   IFRNSYVYNRPGSGDLVYESAEKLSLSFEKELLKM"
FT   CDS_pept        complement(521943..523328)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634017"
FT                   /orf_name="MICPUN_108888"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65830.1"
FT                   /db_xref="UniParc:UPI000199BD8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC37"
FT                   /transl_table=1
FT                   /translation="MDTIIKNLKVIYTQATLRYAYLVNEDLAAGTDWNEHQAEGFAFYN
FT                   NIAPYVKAKSATGHNMLENYFNPKVVPDSYNFFGYCKAKAVLQAADSAVWSAMGTFEDD
FT                   ITCPTTFPTEGVITTKAGSYVPVNQIGASLSFAGAIKAVTSLLDESVVYTTVKSKYNAV
FT                   GLRGEAGQKRTGEPYYASAIKFFKEADWVNKYIETAFDSSSTLATAARLEIIEKTARDN
FT                   VAVQAVISDLYKAQATTDADLSTVFWDHAAAKYLGPDITDANTDRSQTIYARADKRAAN
FT                   YGTLDSTGKFALANKAVIDELKAASTIPSRKTAYTKIVTQIKVIYAQCVLRYAYLIDAN
FT                   LGNYVEYQAEGQAFWKILAPWVNDVDENGAIYLDGIFDTARAPTHGDHFCHAKEIIAKL
FT                   NLPATDFGTLEGTAGIDCTGRTAPADAAAWLATAAPVSAAPATLRAGIFAALASVAAAL
FT                   LLA"
FT   CDS_pept        join(complement(528447..528536),complement(525541..528327))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634018"
FT                   /orf_name="MICPUN_61281"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO65831.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG562665"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR005108"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BD8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC38"
FT                   /transl_table=1
FT                   /translation="MEDVLRADYGDAAQKALNDAARAKSKPSSTARRERALAPELPAME
FT                   RDKPYRPPFWESKKFGEPYGDFNRVAKPKAVVVVPKPPAGVPTTDLKGRPVLRDNATMR
FT                   ASGKLSTGKTAPVAALAKKTGRLSVKEEEAVDAAYRHNLAVGNRLQELEEQMRSALKAR
FT                   RQLHCAERELLTNAFARVDPDKTRVVSVERFVEVWKSFGVEVTDREARAAFNKYGQTRD
FT                   GSLPYPVFTEALLVGKARLVGMSSEVRRGAFPLNRPAEEYQFHGKILYPQCRKGVFTPS
FT                   GWDGSPARRSCKAPDATMELTWVHGYARDCLANNLFYTATGDIVYFTAALGIVYDKDAH
FT                   SQRFFTGHDDDVKCLAISNARDLCASGQVGKYPYVCVWDPATCEEKKKLRHPAVRGIAA
FT                   VDFCRDAKLLASVGMDNNHTIFVWDWRAGKCAHEVKGHTDVPPKVYGIAFDPFGPDPTA
FT                   FLSYGVNHIKWWSKPEGSKTYTEESGKFAPAAKKHAVMSAAWLPSGRCVTGTPDGAIAV
FT                   WDSRDRKCVRVVRAHAAGPQVTREDGPPTHHGVRCLRLRADQKTLLSAGADGHVISWDV
FT                   SSGDLKEGSVLGAVPVKRRSGSDAPHPPVFRGLDCAPGSDVFVAGTHRSEVWEIDDTPR
FT                   VLIHGHSADLYGVAWNPAAPTEFATASEGEHVHVWCAASRKLQRTVALGSKARCVGYSP
FT                   DGGELAVGCKNGGVHVLDAKSLIRLKWMKTLAEYVTDVKFSPDGELLAAASADQRIDVY
FT                   ERKGGYKKIATCRGHSATVRHVDWCAESKILRTVCGAYEILYFDARTGRQVTANQRDTK
FT                   WATWTSVLGFDVMGIWRDGSDGTDINACDVSKSRRHVACADDFGGVSLLNYPCVVEDAP
FT                   CAVGRGHSSHVMNVRFSPDDDWVVSVGGKDRAVFQWRFREKTREIPKTAPAPWEAAEAE
FT                   LRGKARGAAAPGGTRGAAPWETPPALKQ"
FT   CDS_pept        join(complement(529241..>529542),
FT                   complement(<528880..529204))
FT                   /codon_start=1
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634019"
FT                   /orf_name="MICPUN_76195"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO65832.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199BD90"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC39"
FT                   /transl_table=1
FT                   /translation="GALLYGPPGTGKTLLAKAVATECALRFLSVKGPELVNMYVGESEK
FT                   NVRDVFERARHAAPCVVFFDELDALAPARGAGADSGGVMDRVVSQLLAELDGANAKSKM
FT                   LFVIGATNRPDLVDPALLRPGRFDRLLYVGVDETTEGRAKVLAALTKKFTLEPPSPSSS
FT                   SLEALARKVPRRFTGADMYALCADAWTRAAKRTVREREREKRDRGE"
FT   CDS_pept        531858..535238
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634020"
FT                   /orf_name="MICPUN_61283"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65520.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199BD91"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC40"
FT                   /transl_table=1
FT                   /translation="MPGHGVRESIHTAPALLLADSHGLNKAARLSEGEGGDKQDAGAPA
FT                   PSSKFRKRWQRAKFALAFRARDDAEHREAKDIAAAWDGASTSEDERSVANSDDPDEDDD
FT                   DDVNDENQKDATLAELRARAREELLAKEKTLCDAVPRRDPSDPSAPRITKIVWSFQNLK
FT                   RVPPGFIRLEGVRDGLESLDLSMNILTKAPSNLARCERLVELDLSHNRLTGLPPALARC
FT                   KRLHSLAVNGNRIKKLGTWIVDLPDLRVVRLHDNPMIDPPPEVSSLGVDRIREYLRAMQ
FT                   AVKRWDPERVVGFDRGGCEYSKAELSAHFRDRYVSEEEAERARLDALARRIPSNGTELR
FT                   HAVFKPAFFRRFTRLTRVDVSGARLESLPGSMAECEFLTTLEADGNRLGGDGALPDLGG
FT                   LKRLKRLSLRRCELKALPEWIARCGALEDLVAAENAIVSPLPSLETCASMNALDLSDNS
FT                   LRTLPNLPKSLRHLFASGNKIDDVSIVTKRCVSLETLDVERNKITSLPDDLAGLTKLVR
FT                   VNVRKNLLRDVDPPSMHRRASSLRSFRFSGNPLGAVPWWLPDVADDALEEVFVNERRAV
FT                   LDLRDIPGYQSVVDLGNRGLLHTPALLPHLPNLTQLTLSHNSLGFLPSHLSDLVHMRGL
FT                   RLDHNFLTFLPDLSKMKRLRELRVDNNRLQVLSPSVCKLAELESLYIGRNPISKLPDAI
FT                   TACVKLRTLWMADCQFEMLPLTLADVPKLENFYAEGNPLKFPEPSVYEEGGNNAVLGYL
FT                   RSIAQNEREQREMEKARKEKAERAAARKAAKAKARWGAIALSRGIAKVDDVSDESSDED
FT                   DPQSKSGEKRSKKKKGKDAEEKGSAMGRLLWRRVRAVVLDDGKRREEVEHGSAMNYDML
FT                   LRARAVTRSIRVANAEEEMADIVTGLEIAKEERDRADAYLLACVNDVKDKREKCEDQRE
FT                   LMRKYVSINGDVLKEMQFKLRDSKGVLVDAVAWKDRVDADVAARERALRKVDRELDAAR
FT                   AAKFEVKQEQAKRAQAKLEAKMRRKAEEAGVVRRQASRGSELRKKLEAEVSGGGLSLFD
FT                   SMGNRGGKADARDEANKAAAMAEAGSGKGAALSYMNEMGMEKGDEAASAAASKAWAKMQ
FT                   MLNRLGVFSKQNKDDGGDA"
FT   CDS_pept        join(complement(537489..537673),complement(535332..537312))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634021"
FT                   /orf_name="MICPUN_106035"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65833.1"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199BD92"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC41"
FT                   /transl_table=1
FT                   /translation="MASETLHEEVAGNVCDWCQTICDPAVQELNALTCSFAECPETSMS
FT                   YHQTCLEKYLKSIKLDKGRKTGFACPRGCGAKTCYDRPCPGRILKSHPIHVVNEEGKKR
FT                   RKAAAVAHAGDQAPKFGPAAKAAKAHAAEQAKREKELKMAKDAEKRRKEEERMAAAARA
FT                   RQADKDASKREHKAAEEARKLAEARELAAAAKRELQLARGGSGELRRSSLDKPARGPKP
FT                   GPTRGTDPSWDARDAFAPPPRSATISLSDLFGEVDVNSDAGGGGSSVNGSERDGGDDWP
FT                   SMGDASSAWGPRQQQHQHQQQQHQQQHQHLQQQHQQHQQPRAFPPLNAGGSSDRPPRPP
FT                   RSSPEQQAQIPGRPGSHHHHHPSAPSSSYPSAPSSSYGMTRTPSNVTMASSQGDANEHT
FT                   NAAGVFPPGVERAAASPILGDVGPVTHQRRACVRAMLRRAAKEQVERLRDMGFDEWRCR
FT                   LAVMRFGDDADGASMWLINHGEGDSVDGQTEEDARDAQLEGASNLDIDRDLANLREVYH
FT                   LGFDVHSVDEAVATCKGDLHLAVASLFQQQTFGVSGVGFSPGASHQNQHRTHAMQSSNA
FT                   PTRQHAGRHHDAGPATPPGVPSSRHSSWGGDLSGSGTGSDADLDPFAAAAAGGGGSLFG
FT                   GGGSGRSESRFFNTASAAGDDGGKAASGEASGAFGAGAASLFGGGSLFGGGGLFGNLAG
FT                   NGGGGGGGETWNGIAAANGNGGANGWQ"
FT   CDS_pept        538214..540877
FT                   /codon_start=1
FT                   /gene_family="HOG000100074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634022"
FT                   /orf_name="MICPUN_61285"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65521.1"
FT                   /db_xref="HOGENOM:HBG561426"
FT                   /db_xref="UniParc:UPI000199BE32"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC42"
FT                   /transl_table=1
FT                   /translation="MTEIAPNARLEPEDSGDLVPAVGVPDLLEKIGIGMPDRHQDASVA
FT                   KKEVLRSARDLPRNMTSRISRLDRLGYELENRIAANPNYPFELVVVFTSVVLVLVGLLY
FT                   HYLAARPSVAEFDVFGSDSWADGIYLALSLVIAAGVDSSVPDKLGLRFLYVSLVIFGLV
FT                   MFAAVVGFMTKKIDDFLVSIAEGHTKVAEDKHTLILGWNDATLRAVVQTCFLRRQYQQT
FT                   NERRFLHMFPFPWIKRFKFLLETPSTSLAVSNVVLMTNQLSKAEMQEQLEQILAERGID
FT                   PRRTKLGRDIICRVGDPTNVNDLIRVGAHKASAILIMMSKMDQVEEEESDGTIQNGATT
FT                   RVLLALRHVLFTNSYTSAPGTGLNPDLRVVVQMSNPSEYVDAACFAHDNGSPVVIPVDL
FT                   TKFSNALMFNCAAQPGLSAILLDLLDFEGPAIRRRIAKNLRSGPHNSKGDCIGKTYGEM
FT                   LRQFTTAIFIGIIRPGMSEKDMRSQGFGLCPRMDIMIEPDDLLIFIGPRVNPVHSYETI
FT                   GLFEEYAGEAMKIHNMHPQIEANRIENGPVNSKKKRNLLVCGWRSVWQQYPQRLRSRLN
FT                   EIIRQRLPGSIVIFVNAVTCEDFKKLMEKIELKPIGDDRYCVDHVSSSTEALWWKGIIV
FT                   KHVQGDAAEVETLRPVIMDHTIDAAIVLGTQANHNLAGRHRDTRVMNIILMLRKLWNEK
FT                   DEGVPMHIVGENTEDMTARLALAPPRRGQNRIHNGERFIEYEPDFVNQMAVIARALVQT
FT                   LAYPLIDSARSELFDDDPDSAQLATVHASEYVPLDTKLSYGVVRAAVLRARGEHSICLG
FT                   VLWADGTVDMLKKQDEPVNFVDDDRLIVLRRWAEGYQGADGVIGFQHKLADKKEELAEM
FT                   GGVGKERKFKGLRLFK"
FT   CDS_pept        complement(541046..542128)
FT                   /codon_start=1
FT                   /gene_family="HOG000264404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634023"
FT                   /orf_name="MICPUN_61286"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65834.1"
FT                   /db_xref="HOGENOM:HBG562668"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199BE33"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC43"
FT                   /transl_table=1
FT                   /translation="MPGDDAPATEDEELNTPEEKEAWLRAHGVEIESAEDRRKKAEAAA
FT                   AATRPLEHVEGVTRRVKYVRIPADDSEPFEQLEIILAQDAAGDQLPDILRPRFIGGGAI
FT                   NEKMAREQAIRQLGENGAALTGAALENASAQGSTETFALVRPSPTNGNTGVYLYLDEVG
FT                   MLKGLAPNARADGLARDCGFDGVQFYGDMFVGRIQAEPLPMRNVDFAVADLSVGSEWLR
FT                   AAAAENYRHNQQMSELQAAMKDKGGMTTIGFGGGSGDGEMPKGEGDGYRWSQTDDEVEV
FT                   VVDAGEGTKAKDVWAMFRPDHVKVVVNGETKFEVGGDKPPGLFRKVRPDDCTWTIEKGK
FT                   VVVTLQKTDEQLWHDLVAVP"
FT   CDS_pept        complement(542286..543404)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634024"
FT                   /orf_name="MICPUN_61287"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65835.1"
FT                   /db_xref="InterPro:IPR014990"
FT                   /db_xref="UniParc:UPI000199BE34"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC44"
FT                   /transl_table=1
FT                   /translation="MSPPIRRRAAASIKSPDARRTIPLSPLPRIGDHSAGTPLRSPVKY
FT                   AVTKNLAERAAAKDHKETHPRDKENASPSPKRPIASKYSSAQAWLDDATHATPPPAGMT
FT                   SDDYSSAKAWLADVKDEPATGWTRGDFRRWCSMKLGDGSSSVYWCIQGDLFEYPSGKLL
FT                   AKVEGIDVARSVVESDGDACHQLSRKLFVFRDPRTGAVMKQFDGKPVTHVQYPYQHITY
FT                   RRNAHGPVTTEVAMGAGKALTRMAGNAVEVRRIEGGAKACFTCPVFLDLDTDQGKYEAY
FT                   ENYDYFDDRDSDGDANRRTHRCVWTRFGPAAPMTEDGVLHALAWRVDTWREVPERIRKY
FT                   VEREAPTWRDAPRDMDEIKRLQREVKAPPFGM"
FT   CDS_pept        complement(543539..543892)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634025"
FT                   /orf_name="MICPUN_61288"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65836.1"
FT                   /db_xref="UniParc:UPI000199BE35"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC45"
FT                   /transl_table=1
FT                   /translation="MSLRRFRLRGTTRKVPFLRRPARASRVRSGAMTAARVVSAGPSGP
FT                   ASAADGPTSVEPRRPRARARRTRGLRPLEGSPEHLGSVPLVAVATWVLGVVVGYIVGVR
FT                   RGRKQRDDASTSR"
FT   CDS_pept        543976..>545340
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634026"
FT                   /gene_name="PCTR"
FT                   /orf_name="MICPUN_107428"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65522.1"
FT                   /db_xref="UniParc:UPI000199BE36"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC46"
FT                   /transl_table=1
FT                   /translation="MVAVHPEPPTEDAPVDDVDVERGDVVVSDVVSGDFDEDVADEETI
FT                   SPLPNLSTPDASRPGSKRTSLDLTVARVSIGHDARVADEHEQKLIDSMGRPVRFQSVFR
FT                   SMSGMTTHYGESPTGMHPKLSIVDEDAYGATAWTSREMRNVAFYTFIHVMAFAALSYGD
FT                   PNSWWHLHRPLGDVIGAVNDGVVTNPTFAGHFWRKIGVQTAVFWTILPSMGLLVVTRGW
FT                   NVGYTRKICHVVTYLTPLAFNLAWPTTEGEEYPPSVWVVSWSVWFQFCNFYLQIKPARR
FT                   RSTVCMLAFRAYDRAQDRPNTLTWIITQMVAGYLIILGLYAYCHEWRKDQLPAHAEYSV
FT                   LIPMVVNVFGDALAEPVGIYFGRHPYRVRAMWHKGRCCAGEFKRTLEGSLVVYAFTLAA
FT                   VAPCLKYRLFTQSQYAVNMVVLPPLMTLTEAIAPHTWDNPLITLVGAAFILCTYEF"
FT   CDS_pept        join(545672..545984,546104..546858)
FT                   /codon_start=1
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634027"
FT                   /gene_name="RFC5"
FT                   /orf_name="MICPUN_107429"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="ACO65523.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000199BE37"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC47"
FT                   /transl_table=1
FT                   /translation="MTEAAMDVDGGDAPQRQKASAVDANDAKKNQMWVEKYRPSKLSDV
FT                   AAHKDIIDTIGRLTSQDRLPYLLLYGPPGTGKTSTILAVAKELYGPQFSQMTLELNASD
FT                   DRGIDVVRNEISAFASTMRFGSNAGFKLIILDECDSMTKDAQFALRRIIEKYTKHTRFC
FT                   LIGNYVSKVIPALQSRCTRFRFSPLGPNAVKDRVQFVVRQENLQITDDAIDAVTRLGAG
FT                   DMRRTLNILQSSFLSKEGDGPIDANSVYATTGQPRPEDIEAIAGVLLNSNFKEAVAKVA
FT                   AIKQERGLALADIVRLLVEYVFRLHMPQLARANLVSDMADVEYRLAYVTHERLQLMALV
FT                   GAFANAREAIVAAAK"
FT   CDS_pept        join(complement(546983..549292),complement(546918..546947))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634028"
FT                   /orf_name="MICPUN_61291"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO65837.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199BE38"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC48"
FT                   /transl_table=1
FT                   /translation="MARRRLSRVKVPLRLVLPLVLLHAVLRANDLSLLHPEHWFAWSVA
FT                   ADAVGVESHRESRSAPTLPDPQELKARWMAELKPPKGAGIDIGSASKASSWKGFDGSLT
FT                   SGEGDSLDARIQKERAVTDDEEEEFEGDDPELVIPDPMPVLAHKVAKPETPSAFAALGK
FT                   FAVGDTVSACFATIEMLDFLVNWLEHASRLEMRNVLVIAMDKHTARWCDENGVARMDAS
FT                   DAIDKSEMNDPRVEVADVGYRMTRGFNLLGEAKTASIAKLLDMGLDVFLSDVDVVWLRN
FT                   PSDYFESGQLALADVAVTSDCVFGSERRRPGWRDEFGQDPEPTRASANTGVTLFRSNPR
FT                   AKAFVAAWRRRQRRTRETEPQHNDQQHFQFTLARSHGFEADTEVLKFDNQAPDGKSDKE
FT                   MFVDDWIRGFRPRYYYAHVGIDGDEETVETKVKVALLPTNLFPNGHLHFVAHHAAKQGF
FT                   ADEVYAVHGTHNYGGSPGKLGRFREHGMWAVDGEEYYFGDLKQKAPKYLKVRFTVPEYL
FT                   ADPTPNLAVGKGERPERHLNLLQWQIERVRDGLALANITGRTLILPPMLCTCDRWWYLF
FT                   QNCTNGVVTLPFVCPNDHVYLEPLMRKPEKMLRYREHTFLRQRREFAKRASDPRRLEER
FT                   AIRSVARLTFCEDGDGEGRCAPTPVEGIMTTLPGYVPDPETDSLLDAIAGDPGKDVTVA
FT                   YGSLAKHVMNALEGNEDADMLVVDGLGRGLNEGWDEGVTPFGGFDTQYMNQVFHKVTEW
FT                   ITESWCCYFHSMEDRGTEEKGAGCQG"
FT   CDS_pept        552084..552545
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634029"
FT                   /orf_name="MICPUN_108889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65524.1"
FT                   /db_xref="UniParc:UPI000199BE39"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC49"
FT                   /transl_table=1
FT                   /translation="MLPPPNLRTEADFARLEQELTAMREELAALTKDRDERRARLLRAV
FT                   QEDIESTVADTFESARFAEGLRAAAGRVTGGAPVRVETSVERDGSMANGASHALVLTGG
FT                   PARAAAVLDTPPLFVASLGDDARGMLGTTFGGPAGWLKDAESSSYVIKA"
FT   CDS_pept        join(553218..553472,553515..553762,554012..554111)
FT                   /codon_start=1
FT                   /gene_family="HOG000237936" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634030"
FT                   /orf_name="MICPUN_97858"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ACO65525.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG284653"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000199BE3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC50"
FT                   /transl_table=1
FT                   /translation="MKKMTNPMAAPHRVPVEAPDWPTVFKDPTLPTFIDVGCAKGRFLQ
FT                   RAATVDREVFEAAHGRHNLLGLEIYPPIVEDANLWTRTHDGAGAIGNLHFVACNANVSL
FT                   AGMRVPNVRMVSVLFPDPWSRRKHAGRRVVTAQFVNTLASALVEGARVYCCSDVRPLAA
FT                   EMQALWLAANPMGVPTERDLVCESKWRPVYRFVVRRL"
FT   CDS_pept        complement(554174..555319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634031"
FT                   /orf_name="MICPUN_61294"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65838.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000199BE3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC51"
FT                   /transl_table=1
FT                   /translation="MFGGGFGPIPAMMMRGMGGYGMPGMGYGGYGRGYGRGRRGGGMTN
FT                   PWFLMLAMQLWQQIERLPVKPPVTLAVMGASAALHFGFLNLPMGTSAAEMCLSAGAIVE
FT                   AGQFYRILTSFLSYGDEMHLIYNLSSFLWKGANLEIKMGSEKFTKLLIGLLVCTNAMAV
FT                   GVMYAMAAYLGMPEAYRNSCVMGNNGVNFALKTILFADEASNTSMLGITMPSKWASWAE
FT                   LGLMYLMYPHTAGLVVHVCGILVGLAYLRRRTILRTLGLENWLSSGVGAGGAGGVGGGG
FT                   GGNYARNERGAGAAEDRARAEANRGSPGGGGGGFFRRRTNAGANLEPGTRVALAGLNAA
FT                   SMNGKRGVVRGRDENNGARVTVVLDGGQTFSVKPENCVVVR"
FT   CDS_pept        join(555475..555569,555690..556755)
FT                   /codon_start=1
FT                   /gene_family="HOG000058039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634032"
FT                   /orf_name="MICPUN_61295"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO65526.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG753931"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199BE3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC52"
FT                   /transl_table=1
FT                   /translation="MEPENRKAEFEDAKAKAAEFLAKGDPQAAIDQYGDAMICAFDDTQ
FT                   RGAIHSNLSLCYLRLKDYAMAVTHADVAMALRPGWEKGYFRHGEVAFEQRDYATALKDY
FT                   EEAVKCAPNDAALNHRVKLAKEATEGFYFRQLLPGRDICVNAKNPVEAQIFGAAVQMQN
FT                   FIYLVGDARTRQCAVIDACWDVDGIIAVAKKDKMSITRAVATHYHFDHVGGKPPPPFDA
FT                   LGIEVPGIKQLEAAGLPVHVQEEDAVKLREIGVKETSMTLHRDGDVLRVGGVRLRFVHT
FT                   PGHSPGSMIVVVDGDNPGAPGGGAGIVVSGDTIFPGSCGRLDLPDADKERMFHSLAKCA
FT                   SSLRDEMTVYPGHNYNGASSTIAKEKRDGLLRPFTKTQWEAMMGGK"
FT   CDS_pept        complement(556847..557644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634033"
FT                   /orf_name="MICPUN_108890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65839.1"
FT                   /db_xref="UniParc:UPI000199BE3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC53"
FT                   /transl_table=1
FT                   /translation="MSRDSQRHDKLEALLAAELDSDAGLAKQTQINLAKDLILRGCGVD
FT                   DPSMLSEDFQYCTPYADPLSKDDYVAAMRAIDLKGAFPGGSLNARHFRVQWDSKVRGQS
FT                   YKVWCRTQFKGMHRGTLFFGRAIPATGKTVVGAPEIMSLTFNDRGKCERITAEYVVDAS
FT                   EGNTGGWGGIRGIMHAIGHPVPAPWTLHGKLCKTFPALMAWTDTTTLWAINAALFASIT
FT                   TGFGRPAVAAEAVQTPAPKGTSRTTKANKIAKIAHLPEELLPK"
FT   CDS_pept        complement(558048..558908)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634034"
FT                   /orf_name="MICPUN_50554"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65840.1"
FT                   /db_xref="UniParc:UPI000199BE3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC54"
FT                   /transl_table=1
FT                   /translation="MEAAADEGMAACEAIRAALASDDDRVAFDDAVFVAREILDLHDGT
FT                   PHDGTPTAPSAPTETETTEASHPLVLEASALREGGVDELLEIAGDVAAALERRATDAVD
FT                   AVRGAEGADARVSAATRLRLLDEADELVAEMRGECARRVAAFALVIVSHLRIAQSGEGF
FT                   AQGPTALGSSVADRAGETRAAVDGALRELEGYAKDAAEALRASTADVDAALGVMEVSSD
FT                   GSKNESSGFAPPVASVGAAAAEACAGTWVGIVRDVVADAAQCVVFPLVAASRSGGTEAQ
FT                   AAGGE"
FT   CDS_pept        join(complement(561962..562351),complement(560437..561861))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634035"
FT                   /orf_name="MICPUN_61298"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65841.1"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199BE3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC55"
FT                   /transl_table=1
FT                   /translation="MNPTSTGDTCTPPRHPAPRAERSVGDASAAPSPIVVGVRPDLVGH
FT                   NTFYTETLEPTVLELKSVGHSEVTRSSRQTPFRRDADQRTSSQHATRDMSVDAEAAPLL
FT                   VRDAGSPSRDRRGGMPLAILAAVVGLVLLGAAAAIATGGGTSAGAPALGMSWKVGDWWR
FT                   PGDRTTSEVAFKNPDPAKAAAIVKATTARAGVGQTQTNAAAAAAATDASQQQPQPPDTA
FT                   ARPQTPPADETPARLPAEAAAVPIGPHSTNPPLKPLKPLTNQKGRWKIVAFASSNYLGI
FT                   TKAWYERLTNLGYTEHVVAAMDDEIFAELARLGYRVEDHVVSPTEATEPGEPVRGWGRH
FT                   LWKLWRYRLAYVNRQTQMGRNVFLVDVDTMWNRKVDLSDLFDGTPDDSSADVFFSQGTV
FT                   YPHDAFDAWGFVGCMGSVAFRATPRTTALLKAAMEDCKAGACDDQVAMNGALLRKYGVD
FT                   WNRVTGFGHGTMAAPVANRLKVTDANAMNIKVRVWPKPFAFRSFMKDVRRVEMASLAGS
FT                   AGGASGVCLGQVEPAALGEAPITTGPKGAVVDYARPFIVAPLLDKDGDKKLEAWNKFQR
FT                   LCFVIDTPEYRRTALPQPTPAVPAASPQ"
FT   CDS_pept        562448..564007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634036"
FT                   /orf_name="MICPUN_50556"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65527.1"
FT                   /db_xref="UniParc:UPI000199BEDA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC56"
FT                   /transl_table=1
FT                   /translation="MLPPSRDEPPPDPHGFRDVIARRRKAAEDDRDRLRSFERACASSR
FT                   EDLRRTARELESTARHRHAAQLESLANALKRAREVPPAFSPSLIAVRWLWRQLMDAKRL
FT                   EEASELGAHASAVEERETTRHLANVDAENAARLASACVGHAKELQSLAASLASCERELA
FT                   GAHARVGRKLTRPGVGAGEARAGAQEAIKNGARWIAAAKKAAEDVASKSSERFARALLA
FT                   LETHTRRRCDAYAATYDAAHLPRDETTGEAAWSAMRKPGASVMKANGVDRAREARRTLR
FT                   EVTAAAAAGASLRAEEAARDARRRYRLERLSAGRGPNDAGGGDDDVEPTADASADANAA
FT                   ARRRARERAAADARWIEPSDEAEGIVPTRPEHEEVETGDGTSGGGTTTTNAAVPSNASR
FT                   RAPGNRATRLVGFADDRDGYMRGVGVEAIVATTAAIEANAARDEDDGDDGDDGDDVGPE
FT                   GIAERRRRRWFDLVDDRLGRALWRRRSGMKLPPPRVEPTGKRADGVKPRSSFNLARKRT
FT                   HV"
FT   CDS_pept        join(564914..564998,565166..568182)
FT                   /codon_start=1
FT                   /gene_family="HOG000218210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634037"
FT                   /gene_name="CLP2"
FT                   /orf_name="MICPUN_61300"
FT                   /product="ATP-dependent clp protease "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="peptidase activity"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO65528.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000199BEDB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC57"
FT                   /transl_table=1
FT                   /translation="MASVPGARPAFGRELGSAAGSGFARGSHGTSGFATHRRVVKVRPD
FT                   SRAICPGESKSQTAEERTQKKNQKLPNDATRRQTLTRNAPFSPHALPHAQARGELVVTA
FT                   VFEKFTERAIKAVMLAQQEAKALRRPEVGVEHIVMGLVAEEAKKGGWLGTGVTIDSARE
FT                   KAKEIVSFDKDRAARRTSTSEVPFSRGAKRVFEAALNNSTNMGMNYIAPEHIALAVAEL
FT                   DDESLVKYFEMLSTSRTFVKNEAERRLKTEKEKESGPAARPNTSLAPRQRQQQASQKDE
FT                   KSPLNDFCFDLTQRARDEKIDPIIGRDEEVERVIQILARRSKNNPILLGEPGVGKTAIA
FT                   EGLALRIVSGNVPEFLREKRVLSLDVGLLMAGAKERGELESRVTGLIKEIQDKKDVVLM
FT                   IDEVHTLIGAGAVGKGGGGGMDISNMLKPPLARGELQCIGATTVDEHRKYIEKDAALER
FT                   RFQPVMVEEPSEEDAIEILFGLRERYEAHHMCEITDDALIAAVQISSRYIADRFLPDKA
FT                   IDLVDEAGSAARIKQYMAQKERRGEVDKATSMEAMEMWRALKQVSEAKEAAVRGLLFEE
FT                   ATLLRDREREVKTNLSKLGVKVDELTGDGAYGGAKVTVDEIEAVAAMWSGIPVQRMTLD
FT                   EQAILANMDQDLQGSVIGQEEAVSAVSRSLRRTRCGLKDPNRPIASMLFAGPTGVGKTE
FT                   LTKRLAEKYFGSEDNMVRLDMSEYMERHSVSKLVGAPPGYVGFGQGGTLTEAVRRKPFT
FT                   ILLFDEIEKAHPDVFNILLQMMEDGRLTDSQGRVVSFKNCLIVLTSNVGSKVIAKGGGG
FT                   LGFQLQDDDEEGSAEYKRIREKVLDELKNFFRPEMLNRLDEIVCFKQLEKESVQRIARL
FT                   MLRETAGRMRLKGMEMALTASAMDKLLETGFDKEYGARPLRRAITSIIDDNLSEAMLRG
FT                   VIHEGDVAVIDYDRSSDQFEAAAVDATAAAMGVKTFKGAANTENTYYGVSVTGVRGDPA
FT                   SQGFDVQWTSVGLDLEGEDFDIHRQVANNISTRSSSPVPVNELP"
FT   CDS_pept        569062..570015
FT                   /codon_start=1
FT                   /gene_family="HOG000265583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634038"
FT                   /orf_name="MICPUN_61302"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65529.1"
FT                   /db_xref="HOGENOM:HBG562680"
FT                   /db_xref="UniParc:UPI000199BEDC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC58"
FT                   /transl_table=1
FT                   /translation="MAEQVPPRMDIAPRDAPARRSGGIVSSLRRWNPTKTPKTTVTLAL
FT                   YLFGLFVAFVARPPVTITDQMQTRYFEMMDAADAMDAAPRAEAERLLADASMARYRAET
FT                   WGWRFNSERKAKVYELRSLEKERFKQAEVYRKRRDAAVKEAKGELGLWSQLGIDEAKAL
FT                   FRKAYERGKLFATRSSYYDTFWLIVAGRSDDSMVELLIRWGFTVLSNFTVGMFSAVINF
FT                   AFALPSMIATFASTGWVSALAFFLVAVVAASSVAASLLLLLFGTAGGVVYGAVAAGPAL
FT                   ARLEASGRERERIRMIAQQRRRGMSGAAAHHREHAD"
FT   CDS_pept        complement(570150..570623)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634039"
FT                   /orf_name="MICPUN_61303"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65842.1"
FT                   /db_xref="UniParc:UPI000199BEDD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC59"
FT                   /transl_table=1
FT                   /translation="MDERAALVGGREATHSRGDSAVSVSIAPELSGDQHRLEAGQAHQR
FT                   TSPWVRALLLVGLVALVVTCAALTREDIASRRVATPRLVSPDLEPSPAPDAATTHGKNM
FT                   RGDGKEHRVARAGRREESKESKRRPDEADYNYIDGEWAYDYEQWDGEFRTVDE"
FT   CDS_pept        570953..572395
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634040"
FT                   /orf_name="MICPUN_61304"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65530.1"
FT                   /db_xref="UniParc:UPI000199BEDE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC60"
FT                   /transl_table=1
FT                   /translation="MDARGASPPSEATSSVAEQCRRESHEALFRARSETVDGDDDSFVC
FT                   DAVFRDAQLTCRIASATTRCRLARAGASPRGDCAAMTDCEKCVVAELGKGLAYVEDAES
FT                   TSSTWSGAAARALAGAFGRVSRASSSSKIDDDDDDDRAGRIDRNMEWSVHLQEVESVRH
FT                   ECRHAELRWRNERTARALLEIHRAAEVAESESSRRFERIAETTTAVAETVVAARAEAEA
FT                   LGAKLDATTIRIDDVNDALVAARAAHEAHDAVTRRGFDGVHAAVASAKEGVDTIAARVD
FT                   AAAETAASLSAHAANARESLDAVRDAVAWLVDSRVTVREHAWRFVSYAAVVAALGARES
FT                   AIAAAATVAVVGFLAPFLETEFGVRIFPTDDVDHFRAKSTWALFATLSAVAKLSVLVLA
FT                   ARRARVGCGNEAAWRRRMERRLETVAADVAAMRRERCDAGAAEARDATVGVGVAVVVAQ
FT                   PVKESAVDGVRRRRSTRRRVRA"
FT   CDS_pept        complement(572682..573176)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634041"
FT                   /orf_name="MICPUN_61305"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65843.1"
FT                   /db_xref="UniParc:UPI000199BEDF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC61"
FT                   /transl_table=1
FT                   /translation="MRAPLVALALAAFLACASALPTPFASPLTDRAPRRHLARALLQDD
FT                   PTTATDAASTFNAVRDVVDSVESSFDSVYETVKSWGPSSAPAAGEPEPVDVDEEEGQLE
FT                   LEPAEAPPPDRRRAILQYDDEYYSDYFAAAPEAAVEDYDYGEAGAGPVGAPAPAPGPYG
FT                   G"
FT   CDS_pept        complement(573444..574280)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634042"
FT                   /orf_name="MICPUN_61306"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65844.1"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BEE0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC62"
FT                   /transl_table=1
FT                   /translation="MPVVDDDTPTVWVIWGSQYVAKALVALDAHGIKHYVRRGKLGTGG
FT                   LEDLPGGGKLVPVLTAGNDVVVPDSEAILRWAEKTRGANLYPTAQCAEWSERASDGFLP
FT                   NAVLYYNWIEPKGYARSMRAKFASFVPWYAGGGTCIAGYLVDWGTAKKRAEFAEKALPE
FT                   LSKHPDVGTLEGRADAVAKEHVIREALVKELMHFQSGLANDAAGYLCGGEAPTAADCSV
FT                   FAQLERLVGSMGDAAVPASVPGLLDDTRLGAIKKWREMMVEKHPIRYGGKRAPTAK"
FT   CDS_pept        complement(574451..576883)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634043"
FT                   /orf_name="MICPUN_61307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65845.1"
FT                   /db_xref="UniParc:UPI000199BEE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC63"
FT                   /transl_table=1
FT                   /translation="MDDRLLASGGRVQGVALRTEADFFAQLRASPSAATPVPGSSTRRA
FT                   LVGAGSPDITTPEIDALLEKLARGSPSELVDHDAPNNLPPSASKRAAVTPTRAAAAAAR
FT                   RSPKSARGGRPRWTSARPDQHGVWVPVEQMPKPPPSFAPHSSATPGRSTPTALVGDVVT
FT                   RVADTGERVQYVTPKRHSSEPDEADGDPNPKPNSHPRGIPEPDVATGAALYEDFSHERD
FT                   HPNLPYSRLPVFERLYRRIPEGQRKKFAFSPGANGSATNGAYSPSTDGAGPAPKELVEK
FT                   RREIESLRAELAAREKSETAGDASRRTARALEAARRGTPNGLPPHDDDQTLDETFDGTE
FT                   SDDEREEAALARAEAAHIARLAKMHGASPHKSEYSATRVSARPTDVPVVRIEDDPESVA
FT                   WELSASFDQTSKPPWQERLRVAEERRAAKAAAWEEEVRERADAKRTNDRLIAEAEAELE
FT                   ALRRKRADVVARQRRRRALALARADPKNLPRKRSPWGMAGSPGTIDNIRNMSPARGGPV
FT                   GTRPTFDWTSPWRAERSSREVARTNVSTPDRRTPASRPASALRPPRGGGRSPSSAARPA
FT                   TAPSPGGSVARILADAAAADSRRANSAQPYNRARLYASPSDAARAAAERVRARKRAQEE
FT                   RERRAAAAAAGPGPARRARKAPAPAPARREATAKARKPPAPAKAEAPPLSWVTVPLASA
FT                   DPPGTKPPTRRELYPTPPTPPRAKPPPTPPRSPARGTGSEARRWAEASTVEKLSDEVHV
FT                   VKRLVKDQGVHLFGEVEGMKQQMGAMFEMMERVLGKIGDVGGGSGAAKAPGSPFVSG"
FT   CDS_pept        complement(577026..578330)
FT                   /codon_start=1
FT                   /gene_family="HOG000240556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634044"
FT                   /orf_name="MICPUN_61308"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO65846.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG286166"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199BEE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC64"
FT                   /transl_table=1
FT                   /translation="MLGGSPGIRTSPTARSARRARPVAVAARSDAGSNVPGALSVADLA
FT                   APVLKSHGKTVANEIALVSAKSAAVVAKDPAKAPAPTVAGLPVTHVAGGALAAAGAALA
FT                   LKNIFDRPSRAYVSGPEDGGLGTVGEEYDAWTEEGILEYYWGEHIHLGWYSDEDMAKGA
FT                   GTLLGSNVKNFIEAKFDFVDKMLEWSECPPEPARVLDVGCGIGGTSRHLAKRLGPNSQV
FT                   QGITLSPNQVKRATELAAEQGVPNAKFQVMNALAMDFPDDTFDLVWACESGEHMPDKKK
FT                   YVEEMIRVLKPGGTIVIATWCQRETPPEFTDVEKANLKFLYEEWAHPYFVSIEEYVRLM
FT                   EGTDKMATVGSANWVKNTIRSWRHSIWVGVWDPWPVVFKGPRIWYKTIREIVTLERMHR
FT                   AFDCDLMTYGMMKGKKKPAATVNAASDTVAVGSEK"
FT   CDS_pept        complement(578787..579704)
FT                   /codon_start=1
FT                   /gene_family="HOG000242152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634045"
FT                   /orf_name="MICPUN_50561"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65847.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG409786"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199BEE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC65"
FT                   /transl_table=1
FT                   /translation="MAATARTLAASVSLAARPVAAPRRAAARAPARSASVVVKAEGATA
FT                   EATDVYEVTLPKSVALQLKFARGNDGGAYCVFVPDETEFDAFEIGDKILAVSASFGDEV
FT                   WDADSYGQVIYAIKNRNGDIYLKMKKMNGDISALEQSEKSSAMKAERAGGNYGAGTKEM
FT                   QMQNYSKKKELEVQRLDMFDEAIALYNKKDYDNALIIFEEVAALEPKNFMSDNFQTATE
FT                   VYKVTMYNIACCFSKLGQLDNSLQALKKCMGAGWTDYKKIRTDPSLAEVRTSPNFKAMI
FT                   DKFDEPLINENAIKFMKGIFGGGK"
FT   CDS_pept        <580154..>580921
FT                   /codon_start=1
FT                   /gene_family="HOG000006721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634046"
FT                   /orf_name="MICPUN_76094"
FT                   /product="Predicted protein"
FT                   /function="omega peptidase activity"
FT                   /biological_process="glutamine metabolic process "
FT                   /protein_id="ACO65531.1"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="GO:0008242"
FT                   /db_xref="HOGENOM:HBG597677"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR015527"
FT                   /db_xref="UniParc:UPI000199BEE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC66"
FT                   /transl_table=1
FT                   /translation="RPLVGVLSQPRYWTGAPDAPGGYIAASYVKWLEAAGARAVPILYT
FT                   DSNETIHGKLSSVNGVLLPGGDSDISPGTSLRAAGESVVRESMAAAAVGETYPVWGTCM
FT                   GFQLAALAVSGDESIFRTFDGPDMTSKLRLTKAAKSSRMLRSIPPDVLAHVTTNPKSIY
FT                   ENHVHGFDPGDWKRDARLVETFGEPVALDVDRDARPFVALVEGRSGVNVYGSQFHPEKP
FT                   LGEWNPRLAIPHDEGAVRVAQSLANFFVGEARRS"
FT   CDS_pept        complement(581113..581625)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634047"
FT                   /orf_name="MICPUN_61311"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65848.1"
FT                   /db_xref="UniParc:UPI000199BEE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC67"
FT                   /transl_table=1
FT                   /translation="MMADDTPPWFIKTTHTAPKPMSIHAFKMALLQKRLAVTAADEDAP
FT                   MIKAELNAASNKRMQKELMEKYANAAEDAEDTKEAAVRAREKSEQLRREYKDEKDAIRQ
FT                   KGAREQETRAKALQDREAKRAEQKRKLQESVSSLETKRTKNLLSLKQVLNDHKEAKRSL
FT                   EDAPPAM"
FT   CDS_pept        join(complement(582140..582254),complement(581772..581980))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634048"
FT                   /orf_name="MICPUN_61312"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65849.1"
FT                   /db_xref="UniParc:UPI000199BEE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC68"
FT                   /transl_table=1
FT                   /translation="MGERRDLHERLLNLPRDTFFVFSLVAAHHGEDNYLLIISVDTTLN
FT                   AHGTESATCLKRPVMPWACFLLQLRRVTLLPATGAPARQPVWGLHSTESTGLPPVDSTL
FT                   LTD"
FT   CDS_pept        complement(584234..585025)
FT                   /codon_start=1
FT                   /gene_family="HOG000230829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634049"
FT                   /gene_name="PACRG1"
FT                   /orf_name="MICPUN_50562"
FT                   /product="Ciliary protein"
FT                   /function="binding"
FT                   /protein_id="ACO65850.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG525259"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019399"
FT                   /db_xref="UniParc:UPI000199BEE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC69"
FT                   /transl_table=1
FT                   /translation="MMHRRAGAHPKIDAPVPKYEARSMTHRWPTDKGRTSEFLRKGDGD
FT                   RIKAGVLRKPKPDIGPPKAGAFKPRDNPPNSLFRKVYENGDLPVAVSTGTKNEIAWKVE
FT                   RVDKLDYHHYLPIFWDGVREKEEPYRFLAVKGVEDMLKAGGQKILPVIPQLIVPIKTAL
FT                   NTRDPAVVCIVLQLLQKLVVSADMVGEALVPYYRQILPILNLFKNKNVNVGDAIDYGQR
FT                   KRTCIGELVLETLQLFETYGGEDAFINIKYMVPTYESCINL"
FT   CDS_pept        585739..586149
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634050"
FT                   /orf_name="MICPUN_61314"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65532.1"
FT                   /db_xref="UniParc:UPI000199BEE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC70"
FT                   /transl_table=1
FT                   /translation="MRASSRPTGETPKDEDEPDVLIPEGVAWTSTEDRRMVEALRRRAR
FT                   VISQLKLQRSRVSVGDYVSDEVTKFRGERFRIERQIVAMRKDLEARTTLGRFEEAKVLK
FT                   KSIADAESRRDGITRAIEAEQTRLLRRYDEEL"
FT   CDS_pept        complement(586272..587855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634051"
FT                   /orf_name="MICPUN_61315"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65851.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG562691"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BEE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC71"
FT                   /transl_table=1
FT                   /translation="MGVVGADDAAERLTELILAACSEVVGPELSRRVLALPKERVRPSP
FT                   KASAGGADYRCHAPVTVFRKLDAMTPASRDASGADAPEPPASPTEPGTMRASRRPNGAI
FT                   DVVVVSALGVARHRTYADATQIADAVIEAMDPRALSELVADVRVELGGSGGSGRPDHPA
FT                   ARLDEDVSARAAKRRARSEGIGRDGCVGTIALLTKRRLLENGANGALLCRRCGHMFAGD
FT                   KGLATHQQVKHGRSYESAKAAVAESRVALVATNQSAPCTSSPDPSSPSANPSTRESQRE
FT                   KRVKEKGSPLPPGLAAARDGDLDALRQLCARGVFDPRTCVDRHGSNALHWAAGSGHLHM
FT                   CKHLVDTCGVDPGSTQVRDGRNAMHWAARNGKTDVCEWLWREKGVSVDTPTIDGTTAFH
FT                   WAVWQGRSATCDWLVNVASCDWRALNQFGCNAAQWAAQSGDVEMCEWLARLGLDMTLLN
FT                   NNGHSAVHKAAVKGRRETCEWLLDVGGLGADHVAPDYHDGMTPAEMARLEGHDDLAAWL
FT                   REREDGFKDV"
FT   CDS_pept        588002..588847
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634052"
FT                   /orf_name="MICPUN_61316"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65533.1"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BF7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC72"
FT                   /transl_table=1
FT                   /translation="MAGIVAGGGIASAHARCRPRARARNPARPSLARAPAVDSHPGSPA
FT                   VPAHHQRRTTIARASFGDPGYWDDVISLMTPSVSVNLGPESLAALAIGGVLVLGHSWES
FT                   IEASRGWRSAKARKEKVEAANATTATSSSSTAAAGTTKKPRTTAAAKPMTKAEREAAVA
FT                   EAKAERAAELNRRRADPPQPVDECEIVVCTNNACAKRGARELKAELERAVGATAAPNGS
FT                   NRGARCVVKGARCMDACGAGCVVRVVGVAGLETHLLVDASEAGVVAELATGRAAVDVSL
FT                   "
FT   CDS_pept        complement(588962..590062)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634053"
FT                   /orf_name="MICPUN_61317"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65852.1"
FT                   /db_xref="InterPro:IPR019352"
FT                   /db_xref="UniParc:UPI000199BF7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC73"
FT                   /transl_table=1
FT                   /translation="MASTGAAAGVPSMRATETDSITITPRGVCATAVENRHLVADSSGG
FT                   VCPPLALDAATGCCLEPKRVVSKEMCAESCSERGCCDAYAACVVCCHDDIARRIAGSEG
FT                   HDPIELAGFTPMHPAMWRRWLITHDPNGVRKLEGEPTRGETFAGADDHAVAPFDYCKHR
FT                   CRTNSGVTKYENAFQDDRHHCFRETYVETVGADDTRSPGREKNHDEAGDWKIAPDGRVV
FT                   ALGLAKIQPRPSDEVNGGPDVDDTDAFSGDKGTLGGLVSDGLASVTSLIGGGGGERGRA
FT                   GDRSARDSNRGPERSQFGEPRVGGAAKQSWVFDSLARTAGSLRGYATGGDVFTTVLEFI
FT                   AAMTALAVFACCCLLRDGDVRRAVRM"
FT   CDS_pept        590302..593088
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634054"
FT                   /orf_name="MICPUN_61318"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO65534.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199BF7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC74"
FT                   /transl_table=1
FT                   /translation="MPPRRKPAPRSNGSDAPLTRELACAVLGVPPHCAESDAKRAYRNL
FT                   ARAFHPDKGGDARRFQDVQRAYEHLASGWRRDAEARARAAESARRTVKSSGGAWSAKSS
FT                   KSTPGDEGPPSEMDSGAENVASSTTAVMPGENLAELGDEALRAGDFARAVECYDAALAY
FT                   ARLDDYASVHRSRAIAHAGLGQWEHSCDDADRAIAIRGLWLEPRIIRAEALERLQRWTA
FT                   AMECYEAASEILEGRGRGGSSHPGGGKGGDGEDDVRGKIAAGIARARTALAARSCVAVV
FT                   PAHKTAVTAVAFAPRWAAIETNEQHGEKGGTHEHDQLLATSGADGAVSLWWIPNGDLAA
FT                   SLTRGVDGTTNGEHPVTALAWAPREVDGRLRLAAASVTGALSLWHLARTRRDDAGSGTA
FT                   GTSKKLSVEVAKTFRLYGPNGGVASIAFDLESRQIAVGLDDGDVTVWSACDGNVLRAPR
FT                   RRHKKTVNCLAFHPSGWQLASGSDDGAARVWDIAGMTGADPGTCQHTLKWSRGPITRVC
FT                   YTACARMICTVSATHLSKDGGEYRLLAWSAVSGRLCQWFDAHKGPVTSMSWHPDAVGAR
FT                   NTLVTGCEDGVVRLWSITGAPRGAGKPVHECYEFHTSGGDGEEESAGRWNAHAHTVAEA
FT                   KLRAWSMRTRGGPGGYAAASGCATCVQHSPGGGAVGTCHLDGKIRVVDSRTFEVRCEWT
FT                   LGSAPRACAWAPDEVKLVPLAKERDGSDSDDGSDSDDSRADSDEDDANDKTDAVPHLLL
FT                   VTGGDDGVVRAWRVPVNKCGEDRATWWDRERGVSDAIGPGDERREARLPSTAVAFAMAG
FT                   GDKDLALTTAYQARGEDPAVAARAAEHLDELRRLYDEVEDEIDELVERRERVVAEDFPE
FT                   MTPKARRRVNQKHAEAMRPLRERRGRLYRMIKQKGFVEAEELEKEDYEEAQPPALLY"
FT   CDS_pept        complement(593154..593870)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634055"
FT                   /orf_name="MICPUN_61319"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65853.1"
FT                   /db_xref="UniParc:UPI000199BF7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC75"
FT                   /transl_table=1
FT                   /translation="MASTSMTTGPARATSLARISPPRARCASSAVTAKRAAPASSAARV
FT                   ARSCLRTFRIGPPGLSARGDLLWMRAGATDGAEEPGSTATPVEDAAPDADEPAGGIVGW
FT                   WRDYNARAKDMASQIKALGLAGFTAYGIFNTAYYTLAFTTAWSIRSVPSNIGIAATWRI
FT                   AGEVMALVWAGSQVTKLARAGMALALAPKIDGFMNRWSEKWGKSKEFIFVGITLGCFLG
FT                   SAAFFAVLIVLKAQFA"
FT   CDS_pept        593996..594934
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634056"
FT                   /orf_name="MICPUN_61320"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /protein_id="ACO65535.1"
FT                   /db_xref="UniParc:UPI000199BF80"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC76"
FT                   /transl_table=1
FT                   /translation="MDAEFFGAPAWAWVQLCAAVFAISTAGVMFQQLPHVPPLLLASWR
FT                   MQATALLLAVGAASEWRVADGDVRARWFKTWPRLGFSGVCLGAHFGAWVAGLQTTTLAR
FT                   SLLLVCTTPLFLAFGALALCLPTSAGELAGAALGFCGVAMVASDRHDGERETATWQGDV
FT                   LSLGAAFYIVGYMLVGADVRRWMPLCMYAGPVTAVAALCTAVVSYLVEDTRGSGGVLGW
FT                   AFSGFSSHFLVTMYLALVPGLVGHTGYNAVLKHISPLVVSTSLTMEPLLGSALGYAVGL
FT                   ADAPGWRTGVGGVVIVASVVIVIVAKGRNPR"
FT   CDS_pept        complement(594994..597186)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634057"
FT                   /orf_name="MICPUN_61321"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65854.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199BF81"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC77"
FT                   /transl_table=1
FT                   /translation="MSSPSDPTTPSAEADTPRVSLTQLRGRMKSASKMKRDLAMRRRLY
FT                   GVSPDHQSVRVSKTPGVADPEERHCLVISMNNTYRKGWDFAQAFILLYVGFVVPFRVGL
FT                   DEPAMGGWFIVDLLVDLYFWIDILLNFFTSYYDEDRGEEVFELAAISARYTRGWFWIDV
FT                   AAGLPLDSVERMQNGTFWCSFNAGGCTKEGDGDGGFQIFKFIKLARMLKLLRLFRIKRL
FT                   LEKYEHHFVHYLPWVDFASLIGLLLFLGHVFGCFFYFFSTKDWWSDSEKERLGEEDTWI
FT                   YSQFGVTPEDHGVWTRYIAAMYWAFTTMTTVGYGDISATTVAERLFAIIGMIAGGFVFS
FT                   LLIGSVAGVMSASKRREVAMQTKLSLVTSFLRDNKVPHALSSKVYQFARLSGVGSQLES
FT                   ERVIRGLPYGLRRELMSLLFRDLVASNPLFVKMDDVLFTTECCSRMTMMFWPMHDVIYR
FT                   RGEIASGVYFVVKGLANIVKAGEEEKFTFKTGGLPNEMVERIMLPGSYFGEGSVLGFKR
FT                   RNRTVTSRTACRFAVIAKEDFADLIDMYPRAYKILAKNYLLRVKAQKIDLKLDADDEDA
FT                   KDPASPADVTLLAELRRSDTSSTNANEDADTLDAKLDRLSGEREAVVSTRAIQNADKDE
FT                   SEHEKSGGADEDDDDAVFSEEAVELNDARVRRVGETGPRGLAAFRPTRTNSALRRQLQA
FT                   TESVDGSSSSDGEDGDLAFDTRRAEAVRARRDAKRL"
FT   CDS_pept        join(597376..597378,597555..597596,597771..598055)
FT                   /codon_start=1
FT                   /gene_family="HOG000232033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634058"
FT                   /gene_name="ODA-LC7B"
FT                   /orf_name="MICPUN_61322"
FT                   /product="Outer dynein arm light chain 7b "
FT                   /protein_id="ACO65536.1"
FT                   /db_xref="HOGENOM:HBG526673"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR016561"
FT                   /db_xref="UniParc:UPI000199BF82"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC78"
FT                   /transl_table=1
FT                   /translation="MSEVEATLQRINGHTGVLGTIIVNDEGEPVRATTVCNKDGTPVED
FT                   QVGTVKQYAELIPQLAQMARNMVRDLDPGNDLNFLRIRSLHHEIMVHSDPEFTLIVIQN
FT                   PEATE"
FT   CDS_pept        complement(598257..599021)
FT                   /codon_start=1
FT                   /gene_family="HOG000049430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634059"
FT                   /orf_name="MICPUN_91621"
FT                   /product="Predicted protein"
FT                   /function="transferase activity"
FT                   /protein_id="ACO65855.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG621238"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000199BF83"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC79"
FT                   /transl_table=1
FT                   /translation="MSRFMFSIGTVLRETGQALDRIGCSMQGSNAFREAISKHRTIMGI
FT                   YEKTPALPRAGFIAPSASVIGDVTIGEKSSVWYGAVLRGDVNSIRIGSQTNIQDNTVIH
FT                   VAKTNVGGVAAPTIIGDRVTVGHNAILHACTVKDDAFVGMGATVMDGAVVESGAMVAAG
FT                   ALVTPGTVVPTGQLWAGAPAKFMREMTAEEKAFTVTSAETYAEVGAVHAAENDKSFEEL
FT                   EYDKAARRMARERDPDYDSHLGIERSQVKVQV"
FT   CDS_pept        599585..602968
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634060"
FT                   /orf_name="MICPUN_61324"
FT                   /product="Predicted protein"
FT                   /function="ion channel activity"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65537.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000199BF84"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC80"
FT                   /transl_table=1
FT                   /translation="MATTMSRPRVSSGDEIQGSTLLALFAALVALNALVAPHLAGCPIG
FT                   DGGSGAKGTGGTCAATDASIGGSRDVAVFAAAMFVAATAFALVNAAMTASPDRSRHFQS
FT                   AAYVNACAAFAHLQMVRGENWHVSSADGFSISGLRLLEWLFGTPVMIVLAKQLYALSRE
FT                   PPVDYVSAAVKLFERDRGADGVYIPPPSIRLVQADVLMLVCGCFIANLAPAPPAVRNGA
FT                   LFVGVATFGYVISHLSRCLAGSAVYSAIAGVRKDAKFGYALAVFNVVSWCVFPTAYFLH
FT                   VSGRIDAARLDLGYAIGDAFAKFSCTMLYVTGCGRIMDLAEDEAAQRTDAQVAEQREYI
FT                   RAVCAELKAPLDAIVGYGQMSADYDENGEKTPSQVRRFQRAILTSAESMRELVSQAAQY
FT                   SKVHGEIHARGRMMTGKEGEDVGLPRVAWRKEGGDSRAFPLPPMLPTPGRRFSRVSRES
FT                   FDGDDETDPPSSVFTLGKLQDLVVKAANIPVGFELTCEISPPAATHTEHFRANTRLLRQ
FT                   ALATLCETAAAQPSVVRRAGGVEAARARGAPPCVRLSASLGATRKMEIAPVIDPNDESR
FT                   DESLETSDLPEWTDATFTASLILDRRVGSHPSDASNSGNPHSLGVGVTPEELAKRRRLD
FT                   LSTTVAKTVVTAMGGSLIRRQSDSMSGDASGDQFSFTVPLLRTSRDESECDFVPVMPLP
FT                   PGRTVGAVLLRARGAVGAGAMSANHVEHVASSLISYGAKVDKCEHESDAASQLSEFAST
FT                   DDVYPVLVMAADDEGDDENSWRHERLLAAAGARGSVVLFSSDASDDVGSDPKPSRHRRY
FT                   ANDSNVVVVARNATGEEVHEALCGVLAHVAANDANPTAAEPSNQATPSEDVSNPTNDEE
FT                   RRREKFDHSASGAWFKELGESEHLTRANSEHRKSRASHDADEDPYAFHGSPSPQKRLVD
FT                   ESSQKNDAIPERTVAKPEPASTASKVKHGFKDDELDGLDVLVVEDNHFQLRIVKATLQR
FT                   SGVTLDVALHGAEAVAHVRRRVDAGGKLYDLILMDSMMPVMDGATATREIRAMESAYRS
FT                   SKTGDELRDAGNAQPMIIVGLSAEGGPGYEQESRDAGMDGTLGKPCRPETMRKTLKEVH
FT                   RGEWKRGTFQSASKRASLHF"
FT   CDS_pept        603082..604359
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634061"
FT                   /orf_name="MICPUN_50565"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65538.1"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="UniParc:UPI000199BF85"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC81"
FT                   /transl_table=1
FT                   /translation="MRGRWWLFAVCALLAALLLARGAHASGADWDADDDEFAAPQQKSD
FT                   RLKDAAGKVFDAVDKEAEKAAARIRAEERRHAKFKNYPPMFEWRYEGIGLVIITLWFVN
FT                   FLVGDAKNKKLALAFEDAFCAENGIFKSQFASVGDIPKKVAPRKGSVLSKEASDEYKIW
FT                   CSGRRFCQGAMITLKLKPRHDLYSAATAFQGRSIPDYCVIECLMNDECVQPGSVFAFGP
FT                   KDLIENLEGAEGEKDLKKLCQTFVPKRDHGQRVTHKDVVIKAESAELANDVVFTPEVVK
FT                   VIGESTWVANGLASLVAVHCTDEAPPKFGSPPHPKTLRFQFTMPAEPEKVAGAMTDVMN
FT                   LVPALVDVVGRVQLTPGQREKAAAARQKRKEDDFKEDLKVNQKKTSAQILDEKLAKMTP
FT                   AEKEAWKKKQEKKQMRKSAGKMIKVR"
FT   CDS_pept        complement(604545..605162)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634062"
FT                   /orf_name="MICPUN_61326"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65856.1"
FT                   /db_xref="UniParc:UPI000199BF86"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC82"
FT                   /transl_table=1
FT                   /translation="MRDDGGMRVGGSQADEGTSLLINSAGSSGSVNGAKWDRRLARWAR
FT                   KDLSARVLLAVVLGMLGLASSSMLVTVESADDGGIRHSWIQNLAMHGDPHVAVHVAGDV
FT                   ANSIAKLSEPRLVDVLSSEFSEAMEGRHVKALREKWARGETDGDDRRVDMKWIEVPRSE
FT                   ARASREAARARAEDVFASRFGAQHAWAAADRASARVSASGAS"
FT   CDS_pept        join(complement(608027..608218),complement(607493..607759),
FT                   complement(605659..607407))
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634063"
FT                   /orf_name="MICPUN_61327"
FT                   /product="Stromal heat shock protein 70 kDa, chloroplast "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO65857.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000199BF87"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC83"
FT                   /transl_table=1
FT                   /translation="MASGAVKIGKSFTGSRQAVGVSGFAGKPLKARAVSMGRRVAAHQP
FT                   LRVVAEKVVGIDLGTTNSARINWVPPLRPPTPARLVQQTLIASSPPLSSQVAAMEGGSP
FT                   TIVTNSEGGRTTPSVVAYAKNGDRLVGQVRSPAPPDPLSTFRRRRRWKEIAKRQGVVNP
FT                   ENTFFSVKRFIGRRWDEVGEKDREVPYSVVKGDTGNVKIKSSVAGKDFAAEEISAQVLR
FT                   KLCDDAASYLGDTVTKAVITVPAYFNDSQRQATKDAGKIAGVEVLRIINEPTAASLAYG
FT                   FEKKSNETILIFDLGGGTFDVSILEVGDGVFEVLSTSGDTFLGGDDFDKRVVEWLAADF
FT                   QKAEGVDLMKDKQALQRLTEAAEKAKMELSSTANTAISLPFITATADGPKHIDTNLSRA
FT                   KFEELCDDLITRCKVPVENALRDAKLSLDDMDEVILVGGSTRIPAVRALVKKLTGKEPN
FT                   MSVNPDEVVALGAAVQAGVLGGEVSDIVLLDVTPLSLGLETLGGVMTKLIMRNTTLPTS
FT                   KSEVFSTAADGQTSVEINVLQGEREFVKDNKSLGNFRLDGIPSAPRGVPQIEVKFDIDA
FT                   NGILSVSAVDKGTGKAADIKITGASTLSEDEVERMVKDAESNAEADKAQRDAVDTKNSA
FT                   DSMCYQTEKQLEELGDKIPEDTKEKVKGKVAELRAAIEADDLAAMKEKQEALQQEVMAM
FT                   GQAMYQGAGAGGAPPGGEGGAPPGGDSKPDDVIDAEFSSDK"
FT   CDS_pept        608669..609856
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634064"
FT                   /orf_name="MICPUN_113372"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65539.1"
FT                   /db_xref="UniParc:UPI000199BF88"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC84"
FT                   /transl_table=1
FT                   /translation="MPRLLLAAVVLAILAQRASARTRAAPSPIASPGGRIDDDYDEDDG
FT                   FDLDEDAFLFFADEEETFDAAAAAREEPEQVDVSGGGRVGDALPAESFWRAVADALGLD
FT                   MFGNPRRASASAGGKTSRARAGRARTSSAGPNAFCLNVSEPRYYAAPAQCACDCAGCNC
FT                   RRYYACWDCEANGGCLSQATYLCAEGDFSYFNEELQACAWEQPRPLPYGCPPRPPGPPK
FT                   PPRPPRPPAGPPRPERPPPLPGFPSQPPRPVGPTFTPQPGQFPGGQFPGGQFPGQFPGQ
FT                   QPGQFPGQFPGQQPGQFPGQQPGQFPGQQPGQFQPGVGQQPQNPGQQTQAGSCSSIPQC
FT                   NSCLQTSDQSAFVCCCDLECTSWSPNLPNQPPGFLGCCNDYNQVCARQQGRRLRL"
FT   CDS_pept        complement(609914..611362)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634065"
FT                   /orf_name="MICPUN_61329"
FT                   /product="Carbohydrate-binding module family 43 protein "
FT                   /protein_id="ACO65858.1"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="UniParc:UPI000199C02B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC85"
FT                   /transl_table=1
FT                   /translation="MFSAIASAVSGRGRREESVPLLPRDVEAGADDAAGDARCGRSRGM
FT                   IAGTSARDALDAGDGAAPRRLPRGVIALVSLLAVAGCAGYSASVSGGRHGAALGAAGTR
FT                   LRPDRWSFHQRSRPSALESVNPWRGRDTEGLKLATRRTAAPESRRGVVMAGQWPGYGAA
FT                   KKSKSRRDDDEEEEEEEEEDNGTLVPVLGDQVVTGESTPRRGAVTSGRRSRPCVLKDAV
FT                   TDEQAQAVLDFACAPESGVSCAPIGAGGALERPNTLLRDHAAWAIDRYFRLRSREPDAF
FT                   PQRDCHFVGVASLDAPNNFYVSTTGALVRVNPSVDTIANKVTVPIEGVVFSSGVGAVRG
FT                   TLVSRRGGGSNGGGGFLRDDPLRPEAGVKTTFKFWAGSTATRSRGEGPCVVETTVVYDF
FT                   DGDGDADRTESFELVQVPREPAMAPVETKIIGHSAKARGARFPRRVTDARVSLLVRSPN
FT                   CPGEVNVWESSATYPSFLTVPYRE"
FT   CDS_pept        complement(611591..613099)
FT                   /codon_start=1
FT                   /gene_family="HOG000208776" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634066"
FT                   /orf_name="MICPUN_84832"
FT                   /product="Dicarboxylate/Amino Acid:Cation symporter family "
FT                   /function="sodium:dicarboxylate symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65859.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017153"
FT                   /db_xref="HOGENOM:HBG739804"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniParc:UPI000199C02C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC86"
FT                   /transl_table=1
FT                   /translation="MSSSDGASLLHGGAESSSGDAQGARRDGNDASSGRVDHDENAESS
FT                   SSCLGALKAEPLLIKTIVGVMLGIVVGSIVRAANPTPRAVELIGFPGELFMRLLRALII
FT                   PLVAVTMSRGVTSLSARSGGSAKRVAKRLVASYALTTLVACALGIIVVEIVRPGVGVVV
FT                   DGARCDKTVVKPSSKPSPPPPSVVNATAGVSAVDSLLHTARSFVPDNIVESAARGDVLG
FT                   VIAASLMFGAAVSASPGDSAAPTVALLDSLNAAIEVAVGWAIGLMPPGVLSLVAGRVAG
FT                   SCDPAGTLAALGKYLCSVLLGLGIHGGAVLPAMYALATRNWSGRMMLGRGNETPGWRAV
FT                   LQKGAPALVTAFATDSSSATLPVTRRCAKTLGVPSALADFALPLGATANMNGTALYESL
FT                   TVLFIAQLHGVELGVWGTTVVATTATIAAVGAAAVPSAGLVTMLIVLQAAGLEEFAGDV
FT                   GVLAALDWFLDRCRTAVNVEGDLMVVAAVNHWEGNDAEDEEDAS"
FT   CDS_pept        613292..615106
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634067"
FT                   /orf_name="MICPUN_107431"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65540.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C02D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC87"
FT                   /transl_table=1
FT                   /translation="MSAATRLHVSGLPRDLLDDDLCARFTPFGAVSDLEVCREKENSPF
FT                   FADGRTDDLAPSVRGGRGGRGGAGGRGKKKGRGGDRLPPSRPPPCRGYAFVTVAFPDDH
FT                   ALRRCLNAYNGTKWKGGTIHVHPAKPKFDERLRMEREGIHPGRPGMRAEVDDDEALRGD
FT                   DVNSDVNSDDETRRLANDGSDERQPLRPGDLLEIDGRVRNSKVIVTYATGATTHVKGEG
FT                   SFEDDASNVPATPDWTPFPDDASNRTLRKLCQLPGLSPAVGTVAGGGRCRRDDDDETEI
FT                   IRDEEEEEEGEEEEEDGTAGDGATGRDGWGRRGEPAGDTADRFNLPREFFNSDVAAARA
FT                   ARSAAGGGDDTGGRAGSKSKRRKKDTVEMRALAAFLGSDSDDGDETEGADGATRLVAEA
FT                   TRPAAEPVPAKKPTRDGAPSKPAATRLAEPEEGGIPMAKAGSWWWESGSAAPGGAGTGT
FT                   GTGTVTVTGTGGGLAKDFFATQPAAPARDFFRAVGAAPFAPRSKSSALDAADDDEAEDG
FT                   EESDGDVEIDVDSDAFSEDDESAEPSDDDDDGEEEEEEEEEEDGSEGASSDDDDDDDDE
FT                   GEFEDESSGSEDGEGDSDSGDLGVVDFD"
FT   CDS_pept        join(616545..617306,617355..617540)
FT                   /codon_start=1
FT                   /gene_family="HOG000030435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634068"
FT                   /orf_name="MICPUN_85328"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65541.1"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI000199C02E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC88"
FT                   /transl_table=1
FT                   /translation="MKLVAAGVDNDEEKEEFWDSLTIRGTNTNLEKSYFRLTSAPDPAT
FT                   VRPQPVLEKALRRLKTEAAGESYFYLQDQMKALRQDLTVQRIRNSFTAEVYEHHARVAL
FT                   ANQDLGEFNQCQTVLKTLYGEGVSGQEVEFLAYRVLYSAITGVTGSNINTVLSTACAMR
FT                   TEPAIAHALAVRSALQDDNAVEYFRLLGAAPSLGHSGTGDLMSQRNEQVRFRHVTVACK
FT                   AFQPRVPVAHLARVLGFTLHRAYVPGDGERDPPEDVDECVQWLEAHGAVVKDDGGVPSV
FT                   DCKESAPRLFVPEDKNAVAHGDQTLDIADFMASF"
FT   CDS_pept        617736..621608
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634069"
FT                   /orf_name="MICPUN_102306"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65542.1"
FT                   /db_xref="UniParc:UPI000199C02F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC89"
FT                   /transl_table=1
FT                   /translation="MVGHDPYGSPSAIGARTTRPQDLKWVADPNNARSYEEMKQAASTV
FT                   ESQVNQLKLVVHKALGGGDFDAALKARKELEGEWWDTKEQMESHKIVSYQQADVYIKRA
FT                   ASRMSTHRKWYATQNKRANKTIEDALEELRLASLVLQQKQTEEEQSAEQLAKASAELTK
FT                   SVRAEAAAVQRLRADLDPIVAAVTSDMERLRTDLTRWSSARAGKTHVVATVEQRIDAPV
FT                   ATPVRDGPPPPIVPASPAPHVAAAGVPHSGPSVEPQVIVKEVVKYVDRIVEREVPVESA
FT                   RSIDSAADVERRRLADDLRRVTARCAALDDECADVRAAHRRDAAKLAEQIESLRDALSR
FT                   ESASTSVLKAEAEKWRAMYDAVRDDASNDSQARAEADALRMSVQHAEDRHRRELMLLGT
FT                   EHGNAYAALRKSVAAAEKRCADLESQVEAAEKRCGTEEKRRREADDKRAELERQLRLLQ
FT                   ADTRTNADRAMSSARDLMDQLSSADARIRVLQEQKEELAKKLAEMEETNTKLLGQNSGS
FT                   DWRLIAAEAKLKQTADHLASEQQETARLNAEIDKLTEQVRLARDTARASATNDLPGVIA
FT                   GLEAEIATLQKKHKLALDQEKELAAAEAERVKLLHEAEVRKLTSLQEAEQLRLTELDRR
FT                   TAELLATEKEIRASTEEEAKRLRADKEALREELSQIKDDLRGAKADLTSLEKALRDSVE
FT                   QTNELREKNEELRAQKAKVQERVVEVPGPERIVTKEVIKEIEVPGPERVVTKEVIKEVP
FT                   VPGPERIVTKEIIKEVEVPGPERIVTKEIIKEVPVEGPERVVTKEIIVEVPTPTATPPA
FT                   SPAPKTAAPAPASPDPALVKQIEAQATKIGRLEAELAAAEDAKRATEDAKRAAEEERAK
FT                   ALKDAELSKAALESAKEAALAKEKERADAEAAEKSKAQQPVAEAASAAPALAVMHASSR
FT                   PQTPKQPTRPSTPKPGLDDEQVEYLQYQYSAASDNLAVLALLVQEAAVQHLWVDGPRRD
FT                   KKPLKFGQPHGPMARTAGRFIVNFIYPRAFVFLWWEVAMFVAAVWFACILGYAYFHGDG
FT                   LGNHPAVLLSPFIPSIAALTARTYKYCRVDQETFSRDAPRFLIDALHLACFPLGFILIF
FT                   CKLWDDQGDIPWWLAIFFPWLAMTRILVETMHDVVVKMPLTEFGQLGYGADGTAYEYAF
FT                   SDPGNDDLDVVEAVGKSPSAARALDMDVVPPMPPPPPPPYPDATPQLSASASAFTPGGG
FT                   SRGGSRPGSRGGDFGSFLRTSRSNGQEQFTDIGGPGGGVAVSDEGVRMTNVPSPREYAA
FT                   GGDQRV"
FT   CDS_pept        623125..623505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634070"
FT                   /orf_name="MICPUN_108897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65543.1"
FT                   /db_xref="UniParc:UPI000199C030"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC90"
FT                   /transl_table=1
FT                   /translation="MVAARSQLQPLVQPLHPSAAGFEQMCAAEAEARMLKTIRLRAAEL
FT                   RRDRKRAAKEAAELAAKETAAGMERERARTITPEVRAEPPPARGGQMGVGGGSGSEGDT
FT                   AGDVTGAENASTSTRGTSTAEA"
FT   CDS_pept        complement(623567..624328)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634071"
FT                   /orf_name="MICPUN_61335"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65860.1"
FT                   /db_xref="UniParc:UPI000199C031"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC91"
FT                   /transl_table=1
FT                   /translation="MACAGLAPSRAPRVVTRREGGASAFARPSPPSPPPSRPLAAKTPW
FT                   RTAPRHDPTRRRIPAARIVVPRASAEPVTSLAAELASLVARGSDTRDDARVRAIVDELE
FT                   RARAPADPRALTGAYEVAWSEGTMAWRALVARGVSAIAGRSRAGQWFTPGAPGRALNFA
FT                   ELFDGRVTITAEGTFRPKPTEDARHPIGFDVQIERGDALAFGRRWTLPIEGPGEFQMLY
FT                   GDANVRVFRSSGGVAVQVPSDWQRPAAEDEE"
FT   CDS_pept        624386..625585
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634072"
FT                   /orf_name="MICPUN_61336"
FT                   /product="Short-chain dehydrogenase "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65544.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG562710"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C032"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC92"
FT                   /transl_table=1
FT                   /translation="MAFTVHPPTHTRWLSDADIHASTDLTGKTALVTGATSGLGRSCAA
FT                   ALARRGARVMLGVRNVEAGARIAAAIEAETGCAPGTVTVGLPLDLASNESVRSFAKDVV
FT                   GKCPRLDLLVNNAGVNFVPKAFTPEGVGVIAQVNFLGPAALTRALEAPILAAAAHAGVA
FT                   NVVHVSSVTHRYASIPSVARFLTQWDAGSYAATKLANVLFAYECHRRWGAQGVRSAAVD
FT                   PGAIYSNLWDNDRVFSSPPMRAILGLTYAPPEDGVAAVVTASLAPFHEATKRKGGRDGD
FT                   GDGDGDGDAATRLRFYARGLFASRLVAGCAPGLRDELNDGVAQSASWHLNYYAWGIATL
FT                   AVSMLDWPVRACSRGRFAGRTAEVRSSPASYDEATACELWEKAGAAAGRVARGKEMLVG
FT                   "
FT   CDS_pept        complement(625671..626879)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634073"
FT                   /orf_name="MICPUN_61337"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65861.1"
FT                   /db_xref="UniParc:UPI000199C033"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC93"
FT                   /transl_table=1
FT                   /translation="MSGQLPPIDVGPPQPPDTEGHDGGAARTEGWQTARRRTVSSPGPP
FT                   SSKSSPRAPPAFPQRERAPAQARQTVGHVGMTVVQARRWQPPAPSDNSWTGNNAAAAGA
FT                   LGSPNVSMLAPPPTPFTPPGTGAQPRASQVMMHSMLAASKFKANKGPPKRPDPLRSVPV
FT                   RETPAATPTRSPSQRADESPGPKSPPGTKLTPGQKTVVRRSDTPVKKDEDVLAEFGGFL
FT                   EKPLGFFGFTMADKRKAMFTIAFLAFFLVILFIVLATAETDDSSSAPSGVPPWPAWPPW
FT                   PDAPSPPPPPSPPSPPPSPPAPPPPPRPPPSPPNPPPPLPSPPPPSPPHPPPPPTACGS
FT                   DGQCLIKGDGTNQCVFSQAGGNDIVCYGSDGNLLVATGSPGNLMCSGLTCYHSPARTSY
FT                   CAC"
FT   CDS_pept        627171..628640
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634074"
FT                   /orf_name="MICPUN_102308"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65545.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI000199C034"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC94"
FT                   /transl_table=1
FT                   /translation="MTAVTFAEDGPGSVPGATTPAAPADPGAPKPKVMLPGACALCACT
FT                   SARRWYRLDEPMPRADPTDDDGADDDATYVAGKGTSRERRLPLMLGRRAQWTGAGAGAA
FT                   LNEARLCPYCHVQNEQLWQESIGAGARTPADVRSTLSRFDRVMSILAPRRGGGGGPGGV
FT                   GGGRARRRKNGASGRTGYGQNFDDADATQLAGDRDFVARLSTSAPSSTDEGGALLLRRA
FT                   MNGLGVGHGTGRSAREEAELREELAAAARLGHRRRRRWANDRLLRELGGRMSVAEMQAQ
FT                   FMPPPFGAPAKPTAFEAMLDAQARGEWTGFHKVDMDKEKAFLDKVRAAEAASRTHRHES
FT                   ESYAAAGWARTSARARAALRSVARRSPERLEDLENVVLDFAEEFANTGRELALPLDDGF
FT                   GRLLAHGLCEFHGVVATSRPTKLGGKELVVRAPSVASISGRDQEPEEGDDDDDEEAAVG
FT                   ESAEPARWRAPSTCAEFLRLLERSGGAGSLE"
FT   CDS_pept        join(complement(630816..630868),complement(628869..630219))
FT                   /codon_start=1
FT                   /gene_family="HOG000147662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634075"
FT                   /orf_name="MICPUN_91628"
FT                   /product="Predicted protein"
FT                   /function="geranylgeranyl reductase activity"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ACO65862.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0045550"
FT                   /db_xref="HOGENOM:HBG590082"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011774"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199C035"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC95"
FT                   /transl_table=1
FT                   /translation="MASASMTMAAAPAARTTSLRNSKFHGAKVAPMRAVKAAAVDTGIK
FT                   AAGKSLDGRKLRVAVIGGGPAGACAAETLAKGGCETFLIERKMDNCKPCGGAIPLCMVG
FT                   EFDLPEEIIDRKVTKMKMISPSNRAVDVGQTLNDKEYIGMCRREVMDDFLRKRAKSLGT
FT                   NLVNGLFMKLDDPGQGNGPITIHYNDYEADAKVGEPKTMEVDVVIGADGANSRVAKNID
FT                   AGEYDYAIAFQERIKIPDEKMDYYKDLAEMYVGDDVSPDFYGWVFPKYDHVAVGTGTVV
FT                   NKTAIKQYQAAMRKRAEEKCAGGKIIRVEAHPIPEHPRPRRVQGRVTLVGDAAGYVTKC
FT                   SGEGIYFAAKSGRMAAEAVVERSQNGTKEVDESDLRVYLDKWDRKYWATYKVLDILQKV
FT                   FYRSNPAREAFVEMCADEYVQKMTFDSYLYKTVVPGNPLDDAKLLGNTIASIVRANALR
FT                   AAGKAQVNM"
FT   CDS_pept        join(631850..632065,632115..633443)
FT                   /codon_start=1
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634076"
FT                   /gene_name="KAS1"
FT                   /orf_name="MICPUN_107432"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="ACO65546.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG757733"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI000199C036"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC96"
FT                   /transl_table=1
FT                   /translation="MAAVSSTTVLVGARGIVANRRTVSARSTRVASTGRKGELQSQTSD
FT                   SNRRPSRRFPSRFTRDPTLGSKPSQPVRLTFRSVIPHPKTAIIVTAMARETDPKKRVVI
FT                   TGMGLVSCFGNDYDKFYDKLLAGTSGVKMIDRFDTADFPTKFAAQITDFDNEGIVDKKN
FT                   ARRMDDCLQYALVSGNKALMDAGLTDDVIEGMDKTKIGVLAGSGMGGLTVFQDGVKALV
FT                   EKGPKKITPFFIPYAITNMGGALLAIEKGFMGPNYSISTACATANYAFHSAANHIRKGE
FT                   ADIMIAGGVEAPIIPVGLGGFVACRALSSNNDNFAAASRPWDKNRDGFVMGEGAGLLVL
FT                   ESLESALKRGARIHAEYLGGAITCDAHHMTDPRPDGSGVGLCIEKAVEDAGIDIKEINY
FT                   INAHATSTLVGDVAEINAVKKAFKGDLTGVKMNGTKSMVGHCLGAAAGVEAVATIMAIK
FT                   TGWVHPTINQEDPIDEVEGIDTVPNVKAEHKISAAISNSFGFGGHNSCCIFGPYEA"
FT   CDS_pept        join(complement(633958..634830),complement(633718..633741))
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634077"
FT                   /gene_name="HPF_3"
FT                   /orf_name="MICPUN_97866"
FT                   /product="Cysteine-rich protein with zinc finger "
FT                   /protein_id="ACO65863.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C037"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC97"
FT                   /transl_table=1
FT                   /translation="MATKTTIWRPGVRVTLDEYGEIEDTEMGGEELTKRGTKRKGAPRT
FT                   KGPCEHGVKYRSQCKVCSACPHGRQRSRCKECGGSEICEHGRMRFSCKECGGSQICEHG
FT                   RIRYQCKDCGGASFCEHGRRRSQCKECGGSAICEHGRQRSRCKECGGSGICEHGRERYQ
FT                   CKECGGASICEHGRQRSKCKECGGASICEHGRQRSQCKECGGSAICEHGRQRSRCKECG
FT                   GSGICEHGRERYQCKECGGASICEHGRQRSKCKECGGASICEHGRQRSQCKECGGSAIC
FT                   EHGRQRSRCKDCRGERL"
FT   CDS_pept        634943..635905
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634078"
FT                   /orf_name="MICPUN_61342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65547.1"
FT                   /db_xref="UniParc:UPI000199C0D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC98"
FT                   /transl_table=1
FT                   /translation="MKTERQPIVKRGVADAARPHATLPTVCVACVEERDHLEAIKREHA
FT                   AERESWNKEKAVMARAHSQEVKRGNELQKQLAAASRKDADHEENLDLEAAKREHAAERE
FT                   KWAKERAVMARQLSAEAKRGNDLERQLALATSRVGGDATELAAVKKRLFAANAEAKKTE
FT                   ARFNAQESRHRLELREREVATLRTTNESDRRAAEATARALEAEGAVAAAHAERDAAVDA
FT                   ARTAAAALRSLEHKFADAVRASQLAQDEARVNMERMHSEHLERVAFYEDRITRLERERH
FT                   AEKENGLLADEVFKKLADFRLAEIREKGRLLASTTTQET"
FT   CDS_pept        complement(635977..637062)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634079"
FT                   /orf_name="MICPUN_61343"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO65864.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199C0D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EC99"
FT                   /transl_table=1
FT                   /translation="MTAAARALVPAATARSRRPRGRHPHGIRVVVATHAVDAVTVASEA
FT                   KPVVTIRRAVPKDVPVVTRILAEAADGAVSTQSLATYAREAAVVDELPGETPEQLALVA
FT                   ERAFPTPSDPPKVVGVVGLLLDNALKPMEMKLEKEVGYVTNLAVDGAARRSGIGATLLA
FT                   AVESTAGDYGCAAVACRVDVGNDPALAMYDKNGYEPLQPRALRKFRRLMGGLYAVAGVA
FT                   HLLDLLVLDSVLPTAAGAPPWALMDPTQRLCAIAWCLAGPVAWLCVAKGSATVGDLALV
FT                   AYGALEVTLCVACAVAYGAVGGDAATGAVGVQVAVAGCALALKPGRSPGRLSLGKELRG
FT                   AGRGGVGRAGEGEGDDGVREV"
FT   CDS_pept        637194..638036
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634080"
FT                   /orf_name="MICPUN_61344"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65548.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C0D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA0"
FT                   /transl_table=1
FT                   /translation="MTTTKTTIWRPNVRVTLDEYGEVEDTERGGEELTKRGTKRKRAPP
FT                   TKGPCEHGVKHRSQCKVCGACPHGKRRSRCKECGGGGICEHSRERHRCKECGGASICEH
FT                   GRIRSQCKECGGSQICEHGRERHRCKECGGASICEHGRIRSQCKECGGSQICEHGRERC
FT                   RCKECGGSQICEHGRIRSKCKECGGGSICEHGRERSQCKECGGSQICEHGRVRSQCKEC
FT                   GGGGVCKHGRIRSQCKECGGSQICEHGRQRSLCKECGGSQICEHGRRRYRCKDCHRGT"
FT   CDS_pept        complement(638102..639751)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634081"
FT                   /orf_name="MICPUN_61345"
FT                   /product="Predicted protein"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="ACO65865.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199C0D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA1"
FT                   /transl_table=1
FT                   /translation="MAVDRARVSANMAKWRKAARMVGRTAAGLDVWQRNARERLRLRRE
FT                   ALLKPPARRTEADVVLLETVLSRVKFVRELTMKTRMDLCKLTGYASYGAGETLFRQGDA
FT                   GEFFYVVLSGSVDVFIRDPGGREHLVATLFNGDSFGELALMQEGNTRGATIVAKDDCEF
FT                   LTLGREDYGAILRTQSEKSISEKVAHLRATPMFRHVEHDTVQSMAYVLSARTYPRNALV
FT                   FKQGEEVEDVYFIAEGAARLVREIENRETLRRAGVTRRGPGCVFGKPVRGMGGAWDEPP
FT                   TPPGLANEWLDANEEGEDRFAPDAARESIDDATPLPGGSRRTSATVGANELAAASVAMA
FT                   DVSFGDSSDDEDGDFDDGASATSRSSRLSRESRMTDMESRFRGSFAAALSLGGGGGGGG
FT                   GGGGGGGGGGGRGGGGASSIKPRPRSPSFAPSEKAAREGLGRLFLEVGSLAKGDVFGDT
FT                   VLTRRFAQPASVITTAPTRVYVMNKWDVLRRADAGTVEKFRRGGAKTLRACSVDDEALL
FT                   EEFRVGQEWGRYRTSMVERTVEVHKGLKALRR"
FT   CDS_pept        join(complement(640476..>640747),c
FT                   omplement(639857..640433))
FT                   /codon_start=1
FT                   /gene_family="HOG000213547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634082"
FT                   /orf_name="MICPUN_85085"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65866.1"
FT                   /db_xref="HOGENOM:HBG397437"
FT                   /db_xref="InterPro:IPR007303"
FT                   /db_xref="UniParc:UPI000199C0D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA2"
FT                   /transl_table=1
FT                   /translation="GGDGVIIGGWKVRARNTRILGKDALEELEQRLGTSHLPEMVYGSS
FT                   LELTHESTGVKLHFNAEDALREWLQEDLPPLKVAAAAVWERGHKASDGGGGGGDAWNDE
FT                   EETDAYDWTFTTPYRGSVSVDVDGHVDGHVAGHPPPWTDTDQRVDRGLLMERDPILFFD
FT                   ELTLYESELDDNGLMSVTVKVRVMPRCWYVLMRHWMRVDGVLIRLRETRFFHRIATGGS
FT                   GRDAPCVVVRESARREETFEGLRMRGAPSEPGQYPDADEAASVLLAAGGPVEMEYHALT
FT                   V"
FT   CDS_pept        641339..641941
FT                   /codon_start=1
FT                   /gene_family="HOG000189970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634083"
FT                   /orf_name="MICPUN_50571"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65549.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG324813"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000199C0D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA3"
FT                   /transl_table=1
FT                   /translation="MVKITALSLWKWNGDNQEPTCLGKTEDVDEFGYFQRSSVREMLTF
FT                   ISRTIVKRTQPGQRQSVEQDQYLVHVSNRGGLVAIAVMDKEYPTRAAFSVLGKMSDDYV
FT                   NRFGDSWKTVSGDDPRGNEALAAAIVTYQDPHEADKILRIQRELDETKIVLHKTIDSVL
FT                   ARGEKLDNLVDKSTDLSLASQMFYKQAKKQNQCCTMM"
FT   CDS_pept        643632..645947
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634084"
FT                   /gene_name="RWP2"
FT                   /orf_name="MICPUN_107433"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65550.1"
FT                   /db_xref="InterPro:IPR003035"
FT                   /db_xref="UniParc:UPI000199C0D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA4"
FT                   /transl_table=1
FT                   /translation="MEEVTVKVEAGIQPFGRPIAESAESHEGEEGLLKAEAAKGHDSDK
FT                   TAGAQERAVDESEDDGDDDADYKIVKTDPDNPTTAAVQSPSEGDRGNVSDQVPARSDGA
FT                   EEEDDDDDGHGFHEEEDEEHDDENDDDDDGHGEEEEDDTEDAEANLTNLSDLALIAGAA
FT                   NGRAKPKSKPKSAHKDKGGKSAKRRPLRSASEITQEELSSCFHLPSEAACRKLGIGLTV
FT                   LKRQCRKFGIKRWPFRKMKSLDRLITNVQAGISPGDQNRTLVKSVEELEEQKRRMEECQ
FT                   VLDLDENTKRLQQAYSKANHKARRMAQAPELGGLGGLLALSSKSDKRGSDASTAGVARG
FT                   DDDHVNSVMSSVLKRAKAGAQILDVAGAIPVLGDPAATITAAANAIQEYSGGAAALLPS
FT                   TFTGLNPTQQNILAALASAMNSKEPGDRSSISAFTTALTNLAAQGKIEVQPEAVAAWQN
FT                   AAKFYPPQGALTTPTPTQQQRPSDAATNPFAPALDPADLVDGKRPVTAVTGRWSPARPA
FT                   RKFDATGAPVFDDRGAEVLEELLAQRTKRGRPPKNEASESESSESESSESESEESEEEP
FT                   EPEEEVEGEAGRSGRRRKPNPKYQEEKTPKKKKTKKKKKEKKEKKRRAKRARTNSAGGD
FT                   VDDADPLASLALAALGAAKTAKPAKASAVPAEHPAFALAQQKSRTVVSRAPPGAGLHAP
FT                   RIDKSTITLVVTEHADRLRDAMLTLAEGGARRWPREGPDAPATQDEKQAISDAIGVEAL
FT                   KLRDALNEMLLPQGAGRP"
FT   CDS_pept        join(complement(647039..647208),complement(646071..646866))
FT                   /codon_start=1
FT                   /gene_family="HOG000265579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634085"
FT                   /orf_name="MICPUN_61350"
FT                   /product="Predicted protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="ACO65867.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG562717"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI000199C0DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA5"
FT                   /transl_table=1
FT                   /translation="MAHGTTPDGILGKVIGLVSLFAVLPVFSLSMPLAFMFGSPSCWGF
FT                   GEKYRPSFSYVWSKFMTETVMGCRLKLVGTRALYKDGPCVYLSNHRAWADFFIDMYLTE
FT                   GRAFILSRFAVAYVFPAFMLPAMWVGAVFAFKRGKAGAHDELNNALDAHFKTFTDFSGF
FT                   VVYPEGTRNVRPKSLPLKRGLIKYTHSRGMDVQIIIGGHKEHVLSEQRGSASWGVEIPV
FT                   GYSDVISSKAFVGDFEGFYAEVKRAWELEWDRVYGDKDRPTRPHHPKVQLVEYTNGMSV
FT                   LLVASSALCSVAGVFAVIWCVTLAAAAMPLGVALGAASGA"
FT   CDS_pept        647434..648552
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634086"
FT                   /orf_name="MICPUN_102316"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65551.1"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI000199C0DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA6"
FT                   /transl_table=1
FT                   /translation="MAWTDAPTPSWARPASAGGPASTSGAPPADPAPPMGYTGHVNLQD
FT                   MLRDLLAAFYQAYLEDATEPRRRRMAALLQQADRHGLLGPCAVEGLATLFSSLTREFAV
FT                   DPQRFAAFYHFFFFVARDRGHRNLADATAVEGWRFLLGGGRFALLEPWCAFVRERREGG
FT                   KGVSEDTWCQVLDFAHSCNDASRGGGGCLDAYDPHGAWPVLVDEFVDHVRGRGKGGAEG
FT                   ADDGAEGADDGAEGADEDVDMDAGAIRGDATYESSSRLACTTAVYNGGTAGGSGRGFGG
FT                   ADRWSSRGGGGGGGFSGGSGDGDGRAPAVGCKRRLSAVLELDGLADQLERQARCSTPPV
FT                   PAGGAGRAAAATPNPTTGSPTRKFFRMDGHPA"
FT   CDS_pept        complement(648640..649329)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634087"
FT                   /orf_name="MICPUN_61352"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65868.1"
FT                   /db_xref="UniParc:UPI000199C0DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA7"
FT                   /transl_table=1
FT                   /translation="MPDLDKIARASGMDPETMRGHAQRLWKHMDELAEKSPDEYRSFLE
FT                   KQAANAGVDPNKAFGPAGGAGGTGADPKDIAAAAEARRAAAATAAAATARRDGVGERMS
FT                   PSLLTKVAGLSSSSSARVGAATRDEPHALIEEVNGTGVRHEVRVTRGAGGVPVAVEVTC
FT                   VMPIGVTSAKDADVTVSGRYVHVECAGVGEKTCIALPIPVDPDDVSAVFKKKERRLTLR
FT                   LTPASSE"
FT   CDS_pept        complement(649491..649766)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634088"
FT                   /orf_name="MICPUN_112667"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65869.1"
FT                   /db_xref="UniParc:UPI000199C0DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA8"
FT                   /transl_table=1
FT                   /translation="MSWEPRQSLTSSEFRKQANRRALERIPKDLYWKVAGFSFVVGACM
FT                   ELFMIKTGFYEKVTAIEAERREALSEPPAWVQELQKQHKAATEKKK"
FT   CDS_pept        join(complement(650348..650475),complement(649946..650204))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634089"
FT                   /orf_name="MICPUN_61354"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65870.1"
FT                   /db_xref="UniParc:UPI000199C0DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECA9"
FT                   /transl_table=1
FT                   /translation="MSAAVRNLASLAAPARATTAPRRAPRVVASAAPAEKNDVAPRRAF
FT                   LFGALAAIPASTAAIPAYAASLEEKEKEKEARKAALRAAAAQSAQTGRGAAAFADSEYQ
FT                   LSEESKTPNFHTRQEEGLRSSGGA"
FT   CDS_pept        join(650849..650873,651107..651168,651279..651584)
FT                   /codon_start=1
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634090"
FT                   /gene_name="MBF1"
FT                   /orf_name="MICPUN_112665"
FT                   /product="Multiprotein bridging factor "
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="ACO65552.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG521662"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI000199C0DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB0"
FT                   /transl_table=1
FT                   /translation="MDGQDWNQVVLTKKRPTGGMNGVPKSADAARRMGMSVQTVKKQGA
FT                   GYNAQRMGKLENETEELSHAKVGGEVKKAIMQGRLAKKMTQAQVAQMINEKPQIIQEYE
FT                   SGKAIPNQQILAKLERILGVKLRGLK"
FT   CDS_pept        complement(652029..652331)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634091"
FT                   /orf_name="MICPUN_61356"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65871.1"
FT                   /db_xref="UniParc:UPI000199C0E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB1"
FT                   /transl_table=1
FT                   /translation="MPSAPVAAIASRVAPRRLRRRLSAESTPSARAPTRTAPEATPVNA
FT                   VATARAFNATNAARACVPRGRSRSAFVLDLSRTVTAPVRPALPIREAAPHAPTDS"
FT   CDS_pept        652402..653181
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634092"
FT                   /orf_name="MICPUN_61357"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65553.1"
FT                   /db_xref="UniParc:UPI000199C0E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB2"
FT                   /transl_table=1
FT                   /translation="MARLDLDPLVRLGDLAARWRDAHREGGRHLETVPALFAAATEDVD
FT                   AEEARAWRTKDGVAARVMRAAPSPRLEAFLDGGRRHPSLAAAAPQKLTDAIDAVVVAAR
FT                   TCEGAAKEAESALDAFIATCSLEGGTPPPSPPQKSETRDVGASNPSPPAATGGHWMDAV
FT                   PTAVLFTRVPWGDPPHRTIEEWLWLCTAVVESLGEEAAVKRGAADYLSQLPGVGEDGEE
FT                   TEAEPLTREKLQGCAEVWGMEPFIDRDLFNTLANAGK"
FT   CDS_pept        653271..653735
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634093"
FT                   /orf_name="MICPUN_61358"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65554.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199C0E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB3"
FT                   /transl_table=1
FT                   /translation="MRTMWKYRRRISAGLLVALSSRPKAPPTDFEAMDDDASYAAVTMI
FT                   QTNVRAHQIRKRKQKERDSNGASRDAPPTPVHGRTEETAARTEELDGWKRRAARAIALV
FT                   LALLFVYVYRPMLWAVNVPSSLLAAIQRWILRPVARRLGFDLACCGGAVG"
FT   CDS_pept        join(complement(656494..656792),complement(656326..656390),
FT                   complement(653875..656195))
FT                   /codon_start=1
FT                   /gene_family="HOG000198162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634094"
FT                   /gene_name="MRE11"
FT                   /orf_name="MICPUN_61359"
FT                   /product="Mre11 DNA repair/recombination protein "
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /function="manganese ion binding"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65872.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG596413"
FT                   /db_xref="InterPro:IPR003701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007281"
FT                   /db_xref="UniParc:UPI000199C0E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB4"
FT                   /transl_table=1
FT                   /translation="MAAQEDPDLLRILIATDNHLGVHEKDQVRKDDAFITFREIFEIAK
FT                   QQNVDAVFLGGDLFDVNKPSRETMVRTMEILQEYCMNDRPVQLEVLSDQTVNFPRRGVV
FT                   NYEDPNLNVGLPVFMIHGNHDDPAGAENLSAIDLLSTCGLVNYFGKHVLTGSGTGKIKI
FT                   KPVLMRKGNTKLALYGLGYIRDARLHQMFSVKGNVEWARPEDKPGFSSKSWFNTMLIHQ
FT                   NRVHHSPKNAISERYLPSWLDLVVWGHEHECLVEPTEYGDFMVSQPGSSVVTSLIEGEA
FT                   KQKQVFILEVKADKNAPDDAPMWRAVPQPLETVRPFKYRQISLIDFARLAKEDGGLGAD
FT                   FTPESGETNTGLGAKGKRAQPSKHEAWITQALERMVRELIAEARAPYERRGEDEVPLPL
FT                   IRLRVDYGGFSTINAQRFGQKFVGKVANPNDLLQFFKSAARRRREDANDAATAAAAHTT
FT                   AVEDIIGNPTMQDQARIEQLVAQHLTQGLQLLSEADLSNALDDFVNRDKSALENLIKDR
FT                   LRETMKFVEENAGHEAEMITSGDAKDVTANVEKSIAEAVQQRLARTGATARAAAEAEAA
FT                   AGAATAAAATTPRRAAAQEKEIIEHARRRAAAAAEEDGDGDDDLGTIAPSEQPGSAADA
FT                   FRDIFNTQASRGARAGRGGRAGRGAARGGRGSRASAAAAKKRAAAEAFVVEDGEGEEED
FT                   PDSGVDEEEIPATRPSRPSRAAAAVGAAASPGEVDIVPESDVDDDDDDEVPASRPVRAR
FT                   GRPTRAAAAVRRTRAKAADNSPDAFDFTEDTDDDDDEVVEESGDDGEDEEEEEAIAVVG
FT                   RRGAKRKAPAKAAATSAKRTRAGGGAAKKAPPRGKKSPPAKAPPVRTRAKRAVHIPYTQ
FT                   DEDSGEDDEEIPATATRRSTRAR"
FT   CDS_pept        656908..657750
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634095"
FT                   /orf_name="MICPUN_61360"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65555.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C0E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB5"
FT                   /transl_table=1
FT                   /translation="MTTTKTTIWRPNVRVTLDEYGEVEDTERGEEELTKQRTKRKRAPW
FT                   TKGPCEHGVKYRSKCKVCSACPHGKWHYQCKECGGSQICEHGRIRSQCKECGGSQICEH
FT                   GRIRSQCKECGGSQICEHGRQRKLCKECGGSQICEHGRQRKLCKECGGSQIYEHGRQRP
FT                   YCKECGGSGICEHGRQRHRCKECGGSQICEHGRQRHSCKECGGGGICEHGRIRSQCKEC
FT                   GGSQICEHGRQRKLCKECGGSQICEHGRQRPFCKECGGSQICEHGRRRHRCKDCRRGA"
FT   CDS_pept        complement(658046..658906)
FT                   /codon_start=1
FT                   /gene_family="HOG000265831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634096"
FT                   /orf_name="MICPUN_102322"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /protein_id="ACO65873.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG410687"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000199C17D"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB6"
FT                   /transl_table=1
FT                   /translation="MKTEKHETTDTNVLFSSPLLRTPLSGSVANAGRHYELPTPPVSCR
FT                   NLMEQALFGDLCTTMAPMDHRRAGWPVASLVDFATDSEGTPIFSLSPMAMHTRNIKVDP
FT                   RCSLVVEMPGWRGLASARLTLFGTVRQVPEEKQDLARRLFKSKHSEENMSYGTSEFPLY
FT                   ALTDIKDVYYVGGYGTVKWVDPIEYLSCSPDKVCDRAVQNPLELLNDVNEEYRSRIPSL
FT                   YPNCSRAKIIAIDRNGMDVRLKTGEGHYVVQRIRFHGPAESYGQVREEVEAILSDGFKK
FT                   LRKPR"
FT   CDS_pept        complement(659719..662238)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634097"
FT                   /orf_name="MICPUN_61362"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65874.1"
FT                   /db_xref="UniParc:UPI000199C17E"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB7"
FT                   /transl_table=1
FT                   /translation="MGILDAEQTDSATCVVLGRHGSSTPVMGAGPGPDRTAVATIHGDG
FT                   VVVYDCDAQTKTRSWAVGRGHALAAPAVFDRGCGRYFAALLPPGETDPALVTWTDADPI
FT                   ASLDQAVDSSSTRLPDGIAALVAVGEGNDGGVIVVDVGGGARWFGADARKLAASAPPGE
FT                   GGGDDDKKKKTKTGSASAKRVAETCGEANGGGGVVVVTADRSNVDVRTVTLYKVAGGEH
FT                   SGRSVKTAWEFEVSVPEGATRAVAVAGSDDDACVMWSNGVWRAYTSHDDESRMRTLVTA
FT                   GGANETPGVGGGGAAGKRAGGKRGAAASADNKVAVLPAASMASLGGGFYAVAQVGPGCG
FT                   GGARIAVLDSKYGCVHSCAETHPQGSSGGVETGVKIAALPDADGDRRLVVAIAGEVVLA
FT                   EVAVPGRTVTLLDVLGRLNLAAGPDGPAGPAIKVLGMANAREASKPPQYSIYTPKFPKP
FT                   TPRPTDPNAPPLDAMIDLGDPVENGWWGPDPAAEKMAEDAVNKFYAFDDEPLTATEAAE
FT                   MLNRFKTVEHVDIPPAVLAAGIEGCLRRKLWAPLRNLVDEGYLTHSCQAPGLAKRLVAA
FT                   GRFADLDAFLRLAHDVDGADIRACLEAFLDDEGVAVPAKAIEEVATRQVKFANDAVVEA
FT                   ERTAKAARTAKDRHALSAASAAKVALHRARIATAAVEAFDGMPRAPLLHALCARPLCPE
FT                   YATEALPDLPPASATRLVRYLSVWLDAYSGGDGKDDATESPVDAATTPPEGLPALREVV
FT                   AWAGAVIDAHFTAFAMNRGSADDTAGGDDEDSDAMATLRRAAARLQAGCASVGRVNGAL
FT                   VHVRDGAPLPENQGVQSSTYSIELVDW"
FT   CDS_pept        join(662528..662740,662851..665568)
FT                   /codon_start=1
FT                   /gene_family="HOG000100114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634098"
FT                   /orf_name="MICPUN_61363"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="membrane coat"
FT                   /protein_id="ACO65556.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG562726"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniParc:UPI000199C17F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB8"
FT                   /transl_table=1
FT                   /translation="MSLPDLPSMKDMPSLSSIGSSAAEGAKGVYTAANNVKLFQKNLRD
FT                   MITGIRAAKDKQKDYMNKCLQDIRAEVVSSDIRTKAVAIEKATYLHSLGYNMNWASFHV
FT                   VELMSTDNVKYKRVGYLAATQSFGDDTDVVLLIPNLLKKDLASPNPAEAALAIACLGNI
FT                   VTPELSQTLVADVYSLLNNHKPDLRRRACLCLYKCFLRYPEALRPSFARLTECLEDDDQ
FT                   GVVQAAVTVLSELAMHNPKTYLPLAPKFYKLLTTSSSNWMTIKLVKVFGVLTPLEPRLA
FT                   KKLVGPLGEILETTSAKSLLYECIRTIVAGMTSQEKIVRQAVDKLKDMLNDTDPNIKFL
FT                   ALHALTFLLESHPRIVAEHKGNIYGCIEHEDSNIQYCALKIVRGLVTKKTLMDTTALLM
FT                   GAMGKSEQRFRDELVWSVIHICMNDRYALVTDFVWYLTVLADLVRVPSSSHGSLVGDQL
FT                   VDICLRVEVVRESAVAILKPLLLDPSLLERSESNATVPEALKAIAWIVGEYAQYVADHD
FT                   AVIAALSHPNVANLPAPVQAVYVQSLLKVYASAVSMHAGSVRPAPEMPAPVLAAHEQLE
FT                   GMYVDPEMPKSSPVPMTASLHRLGEKIRTNVAPFCKSLHLEVRERGCQLKTILDMTFAA
FT                   EAETPGEGVALMEAFAVVLSEEIQPVSLKAQRKVEPAPELLLTAPLSKEWDGLLLSSDD
FT                   EGSDDEAPDRKKKKKGKGKEDRSVTELFTQKKSKEQIAREEAEAREMLQRHREKMGQYY
FT                   LGGEVPEAKEKKKKKKKGDAEALPEPEPEPELPLYMQQSMAGGKMARPTIKGEDDSSDD
FT                   EYAPKSKGGGSGKFKSKIDAAELHAGLGTYDPLKPLGRGEEMPSVEAYPTFDPYANEPG
FT                   GPPTNAFAVGAYRGKDKKKKKDSKKKDSKKDSKKKDSKGEKKEANNADKKEKKAPKADE
FT                   GKVKKEKKEKTAKTEKKESKSKDKKESKSKSDKAAKKLSKVSIGEA"
FT   CDS_pept        join(complement(668869..669129),c
FT                   omplement(<668566..668796))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634099"
FT                   /orf_name="MICPUN_84979"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO65875.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C180"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECB9"
FT                   /transl_table=1
FT                   /translation="MGGRLVPFERAREQRFIDGLDRYLKDQHARLKDVFDTFDRDRVGA
FT                   LNRSDVSTMIRALLPDATAGDVQYILTLLDIDSDGEVSFTEFLGAVLKILTDYVSSRGV
FT                   SLAQAFDEFDSAHTGFLTHNGLIAMLRKLIPNLSNAELKHMAHHLRQMDADGDGRVTLA
FT                   E"
FT   CDS_pept        join(671909..672160,672233..672595)
FT                   /codon_start=1
FT                   /gene_family="HOG000198223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634100"
FT                   /orf_name="MICPUN_61365"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA binding"
FT                   /protein_id="ACO65557.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG562727"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniParc:UPI000199C181"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC0"
FT                   /transl_table=1
FT                   /translation="MTAIDFESSGQRIDVSLEDVAAMALLYGFERPGPHSDTKPAAQRA
FT                   NLSDFFNVYGVNAFSKFKDKFRRETLLPPEEQKAMEQQKAIDAELNRYKFPEVTDAEFK
FT                   SALEQHDRMNRKWRIFKKPGGVAVRPEIFYEILGAKMQIESGDCTEEEPQWNDLGAVDY
FT                   IGKAIWRGHTGWKGKSKEEAMAGFVALSKKAKHNYSDNFFV"
FT   CDS_pept        join(complement(675007..675711),complement(673425..674988),
FT                   complement(672643..673352))
FT                   /codon_start=1
FT                   /gene_family="HOG000231586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634101"
FT                   /orf_name="MICPUN_97868"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO65876.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199C182"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC1"
FT                   /transl_table=1
FT                   /translation="MEKAVERLSGLQKFPDNIRNICVLAHVDHGKTTLSDGLIAHNGFI
FT                   SQKLAGKLRFMDFLDDEQRRGITMKSAAISLLYTPKCAVGGDEAQPEPLLINLIDSPGH
FT                   VDFCSEVSTAARLSDGGLVVVDVVEGICVQTHAVLRQAWEERLQVCLVFNKLDRLIVEM
FT                   GYTPTEAYERMRNLLNEINGVMSAFVSEKFISQADTLLATSTEGGALDHGGRDDGGEGR
FT                   DDEMHDDDDIESDHSTDTFSVERGNVAFACAADGWAFRTDAFAEMYASKLGCSCTALRR
FT                   GLWGDWFFSPKTRKIVGKKAAGGKLKPLFVQCVLDPIWKLYKVAEAERHGYPPEGGKDL
FT                   AAMAASLKVDVAEKDLKSADRKTALEAVMKAWLPLSPAILEMVAHRLPSPTGSSKRRVH
FT                   RLMPAPTLKQTLAADDDAALAASRKAVSRCDASEGSVTTAFISKMLAAPASAVHGKSTE
FT                   RNGGASVFLGFGRVYSGALREGDVVYVINGAYDPSEPDDGSCEEIVVEELYLMMGQGMF
FT                   RVKEVPAGNILAVGGLDRHVLKSATLSSSKMCAPFGNMMFQVAPIVKVAVEPESVADMP
FT                   ALVEGLRLLNRSDAFVEVGLMETGEHVIAAAGEVHLERCIADLRERFAKIDLKVSPPLV
FT                   SFREGVSTTGSATVTTSNGLLTIKATAAPLPPFFPRVIEDSADSLKQILLSAHQKAGDA
FT                   ADTLVPEIMGKLNKAREAVAIDGDGSEDVIEKTLSSAWSLGPKHVGPNLMSVGKMLDGD
FT                   RGRAEKQNGIIDFSDANVVKTIEGNALTGFQMACERGPLCEEPLFGVTVQLEVYSKVDA
FT                   EAGGDGEVGEAQYGPFSGQVASAAREAIRKAVLKAGPRLVEAMYLSVISTTSEALGGTY
FT                   SVLGRRRAKVISESIREGTGVFIIHSYLPVAESFGFADELRQCSSGASNAQLMLSHWEH
FT                   LDIDPFFKPKTEEEREEFGEDGYVGPNMARQLVDATRRRKGLKVEETIVKDATKQRTLS
FT                   RKA"
FT   CDS_pept        675982..676539
FT                   /codon_start=1
FT                   /gene_family="HOG000149081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634102"
FT                   /orf_name="MICPUN_84637"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65558.1"
FT                   /db_xref="HOGENOM:HBG636318"
FT                   /db_xref="UniParc:UPI000199C183"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC2"
FT                   /transl_table=1
FT                   /translation="MLNGTLTPLVLGGLFDGVLGAGGSQERPQGLGLHQYGDIITLGLC
FT                   PPAPNCVSTAEDLNDDSHFVPPWTYNPQEGRGIRNPATQEQAMEELVDVIQNTDCDGYE
FT                   TNIVTKLSDYLYVEYKSPRLGLVDDVEFFFAPDPSGSSSLARVDYRTSGRVDAPKSAET
FT                   QRKRIKTLRLALQKKGWKSVGF"
FT   CDS_pept        complement(676660..677049)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634103"
FT                   /orf_name="MICPUN_102327"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65877.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199C184"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC3"
FT                   /transl_table=1
FT                   /translation="MEANRSPSMRALDLTGSSDLLCVNMVCEKVGEPCVCRLSRVLERN
FT                   GRELRSLVLAGNKLTQLPASVFELQHLQVLDLSENELTEIPADVVKLESLKILDVRNNP
FT                   ISGIPKDVAKRFYGLVEIRWDGSDT"
FT   CDS_pept        678760..680217
FT                   /codon_start=1
FT                   /gene_family="HOG000198224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634104"
FT                   /orf_name="MICPUN_50575"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65559.1"
FT                   /db_xref="HOGENOM:HBG562729"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="UniParc:UPI000199C185"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC4"
FT                   /transl_table=1
FT                   /translation="MALLKSGEIFAWGDNYFGQLGLGYQSLRREPDRFHKTQHYYQPEM
FT                   IDKPTRIEHWDYFVQQKREETIGNGTVEIEYTAQVTGKIRYESDAIITHLEAGNFQTIA
FT                   RSSSGNVYIWGTNSLGQLGTCDCGACAHNYDATGDDPMGTCTAQKSPPAPPKPDASSLV
FT                   AGEDAPPAPPPDLTVYAWEQGCECNCAGAGTCKYTASRGDTDAVNEGKCVDFGANTKCE
FT                   CVEPFLKMQGSIYKMDQPMHFALGVATEYKFVTVAAGGAMFAISQSQCPTDDLGKVCSG
FT                   IGECLEADDGELSTCDCPFGTAGIKCEHSCPVGTEEDYLAVRAEHNIGKFPDTRYREDT
FT                   DGVMTGRVCSGHGQCDDVGKCVCEDFWYGERCQHMCPWDNQKRHCSGNGTCAYDPEIQE
FT                   TPYCICNRYKTTDKDPLVAQEAAKQCGERQLAVREGGWCSYYDSDQGFEACYQFGLCGV
FT                   CEDSGFRHSILLTLVISVLLRLLVLDR"
FT   CDS_pept        complement(680268..682982)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634105"
FT                   /orf_name="MICPUN_61370"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65878.1"
FT                   /db_xref="HOGENOM:HBG562730"
FT                   /db_xref="UniParc:UPI000199C186"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC5"
FT                   /transl_table=1
FT                   /translation="MHGARRRGDYGGGGARQKSGTPGGVGSPGPSKPTTFEELNRLLQS
FT                   RNRSLSTRINSVLQVLEENRDNLRGFFAACYQTLLWQIFNFDDGANGWLQSASSGNERD
FT                   AWLLLDFLSPNGQFMKAVLAADADGLMQFAFPLERLPERTQRMLRLDPAALNARLPYRN
FT                   CVQRDAHGRAHVHLGLYHYFLFWSAYYACSSARSPYGDGGGGRGGRNNPYGGYGYGGGG
FT                   GGHRSGAWMDWPMTTLGGHRQRQGIQPYRELLLSHLRCFLPRGDEAGRGGGAWGSGSQT
FT                   TPGAGWPRGPVGDASYRRANRVGASQGEMLVSIMAEFWLPGANEGALGAGAAVGAGGMS
FT                   PYATGVLDGRSNRAATRHHSPSSASPYGREMSPLSTMQRQYSYNPPSDDLVNAVNLLVT
FT                   YLYAEPDDISGDVKRGAQLSGGAQLGAPVSPRSPRSPRTPATPASGGGGGGGGFEAVGA
FT                   SKRVNASRSGGSPGVQDLGVDAEVERAKEMLQKPLYKFLRDAFVYWPNESTANLGPVMN
FT                   LWVTYLMPWTLSFPAPHRRRSGSGGSPTSRGIEKLSRGIEAVQAVAADIKSNSPKFVGD
FT                   RSPLSSSASPRRTKQPLDEMHVMRNVPFYCELMKHFLELCCNRVPVDAEGTATALYSVL
FT                   RSLASCPEAVRILEQVEAAFNEYAPVDPFAPGASAKEPPPPTPYDDFLPYIHEQIMDWD
FT                   PPETTNQDPMATVTPMGAPGARRGADPFALHGAAKPPAVSPKFCMFTMDQEGLPQVALA
FT                   LLERLDRDMAHVGPSHSLRQRVPKLRKAAFTVFSLERLGESVTARATFSTELNKPDSRT
FT                   DGNGSGKNAIGWARLGKSQTTSKQLYRGDWNTRPIHDMEFPPLARLLIALSEELNSGLG
FT                   LEGEKRISLRVFAEYGSMLGLSFLMLLFWLFFG"
FT   CDS_pept        683449..685566
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634106"
FT                   /orf_name="MICPUN_61371"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65560.1"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199C187"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC6"
FT                   /transl_table=1
FT                   /translation="MSGGRAKMKKVNWGQPITDYRIVIPRDYYFAGETVQGTLELKTHG
FT                   PISCRGVRVKLEGVGMCHWHYYEGAGEHRRRVDVHGEKKYNGCQKTAWGSTYNTGRIDN
FT                   AGDDAVWGHPTTPDEGHVDMPLQTAHGSKVVLRVMDYDWGTKDDELGECLLDVDELLAM
FT                   NGADVTVPLWRHAGKGVFSSGAYGPAEGNASNGVKPRSVVVLSCELSELEGGFGFQQGA
FT                   RRVVFKVKSAHNLRDADSMMGFRGYNDVYCQLYEVSGTDLAPGLPLPGPPDASAVQLPP
FT                   TRASIPFSFKLPRNLPSSMEPLDVFAAPVDRASVRYCIYSHIDIAWRMDPSCRRIISVI
FT                   NGPSSTIPKLLAPLHAVPQEKEVHPVNCESLCFCCSKDCVGQWCGENKSVSLGKVFLDC
FT                   HMDRRGYAPGETMFLSGIARNETDRPVTVYVSLVRTIVYTAKEGLTHKTRTARGEIPLA
FT                   SFEVPAHSTWQLEDGQLICPAIASDYFGGYGYDEEFASRNAQYGARYAERLVDPVKWST
FT                   RLMVLMDVPDTPFNLKQFMDVLITGLPGNPIVWEEYQQKRKGAALSMPALPGAQEMTPR
FT                   RSGDDIGVSVLGTAECPTWTPGAEDEQVRGDTLCIARTDEIAAADPQEDIKCDPAELTY
FT                   SPAVAVYKPDAPRKCKSPYKPDNPEVDCTMNPPGSMMICPYTGMPFVVPPPPPPQAQVI
FT                   STVAAPSMSMV"
FT   CDS_pept        join(complement(687142..687280),complement(685672..687005))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634107"
FT                   /orf_name="MICPUN_61372"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65879.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199C222"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC7"
FT                   /transl_table=1
FT                   /translation="MFDDLDDDEPEAWPRVEQRRLDESLRCAICGDLFGMPVSFATCTH
FT                   TYCSLCIRRTLEFKKECPTCRTAGDESDLRPNHALETVVGAYKAARGELLACARVGNGT
FT                   TPPVASAPPPKRRAARGGGREADDGSNGRSEGRGASGAGRAEPDDPPPAAARRSTRRSA
FT                   QADAAPATTTQLDPATTKAKDRSTKRTRSSARGAAAEDLPEPGRTKRRSAGIRPTQETE
FT                   TEEANGKEKVGQELGQGEHEIGEEIGEEDEEEEKEEESPQSPASWRTQGDDDAVSESDW
FT                   DGGDGSADVVDLSEDGADAGAPAADPGSGQNQRPGTVNCPICGIGILEGLINSHIDTCL
FT                   IRASEGRVGEVSAEKAPRGRDGADQNMAPRACTTAKLPKLVYHIMKDKALKKLLADAGL
FT                   NATGTRAQMISRHKEFTLRVNASIDSGHEPNVANIARDVTKLERDRTRAEKPNGLVVGA
FT                   LPTAAAAETNKADTFNKLIAAVRERSANSNRE"
FT   CDS_pept        join(687407..689239,689289..689342)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634108"
FT                   /orf_name="MICPUN_61373"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65561.1"
FT                   /db_xref="UniParc:UPI000199C223"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC8"
FT                   /transl_table=1
FT                   /translation="MGPRHTSSRRLMAGGERSVGSIMSIDPADLWVAADEDFQEWVLER
FT                   AYADNPAQCPLSADEDDPTCSLIHFAQGSLEVVHDDLRRVLPPAQLKEAIDILRVVGID
FT                   DAFVVRRELVNYKKTCLNIQRCATQLDRDLRQLVTFFKGSDDERIDIDDERIYVHSDRH
FT                   TALCDALGQCKGALGVMSDLRQFVKTVCCVSRHPAKATPEYLAGLPRSLKHLRKYVRCA
FT                   GDTVASQRGHTTVDEVHEADGDDDGADFHRGEESGAAHLARAMDGFAHLGWPPRIVSFV
FT                   RKSLVAKGAVKALWMHSELIRGLRHLETYLRLLRGCVTELEAAPNLVDALSASRLEGVH
FT                   GGDASSILQRVSRACRVRKELNQLYGAVEALGDQTTWLRRIADVPAERLFVAGDSDLRA
FT                   STSMFIPSGFRVGDLFARCRAVCDGEFPRMMDVLRHEGWPTHLLGRLGAEKRTETNFKE
FT                   TTCRVCARGFSSLWVHRFICVACEINERFELGRCPYRESCASPFCPHANRCFVCDSWSC
FT                   GECRLIRGDGEECLALAQQIEPDLTYLDWDRTVCTTRSGASPLKGTHAVDPDLLSMICS
FT                   RPKGSVHIVTRNSYRDDIKTFMARAGLPDDIPVHTGRFCSSMTLSPNTWTRG"
FT   CDS_pept        complement(<689491..>690250)
FT                   /codon_start=1
FT                   /gene_family="HOG000248673" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634109"
FT                   /orf_name="MICPUN_71216"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="ACO65880.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG621020"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199C224"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECC9"
FT                   /transl_table=1
FT                   /translation="HTYALKLAYDGEAYLGFQYQPKGKTVQGEVERALTKLTGHDREFL
FT                   GMQASGRTDTGVHARGQILHFYTKEPVSDLERFHKSLNGIMPKDVRCVEVMRPHPAFHA
FT                   RFHAVRKTYHYFLDPRLVLDPFVRRHALHCGWKPPSVERLREAAAVFVGTHDFTSFSNK
FT                   SRDKTLVRSPTRTIYRFDVVEQPDGLIRLEVEGNGFLYRMVRNMVGALMLAATGEDGKF
FT                   TAEDLRDMLEGKDRGVAPMGAPPHGLFLHEV"
FT   CDS_pept        690693..691985
FT                   /codon_start=1
FT                   /gene_family="HOG000265854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634110"
FT                   /orf_name="MICPUN_102332"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65562.1"
FT                   /db_xref="HOGENOM:HBG562734"
FT                   /db_xref="UniParc:UPI000199C225"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD0"
FT                   /transl_table=1
FT                   /translation="MAEAIKKLPVKGAWQVYVHKLRAYVMGDDGSPVRPHLMLVISTKD
FT                   GQFLACEPASGDDEAGGGNVVKDRPTPEALLAFLKRVMTHPRVMNTTAAGEKRKAARPE
FT                   SIRFADTHTASLHLGEKEKWAGETACPYVEGCRAGLAECGVDDVGFAPVPPDLIESIIR
FT                   AQIEPSMAPDNQEWGTQHLPGLSQSVDGFTDAFGGSLFAAAAEFARVSPWTALAKRRPV
FT                   QISYRLVLREDVAMRLTAYVSLVGSKEEGSFGFAVHKTLAEAKRAYEVEVGGGEDGESA
FT                   GESSVNGQSCMFASVYECPFEDVDDAERAGWDLAPMEDEPGERYWPIFCKMAFEKGEGG
FT                   TEDALSLTRPAIVELQCFELALKAVTALIKSGELRRADDENQSANDGKPWTVQCETFAG
FT                   SAGSEMATIDVEVSLPSLDDSAANEGQDAYL"
FT   CDS_pept        join(complement(692813..692915),complement(692501..692676),
FT                   complement(692210..692383))
FT                   /codon_start=1
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634111"
FT                   /orf_name="MICPUN_95085"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO65881.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG622018"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="UniParc:UPI000199C226"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD1"
FT                   /transl_table=1
FT                   /translation="MSDELVTLMSSEAEKFEVAQDVAFKSETIKNMIEDTGLEAPIPLP
FT                   NVSSKILQKVIDYCKHHSEKKEGEAEEDKNFDAEFVKVDQATLFELILAANYLNIKSLL
FT                   DLTCMTVANMIKGKTPEEIRKTFNIRNDFTPEEEEEVRRENQWAFE"
FT   CDS_pept        join(complement(693921..694388),complement(693427..693663))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634112"
FT                   /orf_name="MICPUN_84692"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65882.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG611003"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniParc:UPI000199C227"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD2"
FT                   /transl_table=1
FT                   /translation="MASLSLANAAATRRAGKPAVALSARRSVAAQPRVASHAGVAAGRG
FT                   SLQVFAVRSRSNTGGSRKGLMQYVERVNAPQMKDDLIPFRVGMTVRVGVTVVEGNKTRV
FT                   QPYEGIIIGVHKAGVATTITVRKAFQGYGVERIFPIHSPLCTFEEVRGAGKPVRRAKLY
FT                   YLRDRIGKQAKLKTRFVAKKTGPTRHQLKMEALAATKAAAAAEAEAAAAAAAAAEAAAA
FT                   PAEEEAAAEPEA"
FT   CDS_pept        join(<695524..695913,696205..>696936)
FT                   /codon_start=1
FT                   /gene_family="HOG000268807" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634113"
FT                   /orf_name="MICPUN_75728"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65563.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199C228"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD3"
FT                   /transl_table=1
FT                   /translation="DPAVKPDAADASDPSGSAFTRAGLPAHMVNAMRAAGLKRTTEIQR
FT                   LAIPHLVAGEDVVILAETGSGKTFAYALPMIAAVGAPGRGGTKVQGRCCPSMIVLVPNV
FT                   ELGRQVAYMAELAAEWVDTGEYPRPAGSKLAGDQEVIPEFRRAEVLVATPARLLAMMRD
FT                   GWVLPGRIAHVVVDEADEMLSRGFEREVAAVLETCYQDDGVNKFGGTVQFCFAAATMAE
FT                   EGPILSAFRRGPDGLRWVSTAHFGGLHPQLKQRVREVHGVEDRRAALLRALAEDKTHRA
FT                   LIFCASPEEADACAEHCNASGYVAMSFHGKTADRGVALDEFFNGDLPVLACTDLAARGI
FT                   DFPDLHHVVHYTPAADAATHLHRCGRTARVGQSG"
FT   CDS_pept        join(complement(697427..697664),complement(697102..697316))
FT                   /codon_start=1
FT                   /gene_family="HOG000246458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634114"
FT                   /orf_name="MICPUN_61379"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65883.1"
FT                   /db_xref="InterPro:IPR000781"
FT                   /db_xref="UniParc:UPI000199C229"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD4"
FT                   /transl_table=1
FT                   /translation="MVSARSSLPPDIAHARLFPPLGLLLREIRCDETVIDLLTRVPVTF
FT                   HQADNRHTIILVQTTSNKKSRTFMDFEKVSMAMDGVCTMFEKRLKEMYPHMKDITYDIA
FT                   DLYNYVDALADLSAMVYEPKINAYLPYNKEWVKKKAFAHLKRQAGQ"
FT   CDS_pept        697873..698514
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634115"
FT                   /orf_name="MICPUN_50579"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65564.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C22A"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD5"
FT                   /transl_table=1
FT                   /translation="MPSIWRPNVRVTLDEDGEVEDTERGGEELTKKGTKRKRAPPTKGP
FT                   CEHGVKYRSRCKVCGACPHGKWRSRCKECGGSRICEHGRQRNHCKECGGASICEHGRQR
FT                   HRCKECGGSSFCEHGRQRSKCKECGGSQICEHGRERYGCKECGGSGICEHGRIRFQCKE
FT                   CGGSQICEHGRQRSKCKECGGASICGHGRERRYCKECGGSQICEHGRRRS"
FT   CDS_pept        join(complement(699698..>700399),
FT                   complement(<698771..699553))
FT                   /codon_start=1
FT                   /gene_family="HOG000224767" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634116"
FT                   /orf_name="MICPUN_66643"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65884.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG457663"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="UniParc:UPI000199C22B"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD6"
FT                   /transl_table=1
FT                   /translation="RKNVYVETYGCQMNVNDSEVMLSVLKDRGYDETGDMHDADVILVN
FT                   TCAIRDKAEAKIWQRLAYFKSLRRKKKKSEKPVVGVLGCMAERLKTQLLEADQLADLVA
FT                   GPDAYRDLPNLIEAVAGTGEKAMNVQLSVEETYADIIPVRKEGAHAAFVTIMRGCDNAC
FT                   AFCIVPYTRGRERSRDPASIEYEVRLLSEQGVKEVTLLGQNVNSYAYQEGETDFLSMLA
FT                   AGEGVVGSDAAARRREGAVQFAALLDRVAAIDPEMRVRFTSPHPKDFPDEVLEVIARRP
FT                   NVCNCLHMPAQSGSTATLERMARGYTREAYLTLIDRVKEIIPGCAITTDIISGFCGETE
FT                   EDHADTVSLMKAVGYEQAFMFAYSERDGTSAARHQEDDVPEDVKQRRLAEVIDAFRTTA
FT                   AERQKEEVGRTHLVLVEGPSKKNERELTGKTDSAKWAVFADTPVGIYGGDEDEERTGGE
FT                   KGVATPRAGEYVAVRVTGCSTGTLFGECLGRTTLTAF"
FT   CDS_pept        <701042..>701566
FT                   /codon_start=1
FT                   /gene_family="HOG000006002" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634543"
FT                   /orf_name="MICPUN_72929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65565.1"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199C22C"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD7"
FT                   /transl_table=1
FT                   /translation="RAMSGRAEAIQEELEALESMYPEGLRVTHGHDARAQTTVALDVAP
FT                   RTLDDETRQYVRVTLRIVLDDDYPAAAPSLSLTDAKGLDDARIATVMGRLRDAADEHAA
FT                   PGDPVLALLCETAFETLTELNHPDGDCAFCLEPMWRADHPSSRDHSAEAFTKLAKCYHC
FT                   FHASCFARWYRW"
FT   CDS_pept        complement(702382..703815)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634544"
FT                   /orf_name="MICPUN_61383"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65885.1"
FT                   /db_xref="HOGENOM:HBG611006"
FT                   /db_xref="UniParc:UPI000199C22D"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD8"
FT                   /transl_table=1
FT                   /translation="MTAVCRIAGSVAGFRAMPPRRSAVRAVRIPRSFGGATDALRGGTT
FT                   RLDRSRVVLAASSDATPDLPSESAADAPVAAEIIEEKPPKMAPFVPPPIAAPVIVGDKL
FT                   RARDVIKETVRMSVRDLLPCVALICVAGAAAQILNLGGTFLLALIQLHDVDIVAALFLM
FT                   CVQFWKLCCEIMARIAVMRNARDVDAGDVTRFQRVSVVEAWRTITGAYEGWRDVLFIDG
FT                   RRMLSIAWNSLLTIPIPYLGVVKILDYALCVPVYLFEGKTGKECLRRSEELMLGHRLTL
FT                   LRAAFGLGGMLAAAFGLSVGAFTVICPSLPQLLMPPEPEPGSAAAKASRWVEGVVGSAG
FT                   DVAAESTAEAAVDAAVVGAADIGEAAKGLFDGTSFDRVWEVGTATEKASTIALLSCAVI
FT                   GSFVFTIMLRHLLYVMHREVSARWKPPPPPEPAEEGKKGGLLSKLMFWKKKSADAPAKD
FT                   EGAGEGDGGAGIAPKPAPA"
FT   CDS_pept        complement(703966..704313)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634545"
FT                   /orf_name="MICPUN_108905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65886.1"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniParc:UPI000199C22E"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECD9"
FT                   /transl_table=1
FT                   /translation="MTVFKQKISTFREACYLIFGFKVDMGEDRGTGLPTFTLRSMFASR
FT                   DDEAMVFRVAPPKVGATGNETGGTVELLPAPYTSTDEMRRMIDMYVTRWSSVPGFVANL
FT                   TMELFNKQTAA"
FT   CDS_pept        706421..706921
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634546"
FT                   /orf_name="MICPUN_61385"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65566.1"
FT                   /db_xref="UniParc:UPI000199C22F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE0"
FT                   /transl_table=1
FT                   /translation="MGCGVSLGGGGGMSSDDGDLGPGDRRVARGVGDFFGDFFGDFFGD
FT                   FFWDGEGSVVFFFGDFSCAGVALFLGDLLAAGDSSGAAAVTLEARLVERPVVMATTFSE
FT                   VSTAPTSVLLRFAAAGFSAATGAADAALLRRLDVRVPAGTSGSSDGVEAVFATACRHEV
FT                   CAR"
FT   CDS_pept        707471..707926
FT                   /codon_start=1
FT                   /gene_family="HOG000180723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634547"
FT                   /orf_name="MICPUN_108906"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO65567.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG747651"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="UniParc:UPI000199C230"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE1"
FT                   /transl_table=1
FT                   /translation="MGRMHTPGKGMSGSALPYKRSSPSWLKITSQEVNDIIAKMAKKGL
FT                   TPSQIGVLLRDNHGVAQVSSVTNSKILRILKGQGLAPTLPEDLYCLIKKAVSVRKHMER
FT                   NRKDMDSKFRLILIESRIHRLARYYKLAKKLAPNWKYDSATASTLVA"
FT   CDS_pept        join(complement(709245..709301),complement(708591..708908))
FT                   /codon_start=1
FT                   /gene_family="HOG000264377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634548"
FT                   /orf_name="MICPUN_108907"
FT                   /product="Predicted protein"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="ACO65887.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="HOGENOM:HBG562739"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="UniParc:UPI000199C231"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE2"
FT                   /transl_table=1
FT                   /translation="MARPAAAPMDSMHRTVAAPIYAARRAMGDKAPVSTDWEHATGLEL
FT                   KELQAAAEGKDFFDHYDFLKQPNGTKESPVVVTSSMPYRVVGATDPDDDTIVHWGRVEA
FT                   GKPPVKIGSEWFVHKAEEPH"
FT   CDS_pept        709524..710003
FT                   /codon_start=1
FT                   /gene_family="HOG000214661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634549"
FT                   /orf_name="MICPUN_102339"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO65568.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG562740"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniParc:UPI000199C232"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE3"
FT                   /transl_table=1
FT                   /translation="MAVLFLWILAFLVLGAVMGINLYALICLSDLQADLINPHDCAGRI
FT                   NKLVMPEIIAHAAAAGLMMLCGSWSMVLVNGPLIAWHVRQVGRNQHLADVTEIFNQLDK
FT                   EKSVRVGKAMVYALVFLTAAYRGTERGVNMFLDPDEKAKMAEFFKDAVASSVHHF"
FT   CDS_pept        complement(710174..710782)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634550"
FT                   /orf_name="MICPUN_108909"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65888.1"
FT                   /db_xref="UniParc:UPI000199C233"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE4"
FT                   /transl_table=1
FT                   /translation="MFAVMGRTAPASAMSAGRVAVGARRTTVARVPPAAGVRPSARSVG
FT                   NKARLFGDDDRAQSLVARAAEDEPAATSAPAAGEPEFAFEPKSKSKRPRRDGSKTKRAT
FT                   LKVEGLAIEAAKGTAPVTMQSASEEAFILFLLAYVAVIFLAGLVLAISAFGVLPESVDG
FT                   WVTETLYPAYSPIVVGFLLFSSVYGLIKTRSDPDSASGR"
FT   CDS_pept        join(711344..711576,711663..711717,711865..714159)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634551"
FT                   /orf_name="MICPUN_61390"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65569.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199C2D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE5"
FT                   /transl_table=1
FT                   /translation="MGEAGATEPVSPGASAETADTSNDGNAANDDPARDIKPSELLQWL
FT                   RCVVAPATREDSAALRRCPTFLQPDPVTGQTDASVALRTGRQPVSAGGVTGGDSEEVNC
FT                   IALDRYRVATAVVRMQPRRGARGGSGGSARARAAAWNFLGGKATLTKPSVIRVGQQFQA
FT                   EVPAWHGPVPLDGSAPMMPEEIDLVALPEKEDAPGNEVAVYGVPAPRSKRVDARREKEE
FT                   AERLRQAREREELERARRERARRAMEQSRLARETEPERAERLGGFRIWPPEGVFVRTRG
FT                   YDASGGSVSTLQSLSASAGSVGTPLALPSTSGDKRKASDMTDSEDADDPTKRPRTRDNE
FT                   GGLLDGIRTVLAEGSLAMIRAAAAARAAAAAARALASSRLSPRKSGARDLSKPDYSDDD
FT                   DDGDNVKGSLMRAAMARADADVAGANAARLVIFGAPEAIVPVGDRTGEAGKKAGVEWEE
FT                   PVDPPKPKRPTPEEIAAKRSRLDARLRGRRSSPTLMGLEQMGIGSAEARGWTSVQATAF
FT                   EEQMVAHKYNLFAVSRMGRKKPPKTKCGPEEEMLQEGNEFLGKDKENDKAGDNRAIDDE
FT                   KKDAAKDETGEPNGGGERAPGVELDVDDVPCLKCGETDGEPDFVLCDGCPKGGHYQCLG
FT                   LPGVPEGDWFCADCVKDKETHLSPRKVPSADDFDEEPSDERLKGKTLHDMVDYYYNNWL
FT                   TRPGTRDDDDDRSVCDDDDVLPAKRKSIVSAKLARTISQEKELARLGIVDSPARKPAPK
FT                   PKKADPKKDAERASKKVDELLRFTQRCARFPRKTAKTLAPSALSSKQALVRRWRRVMIV
FT                   SDAGEGAGDEAEAELARKKLECVEATLTRAFENPQYPKADVAFSDDVA"
FT   CDS_pept        714349..715335
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634552"
FT                   /orf_name="MICPUN_102341"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65570.1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniParc:UPI000199C2D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE6"
FT                   /transl_table=1
FT                   /translation="MRRDTPSPTATAHLERNDREEDDLVRALLSQHKAEDTADGPPGHS
FT                   HSLDDTYYHDGPEPPQAYRNSMPEDRTCACHTSPLASVLCWLTTPLLCAPLCASCVTVP
FT                   PRTAVVTTVFGRFWHNYTTPGLYFVNTCGRETTIVSLKTTSVELPAVKVADARGNSIVV
FT                   SGVVNYRVFDATRAALDVAHLPNFVKVNAHASLKRVASLYPYETNDGTPSLKTEAALLG
FT                   RALRRALQTKLDCAGICVVSFELSDLAYAAEVAPMMLVRQQAQALLDARGVIVAGSVGI
FT                   VDSCLRQLTKKGHPLTDRDEARLVSNLMTVLAGETRPLPTLSLTDAK"
FT   CDS_pept        complement(715455..717938)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634553"
FT                   /orf_name="MICPUN_61392"
FT                   /product="Histone demethylase"
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65889.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199C2D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE7"
FT                   /transl_table=1
FT                   /translation="MGRGSGQGHSGGMTLPVNAGVNGDTVAKAPRRITPQAVVDDDVAT
FT                   GSLGRRARQPSAKALDAVPDKRARLDDTPRNGHGAHDDPFMLELRAFFQEKLDGRVLVV
FT                   PKFCRHPLDLGHVYREVVARGGYKAVCDNRRWKEVCATLGHDLTGQTSAGFQMRQNYER
FT                   CLLEYEFAEHGRSLELVPDAIANNREWAAKWNRTRPAGDTGRGPAPDAGLGPTPPLVNL
FT                   NLDKARFNAAYNMDDADERRTAHTLGLYDAVEPFELSFLFPGADLGVYITVRNSVLCRW
FT                   RANPNAYVSVEQACGWFMPKHRAVVHCAHRFLTVAGYINFGVGFTGNYPAPGASKGTVV
FT                   VVGAGFAGLAAARQLQCLGHRCVVVEARDRAGGRVWTERLEGIDPETNERVVAACEMGG
FT                   SVLTGADGNPVAVIAKQMALPFWKIRDECPLYLEDGEPVDADTDKRVFREFEDCMNEVG
FT                   EKRNQLTETDEHGADHLSLGRELERTWAEKARAGNKPQIETDLFNWHLANLEFANADRL
FT                   EVLSLGQWDQDDPYDFDGDHVWLPGGNVRLVSAMARELPIFYGHAVTSVEYPAAVGADP
FT                   QLEGPAEPVKDREGRAHEGVVVTCKNGREFRADAALVTVPLGVLKKGSVQFEPPLPERK
FT                   SRAIDALGFGVLDKVILLFPKPFWDMSVDTFGYVARGDRDRRGRFFMFYNYAKTDEHDL
FT                   SGGAVLIALVSGEAALEFERSGVANAVAETMTVLRRIYEKRGVTVPDPIDSKCACWGTD
FT                   EFAYGSYSNISVGATGEDYDALAEPVGDGLFFAGEATMRRHPATMHGAFLSGMREAARI
FT                   SEKMRELNKAGKLAR"
FT   CDS_pept        718495..718827
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634554"
FT                   /orf_name="MICPUN_61393"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65571.1"
FT                   /db_xref="UniParc:UPI000199C2D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE8"
FT                   /transl_table=1
FT                   /translation="MTFQIYVGGQRVNSDFITSTPAWASQQVSLPAVKSRQSGFHRWEG
FT                   GASNDVEDPRTDPPRIPFSTSQPNKSRKRCSDDTDEAAMSAANSKRQQSSPLGSVTNLL
FT                   VHGTEQ"
FT   CDS_pept        join(719092..720319,720357..720373)
FT                   /codon_start=1
FT                   /gene_family="HOG000276738" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634555"
FT                   /orf_name="MICPUN_61394"
FT                   /product="2OG-Fe oxygenase protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65572.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199C2DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECE9"
FT                   /transl_table=1
FT                   /translation="MSTAAFSRGPCATASTSASTSPARARRIAPRRPSGRARGSRTRRG
FT                   ASPRAPEASAASAATSTFSALPVLQLPDEDCTPEEEAAFCVRLRDVCHTVGFFYVANHG
FT                   IAPKVTVDVLEASRAFFALPHDVKQGIANVNSPAFRGYVRLGAENTAGRPDWREQIEMG
FT                   VEADAPGEETGAEADAAGVDADAAGGVDAYTAGDRPVYDVLVGPNQWPEESACPGFRRR
FT                   VTAFLDDAASLSRRLMELLALSLDLPRDFFDDDFRGRPNVQAKIASCPSAPEGSPSSAS
FT                   SFGVGAHTDSGYLSLLLQDDVGGLQVQNGHGEWIDAMPIDGTLVVNLGEMLQLRTRGYY
FT                   LATPHRVVSKAASGAGSPPRLSVPYFWNPRLDAVIEPMESLPETLTWLRPEPEDVAETR
FT                   SHGDGGNRLIGLTPR"
FT   CDS_pept        complement(720482..721345)
FT                   /codon_start=1
FT                   /gene_family="HOG000004797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634556"
FT                   /orf_name="MICPUN_61395"
FT                   /product="Peptidyl-tRNA hydrolase, potentially chloroplast "
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65890.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG610927"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniParc:UPI000199C2DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF0"
FT                   /transl_table=1
FT                   /translation="MGLLAVVRKVVTAPMRLIERVRGHGSAGAGVAEPGRWLLVGLGNP
FT                   GSRFEGTRHNAGFDVLDILARTEGISWTDAARHRAKVGVGKIAGVPVLLAKPQTYMNLS
FT                   GESVRSLCRWYKIPNSNLLVVYDDLDTAVGAIKLKGKGGHGGHNGIRNIIDEVCGDKVF
FT                   ARVKFGIGRPKPGVEVYDHVLTKFGDDEATELESKGTWAKACDAVRGVLVDGLDKTMSA
FT                   VNTEHKAPKPQKEPKQPKEPKEPKEPKEPKESPAAAANEGDAPAVTVDTNVRDGAEKVE
FT                   MDSTPL"
FT   CDS_pept        721450..722259
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634557"
FT                   /orf_name="MICPUN_61396"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65573.1"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniParc:UPI000199C2DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF1"
FT                   /transl_table=1
FT                   /translation="MGAALSTRKGRESKSGPTSGVVNPQHASTQHSDVHVDLNDPEVSS
FT                   AVREYASRVSQFTEADERWLRSNQDAKRLDANVRVVGVAARHAVTGHPVVLVTYPLRVA
FT                   YDRSRAGRKGYSTHKWDSRKKDGRVPWTNTFWLVCPEVVSAVGRLEHAGLVRDFHAKFV
FT                   KGDPTHDADAAATFAKQHARYAAFRWSLLSDEDKEHCEKEGYASVLRDCGVGGLRFVNQ
FT                   VKCLHLQYGHYLASGGDNVVGEWTRAELVRRGESIGRGEDASAPVEG"
FT   CDS_pept        complement(722341..722922)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634558"
FT                   /orf_name="MICPUN_108910"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65891.1"
FT                   /db_xref="UniParc:UPI000199C2DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF2"
FT                   /transl_table=1
FT                   /translation="MEGDIKFDLDVTGTGFEVGLEEGKPFVNFKEPKVKFVNSNAATAA
FT                   AHLQLGMSAGVESNVQVCFGGKICSGPAVELGQSVYAGIDTVASSKTADFEQDKCNPRE
FT                   FELSARFVEWDYPDNTKGECTIPDGKDGQLAGMGAYVQVPAPVFNIGIMNEYPAAVDLL
FT                   PKYVSIYAHEGDDVLMKEVKHECSLMMLED"
FT   CDS_pept        727421..728596
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634559"
FT                   /orf_name="MICPUN_108911"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65574.1"
FT                   /db_xref="UniParc:UPI000199C2DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF3"
FT                   /transl_table=1
FT                   /translation="MDDEEREQLAREIIRTHIALLGKVERHTDKVRAKADNYVNVIERI
FT                   TLLELSKVHAALLGFNGDFSKVPAMSEHPQLGGPIQQGMKDAKAKMTSALDGMKDIKMG
FT                   FFVENRQSITFTVSLDAGQMIEGDLLQSDAVRKKFKNPITFGQEVYVGFGFSTKVDLLL
FT                   EFKMPWAAFSALGGDFEFELAMEGAGIELGIEKGKVKVEAIKPKVTLTPKGDASIALHV
FT                   HSGMHGRASGYMSLCFWSNICVGPEVSFQQGLWAGVDAFVAQGSSALDECHGGDNFEKE
FT                   LSTMFIDWDYPDETKEKCKTDDDDESLFAAGLGAYFQLDSPTLDVLIVTTTPDDNSNCG
FT                   GSGECAIDPLVLYTNRDAPPMVQQQIGEPKCAVCTFPFTCESKKSYESTKE"
FT   CDS_pept        complement(728678..731263)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634560"
FT                   /orf_name="MICPUN_61399"
FT                   /product="Predicted protein"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65892.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR021602"
FT                   /db_xref="UniParc:UPI000199C2DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF4"
FT                   /transl_table=1
FT                   /translation="MAAALASAARVARARVDTRAALSEPSSSSATPRGVRGSSRGASST
FT                   GSRRGGARGGGRAPRPRGGTTRGGGRDWPSVTLGDGAVTFGSPDDAMRFFNRLLETSPV
FT                   DEDWPVAGETHAVLLDALGRHPDARDKMGDGVATFRVSLHPTEGYRSFVATRVDGTAVD
FT                   FSLRKCVDAMFGVDARQRGGDPASALTATISRAESVAMTLDLVARHVDEFDRIHVAAAM
FT                   HRLARLAQRDNNSSAGVVPRVRFGDDKRWRDVVKVARDMCDAGELDARAHASVVHSVAA
FT                   AVDAGAVEMTSTGVYDLLTSLERKTPDALEKHSTGVEVANLLWGFAKIGWQPSRATWEA
FT                   TERSVVRAARNGEMNAVETSNVAWACATLGWELTDDAWRALDLSAANCAGTMTPQGVGN
FT                   SLWAYATSGRLPAEATLRALEAAIVRVEPELSIRDQAVAWWSFAQLGSVPSDRCARSLE
FT                   RATRRLARSMNARDVCNVAWALSTLSPGLVPSVETLRALAQAERRLAPAMTPSDVAGVM
FT                   MGYALNDVRREGLLAISGDDTWRALEAAAVRCAPAMDAAHLGGVMYCYAACGRRASSNS
FT                   WAVLERAVVAVAPSADASHVAHVVYAYARLGVVPGRDAFDALDAAAARTAGSMSARNVA
FT                   NALWSFLALAATRGAPLPRCYGALWRAAGELDTRAMLDVNWCNFFHAYLIHAELIGVSA
FT                   VGKKGVGVDVVLDRPDAAALVDGARHFPPWLAVDAEEAWTRNAFEEVEVSSGHREVAEA
FT                   LAYLGIGHEMECLTDDEYFSLDLYVPAHDCAIEVDGPTHFVDEIVVLETGDVGRVTRRT
FT                   TATELRDMFLRKRHGRVVTMPWFELDECDTREERAAYVAGKLRAAGIEL"
FT   CDS_pept        733809..734894
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634561"
FT                   /orf_name="MICPUN_108912"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO65575.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="UniParc:UPI000199C2E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF5"
FT                   /transl_table=1
FT                   /translation="MKQRVDRVKVFHGTWAQGAEAEGPGSITIASLLDSMDWMPPTMIA
FT                   ENISKVIANMDRKKGRIFWRSFADRVHSPVLAHIKADLVDTYDRVGWYLTQFIGPVPEP
FT                   YDPAMLECTGTDSRPVNSFLDDVAVMAAMAKQGLASKKDVRAFYKSQGKRYDGFREALL
FT                   PGRDLLMQHAVPWVKTPKTWISVGCGTARDIEFVTGHVKAAGTKVILVDLSDALLDMAR
FT                   QRVIDLGLQTQVQLVEGDINDPKIRKQLPEADLVTCSYCLTMIPKWKDALKNMLDLVKP
FT                   GGNLALIDFVTREGRESNWDQKLYKWWFAMDGVYFNREHVDWLRAQRSLSTIWYSEEES
FT                   RVPYTPYYPTHYLYVGEKKAK"
FT   CDS_pept        735763..736845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634562"
FT                   /orf_name="MICPUN_61401"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65576.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199C2E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF6"
FT                   /transl_table=1
FT                   /translation="MSAMSSLSLAGSARVRSNSAASSSTSKSRSSVAAPARAAVSDGNG
FT                   AGDRPAPGTKHAVKLDGPKRGEAMRRDAISYPASPTAPERAKKRVPAKKRVPAKKRVPA
FT                   KETESAPERAKRLIAREQETAPERAKRLIAQEADQLNSMVVQLPSGERVTPWWRKGPNL
FT                   RNVVDVRSADEFVAYLHEAANLDRKTGRARLVCVEYFAGWCHACRSVHPKLGKMAEKEF
FT                   PDVLFLRVHKDDVPELCDTLGVTKLPFVQLYKGVDGLVSQFPVSVTASALARFRGELNQ
FT                   HRDGNVSLTDAHDGVSRLGVATTLHARGWPSHYTSAHKKLRHRALKYYRGKGGVKGDGL
FT                   PPPGCPKEPPEGESAGVMSR"
FT   CDS_pept        complement(736961..739594)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634563"
FT                   /gene_name="TOC86"
FT                   /orf_name="MICPUN_102350"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="GTP binding"
FT                   /protein_id="ACO65893.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG633303"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="UniParc:UPI000199C2E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF7"
FT                   /transl_table=1
FT                   /translation="MADSTDDEEYEYDEQASVSEDYPDESEDEQSEDVEEEEDEPEPAP
FT                   APAAPTVSASAAPFVPASQAAPAPPAPAPAPTPPAPGANPTAQVSDPTEIRALQALNLM
FT                   ATGVMTRDLALVEGARSAAEFAARVRSIADAQPAPSRPSDEAVRRLTTDLAPLAARLGK
FT                   FQTRPNDAMAEPADFDRSAEPAAAVPTPAPATSSAAPTLPVPARVAQPPPPVVPEDELS
FT                   ADPGDKEAMTAAKLQSLRVNLLRIATRLGQSPRNTVVAQVIYRLELAEQLKSGKKQPAA
FT                   PAGRGSTTSFDRAVALAERKEKNDGADSDLGFTCTILLLGKSGTGKSSTINSLLGENTA
FT                   AADAFRAETKKVRMVEHKMHGMTLRLIDTPGLQPSSSDISYNSKIMADAKRFTRRHKPD
FT                   IVLYFDRMDQPARVDLADLPLLKTITATFGASVWFNAIVVLTHGSSAPPDGQNGQPISY
FT                   EMYFAQRSHVVQQIIRQAAGDMRLMNPVALAENHPMCRTNRAGERVLPNGQVWMPQLLL
FT                   LCFASKILTEANSLLNLQEQNAKAAKAAAQQQKVPPLPFLLSNLITSRKPFKLVGDDDD
FT                   EYDDASDIILGAPSPYDVPKDQQEEMLPPKQVAVPAPDPQLPPSFDGESVGHRYRFLEP
FT                   TSQWMVRPIVEAHGWDHESGIEGFSVDKGFVVFNKHPGNMSGQLTKDKKDSNVGFEGGV
FT                   SVHHTKKLVTTTGVDVQTVGKQLAYTARGETRWKFCAVNKIAAGLSASLVGGALALGTK
FT                   LENRWKVTPGAKLVVSAGAVSANKDVAYGGNCEAILRHSDDPGNPNSSTVGMSFMNWRG
FT                   DVALGGNAMSSITLGRDTQLTARANLNSRGAGQLTLRATTNERLQLASLGLVPLLAALI
FT                   GRIRGD"
FT   CDS_pept        join(740324..740511,740674..741307)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634564"
FT                   /orf_name="MICPUN_106051"
FT                   /product="Putative uncharacterized protein "
FT                   /function="amino acid binding"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ACO65577.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniParc:UPI000199B92C"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF8"
FT                   /transl_table=1
FT                   /translation="MSIVASVIAPTAPVVASVPRAPVARHVPLPSQKVARGPAHRGLVV
FT                   ARGGEISWDEADEILTLDLGGEHADIQVDVKDKWTAEVMVKAPDRPGLLNDVCAALNDN
FT                   NLHVVGAEITTVEGKGENKFVVKLPEECPVTFGEGDSFFDDEGELCGTMMAKVRAVVVE
FT                   AALKSWSEGAVAKKPQYIPPEESKVEAKVTATVVETSLTKTGQCVVISMEATDRKGLLN
FT                   AITSALRKLNCEVLSGSVATKDGIANNRLVIAAPSNMKSEKIRLAVEALVK"
FT   CDS_pept        complement(741476..743080)
FT                   /codon_start=1
FT                   /gene_family="HOG000233857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634565"
FT                   /orf_name="MICPUN_61404"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65894.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG407205"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199B92D"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECF9"
FT                   /transl_table=1
FT                   /translation="MAPVNPVEESEVKLSQNGSASGHAESPKGSPVAGGPGASSDPVTW
FT                   ASTNNLQDLVAPPDLHAYNSAVGGSGHAASAYNDSNYEGTSDEDRDSNRPGTYEFLKYN
FT                   TRHLTAEVLFCSSMGNLRRLKMVLNKAGKTIRDENYADYDKRTPLHIAASDGSVFVTNW
FT                   LLEQGVDVNPLDRWLMTPLEGAVFGDHQDIVQMLVNAGGMIMDRTTKTLVPLEESHLAS
FT                   ASEAKPVLTADLMAWEIPDDELTERTEIGAGAFGVVMKTRWRGTIVAMKQLHRHLHHDE
FT                   VAKAEFRTELKLMRQLHHPHIVQFLGTSVEPTTGLVSLIFEFMHSGSLDQLFRKAQVPL
FT                   SKGHALELALDVARGMSYLHGRKPQPVIHRDLKPGNLMLTRANRLKIGDFGLSKTLSVR
FT                   NKMPTDIDQNFTMTGETGSYRYMAPEVFRHEFYGPAVDVYASSMIFYQLFCFRQPFYGI
FT                   NPVDAAKMASIDALRPTMSKNLMPPDLARVIRLMWDPDDQRRPTFPQIIQILEPLAEKY
FT                   QQEDKEIAAGGKCCVIQ"
FT   CDS_pept        join(complement(745390..745644),complement(744571..745269),
FT                   complement(<744337..744486))
FT                   /codon_start=1
FT                   /gene_family="HOG000084095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634566"
FT                   /orf_name="MICPUN_84843"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO65895.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG597651"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199B92E"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG0"
FT                   /transl_table=1
FT                   /translation="MRAWTRDTALAALEPVDLRWTVGDDVPPVGRGLRNLGNSCFLNSI
FT                   LQALTHTAPLAKLCLARRHTANCALTNAREPCAFCIIERHAIAPEEVFGNLRLLARHFV
FT                   RGRQEDAHELLRLSLEAMDDSCLANCGRPSARRGGHRGQSSVVFDPETGARLAPPTAVE
FT                   RIFQGKFRNLVRCARCGHESKTYDPFLDVSLELPGREDRSSHGGGYGPGYLRGSGSARG
FT                   SVESALKNFTEEERLEGENAYRCERCKDLCPATKRLTIHEAPAILVVHLKRFDHYGGKI
FT                   NSPVDFTERLTLGGHMSEDAEEAGPAYRLYAMVTHSGNDAIASFYGAATNASDDEWYLC
FT                   DDSSVRRVNRADVFDEQAYVLFYERDEE"
FT   CDS_pept        complement(746245..747867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634567"
FT                   /orf_name="MICPUN_61406"
FT                   /product="Predicted protein"
FT                   /function="copper ion binding"
FT                   /function="dopamine beta-monooxygenase activity "
FT                   /biological_process="catecholamine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO65896.1"
FT                   /db_xref="GO:0004500"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0006584"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000323"
FT                   /db_xref="InterPro:IPR000945"
FT                   /db_xref="InterPro:IPR008977"
FT                   /db_xref="InterPro:IPR014784"
FT                   /db_xref="UniParc:UPI000199B92F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG1"
FT                   /transl_table=1
FT                   /translation="MRGDMLSVRALSAIAILALLSPPVVRPVAAGGVIAPTRGVTDRVL
FT                   EDVGHDGVGQASTPTASQGNAASWVRKALRPKLVDINLDDAKADGGALGSSSRPASGIK
FT                   DLPADAVAVDVRFDYVVPDTNIEGTTGRPDTLIACKSFLVHPESVDPYGGELDHFKDLG
FT                   ADPDLDRRGGEDVAARNVNIVAIEPMPGMHHVHHMHLHVCSDDSKSWARHRRTFEDALD
FT                   PGFDELGTTPARGDKPLYCAPPSWDRGSGCHGTAWTFLPGQNGVLFPEGVGMRIGDGPL
FT                   DLRRLILEVHYDKANEYPRVRDRSGIRLWTVPRDDAVVHRAGVFSVADPFARLPQSLPP
FT                   GEKKVTYDTFCPPGCTKRFETNMNVFASMTHAHLRARRVVTSVGTPDARTGEVPDDAWR
FT                   SVVNDDGSGTATGHFSHEDQKFVPVDFTVKAGDSLKTSCIYDTSADNAPIPFGPSTQDE
FT                   MCMQVFLYWPKQYTFLCGYYGDQAYWCGDAGMFVPKDGSDRQYHSEACHVEAGQSCDDR
FT                   NKELGFPLKDAPDKGEPITFLTR"
FT   CDS_pept        748121..748747
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634568"
FT                   /orf_name="MICPUN_108915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65578.1"
FT                   /db_xref="UniParc:UPI000199B930"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG2"
FT                   /transl_table=1
FT                   /translation="MIAIASAVAIAPRVWASVGSNGRVARAIQTRAPQKITIGATERRT
FT                   SVVAASGKGFFSEPTNDGATMFRFYDENDAAAKAAAKAAHEAATGKKDEPEPEPEKPKA
FT                   AEAAKPKAVEASKPAAKKEDKPAAKKEDKKATGAEDDALTSAMNDWIAALPEKAREKLV
FT                   GDLSKCETEEEEWTVLVASAKADTTKVREKQKEVLIAEAAKKGFK"
FT   CDS_pept        join(complement(751291..751350),complement(751100..751162),
FT                   complement(748862..750988))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634569"
FT                   /orf_name="MICPUN_61408"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65897.1"
FT                   /db_xref="UniParc:UPI000199B931"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG3"
FT                   /transl_table=1
FT                   /translation="MPSLHDRHVYIDTGYDRQEHDFYENLFMSEKIVDGHVKLALPTVE
FT                   SSEDEEEAWSKWEAANHRRYQHEKELARRSGRSPSGSSSKSPSMSGILRQKKRPESPVG
FT                   RRGPRARNDPSYAALLDRRDQNTRKVWEAKMKAGDDDEETTRGRSPGKLGSKTKTPSKA
FT                   FDSSDDENYPSAGGSGSGSRGRSRQRGGIVREALAAQLAESRQHLATTGGYSPTDLAPR
FT                   LAGAVPAPSPRRRPSSAPRSNASPGSSLVVPRATYSRDYSQSPGRRSSDGTCVPEDDEI
FT                   AFGRHATFEGRAARERRREALGIPKPSRRPSNATTTFDPPRLHTASRPREREENRAAEE
FT                   EAWRRRAMVDYVVRTAVGYGVDGEPRATHWDDPMLAAAEQAAANVREATGDEDAARAAA
FT                   RRAAAAAAALVNAAGGGHSPTTRHVSRHAAPRLALPPPADDGSDDSGSEYGDFERELAI
FT                   AGGQRGALAVSAARKPPAAHPRVEPRRHSRQNSRPSSASRQNSRPSSAGRFLRSGKGGA
FT                   GMSRGRSVAAMEEEVDPAHAARLRESLENANGIAQARALAEKAEREARVGMAAVAARHR
FT                   AAERAERSLRSSPVKSAVKQALGARLAESRRYVAAHKTPARSRLEDRPDFDLNFTARRS
FT                   EETPGREAFSPIAVRYPDGSPGASFNVADEAAAARARARELALEAAAAAEAAEAANRRL
FT                   AAAEMSVVRVRNKRVPVFDPRTRYRGTPGGTPGGGGSAGKRHGLSLVRESLGSFL"
FT   CDS_pept        join(<751718..751827,751926..>752577)
FT                   /codon_start=1
FT                   /gene_family="HOG000239356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634570"
FT                   /orf_name="MICPUN_71129"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65579.1"
FT                   /db_xref="HOGENOM:HBG319734"
FT                   /db_xref="InterPro:IPR009457"
FT                   /db_xref="UniParc:UPI000199B932"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG4"
FT                   /transl_table=1
FT                   /translation="PRSQDITFDVLAGCYAVIALVALIQLLRIQRRVPEYGWTTQKVFH
FT                   LLNFVCASFRAGVFPVWREVDALPNAAARAALMDTPGLLFFTTYALLVLFWAEIYHQAR
FT                   SFPTGALRPTFVGVNALVYAFQGSLWTWEGAQPKVGPILEKVSALFLAFVCAAAAAGFV
FT                   VYGGRLFAMLRRFPVESRGRQKKLREVGAVTVVCATCFTVRAVMVCTSAFAETKDGLDV
FT                   MNHPVRNAFYYACCEIAPSALVLFILRKLPPR"
FT   CDS_pept        complement(752826..754388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634571"
FT                   /orf_name="MICPUN_106053"
FT                   /product="Predicted protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="ACO65898.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199B933"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG5"
FT                   /transl_table=1
FT                   /translation="MAMRAHSAVGAPIAAPARAAQRGRAHRGQIRPAKSRHSVVASGLL
FT                   AKALSTVRSSDATDVMYADGEKVTYPTVLYAFREDGSCVVTNCATGKVIQRVRGDGNAI
FT                   EFTSQTEEPVAAPAPVAAPTPASSTPAPAPMNNVVGATGDGNESRLQAIKQSLGWLDVA
FT                   KEKVAGAVDFAINGKPKEYKTVALDSDAQRWIDAWSSGASKEDLAKVPKSKSPSLADIE
FT                   DVANDSSWMAPSAVGAKPSPTMQTCDEDDQAAMESVLNRGVAACDIDEVDKNLAFAEFG
FT                   AKTGKRAAFFDLDGTLCASNVVSQYAVAKLANMPTWLKLFWVPFYACKCLVYLIVDKFS
FT                   RTAFNNMFFGDFAGMDASEKAKAEMARLVYERYTSPRVFPAAVEAIAGLRRDGYDVVLV
FT                   TGSVDFVVEPLAKAIGASHVIANALEEKDEKFTGKLVGPAVADDEKRVRIEAYARGAGY
FT                   DLSKCAAYGDSYSDLPMLECVGDPRCVSPQNSLRIKAQKEGWPVLEWGAETTGENGGAP
FT                   VAA"
FT   CDS_pept        754752..756404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634572"
FT                   /orf_name="MICPUN_61411"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65580.1"
FT                   /db_xref="UniParc:UPI000199B934"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG6"
FT                   /transl_table=1
FT                   /translation="MPVLDAAFALENGGGGALDLKGKGVSRVDPSLARGCPNLGKLDLG
FT                   DNVVSDRASIAAIAECEQLKWLSLANCGLGGAGLAPCAEGQAREVGGGGGENERPDKRH
FT                   RGKHQKKGRKAMGGKACRMPNMRVLNISGNELESLQGVNGMANLGALIANENRVESMEP
FT                   LSGMTRLNTVVLSSNRVETIGEELAGMTELNKLSLSHNKIEKIGKHIGECVALKELRLA
FT                   HNPDLKTLPPALGKCAHLRVLDLSHCAVANFGDVSAIKELTNLAQLSMRGCPIANEPSY
FT                   ARTLVKMCPSLRAVDGRRVGPGGFLDPEKPEKDGGKEKKDARKTPWERMETNDAGGDED
FT                   DEEEEDGDGEEEPEPEPEPEPEPERKKSKKEGKKESEGVSFIEEMVAVNRGKLRGETAQ
FT                   DERGETKATRSGVVKIVEVKSSRENRGKAVATGREALIMAASGGGDGDDAGGWDDLGGW
FT                   GDEAPTTGGWDEPERAEKSEEERDDEEPAPTKEKKKKRRAEEDGRGEPEPEAAEAKKKK
FT                   MKKKKSLDGKKLKAETPDSLGRKRKKKKVLFFD"
FT   CDS_pept        join(complement(756860..757138),complement(756461..756820))
FT                   /codon_start=1
FT                   /gene_family="HOG000216665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634573"
FT                   /orf_name="MICPUN_85017"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65899.1"
FT                   /db_xref="HOGENOM:HBG395648"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199B935"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG7"
FT                   /transl_table=1
FT                   /translation="MASIDESKEKLKELYATREEMEKEMAEIAQRLTEPGMPGLRGALV
FT                   DREGFPIPGVDLYQVRGDRGRYATLRNDHAEVTKELEKRLAELHLQAGAIEKQQRDEDD
FT                   AFMRARARAAAQYGAPPGARAFAYVDEVTPGSPASMAGMRVGDVVLMFGDVVGPHEANT
FT                   LPRVASMLAEREGHPVAVWVSRGGVDVRLDVTPRAWEGRGLLGCHMRPR"
FT   CDS_pept        757584..759212
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634574"
FT                   /orf_name="MICPUN_102358"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65581.1"
FT                   /db_xref="UniParc:UPI000199B936"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG8"
FT                   /transl_table=1
FT                   /translation="MLKTLTGEQIEDTAEHLATRVQHRSPNVKLKALRCVKWLCQRGNE
FT                   PRFRRAMTKRSGPVRTCVSHTGRPDPQRGDAPHKAVRDMAKETLEAMFANDGSGGGGGG
FT                   RMEGFGSDTAAHTGAPHASHDVSFDGNEQLGSWGGVAEPTNGFGGDEATAIIGDGPARL
FT                   NKISGTWGAPEPPRAPPPAPTPSPPPAVPAAAAISNPSQAPAQAPAMRLASRDIWGQPA
FT                   QQPTRQPARQPAQPPSPPLSPVAAGANAPFTLEGSEEQRRVDALCAGGGVKLAPAVDAM
FT                   DSFAGACGGLRPEGVAAALAHKIRRGEWREGYRAACVLEHVAKRGGCEAVVRAFASAEA
FT                   DSLDAAAAMGAGSHELLRAKAGEAKAAVAASLGGVANPSTTNAPKVAGGGGVDLFGFMG
FT                   DGTTPAAAAAAATSFDAYAVAPPPNAPPAVPAAFAPPPDLLGGFGDMSLGGGGAHAPAS
FT                   APPAPAPGVDPFGGLLGGLSSPPPVVVQTGGAMFGGLDPSMMTAKPNSSRSPSSPTALN
FT                   GKQSTYQQHKDVKAFDFVSDMLKKK"
FT   CDS_pept        join(759359..759731,759839..760073,760279..760684)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634575"
FT                   /orf_name="MICPUN_61414"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65582.1"
FT                   /db_xref="UniParc:UPI000199B937"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECG9"
FT                   /transl_table=1
FT                   /translation="MIVTAAAPVEVAVPSDPEPPVTPSGSVNDSVNSLDTRLDPAIRAF
FT                   APESLKRPPEHIFLGRDNATGRFNEWLQNRYGLDVGAPIFRESYESFGPAHRLTHRCNF
FT                   VVHSEDMGLRKAVTSDYCVNVKAAKKHACALMHEWFLSREADPTAPYPPPPPGRGGQAV
FT                   EAMIGDAVLKLLLVQHHVDHHRFESNGRDEPDPGPLNQAGTNKFLYQRHIQLSRECALP
FT                   RGLPPPKGHAHADPTAFEAWIARVFEERGRSLVECAKAVLPALGVEPPFLFDRNPNKED
FT                   DSSLSDSDDDMDAETPDDEAVEAVEVIDAAVDEAIDAAVEASCETETEGIEVEPEA"
FT   CDS_pept        complement(761029..762240)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634576"
FT                   /orf_name="MICPUN_61415"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65900.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B938"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH0"
FT                   /transl_table=1
FT                   /translation="MPIGDPVYSDEESDLSDYAGPDDDLGFDFNFRTPIGGLTVAVPPD
FT                   ARGGERARLLRGDVADESAERAKPPRLLREIPAGHDGHGRPQCGRFNRDGTLFAYGCDD
FT                   GVVQAFHVDTGHRAGVAFAPSPNVPKGVCTALRFLPAGDNANVCVVATSAGVIQHHHLT
FT                   SGKTLGSPIVEANNGVFALDVRADGATFATAGRDGGVRVYDERTGRCVTRLDGGTDAGE
FT                   DASFSGHADRVFGLRYLASNADVLVSGGWDNTLRVWDARVADGRSVLTLRGPQVCGDAV
FT                   DAEPTGTGLSAGAGLVLVASWRDRDAVQVWDLRAGVASANLPFGACAGARGCKPYAARW
FT                   ADGGVAYVGGCGSNEFRAIDVKSGETMGRDVFGGDGAVHAIDVSGGLVGVTCADGVRVY
FT                   EAVR"
FT   CDS_pept        762383..764140
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634577"
FT                   /orf_name="MICPUN_61416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65583.1"
FT                   /db_xref="UniParc:UPI000199B939"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH1"
FT                   /transl_table=1
FT                   /translation="MVHFGRHCATQRGMADPAATPMAPSSAMAPAPGVNPSPDESAREE
FT                   LAPAPAAPPPIPETPPLEPTAVHQPPPLAPQAAPPSGPEYGLDGDLNAAGLGGDEKPPA
FT                   PASDAAAKVPGPAGTQGRAKGLWRKLKTTVNNMSFINQVGRMAETARPSALKELALKPE
FT                   HGYAVAMLPTVDEASAGLKDLGVSVDSGSFGGAADVEDVLSPAVALTFTKALDVPDAGM
FT                   DRQISHVLLRACLYDKGTLVGNVATVKGSPATDANGVPTWRFGDDDDKDKNDFHLLVRT
FT                   SRKKPRQATANLGGAGGSFDVQIHVELNVVPVATAEDDAACFETDEKTGRRRRLNQVDE
FT                   VCVAWGRCPWPDQFVGGSTSVDVQLSGASMDEPVALEPSKLAAKRASSVFRKFTDKGKL
FT                   LAKGPTLSVKIAAANYKYADLVNKLPRDVLCPAAMVPVLATFREMAAVEAAALGRRGVY
FT                   RNTCNPTLRLLPTLVADATICHELVRAWRRTTARWPPAHLKDPRRRGETLDGLVLKFWP
FT                   LLHSHAVPDQPVAGNVAATSHREGIVRAFAEDHPVVAMSRNPDEWMHKPFDVAELAHNF
FT                   GDPLEVYVG"
FT   CDS_pept        complement(764262..765182)
FT                   /codon_start=1
FT                   /gene_family="HOG000241154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634578"
FT                   /orf_name="MICPUN_61417"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65901.1"
FT                   /db_xref="HOGENOM:HBG397344"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000199B9C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH2"
FT                   /transl_table=1
FT                   /translation="MGAAFLPVHGAGKVASVRVHPVVVFNACDSYVRRQETQERVIGTL
FT                   LGTVRHDGVVEVKNSYAVPHNEQNGQVYVDVEFHRAMIDLHLRVNPAEKIVGWYSTGDG
FT                   VVPTDALIHEFYAHECHNPVHVTLDVTFADRDRLVRAWVGQSLALGSKDASKEAEKPDA
FT                   EGGEASAAEGILNATTAIHFQEVALVNTFDAAERVGVASLAATNADVVTDGDDLGATAA
FT                   KLRGMLEKASAYVDAVVAGKTKGDAEIGRRLADALSSVPGLTKSQFEKLFGESAQDALL
FT                   VTYLSNVTKMQLMLAEKLQTASLLI"
FT   CDS_pept        join(765843..766097,766166..766798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634579"
FT                   /orf_name="MICPUN_61418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65584.1"
FT                   /db_xref="UniParc:UPI000199B9C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH3"
FT                   /transl_table=1
FT                   /translation="MSRWLLHDLPDEDDGSGGHHQYQPTAEEVEEGCKRWLAQNPGRLA
FT                   WDCPCEEAIRSGNQQVRRRSRIKKGPCSKVLEMMRFLLARVVGCFNIDPQQETNEEKRE
FT                   IRMGALICIFVLIAFAVLLRVCLAPRARRERREREEREARERIEAAAAKEREIRRSWRT
FT                   GMFAVQPDGEHIVVMVMHPEDESMGDFGPALVDEKALEAAARAEGPGVVVVSRASSPAP
FT                   PTHRRRYSRGHGYEFDASMGVVVGGGGGDAAAEGGRVDATPPPPPTPAGEREDGTGEVT
FT                   ADVVVAVNVPDGRS"
FT   CDS_pept        766962..768362
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634580"
FT                   /orf_name="MICPUN_108917"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65585.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199B9C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH4"
FT                   /transl_table=1
FT                   /translation="MTCSGCGAAKRPDGKSLLRCGKCKTTQYCSKECQVNMWPTHKAEC
FT                   LQQTSKKALDEAKKRPDEGALRQRRSIQQNSGSGMNALFERLQQQFDARDKAIRDFVHP
FT                   ARAASARAGLVHNDFVDLEAAMRGEQFPGPLAAEDAEHSGFWVYWPDDWAKTPGAMAEW
FT                   CLEEFNEFGAFHSEEEIEKEFFGGDGEEWNLIDGPGWPGIYTDRRSHGIHLAPDKYVTR
FT                   CDTWEEAWKLWHRTGGASGRRWFTCFRTPIPRSITKAQFAAIVNWYVCSTPMGEAMRGR
FT                   HGLGAIGIHVELQYANRRWGYVNMASANHRGPACNDVVSNLDCDQVPKAGDGRNWHVKV
FT                   DDFTLAFQEWSPENPKTAARQKRLRTKVPAGAKPAQTTDPTTRPFSKYLMKSEALFPAE
FT                   GKEWACVDGETIDSVLASGQLPGAVKAKFARWETVEPGADYDERGQRIQRGGFTAGGES
FT                   WGAPPPWE"
FT   CDS_pept        join(complement(769772..769936),complement(769426..769703),
FT                   complement(769118..769316))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634581"
FT                   /orf_name="MICPUN_61420"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65902.1"
FT                   /db_xref="InterPro:IPR019387"
FT                   /db_xref="UniParc:UPI000199B9CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH5"
FT                   /transl_table=1
FT                   /translation="MRVTLRSLRIGWSAILDVPDKCLVGELRAEAAKAAGIEPAGRAKL
FT                   VLRGAPLQARDDAQIAPLKPGDTVLVSALHSAPSGDRTGAAVDVTLPARINRSGLSPRQ
FT                   LRAVRFLQFTCGVPEPVIHAAMRTKKRTLATLAAWCVAWYWAIRVEFGAVFVIVSAMVA
FT                   IFTVGLGTRKEGEASAYSIFNGFNELPGAFNAAQLDDQMRNRGEQGPYVD"
FT   CDS_pept        join(<770061..770168,770280..770575,770882..771134,
FT                   771351..>771469)
FT                   /codon_start=1
FT                   /gene_family="HOG000180196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634582"
FT                   /orf_name="MICPUN_70417"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO65586.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG607918"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniParc:UPI000199B9CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH6"
FT                   /transl_table=1
FT                   /translation="RVSGLTIYPVKSCAGIDVDAVTVTETGFMYDRAWMLRRAKPRASV
FT                   FVTQRTEPKLALVRVKLPSEVLSPSWDGILPPDAAMTITAPGMPQALEVPLAPASPLPR
FT                   CKVGVWEWEGLAGDEGSEASEWFTRYLGKTNRWRRLTSKPRRRVDREFASPGSGSAFSD
FT                   GYPVLLASDASLRELNERLATPVPMNRFRPNVTVDGAIEPFAEDGWGGVVFGGVKSADL
FT                   VKPCSRCVMTTVDQSTGVRGGPEADPLRTLYAIRSG"
FT   CDS_pept        complement(<772590..773663)
FT                   /codon_start=1
FT                   /gene_family="HOG000200832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634583"
FT                   /orf_name="MICPUN_85139"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65903.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI000199B9CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH7"
FT                   /transl_table=1
FT                   /translation="MTSVDALRDGSFSLGDFRDTKTLHLRADASGNVRLNQYVVIKDLG
FT                   QGAFGKVKLCLNTQTNRLCALKCINRRSLRRKFGAGLARGGASGDVGLQREIAIMKKLV
FT                   HPNVVRLYEVIDDAVGQYMFLALEYVPGGPVYDPARYGGEGMGEELARHYLREICRGLD
FT                   FLHVNGVVHRDLKPDNLLKKTDGGVKICDFGVSELFEYDEAGGDDGRGRVSLDYVTTTA
FT                   GTPAFQAPELIELNARGGERFGRSSSGKGARGKPSDVWSLGVCLYYMVCGSVPFKGDTT
FT                   DEVYRNIVGTEPEMPGEMSGDLVDLLTRVLNKNPDERVTLKDIMCHAWVTKRGTLPAVD
FT                   STQTATAEPTARELLTSI"
FT   CDS_pept        complement(774087..775112)
FT                   /codon_start=1
FT                   /gene_family="HOG000077502" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634584"
FT                   /orf_name="MICPUN_85346"
FT                   /product="Predicted protein"
FT                   /function="formamidase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="ACO65904.1"
FT                   /db_xref="GO:0004328"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG287568"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="UniParc:UPI000199B9CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH8"
FT                   /transl_table=1
FT                   /translation="MSSGGLGGLNKSPNGIVLGCVQLQLPVVKTKDDLAKQTSRIVEMV
FT                   GKARRNLGTMDLVIFPEYSLHGLSMDTNPEIMCRLDGPEVQAFKAACVEHKIWGCFSIM
FT                   EYNPDGNPYNTGLVIDDTGKIVLYYRKLHPWIPVEPWEPGNVGIPVCNGPKGCKLALII
FT                   CHDGMFPEMARECAYKGAEIMIRTAGYTAPIRNSWRFTNKANSFQNLMVTANVCMCGSD
FT                   GDFDSMGEGMIVNFDGEVLSHGYSGRPDEIITAEVRPDLVREARIHWGVENNIYQFGHR
FT                   GYVAVKGGATDCPYTFMKDLVDGKWNLPWGEDVVHKDGTAFGFDPPTRVYKGEEPTPEM
FT                   P"
FT   CDS_pept        775408..776592
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634585"
FT                   /orf_name="MICPUN_108918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65587.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199B9CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECH9"
FT                   /transl_table=1
FT                   /translation="MASSTVSITAPRVAVPMRSTRAMPRATVAMARAGRGSSSGRRANT
FT                   LNRRREDERRRSEERAAAPPLESMREVLALLASLELGAPTAASDDSPEDGSPGVYLARR
FT                   RSDGRASFGASIDLAATSATMREDPGNAEMIHVVVTDEATRSSLVERLGKRMKSMNVPT
FT                   WDVNQGKLQTRKDPVERVDPIVAMIGAPGSDEDTRVAAKEDTAKEDTAKEDIAKEDTAK
FT                   YPAPYSGFVPPEVTKEVIVKMPSPGALDDVDERLWVPQTADVSFRPLLLNVSQGYYVNL
FT                   LRVRGGGGVLSRHRHPGPVHGWVLKGRWRYLEHDWVAEEGSYVFEPPGETHTLVVPDGV
FT                   EEMITLFNVTGPLLYCDEDGKVVNAEDVFDKLALAKAHYEKVGLGADYVDQFVR"
FT   CDS_pept        join(complement(779734..779904),complement(776677..779505))
FT                   /codon_start=1
FT                   /gene_family="HOG000265574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634586"
FT                   /orf_name="MICPUN_61425"
FT                   /product="Condensin complex component, non-smc subunit "
FT                   /function="binding"
FT                   /protein_id="ACO65905.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG562769"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B9CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI0"
FT                   /transl_table=1
FT                   /translation="MPAKQLPTVGQILNEAQISLTVHRKLVKQMTSVRHATPDTFLPEL
FT                   CNCILPVLLEYKRDLCAERVVRFLVHFTASRSPGTEDEADEFCENFLGFLLNLATAKDR
FT                   AIRFRVCQLVAGVLNALGVEAEISDDLYERMEEVMLDRLRDKVPVVRAQAARALSRLQD
FT                   GGEDGNFSDDVITTSFITLLGAEKNKDVRKSILGSLAISDFTIPHVVERTRDASEDVRR
FT                   VAFLALTSKVPVASVSIALRAAAVRRGLTERSDAVRGAAIDMLKRWLDAFEGDVLALVA
FT                   ALDAESNEDVAASAVRALIECGRVKLNDVAQSVPDGVAAGGGLRRTSDAELMSPEAAVY
FT                   WRVVCEELHAAASTSGATAASAVGQRQVVSAAVAGEKLEALEGVLPVNTGDLLDLISKH
FT                   AREGAKFVARQLLPLLDLMDMADAAARKGTAALCDAQLRAPPQAADECHLDVCGVVSSY
FT                   AKGGDGRWERSLVTVMKACHNSPSDAAAAVFACADALIEDVGTPDAHAQALFLASLVLE
FT                   ECPRHVVNGDVVEALMATLVRPGVTSASAAVRREAVRCLGLVGIVFGVRDDGECVRVLR
FT                   AALCGDCPAVRAVAARALGDLSLLYGVQALDAHNPSRDECEPAQAALAAPLETALLDAV
FT                   DEEYGDAAVAEKGTEDEEAVDEADMLTGGAAAAEAERDASVATAAGEALAKLILRRGAR
FT                   AVADPAAVVARLVRCYFNVDARRRPRMAQCLAVFFPAIASAPADRRALVAESSLFALRT
FT                   SAKDKGVAKVASYLAHLLACNTQEVEEKEEKDGVIQTTTKSVVAPAVGGAALVAELAKE
FT                   ALAVTFRPAPTAAAEKQLTKAYVAALAKLAAAVPLAPISVLEDVQQRAAAREVLAAGAE
FT                   AAAQCAGRVADQKPAVKDLTAAVESMCEAMGEDPEDEDGVAVVDEEEINRRVMEECVAL
FT                   AAGDDVPLPFKQRVVKQHTGLSVKEIKERKAAREASPELDDDATPEKPARAKTARATKS
FT                   RAALKENVVA"
FT   CDS_pept        join(complement(783172..783274),complement(780114..783052))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634587"
FT                   /orf_name="MICPUN_61426"
FT                   /product="Protein kinase"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO65906.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199B9D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI1"
FT                   /transl_table=1
FT                   /translation="MEKYKRVKVLGKGSFGHAVLVTVAKDPSKQYVVVQVDMSKMPKSE
FT                   REASLLEAKLLSALHHPNIVTCYESFTERGRLCIVMDYCAGGDLYQRLKRQKGVLLAED
FT                   RVLDWFTQMCLGLKHVHDRKVLHRDLKTQNVFMTADGRCKLGDFGVSKVLSGTTQLAQT
FT                   AVGTPYYLSPEICENKAYDNKSDIWSLGCVLYELCTLQHPFEGASLKLLIVKILRGNYA
FT                   PVSSRYSRAIRDVIAQMLQRDPARRPSVNEILSRQPFKDMAKRWLDDDVHADEFSHTVI
FT                   HRKPGSRIAKRMTDPNSKIAGGGVRLSPPRSRPAPYPSGGEGVPTRPDPPTRPLPSRGG
FT                   GLIAPSREGQGRVMTSDARKPSDNKVAFTPPVHRAAAARGGGVPIWAAHAANMARPYEP
FT                   VPLPSRQNPPTHPNFGRAQSAAAEAARARREAEEINRRRREQALEERRRKLREEEEARM
FT                   ARRKKADEARAREREEAEKRRAAEREEARREFLRRQAEARANKQRAQADLGNQPVEVEV
FT                   LVPKQRAVESVRPSPPRHSAPAAVAAPAGPLATPAATKKRPSPPPSAAPSRRPAERETS
FT                   CAAASQSSSPPPSQSSSPPRKKPSPDRPAWEAETKTGPKPDEESRNPVGGRVAGFVKVG
FT                   QVTRECSGIDARRRVWEENKAAAERNRARAEGIPTPARRLGGEENKGGEGNKAENKDDV
FT                   PALPPPRSSAVSRTSSPPARCEPPAAKEPDPRRKVWEENKAAAERNRERAMTDAVTAVE
FT                   GVDGASSGNMLGVEVHADANGARVFVDAPTNCVLGATTCEPTTLASRLGALGAPEEGRG
FT                   GGDPEVDPMAIRAGSALRSGEDDGADDDGDDDAGDDVDMTEVDTATAYAAPDRDGDAAS
FT                   SDATSAGRRSKSSKSSKSSKSSKSSEDGGLDSTSSLDHDSTFVAPAKFYLDGRTVMLRD
FT                   VDERSTLPDRVEALRVHLERALGETKFVRAYRALDNLSESDDEDKVVSSLCDVMGEDIS
FT                   YLGLIHQLLVCEDSMHAANEGVEE"
FT   CDS_pept        783700..784578
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634588"
FT                   /orf_name="MICPUN_61427"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65588.1"
FT                   /db_xref="UniParc:UPI000199B9D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI2"
FT                   /transl_table=1
FT                   /translation="MASAAPPATKPVVHSFPSDLVEAEAAQRAKEEIRRKVEAELVAAL
FT                   TSLETAKNAKWVGGASDKENSEPGASDTKLKEELARTKEELNGCRFLLRDAQNALAEEA
FT                   AKTEAANKDAQRWEGEASKLRDELASVKDELDKARVATAAAQGFVKRHQEMQRQQQEAT
FT                   EMMRRAEELKLAMESQAVAVEPPVAAEPSAPAVDGENIGHPPPPPRSPARPTPKAGEDA
FT                   FPKVDVEKVKLARQVAKQTQEALRAQEAAIAQINQLLVENAKLGKELAEERKKTGALEN
FT                   IGQDIFKGWWG"
FT   CDS_pept        join(complement(790320..790529),complement(784632..790175))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634589"
FT                   /orf_name="MICPUN_61428"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65907.1"
FT                   /db_xref="UniParc:UPI000199BA5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI3"
FT                   /transl_table=1
FT                   /translation="MQANDTDILPRAVSSGSILPRLCFTIRFIPTTQEPDGDGATKDLQ
FT                   RKLQQRQDELDMLQIANETLQAQCKRTQAAVEREEEIKEAMNDALGASQRRITDLEGEL
FT                   EHAKAIAAAAEKSQDQGTEEEGGDSSELEKLRKKLKVSAGLVKKLRDSENGLRDELAAA
FT                   QRRIAEGVKDRDAEERAVATQRNLLRKTEEDVASLRDRLRAKEDEARAQEEANAEASAA
FT                   QAARAEELHERVEALEAEVAESKATLERKELESGAMTAAAFDSANAQANKSEELQHELE
FT                   ALRAELEAANERTEQVRVDANAKIERAEAAYRSMEEELAAAKAKEGPDPSLQAQLDKKK
FT                   AQLEVANKLIKTMKENEKALEEKLSSTNSGDSGGADVEKIRSDANAKIERAEAAYKEKE
FT                   AELERVRADANDKIEKAEAAYKEKDAELRAAQAIGQGKGKGKGKKGGKQGDNPDDVEKI
FT                   RADANAKIQKAEIAYKEKEEEVERLRADANAKIEKAEAAYKEMDDQITKLRAEANQKIE
FT                   TAEKAAKLSNDNAAKALEASAAMTDEINRLMQEIDRLNQTMPSSDGGKTSASSPALKGA
FT                   VAALEQTLAEAESSFARERESLVGDLAAARSEAKEEKNARESAEADANAARSDAETQRA
FT                   VALAAAAERDGISAAKKELEAALEEAVRDADAVREECARAKTAMSDAARRLDDVTKRHA
FT                   ATERSSAESAARVAELETSIESLEGELAKSIEDLRETNLRLERAEAVADAAGDKDQVLA
FT                   EARTAKRDAEEALTAATASARAAKADADAARADAAADAKIAASLRSQLAELEQKAALME
FT                   KRVEAATERADSAEKANKSLASIESALADARKEHAADASRMQSAWDKERVALEREVEAL
FT                   REAGAEDAARETARDSGVARRISELEQSAEEAAVAAAEEKRVYAERYAALSADFEASAE
FT                   RCLELETLCKKLRDDIESAERRELASKEVNDRLTDLAAAAEGNASVEIARLRAELAAAV
FT                   ADKETMLAQNLELEAAAEVASAAIVEAKADQDAAVARVEAAERRRADARGETEGLEKEL
FT                   AGKKAKIDSLEAEVKELRAKETDAVKECESLRAEIARLEAGSAARTRTDDENKIKSEMY
FT                   ATQEAETLKVKLAEANALNDRLQKQVQRAEAAKHDAEKERESLREGINKTARENRALTA
FT                   RVAHLEAQDASHEREKNEALREAAAARADAEASSASAAQASSARAAAELRAEELRDQLR
FT                   SARGDVTSAAAAALEMERHMGSAQRAAAESAMKLKTHSAGKELVSLRLREKTQELSDMA
FT                   ETLREERAKRREERETIAAEKETLRVKLAALERRLEDRTEELETARAELGAATDEVAKM
FT                   SSECARSEERAASAAARAQRLHQRLFPDGAPPGEDSDDEAVDAVTPIRKGKGRGNKARL
FT                   AVVRATLLGHPSFPEGVDVTAAMRQRANSEDGERLCVRVSENLREVFGDRYPADDDACR
FT                   AAPKTEGKLTVEYRSTYFGEGGGALRCTVRVGGVTSRTPFLTESMWIEAKPSAADHAAR
FT                   TSAARIRDAESAVASARSRAIVLEGKVRSLTDELVLAKAFASGLERRERELDSALAKMR
FT                   TRWSMAAESSDRNESDADRHRKAAFAAAAVAHRAVEDARTEAEIAVMEAVRLERLSADQ
FT                   RAREIRLSQSGKGRGVGSASDSVKGSWGEPRADRTPSVPSRETTSLPAKSPVDFGYKSR
FT                   SKVRAAMRAEAEAWERARAVSGVGESVATRARASWARGRDVPEPFLTPRASLSAPKTAA
FT                   RLGPTAQSRQSASIARRDFRLIGRESPSEEARRRADARVAALRASRQSASRDAGPNSPT
FT                   NPKPRDSTSNSSSRVARAITPRRGSAGSMGRKGGALRAKLEAAEARLASAVAEREARLA
FT                   EAEALRRRAWASSVTGTSSSRDEIETLARTVIARSERVLREDD"
FT   CDS_pept        complement(790840..793950)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634590"
FT                   /orf_name="MICPUN_61429"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65908.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199BA60"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI4"
FT                   /transl_table=1
FT                   /translation="MFAPGFSAHASVESGQAHCGARAGSSSGGEERINPFDMPGENSPP
FT                   SKKARRGSPVLPVDADLDGVLHDQEEDDRQPSPPHPSTGKRVIWRVPETSHTGSCWQII
FT                   DGFATPEECRALVADAKQGLADSLRQPLRRFEDPPLVGVKYRSADASSLASEALAALSA
FT                   RAANVTCVGVNKEKDSVMIAHTSARVTTTTRAAVLPGDEKDENADVGKEPGAAEGDGVG
FT                   AAREGSVDSEGFLLREDHAKDGGVSRWARLVNVHHDHNRDELRACTVFVYLSDVEPITG
FT                   PADDADGTERRKTPGGGTFFPCVMGDVDPREGDDLRARLALHGKRGTNVIFHDSRDGGA
FT                   EEEASEGDALVAEFGTLSRGGVGVVGVSGGAGAGAEAGAGYDDEGMTETMAECEARYAA
FT                   VCASGRHPLRGECPESMRGTILEGNGVPGLLIRPREGRAVVFWHGEDAGSCPEAWHAPT
FT                   CVEEGSSDKWLVTFFKVPLGAKPKLKQATEETIMPGGLDPYAAVMAASRGTLDSVNMVN
FT                   IHGTQMIQPVRKNDDATTAAAMEKIGRSPGVEVGNLPGSELPAQLGPGSEPARAQGNAL
FT                   TGLPGLSNNVPGKSLSQWKQKWCCLVDDCFTPRKQPSEQNSRMPLTCKEHSGALVVLYG
FT                   GVASRECQACRTFHPITAFDRDNKTCETRLLRKKLRYRAKTMQRRGSMQPENLTYPAGA
FT                   HPYPAGAYPYPAAVPGHVGVQPGAQFAPGAHPLLIPDANQTALLLAAASQQRNHQQQQL
FT                   NSMLPFGGPPGGPASSGHPGATGAGAQPSIDALGALGATGLDPWNLAQYAALVQAGAGS
FT                   GSASASAQAPAGLTGTGLASAGQDQTQAYLAALQQANSLSGLGGGLGGGLGGLGGLGGL
FT                   GGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGGFGLGGVGGGVGGGVGGGLGG
FT                   LGAVGGLGGLGAMGGLGGLGGLGGLGDLGDSAHLLAQLRQQVGDNATAAASAAAMNQAG
FT                   ASYPGVSSELAEILRNVDPQALPAVLAQLQQATSGLNGGTDTGGGGQ"
FT   CDS_pept        join(complement(795521..795973),complement(794625..795227))
FT                   /codon_start=1
FT                   /gene_family="HOG000233491" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634591"
FT                   /orf_name="MICPUN_107081"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="magnesium-protoporphyrin IX monomethyl ester
FT                   (oxidative) cyclase activity"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ACO65909.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0048529"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG284843"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008434"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI000199BA61"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI5"
FT                   /transl_table=1
FT                   /translation="MRDGIKEAASENLLTPRFYTTDFDEMEQLFSKEINPNLDEDELVA
FT                   ILQEFREDFNQKHFVRNDSFKAAADGITGDARRIFIEFLERSCTAEFSGFLLYKELGRR
FT                   LKKTAPVAAEIFTLMSRDEARHAGFLNKAMSDFNLALDLGFLTKNRQYTFFKPKFIIYA
FT                   TYLSEKIGYWRYISIYRHLQANPDDQLYPIFQYFENWCQDENRHGDFFTACLKARPEFI
FT                   NDFEAKLWARFFCLSVYVTMYLNDHSRTEFYESIGLNTTQFNMHVIHQTNKTTASIFPQ
FT                   VIDTYNPKFKEHLDELVVVNQKLAEAESPVEKAPLIASFAFHLLSIALMKPIDSGSIDF
FT                   VEDVNSPAFMY"
FT   CDS_pept        join(complement(797895..798155),complement(797537..797596),
FT                   complement(796847..797176))
FT                   /codon_start=1
FT                   /gene_family="HOG000111347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634592"
FT                   /gene_name="PSAD"
FT                   /orf_name="MICPUN_84657"
FT                   /product="Photosystem I subunit II, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I reaction center "
FT                   /protein_id="ACO65910.1"
FT                   /db_xref="GO:0009538"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="HOGENOM:HBG286318"
FT                   /db_xref="InterPro:IPR003685"
FT                   /db_xref="UniParc:UPI000199BA62"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI6"
FT                   /transl_table=1
FT                   /translation="MRIAPVASTKASGRVSLKAGFAGKPVQAASVSLSSRRAERLVVRA
FT                   EEAKAPAKAEKAEEPWSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIF
FT                   EMPTGGAAIMRKGPNLLKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDG
FT                   VYPEKVNKGRVGANNNMRSIGKNANPASIKFGGKMYKDGLASDGAGFSRVFDQ"
FT   CDS_pept        798555..799772
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634593"
FT                   /orf_name="MICPUN_61432"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65589.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199BA63"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI7"
FT                   /transl_table=1
FT                   /translation="MSATTRPWVAAARGPACSRHVAGDAPRASTSGASRPPRSAARVVR
FT                   GEAPGAAPRGHRRGRREPVRHPRASSGGGGRTDRELLDDEFKSLRAARGVVTALGVDYG
FT                   TRRAGIAVSVGGASPRPVAVVPATPPGELIDAVVRAAVRERADVIVVGLPKPPRDFEAE
FT                   RAEERRRTLYSALVDVGDLANECFDASDVAESLGADEMKHRLAAYSMKIGGRVEERAAR
FT                   LWALVEAGGDLDLVPAGAFVGGEAGKRNACARARKERVQRRDGFDERTGRRQRAGGSSF
FT                   GGFNVAVGSPPNRRTEDDGSTNRRGRAPVKMHVLARRFAENLADAVRDAGLGAKGTRVV
FT                   MVDESATSAEADLIASTARGGRGLKDRPRGAHLDDIAAGVLLDRYFAGSHGDAEEIPPA
FT                   NSSAYY"
FT   CDS_pept        join(complement(799944..802259),complement(799843..799866))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634594"
FT                   /orf_name="MICPUN_61433"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65911.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021832"
FT                   /db_xref="UniParc:UPI000199BA64"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI8"
FT                   /transl_table=1
FT                   /translation="MASSDDSDSDGFDSCSETFDDARSGAPDPSSAGRGGNVDDGDDDE
FT                   AGSEGFDTPDEFEDARSVLSDVSAAPLDTCAAAGTPPASDDLAAADDERASSRGSASGT
FT                   TRANGRARPPGKVDPPYRVYDPWATAIRDSDRARTTTTTTTEAMTEAPAGGRRLSRDGS
FT                   FEWRHHREYSPLPTVESAKSLLLSGGDSGSSVDNPTSPDKAIDRGGGDAASVSSAPGSR
FT                   LGAIGGRPRHRAAGGRGPDNPRSAALRADPASASYPLHAAAYYGDVDALRRALHDAKAA
FT                   DKASGIDGEHPDSALATLDPCGNTALHVAVARRSRSALLTLLEDEFDFPLDARSSAGWT
FT                   PLQEAVHMGSRTMCRQLFVKTMDRGKRQFDRKKPKLLATLASLPDFRMKIHWEFGSMVF
FT                   GPIIRAYAPQDTYEITKRGTQLRIDGTLKGMEDPDENGGGILPRWRRGRFSLVFEGKAG
FT                   DSRLLFLDHEKRECVDVGNEPEETAEEERDRIDNEVDVMMEEGPTKRKYRADDVNFKPV
FT                   KAWLGGNKKEKVGEWNTEVYEASGKMAKRKVTRNGAYKVNGTFSEYLASFKEGAADIIV
FT                   DRRVNNLDEAESDESDDANDAKTREQNDDEGGIDDKGAGVGKPPDPSPERPTTAGPGST
FT                   RQRPKRPPAPPPPAPPPLTAKQKWKMERARKKKEGKDEKPRRVTARCWLADEFPMTVDD
FT                   LLPILDVMSHANKHLNKANRLIQYWRKDHGASFPVKVLVPIAMTVYVVMRFKDFARLPA
FT                   TDDGLSGLPPGHFDIPAGFGTIQTYG"
FT   CDS_pept        complement(802420..803352)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634595"
FT                   /orf_name="MICPUN_61434"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65912.1"
FT                   /db_xref="UniParc:UPI000199BA65"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECI9"
FT                   /transl_table=1
FT                   /translation="MSAEHPEEPSDDEESFDDEVFKPMHHPGKLRIDLQLHVPGEDVTS
FT                   RRAKRENLDRFMWTCCGATGLDPGCEDGGDQWQGIKDKYPLPEDHGLPPDGDYESELSG
FT                   NRTGESYLDDDDEEGEEQQVVIDDDEDEDEDEDDEDEDEDEDDEDDEDEDDDDGDDMMN
FT                   PELEAYLARVERNDPHWEVDLWDEEAEHGVEYYHPGKLVLDEPGQFTPAELRTNRPQRT
FT                   RPDFFTWSCCNGSGNEQGCEARETGDEPGIKEKYPVPEEEEFYRQRKRRRREDDEDDED
FT                   DEDEDDEDEDDEDEDDEDDEEDEEDDYGA"
FT   CDS_pept        803725..804459
FT                   /codon_start=1
FT                   /gene_family="HOG000139577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634596"
FT                   /orf_name="MICPUN_85076"
FT                   /product="Predicted protein"
FT                   /biological_process="proton-transporting ATP synthase
FT                   complex assembly"
FT                   /protein_id="ACO65590.1"
FT                   /db_xref="GO:0043461"
FT                   /db_xref="HOGENOM:HBG562778"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="UniParc:UPI000199BA66"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ0"
FT                   /transl_table=1
FT                   /translation="MRGDGTAPRFYKKVEVVRVENGGGWGVALDGRALKTPKRAALAVP
FT                   SKSLAMAIAAEWEWQSGRSIRPFTMPLMALVATSIDQMTQEEVRDFHVRKLLEFFPTDV
FT                   VLIKHEPGKLADRQAEIHAPILKWARSELGPGVEPTESLYGAQIPEEAMAAAEKRLRAM
FT                   DPFELTATFNAAASAKSLLTGMALIRGAIDVEQAEMSARVEEDFQIDEWGLVEGGHDID
FT                   KADIAVRLAAPRALMSLLRDTL"
FT   CDS_pept        join(complement(807320..807711),complement(804596..807110))
FT                   /codon_start=1
FT                   /gene_family="HOG000209413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634597"
FT                   /orf_name="MICPUN_61436"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65913.1"
FT                   /db_xref="HOGENOM:HBG333008"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniParc:UPI000199BA67"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ1"
FT                   /transl_table=1
FT                   /translation="MKFGAYLEENMEPEWKEWYLRYKPLKIQLKEIVALNEELAMKSAD
FT                   SNFGPGIDGRVSFTPPKNLTTMSLSFVPTRPGSSGQKGERPVASEATFFEALDADMKKV
FT                   GKFVESSLTKLKQRVEELDVDVAAAVRDGLPELAAHGASTDSWASGSQSSDMSGVLTDP
FT                   EQGGGSAGNAEAVERVAHLRDALHEVQREFLRIEKFANLNTTACYKILKKHDKLIPATV
FT                   CCRYYMERLHSKPWVNTDHSAVFVVQMSDLFEKLRPRRAQQASKAQGNGPKGGPGAQDF
FT                   VRTTRKYWVSTEDVSTVKQAIAEHLPVFLMEREKAGKNIVDLGEEMVSSPGPGVASDSQ
FT                   MTSSVYLDNVNLGLYHTRLQKQPHSIAIRLRWYGLDPTGGVVFVERKTHRESWTGEESV
FT                   KERFTLPHDLVVPFLTGQHTWEMEESRLIEADAKKQLNNSVPGSSPAKGMSKAELSGIK
FT                   KLFTEVQNAVESKQLEPTLRTMYMRTAFQVPFDASVRCSLDTSLCMVAENPVNGPTCKT
FT                   MNRWFRDPELPVHRTEVTKFPHAVLEIKLALDPGQDPPRWVDDLISSGCLTEVHKFSKF
FT                   MHGCAVLFPDVAQEVPYWVDDVSLRQSLQNSASRETGAAVARNNSRRVKPQPPANGTLN
FT                   GALNGALRPNDNLDGDLTHPLLVGASSDTVLDLMGDTRQNANVTDGDEIDRHGGGRSRG
FT                   MIQRGLSAGSKFLRRKFGLGGDGSEQPSRPQQPRTVPMRIEPKTYFANERTFLSWLHTA
FT                   VLIGTIGAGLVSVHMGRAGQPRQDDSTANMPDPNYTGSAPHERVLTIVHKHEYRVVFPR
FT                   DGALDDTSPMVMRGGVDGEIGAVDSGGMSTAAIEEIVSRAVAGYFESANSHKALSATAG
FT                   TPGMEHHALTSSAGASIADTGEYTSVGLTVALTMLSASVCLCVYATWTFIWRGQQISKR
FT                   STVPFHDPIGPVVMGSVLIASMVILIAITAANFGEITD"
FT   CDS_pept        808329..810410
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634598"
FT                   /orf_name="MICPUN_61437"
FT                   /product="Ca2+:Cation antiporter family "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65591.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG609412"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI000199BB10"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ2"
FT                   /transl_table=1
FT                   /translation="MKGARAPLTLAVVACVLVACAAAEEGIHSQYKSLARIDVTDEVGE
FT                   GFGGRGEKVAGGLETTSDLAKYAGADAAGDAPALHKTHRQKIRKEKCEPRKRPVEDRCE
FT                   YVRTHPACEQDDNLVHYLRLHYCAFGPSQSLVSHITQAILIVLLCSVLANVAEQFFCPA
FT                   LANVARWLRLPEDVAGATLLSFGNGAPDVFTQIAALHNASAQGISLGIGAALGASFFVA
FT                   SAVFPIVALVAPAGNESRLRRAHSRGAADSDLDEEESFSRRTSEGELLSQSFGTTGDDY
FT                   FFPAWCPSSVARLIGRLRETMSTGGVEIDPLPFFRDSVFYLVAVASIFGTLLRGSVSFA
FT                   QACAICCVYVMYLMAVLLPRRIAAALNKWNGSADGMETPNEGYVTPPEEPSERRATTEL
FT                   LDDVDGYTDSRGEPDSFDETVSDADDSGVAARLLEVLRTPVLLMLKVTMPEIGKPLSRQ
FT                   SRWAVSLLPITSPLFFAAVARFLNDKLITHPGVWFGVACGSVGSVALYLSWPAIVGASA
FT                   PLGIAERFQKFLTVITFVQAVTWMDAAAGELVALFGAIGRISGASEALLGATVFAWGIS
FT                   IGDLVSDTTVARRGMAKTAIAACFGGPLFNLLVGLVGSMVFATVSRGVISGIKLENEII
FT                   LLASCQLLAVTYLIVGIPFVHKGRVSRVAATGMLGFYVVTQVLIALTSGQVIFKDPWM"
FT   CDS_pept        join(complement(811301..812196),complement(810490..811075))
FT                   /codon_start=1
FT                   /gene_family="HOG000187275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634599"
FT                   /orf_name="MICPUN_85046"
FT                   /product="Predicted protein"
FT                   /function="acid phosphatase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO65914.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG562779"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="UniParc:UPI000199BB11"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ3"
FT                   /transl_table=1
FT                   /translation="MCRAFTWLTILLTLALTSTASAGTSHDPKGVHLSFGASDTTMVVT
FT                   WTTRKETETNVRYGPSDPGGATPADLSINAIGDARKFVDYGSTSSVRYVHVATLEGLTP
FT                   GQIYEYQVGDAKLDRWSKVFWFNAKRTAEQYAEGPPLRIIALCDIGFKESDSVVELLTQ
FT                   EVHGEQPPDAFVQCGDFAYDLDDENGGVGDQFMKAMEPIAAYVPWMTSAGNHEASHNFT
FT                   HYRERFTMPDRSKTDNHYYSIDVGPVHIVAYNTEALFWPASFGVEYIQRMYEWMEADLA
FT                   SVDRMRTPWVVVHGHRPIFCEAADGTSCAFNENAAFLQSGKDARDGVGHALRFPIEDLF
FT                   YKYGVDLAFYGHEHEYWRTFPVYDEKVVNGTDVSLNRYFEPRGTVHVTTGAGGNINMDR
FT                   GDDPPSRGTCDMIKDNSPWCAFQSGVDHGGDRSQEFAYGVVTFESGSKMTWEHFSALDD
FT                   GKRIDLWSIETSSHGPFARRTYSDNLSDAALIATE"
FT   CDS_pept        <812764..>813591
FT                   /codon_start=1
FT                   /gene_family="HOG000198163" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634600"
FT                   /gene_name="PGP2"
FT                   /orf_name="MICPUN_70469"
FT                   /product="Phosphoglycolate phosphatase "
FT                   /function="phosphatase activity"
FT                   /protein_id="ACO65592.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG728229"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI000199BB12"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ4"
FT                   /transl_table=1
FT                   /translation="VDCIVMDCDGVLWQGDTLLPGVRESIQLLREMGKRLVFVTNNSNK
FT                   SRRQYVHKFEKLGIFVEKEEVFSAAFAAAAYLKTQKFAKKAMVIGGQGIVDELNEMYLE
FT                   VDPGVFNAVQCTEMDWEELDIDPDCGAVIVGQDTSFTYAKLAYASLAIQRGAVFVATNP
FT                   DAGDAIGPGLMPGAGAIVAAVEKASGVSPEIYAGKPSAFLLELLKGNRVDMARTLVVGD
FT                   RLDTDIAFGRAGGAGATVLTLSGVCGLEDVDAAMEEGGDIPNHIVQSLPHMLGL"
FT   CDS_pept        join(complement(814538..815160),complement(813838..814393))
FT                   /codon_start=1
FT                   /gene_family="HOG000223047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634601"
FT                   /orf_name="MICPUN_84974"
FT                   /product="Aminotransferase"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO65915.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG752297"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199BB13"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ5"
FT                   /transl_table=1
FT                   /translation="MVDAAERLRDTGVVGESATQELNYVARWGSPETLDAIARFLTDQY
FT                   AFESEPTEPREKEASGVVRPESLMITNGVSHGIDLACAQLTKPGDIVVVELPTYFLAAD
FT                   VFRDNGLDVVGVDGLEEGIGPDGLPDGTPGYFDVGALERRLRVDGLRPRLVYLVPTHSN
FT                   PRGGTLPERDRKRLVELAVEFNFYVLADEVYHLLHWGEEPPPPRIGRSSAARVVSVSSF
FT                   TKILAPGLRVGWIETARSIVDTISDRGYVNSGGCVAPFAASIVVSAIENGSQARWLQRL
FT                   RERYRGTSRALHDAASREKASTGWKVASCPPSGGYFLWIELPADCDERGVTRAAEDAGV
FT                   AFLPGSRCVPGGTLEVPREERSCRLCFAYLDEEKIVEGVKRLAESVRNARGK"
FT   CDS_pept        815870..817342
FT                   /codon_start=1
FT                   /gene_family="HOG000245066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634602"
FT                   /orf_name="MICPUN_102376"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO65593.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG322402"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BB14"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ6"
FT                   /transl_table=1
FT                   /translation="MDRRHRDTTRLRLGRIERLRELERGASNGGAVGALLLPGSDSDCG
FT                   GNDSDGTATPTRYLSQVPDGAVKDERDTSDTSARIDEELHKSKQCYTCKARFTKLHHFY
FT                   AQLCPSCAGINFEMRNFSADLTGKVALLTGARVKIGYEIGLKLLRAGASLVATTRFPAD
FT                   AARRYAAEKDFDEFRHRLTIHAIDLRDVAGVERFCDHLNATLPRLDIIVNNACQTVRRP
FT                   ASYYAHLLPLERSVDAALRLGSASQEHASFVPLLADDATRRAMESQSPSSEASSSLLPS
FT                   PEMLESDSYYPTAAELSQLKIAPEDYAATSADLPSGHLDINGQQIDLRSTNSWLLKLQD
FT                   VSIPELVEVMAINALAPFLLNSRLQPLMASTQGNKYVVNVSAMEGKFYRHKTPNHPHTN
FT                   MAKAALNMMTRTSAKDLAEKDGIYMTAVDTGWINDENPRDKAARIAEASHFQTPIDEVD
FT                   AAARVLHPVFHGVSTKEPLYGVFLKDFIATEW"
FT   CDS_pept        complement(817405..818097)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634603"
FT                   /orf_name="MICPUN_61442"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65916.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199BB15"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ7"
FT                   /transl_table=1
FT                   /translation="MAAERPRRFAAQVPASPAKVSRAEAQIEQAAAERVNLSAYPKDHP
FT                   IWQDSHFCPDGPDAMFPDAEEAFAAAAASLGFTTQDGDEGNTTQEDGRDTSEAGRDASS
FT                   EPFSDNGWATIAALAGTPLAAGGTAMSTPSTSAKPSVAFAIDTPVGLPDLDAMMNTPVM
FT                   DGSKDRVRWTPEEDELIIRMRVHGDRSIDWNTISAATGRSKQSAKNRWQYVLKKRYPEV
FT                   PAGRVHGI"
FT   CDS_pept        821738..822544
FT                   /codon_start=1
FT                   /gene_family="HOG000012647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634604"
FT                   /orf_name="MICPUN_84687"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO65594.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG562782"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199BB16"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ8"
FT                   /transl_table=1
FT                   /translation="MESLGTFGEVDCGVPIRDFFSQFDKNSKEDDAGGVPSKAKQKKLA
FT                   RESAALSENQLPCEAGSSIFLRHDPDRFDRMRAVITGPGGTPYSGGCFVFDVYFPAGYP
FT                   EKPPMVNLDTTGGGRVRFNPNLYADGKVCLSLLGTWHGGGMEEKWDAKKSSLYQVLVSI
FT                   QGLILVDDPMFNEPGFDGIRGTTEGDMKSREHNEEIRLYTVRHAMIAHLKKPRAGVEKV
FT                   LTEHFRLRKWTVMREVLSWCKEAGDPTVQKRMWGAARELSQLLAAL"
FT   CDS_pept        822816..823346
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634605"
FT                   /orf_name="MICPUN_61444"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65595.1"
FT                   /db_xref="UniParc:UPI000199BB17"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECJ9"
FT                   /transl_table=1
FT                   /translation="MAWETVASSWTSTQVRHMAKAAKKKQPVKKKAQGAPKAEVNPRMK
FT                   AAVEQYKDMLFGAVPRLTKEQMAENISEEELKEFQLRAAEYSRKKMAQHRAFQKDINNK
FT                   IRHKRAAIAALPPGYLRDHAETPDNTLFPLKRRLPGWDTPAIEGYYEEKQRAMEEAVMG
FT                   GGDGAIGSAGPSR"
FT   CDS_pept        complement(823488..824591)
FT                   /codon_start=1
FT                   /gene_family="HOG000069044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634606"
FT                   /orf_name="MICPUN_97880"
FT                   /product="Predicted protein"
FT                   /function="sulfate adenylyltransferase (ATP) activity "
FT                   /biological_process="sulfate assimilation"
FT                   /protein_id="ACO65917.1"
FT                   /db_xref="GO:0000103"
FT                   /db_xref="GO:0004781"
FT                   /db_xref="HOGENOM:HBG480761"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199BB18"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK0"
FT                   /transl_table=1
FT                   /translation="MVDESKKASVVSSCNRTLELSDRNACDVELLTVGGFSPLTGFMNE
FT                   DVYTHCVKEMRLPGSNLLFGMPIVLDTACEDTKVGDKVLLKYQGKDVGVITVESKWKPD
FT                   KPLEAKMCYGTSSIEHPGVSMISMERRKYYIGGKVEGLSKPERPFPCPDPSEVRAMLPA
FT                   GKDVVAFQCRNPIHRAHYELFTRALDAENVGEGAVCLVHPTMGPTQDDDISGLVRYHTY
FT                   EVLAKEVNNPAIRWAYLPYSMHMAGPREAIQHMIIRKNYGCTHFIIGRDMAGSKSSIDG
FT                   EDFYGAYDAQDLAKANAAELGMKTVPSLNVVYTDEEGYVTADVAEAKKLSVKKLSGTKF
FT                   RKMLRGGEDIPEWFAFKSVVKVLREHQ"
FT   CDS_pept        825946..827517
FT                   /codon_start=1
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634607"
FT                   /orf_name="MICPUN_108921"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein refolding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65596.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042026"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG625289"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="UniParc:UPI000199BB19"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK1"
FT                   /transl_table=1
FT                   /translation="MGPKGRNVVIEQNFGAPKITKDGVTVAKNIEFSDRFMNLGASLVK
FT                   QVASATNDVAGDGTTTATVLTRAIFSEGCKSVAAGMNPMDLRRGIQAAVDKVVAELKSK
FT                   AKLISTTEEIAQVGTISANGEREIGDLIARAMEKVGKEGVITVADGKTLENELEVVEGM
FT                   KFERGYISPYFITNSKTQKCELENPYVLIFEKKISGLNPLLPVLESVLKTSRPLLIVAE
FT                   DVESEALATLIVNKLRGGVKICAVKAPGFGENRKSNLQDIAILTGGTVVSEDLGHKLDQ
FT                   VDISMLGTAKKITVSKDDTIILDGAGEKATIEERCEQLRDAIAESTSDYDREKMQERLA
FT                   KLSGGVAVLKVGGASEVEVGEKKDRVVDALNATKAAVDEGIVSGGGTALLKASKALTEL
FT                   EGSMANFDQKVGVQIIKAAIKVPMKTIANNAGVEGSVVVEKVLGNDDDNWGYNAATGEY
FT                   GDMVSWGVIDPLKVVRTALTDAASVSSLMMTSECMIVEGKKDPADVAAGMGMPPGGMGG
FT                   MGGMGF"
FT   CDS_pept        complement(827621..830587)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634608"
FT                   /orf_name="MICPUN_61447"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65918.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniParc:UPI000199BB1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK2"
FT                   /transl_table=1
FT                   /translation="MVGFGKRMADTQVPEWSTEYVPYKAMKKHLKRLVKRMTAEEQQMT
FT                   ERENIASSGDGTRQQLLDGDGTADAGVRPQLKREVKHDREGLITVRTTGDVIDNQATVN
FT                   RHRRQPSSETNELSIATTVVAPKEKNVLALDEEVQFFHLLDEALRRVVAFYSDRLDHIR
FT                   CETQRERSQLNHLMSEAQRVVRMPKREPKKGDLVDIMHDIGSSFGSSSKKRSTEPRTFA
FT                   QEKARDSARMLRKAVSESYRAVNMLESFVSLNMEAFRKICKKHDKVTGWQTQDTYMRGL
FT                   RELRVFHDDEVQSLRSALEDAYLKIEEVLCMLEPDRWNRVVRGVKTRSKSSKQSGPLGF
FT                   YEVRKRRNELLAKLREETRETGTSFVAHGRTSGPRFTAGLALGAAGALFAMLITRVIEK
FT                   CANGRMDTVECNAVAAVAPAIRAPLLIALHVALYGSAVQAWVDTRVNAPFIMQAKRGTE
FT                   LTSTGAVLAGALIASTWLIISLVLVARAENNAKSAINGSGSVWTIRLYHLDDVFAAALG
FT                   AMVLMLLFFLAPWPKWLLRGPFKKTAVRLQHPPNSTRRFFLTALSRAIQAPFRRVRMMD
FT                   FFLADQLVSQTTAMRDFVAVLFLAFGSLLRSAVKYAPVVALWPSWCRLTQVLRRYRDDG
FT                   MPVHLVNGGKYFSGLLAIAIGLILRYEEAGDNKIGGAIFSNPSALRVWYNVASYVAILY
FT                   GSAWDFFQDWSVVKVKLVSKDWHETASKKMFGFCMSTNCGFTFSLFERRLMVKRRWIYH
FT                   VAIGGNALLRNVWIIASIPTIGSAETIGHEIWLTVWATLEVIRRSAWNYFRVENEHTTN
FT                   CGMFRATLEVPMPYAEGELTDDEDDEDDDKSVRSSDDAQAESDHSDTDEDIDHIRDNLS
FT                   VSDNGQSVDDANPPCGDEPLSRRNSIELTSMSRPVISTDIDLPTESFDSPSGGVTPRRI
FT                   SVNTSGPLTPQKSLGLEAIARLTSGMPVGDESPPGSPSSVRRSFDAEFRAAPSPKKKA"
FT   CDS_pept        <832764..>833522
FT                   /codon_start=1
FT                   /gene_family="HOG000006818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634609"
FT                   /orf_name="MICPUN_71683"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO65597.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG607394"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI000199BB1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK3"
FT                   /transl_table=1
FT                   /translation="KQQERAKQRAVADYKRAQAAQQRCPFCLDNPNKPRHLHVAYGNLA
FT                   YLMLPMAGRLVPGHCIIAPVNHCASSRAADEDVWEEMRNFKKCLVKMFAAKNQECCFIE
FT                   TVVKLGGGGLGAVGAALSKHTIIECIPLPDDVAERAPMYFKKAIDEAESEWSTHDSKKC
FT                   ISTAPPKGLRGAVPPNFPYFHVEFNMKGGFVHVIDDDDKWRVDFGRDVLIGLLDLPENT
FT                   TQAKKRPLPPAVLKREMDQFLDMWDPHDWTK"
FT   CDS_pept        complement(833661..835010)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634610"
FT                   /orf_name="MICPUN_102382"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65919.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199BB1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK4"
FT                   /transl_table=1
FT                   /translation="MAPNDVDDDDDKPLTEILRGAAGDVNPSGGAGPLAVIGNDGGAGA
FT                   GTYSRGTKRRVGKSGYRGVALHNKSGRYRARITSTAGDGRQRALGYFETKELAALAWDK
FT                   AAREIGFAPELLNFPDKEEEAKAEARINGIEELKDLHGGATLATLALGSTEDSTANAQA
FT                   IPGAPVEEEARALIVHKDVTWSHKVSTADKVSTGDSNQTAHDANQAAHDADLEGKEPKM
FT                   KGVRRKGQSIYEARIKMRGEDKRTCLGRFKTLAEAADAYDAKAREAGYCVNVCKHFGDH
FT                   VDSKTLDDIGSPTGTKGIRAISSERAQNMDRGVIPDDLQAYFDREEAIDPRSAKEKRVA
FT                   ENGGDLFGAFLLDKPGIYKFLGVFKMEAHCVAALKNTIPEWKLKNQERERNGRGAKARK
FT                   KREQEELLKLEAPPAGQATQAEAVTAALPAPTAINGSLQDTTPWQTTGVL"
FT   CDS_pept        join(835255..835422,835624..841512)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634611"
FT                   /gene_name="RRP5"
FT                   /orf_name="MICPUN_107434"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO65598.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG562786"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199BBB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK5"
FT                   /transl_table=1
FT                   /translation="MGAKRTRDEDDAEEAFPRGGSGSGGDDLPRGGNTGGGGGGSGKKR
FT                   SKKLFDDEDGGATAWVAGAKKVGDGKYVELLKYKNLRVGMKVLGVVTEVNDRGLTVSLP
FT                   NGLKGTVTRAEASDVLAPASKRGKKGPDGDDPSEASESESESEEEDEDEDERLDLTSMF
FT                   QVGQILRCKVRQLGKGKSGGKRIDLSTRLSQVCSNISGHSLTDGMAVPACVNSVEDHGY
FT                   VLSFGCSDSPTGFLPRKSCPQSLVDTLVRGSILDVVIAGDEGKDGKRARSKGPGGVMQC
FT                   TADPKRVAQAVTHEGDGAAMSTLLPGMLVNARVKAVLADGLQMNFMTYFTATVDAFHVG
FT                   GGVHGAAPDPAAAHKTGERVRARVLYVDAAAKRVGLTLRPHLVTLEASVRAGAMPKPGT
FT                   IFETAVVRRVDTAIGVLLELKSENENVHPTFGYCHISDAADEHLDKLEKRFKVGKKVRA
FT                   RVIGSRAMDSVATVSCKSTVLDQPFLSLEELVPGMQVRGEVVAVEPYGAVVKLAPGVKA
FT                   LCPPNHISDIPGRVTNAKVKEGLSAKFRVVSVDRVKGRAVVTHKKQLIRSELPVVASLD
FT                   DATPGTTTHGVVTGVEPYGVFVQLYGNLRGLAGLQDLGLAADQTPQEAFAVGQVVRATV
FT                   IRSDRGEQKIKLSLAPGGAVANGNDLDGTPGEKGDVGAPEPGTVVESATVKRVDEATGN
FT                   VQVTLPGGVPGVVTAAQMSDHPLTGAGLSQAFAPGDEIGPLVALEAKPRRSILSRKASL
FT                   VEAARGGTLPEDISGVVVGAIYPGYVASATANAGVFVRFLGRLTGLAPPSQLTDVPVAG
FT                   GVDPEEMFALGQTVLARVVSVDATVEPPRLSLSLAPRGVAASSGVTAEAPLIRSIFTDV
FT                   DVADRLADERAASGGEAPEGFLTAAANEKLKVGEEIKGVVHAVREYGVLVDMPDVDPDA
FT                   VGLVAFHQLPNANGDNEEPKHPAEGEKITGRVLDVSRREGVVDIGARPSLTGAKVGKKG
FT                   AKALTTAELKKRKAAQAGAHKLEIGSKVTAEVELVKPEYAVLSLPDHGGAIAYASVNLL
FT                   NRRFNEDEVETERFAVGRKVTAFVAGNAASGSPGDRLLLTVPAAKSNKGAGSGEASAVG
FT                   AGLAMEGVVKEVQSMQAILTLPNGRKGRLHATELAEGAFPMKKIAVGATLNVVTLGPAG
FT                   DRGNMLELTVRRSVEESREIARAATDAGGGDGSGAGIAGTAALATLSEGDEIDGIVSAV
FT                   SADTLAIAVAPGLTARVPKIETGDSIAALRKALTSRFTVGERVKMTALAADVARKKIIV
FT                   TLRSADKRNVVEGAKIAGIVSKIAPGGGGVFVQLNSRQHGRVHVTDIADDPRSEPWKLH
FT                   SVGEAVEVRVLGVGEGGEVDLSMKSSALKSKGSSNGISSVSQLAPGAHVSGFVKQVNKG
FT                   GCFVAISRSVDARVKMCNLADTFVSDPAQEFPKGKLVKGTILSVDESSGRAEMTLRSDG
FT                   MDAAAGRSQIDNNAHVEEGSVQMGTVRRVQTYGVFVTLDGSGRSGLCHISMFADARIKD
FT                   SLEQHVRAGERVRVKVLQVDEETGKISLGMKPSLFADDEMPDGDAGAGMEEDPLMADED
FT                   EEMEEDDDDDSADEAEEEEEIDDDDEDAEDDESDEDDDESDEDDDESDEEGADVLEGDD
FT                   DVDMDSEDGDDVDEDDEGEDDSDDEDDEDSDDEDLEDDDKGAVDEDIGFDWDDDKNAKD
FT                   EEDEEDAADEGPKSKSKSKRERAKEKAAKELELHRKEQALRDKADAAPETAQDFEKLIM
FT                   SSPRSSYVWLRYMAFQMSVGAYDEARSVAERALKAIPADDEDERMNVWVAYLNLENLHG
FT                   KPSPREALLKLFDRATKVANPKKLHLTLAGIYERSGQDDMAAQTLKTATRRFGQSAKVW
FT                   LAHIRAQILHVGDKNADPESVRKALDRATQSLPKRKHVKVLVQTALLEIREGSVERGRT
FT                   MFESILRNYPKRTDIWSTYIDQEIKQGDPDRTRSLLERATHLDLNPKSMKFLFKRYLNF
FT                   EREVGDRQRIEHVKQRALDYVAQKFG"
FT   CDS_pept        841594..845700
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634612"
FT                   /gene_name="CUP499"
FT                   /orf_name="MICPUN_107435"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO65599.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199BBB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK6"
FT                   /transl_table=1
FT                   /translation="MAGTRQRAPFVFPSHRVRFSWPEQHIVGGAARVGAMASGDAGDGV
FT                   TPDVSFATFHRSATPLVSDDAAVEDTVSHLAAVAASIASMDAPMIERSLDFILFPVTAV
FT                   MRRETEPNGDTATNPKAQARRIKTLEESLKCISTVMRRLEPGCGKPDFIADLFCDVVAV
FT                   LARAGSDPSLDPSRSSDLEDLRLAAVTCASEVLRLVRPDTEHAVALTADRNLPAVGYAV
FT                   SLLVQTAHLEAAAGARGSKVARSASLRTLRDLVMNTADPDVWSFFLPGIVSGLAKALHA
FT                   SSGSRSGEGSGPASAADDSSSTEAAIEALTAIVTCVLDDGVNVNIIKRRGEDGGDVRER
FT                   LRRMMSGRTASDGTGGDDAEDEDDEKDDDVRGPPPTGADATEAAARLKTKRTARWLRET
FT                   APRVESVLAAALTPLCAHRKPSVRRGASAAATAVMRTCADTLRGATRTLLECALVARGD
FT                   PWDSVSGPAAIALDGLRRDGYVDDDALDEVILDALRRLPGLVRAGRGGGAGWGGGDGGI
FT                   ACARMAIAAMATAGSQRVSDMFLTRYAVRSGACAGLAQCFAVSADLASVGRSNELRALG
FT                   QLSGKENGGPNEEDGESSSAMIEGDDAGAPARTTMNVPVLPRHPPRMLHLSDPDRYSAV
FT                   AAVARAMGRHCAAAHNGALAALVDAHLDALRDSLEDARSDGNEGNTLWQRSACAHVVVL
FT                   NETIRGAGEVEPKRKAETVAASRGVLQEYLSREVWDLPTSFDDIPLDDISHSRGGLTLA
FT                   TLRDNALLTCLAAEGVGVVAQACGADFVRRGGFLPQALCPLLQKLGDPAATVSDTAGDV
FT                   LCAIAAVGGFVHPTGTGGSDGGNNRVSREGPVSRLVAANADYVVDMLSRHLRHLDDHPG
FT                   AARFFAAVLGRHTGAARRTLPLLHEPVRRALDSMGINARRKNWRHAGTFLGCLREVSDA
FT                   TEAEARALLEAANKAVDDIRPLHDLIEEMERVRSEHFDDEDTEEEGAAAAAARMEASMR
FT                   GVIDASAHSDRAKSVDIPAIIVEWNRRVRHESSLSRLVDGVLSSAAPLLESTDPRVRLA
FT                   AAEVCSASLGAIAACDACSAPETAVYDTVKRLHPHDVPQTHGDNERPVRLLPRVHQLWP
FT                   HLMMSLGHRLGPDILPEPFKASLELLRRCAEVSGGDFIARRMSTDAWPQLARVLKVGVK
FT                   HANSESLVKRMETLYLGADGDTFFDDVRPDVDDDGLGGGKRGRETAGSAPQKTETVRRA
FT                   IMKTLADIGAREQSRMALRDVAAAAVSVVAPFAVTSGSDGKSSPATAAPSPELISLARD
FT                   AVKSLATVAPDAVWTALAVNATGHSGAPTPAAPRWTGRLGAGLPTLPSFRDIMPMHRAG
FT                   CAITREEAEACLDLLVECGMAIRTW"
FT   CDS_pept        join(complement(848159..848272),complement(846704..847978))
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634613"
FT                   /orf_name="MICPUN_97883"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65920.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BBB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK7"
FT                   /transl_table=1
FT                   /translation="MKKEKKDKKDKKDKKDKKDKKDKRDRDAAGDAGGEAKKAAPDGTN
FT                   FTPVAEFSEAGFSKDVLAATANFKKPSPIQAQSWPIVLSGHDMVGIAATGSGKTMAFGL
FT                   PALMQILAQPKCAPGSPQCLVLAPTRELAQQTAKVFEDAGTACGVRCVCVYGGAPKWEQ
FT                   KKLMQQGGGCAVIVATPGRLRDFMNDGDVKLDKVTMLVLDEADRMLDLGFEPEIREIAG
FT                   KTRADRQTVMFSATWPTSIQGLAAEFMCNPVKVRIGAEGLKASHSVTQVVEVVEPNEKD
FT                   AHLARVLKKYLGGKKPVPRTLVFALYKKECARLHENLRRQNWQAACIHGDMSQRDRELS
FT                   VEAFKSGSSPLLIATDVAARGLDIKGVEYVINYTFPLTTEDYVHRIGRTGRAGQTGLAH
FT                   TFFTQHDKARAGELANVLREAGAEVPTALTAFGTHVKKKESKLYGAHFKDIDTSVKAKK
FT                   ITFD"
FT   CDS_pept        join(complement(849199..849615),complement(848553..849077))
FT                   /codon_start=1
FT                   /gene_family="HOG000036765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634614"
FT                   /orf_name="MICPUN_97884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65921.1"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199BBB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK8"
FT                   /transl_table=1
FT                   /translation="MKLSPLAHQANAHDDAVWSVAWSGAGEGLLLTGSVDESVKAWRAA
FT                   GDGLEMAHAYTGHTLGVVALAAAPNGLVASSALDSLIRVWSVDTHETRCVIETPPAENW
FT                   QIAFAPGDEPAHLAVAGGVSGGVKLYSIEQDGGEQLEKPSPRFRTPSHAPTSSVLPQSV
FT                   TYSPDGRRLACGAMDGTVALFDVGTGKLLHTLAGHAMPVRSLCFSADGKTLYTGCDDGH
FT                   IHAYDAEHRSLTDALPGHKSWVLGVAVSPDGSALCSCSSDATVKLWDVGQRSCMQTMSD
FT                   QAEAVWGVCFAPGGGKVASVSDDKSVNLYDFV"
FT   CDS_pept        join(854014..854025,854070..854384)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634615"
FT                   /orf_name="MICPUN_108898"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65600.1"
FT                   /db_xref="UniParc:UPI000199BBBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECK9"
FT                   /transl_table=1
FT                   /translation="MCARHFHCDYGAVRWGVSLGPGWIITTPFAASQDWLKSSRNLDKR
FT                   LQEWEKHIDADSDLSRGPEGIPNFTKSAWLLNPDAMVAHVETDVDGEDDGDEAGPMDDA
FT                   IGET"
FT   CDS_pept        complement(854479..855180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634616"
FT                   /orf_name="MICPUN_61455"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO65922.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199BBBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL0"
FT                   /transl_table=1
FT                   /translation="MAPNLDIFMTTFPYVGKFFLAEEYFFMVLAADLRNKILPFAPKPG
FT                   YFVFSRTPGSTPPKATAQRMLTRYPKLNRRRVALAVDDSPNAMRAVRFAARDIVDADSD
FT                   AVLITAVHPGQGNPGKEGQRVLDHHKAQLLRCGLAESRISTITVKCKDRESIGDAVCKT
FT                   VKRQNCDHVVLGSRGLSSVQQNVLHLVGLGSVGEHVAHHAHVPVTIVPPITPVEEMITV
FT                   RGARVGVKRKK"
FT   CDS_pept        join(855489..855540,855702..856579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634617"
FT                   /orf_name="MICPUN_61456"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65601.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG562790"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199BBBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL1"
FT                   /transl_table=1
FT                   /translation="MAAAATHSRVVRSDGDLDDEVCWICLEGSTNEKVELIRPCKCPRV
FT                   VHARCMARWQLQCSGKDEEVHCKFCTQDLPNWRETLFRDVMDDDTEEDPRRASSNATAE
FT                   QQPKPAPDSVNGDIIVKFNNMSFRCRVRTGQEGLDDFMKQIREKCKIPEDKMNCLNLTY
FT                   RCKDPNTGTQMTLEGVNNSAFDAAVLCSAVQDKLKQRKSSKHSKTSNPGKISSFFSRSS
FT                   TSSSSSSSSSGRDVSPDPERRSGGMFHRPRRVSAPPPETESSRERDQNRRRSNMFGAPE
FT                   NEISRERDQTRRRSSRFMPSFMSSFVSL"
FT   CDS_pept        complement(856761..857978)
FT                   /codon_start=1
FT                   /gene_family="HOG000232446" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634618"
FT                   /orf_name="MICPUN_50606"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65923.1"
FT                   /db_xref="HOGENOM:HBG318768"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="UniParc:UPI000199BBBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL2"
FT                   /transl_table=1
FT                   /translation="MTTMTVALGAAIALPRTAGVRRTRVAAAARAFPTSRIAPRVAISS
FT                   RRRDASSVLQASDNPGQAPSLSVNDENAEEPALSPRPKPTKKPDEPVPNPPLRVAAFLA
FT                   GAGFLESSYLAVEKLTGGEVTCPLTGCQTALNSGYSELFGVPLSAYGAAAYFGVAALTW
FT                   WGAGMAGNEEEKDAYQRARVLTFLSTAGLAGVSSYLLYLLAVPFGGAECVYCLTSAAIS
FT                   FSLFAIGLSGVNGRDFGKAAPAAFSVYIVTVLSLSVLLTDDSSQANINSLKLPYAAPVI
FT                   EAQSTSYSRDLAAHLKSVGAKMYGAFWCSHCEDQKEFFGAGADIPYVECFPNGWERGTP
FT                   VAAACSAADIQGFPTWILADGQKLEGEKTLAELAKLTGYEAPGPGALPTAPGLDASSQL
FT                   DSFLSQ"
FT   CDS_pept        join(858055..858210,858414..858800)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634619"
FT                   /orf_name="MICPUN_61458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65602.1"
FT                   /db_xref="UniParc:UPI000199BBBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL3"
FT                   /transl_table=1
FT                   /translation="MKVRSGENRFRPHWLGALRGGSRGAHNSGKMFSIVHLEYFFGFGM
FT                   FILGMTKVSGELIPAMHREFERDYNRWAEGKMAFLHLTGDQLMNAVGYIEGVVACLVMM
FT                   AQPGNPVRRWGLFLVFNTLITTFLLHVFDKDGREMPNLIMASVCIFIIANEPKYPLGVP
FT                   PTMVKTRRVKDPVKKDK"
FT   CDS_pept        join(complement(860376..861034),complement(858878..860312))
FT                   /codon_start=1
FT                   /gene_family="HOG000030368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634620"
FT                   /orf_name="MICPUN_84836"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65924.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG562792"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI000199BBBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL4"
FT                   /transl_table=1
FT                   /translation="MAGPLRAVARRVAGNLLSRPVDVWSRANLGTAAAASHLDDDRKGL
FT                   FALPGLHEPSDFARLARRAVARSDDLMRGLVSSGPSGFPHRSATAVIDDLDEISDTLCA
FT                   VVDVAELCRNVHPDLRWVRAAENAYVELQGYVQGLNSNRGLYLALVNAQERHGAELSPE
FT                   AARVALTLRQDFERGGIHLGGDEHARLEKTAGDVVKLGMAFQQNLSDPKALGHMDVSDT
FT                   GFARVPLDQRTVSAVLRYADEPDTRRSVYLAAHSGPEANRAVLNGLLRARHESAKILGF
FT                   ESHAHFATSPLLAEHPDAPRALLERMASECRDRAGEEIEAMLRLAGRDGMDGTVRGWDR
FT                   SYLIGKARAKACELDAAAVASYFPLERVISGVGALVDRVFGVKLTEVAMEPGENWHAKV
FT                   RKLRVTLGDRGAGEGQEIGTIYLDLEPRPRKFPHAAHFVIRCSRGVGPDKQRPAVALVC
FT                   NFGAGSAATLSHSEVETFLHEFGHAMHSVLSDTQYQHLSGTRCAMDMVEVPSHLFEYFA
FT                   WDPAVLGLLARHRVTGDPMPREMIARLRASKELFGATDLQQQCVFALTDLEVHALDPAT
FT                   LTEGSVSDVAARVQAAHSLMPVEPGTSWELRFGHLVGYASTYYSYPYAKCVAADLWGKF
FT                   FREDPLAPGAGEALREGMLRHGGAREPGAILRDMLGDGALMTDPVGAAPDPTSMLADLN
FT                   RGR"
FT   CDS_pept        join(861208..861460,861561..863306,863354..863373)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634621"
FT                   /orf_name="MICPUN_61460"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65603.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199BC59"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL5"
FT                   /transl_table=1
FT                   /translation="MSNTDTKAYSATEIRPGEPREHDDKASFGPQAVARPRPMAIRQVN
FT                   TVTRGKGRIKPRLSQVERMGGVDGAAGAIEAAHSMPREEAVADRDPDRASGELPSDAPP
FT                   RYPYYLTDDGDSVVPRLDWTDARQRNRAMDLMRRGEPVLLRRTGLTGSLTGRAADIKPG
FT                   LLNWWGTDDFDKVLERHRATVDGGSAREMRCMTSVAGKHAFTPAIEQNNAFGSHYRVRK
FT                   PETDVSSRDFQTFATCARNWTDLKMYLLDDVAVAVDRSTAGKPPTDVTPLKSFPNDPIG
FT                   SDVVSGIDWEWLANVRRALKMGPVRGAVISAGTEGSLLPAHHLTSSLVSHGVASPKKVP
FT                   THVGKFEVNPLDLEGARAAEDAAKAMSNENHCESFQCQVIGRRRVLLISPDLSYKGLYP
FT                   YPIAHPYDGYAMANLDDADYSRHPRLAEVRGAAAICEPGDVLFVPDSWWRHEQGLTQEH
FT                   AAVEIRVGTGMRPRTAAAAVLHVGRLVEDRVTRAEGHRDARHWTKVIADAEEADWLDLG
FT                   TVRGAHRIDMAHMVRDEIDLGLPTPRGAQPGAGRGRWQAFLRDLIDGRMEPTDWLNDNF
FT                   VDPLFLSEAKAEMKRRAELIADGKVDPETTGTELALSSDELAKVAGAEDNFAVSLAGGG
FT                   VLTKNAKRLPDDRSETQRSFPEFFVDSLNQKASQLRE"
FT   CDS_pept        complement(863496..864989)
FT                   /codon_start=1
FT                   /gene_family="HOG000264373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634622"
FT                   /orf_name="MICPUN_61461"
FT                   /product="Predicted protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ACO65925.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="HOGENOM:HBG608478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniParc:UPI000199BC5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL6"
FT                   /transl_table=1
FT                   /translation="MAPAYAATASRGFVAPRRALRADRVAAPAARPSCVPRKPIIIAAM
FT                   RRDDRFGGCCVRATRRPALVTTRALSDGDADKWELAQAIMRMRRTQDEALDLILSEVST
FT                   LSKEVRSLRRELDELRANGSVAPSTEKTLAEVAKNTQDRDVLNEMLNALIPESDGSGDE
FT                   GDAPRRSADVAVEERSRPAEDVPFPENADIADVPVVLDVAGWKGDGTDRSHLWPMCKMG
FT                   EDDLYLMSTIQSSLNEAGFWAGEEDEADMYFGPSTQEAMCYFQASVGLPEVGYVDPDTW
FT                   RALLGDDRYAWGPVPGAIGFDAEEEANATEEALANAQGPADAAPSAEAKAATEWSKNVV
FT                   SLVDNPDNDPGDDAPVWGDEQNRPIDKVSEEFTQIATSGEKWPVLRLEDGGMEVHKLHV
FT                   LLDSAGYYSGEEDMEWWSFGGSTENALGTFQASNGLPDTGLTCLLTWKALLGEERVAMG
FT                   PAKAFETVGELASGEYTMDLSRQDRVFLLGEGRFEGTKK"
FT   CDS_pept        866452..867102
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634623"
FT                   /orf_name="MICPUN_108923"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO65604.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199BC5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL7"
FT                   /transl_table=1
FT                   /translation="MRLEECGECTGSGVKAGTSPKTCGTCGGQGQVVATVRTPLGNFQQ
FT                   VTACNACGGSGQTFTPCSACGGDGRVRRSKRISLRVPAGVDSGSRLRVRGEGNAGRKGG
FT                   PPGDLYVFVGVKDDPDLKRFESINVSSTVTIPYTKAILGTTQKVRTVDGTVDLKIPAGV
FT                   QPGATLLMAKRGVPKLGQPNVRGDQYVTVKVTIPKSVSGKEKELVEELEGLSN"
FT   CDS_pept        867447..868619
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634624"
FT                   /orf_name="MICPUN_102393"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="ACO65605.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniParc:UPI000199BC5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL8"
FT                   /transl_table=1
FT                   /translation="MASPTTAAGLSSPAVVPPDPPAKPVRSALDFFFFGRFRGSSLPAR
FT                   PTPALLFQLVESCSSSTIFTMPNPTRRAMHTDRRFFERAVHACTRKTSSSFDERGAAEM
FT                   GGTRAMLRALAGFAVTSRTLVSTSRDSAAVSLMSSCVGSGWRRWVTASGSVIDEPWRIS
FT                   QARGMSIDRRRDRTEDVTKKNSVAAHRINEQITARHIRLVMGGDGEGDTKSHEVIPTIV
FT                   ARKRARDAGLDLVEMNAKAVPPVCRMLDYDAFRYELRVKEREARKKAVERRRHDQVKEL
FT                   RLSARISTNDLRTKADQANRFLEQGHKVTARIEFKSNDGVKANMRPDAGAILYEEFCAM
FT                   LNPHKVEVEGKMVGPSHMILTVAQEREKKGQAKKQKPKEKQVDAATQEVS"
FT   CDS_pept        complement(868807..869997)
FT                   /codon_start=1
FT                   /gene_family="HOG000239525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634625"
FT                   /gene_name="AMY5"
FT                   /orf_name="MICPUN_97885"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO65926.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG318585"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199BC5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECL9"
FT                   /transl_table=1
FT                   /translation="MLLQGFNWESSRIEGGGAWYRKMTEMAPRLAELGFTVVWLPPPTD
FT                   SVSQEGYMPRDLYNLNCKYGTKEELKQCIEALHRHGIKCLGDAVLNHRCAQFQGPDGLW
FT                   NQYGGKLDWDARAIVSDDPHFGGQGNQSSGDFFHAAPNIDHSQDFVKRDITEWMQWLQS
FT                   EVGYDGWRLDYVRGFSGKHVKTYMESTNVSFAVGEFWDTLEYDYDSPKYNQDAHRQRII
FT                   KWIDDAGGLAGAFDVTTKGILHAVFERCEYWRLSDEDGQPPGVLGRWPSRAVTFIENHD
FT                   TGSTQGHWRFPEGAEAQGYVYILTHPGTPTVFWDHVYDWHDGSLAQDIRKLIAFRKECG
FT                   IHCRSKVNILKAEAGVYAAQIDDRVVMKIGPDAFAPDETEWQYAMHGDNWCVWKHR"
FT   CDS_pept        join(<874891..875675,875958..876871,877142..877680,
FT                   878035..>878599)
FT                   /codon_start=1
FT                   /gene_family="HOG000245391" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634626"
FT                   /orf_name="MICPUN_65459"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65606.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG610926"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BC5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM0"
FT                   /transl_table=1
FT                   /translation="VYDFPLDGFQKEATAALVRGDSVVVSAPTGSGKTLVGETAIMTAL
FT                   ARGQKAIYTTPLKALSNQKLREFQALFGVRRVGLKTGDVDINTADADVVVMTTEILRNM
FT                   LYPQATGDEGTDPTSAGATIGEFGGVSDGRLDDVGVVVLDEVHYLSDASRGTVWEETII
FT                   YCPPRVQLLCLSATVGNPDDLAGWIEEVHCAGASSQRCQTIVSDYRPVPLNWHFSMRPG
FT                   RMWPGLGPLLNRNGTKLNYELFPFTKEGAREWAAANGGAGLVPHVETTVGQLVAASMLP
FT                   AVWFIFSRKGCDQAAFYLADCGAKLVTPKEEAQIAAALEEFEKSNPDAMRPEAVIPLLM
FT                   GIASHHAGLLPGWKGLVENLFQRGLLKVVFATETLAAGVNMPARCSVLSALSKRGDEGP
FT                   RMLTSNEFMQMCGRAGRRGYDTVGHVVCCQSPFEGCEEAFGLVTAPPENLKSQFSISYG
FT                   MVLNLLRAGRPLSSVRSIVERSFGNYLGGRARREQVRELRRIREQSDALREQIATGDCG
FT                   VEPEEWARFIKLDERLKEERRLLKIISRQTDDAMAEMARANVRDALEVLDTVPVARSKV
FT                   DLTPVAVVEAYDSTGVASAMYPLGEFVGLAADGTWYRFDASRIKAVSENPVLHADQDGG
FT                   EWTAPPTPTPGSLRWVRASGGLWRAQGNEEAVEAAQQVSIALSSEAINSADDSEADALA
FT                   FLDEQRARIAATKAELHEMKMFSDMRRAVKKTNRKREKLKKLEERAKKVERRRRRRDAR
FT                   RLARWDVKHGGSDRAEETLRLTPLGECCAKLRGENELWLGVALSSECLEGLDPTQIAGV
FT                   AGALCCDSNRPTSCDYDPSPALGNALADLEPEMAEVMALQFEAAMSSPVNMSRAVAALV
FT                   ESWASGATWDQVRGDTNLEEGDIARVFRRTSELLAQMPRARELPLATRKAAEQAAQLVL
FT                   RPPI"
FT   CDS_pept        join(complement(878728..880011),complement(878691..878696))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634627"
FT                   /orf_name="MICPUN_61466"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO65927.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199BC5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM1"
FT                   /transl_table=1
FT                   /translation="MEDVFEPIANPSGFVDLAMLDSRLLDGYDTSGTGLERKTPTSGIE
FT                   LRQCAAQMLVDGGHGAPWVPPSPGVQGWLSPEWVTILGAKSEAEAVESVVAGALAATTM
FT                   KTGVLVVAPYRPAWPSPSGRLSHLAASDGSVTAANVLYVDPSAHGDDINAALDTGAETL
FT                   RSSSGAEVGAVVLGNPSPATGVVASTGAILEVMRWCQSQDDVHVIADETGACGVYVSRG
FT                   SISSSAVAGVAAAVAAGIGPTALTTNPNAKVTDDEDDEPAWGRKAGFISSSSLWRKANT
FT                   CTHVVTSFGPAAGISRGKTTCLLVTRDDRVRSGAGSDPFANGLQALMGDGGTAAREAIS
FT                   YHNMLLRRRQMKVRTALDALGVATGPAAAVPTTRADGGGYVWIDLSEFCGGSFEKETRL
FT                   WEELAMTYRVLIVPGGLCGAARPGYFRAAD"
FT   CDS_pept        complement(880237..881805)
FT                   /codon_start=1
FT                   /gene_family="HOG000245250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634628"
FT                   /orf_name="MICPUN_96617"
FT                   /product="Cysteine-trna ligase"
FT                   /function="ATP binding"
FT                   /function="cysteine-tRNA ligase activity"
FT                   /biological_process="cysteinyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65928.1"
FT                   /db_xref="GO:0004817"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006423"
FT                   /db_xref="HOGENOM:HBG327651"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="UniParc:UPI000199BC60"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM2"
FT                   /transl_table=1
FT                   /translation="MPVAPNGQTLMLHNTMARRKEPFSPRDSTGKKVNMYVCGVTVYDY
FT                   SHIGHARVYVAFDVLYRQLTRMGYDVTYCRNFTDVDDKIIKRANENGEECDALVDRFIA
FT                   AFHEDIDALGCLRPTIEPRATDHIKDIVTMCERLIEKGYAYPADGDVYFSVDALPEYGS
FT                   LSGRKQEDNRAGERVAVDDRKKNPADFALWKAAKPGEPTWDSPWGAGRPGWHIECSAMI
FT                   DSILGKSIDIHGGGQDLVFPHHENELAQSTASCRCCATDGDEPEEPFVRYWVHNGFVKV
FT                   DSEKMSKSLGNFFTIREVTEKYHPFALRWMLLGTHYRAPINYTQRALEEASDRLYYLYQ
FT                   TLVDSRVALTEAEASATDAEVKGKPKPPTGVAAEGIELAVETKAAVASALTDDLNTPLA
FT                   MASLSSPLKTLNDLVSTKKGKKAVGRNVALRDLVKTVEETLEAVGLPHEGGEGLLEELR
FT                   LLTLARAGLTQADVDEAVAKRAEARAAKDFAESDRIRDELGAKGVALMDGGSQVWRPAT
FT                   VVNDT"
FT   CDS_pept        join(<882672..883428,883561..883706,884307..>885138)
FT                   /codon_start=1
FT                   /gene_family="HOG000200833" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634629"
FT                   /orf_name="MICPUN_65684"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65607.1"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniParc:UPI000199BC61"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM3"
FT                   /transl_table=1
FT                   /translation="FAMRSSKLKFDILGRKVKGDKGNVLKAREAGYIKRKDTLLKEHQA
FT                   SGKSNAFVDRRFGEDDASMTPEERAIGRLARTRLRQIKRGSGFNLNDDDDDGQGYDDEE
FT                   PITLTHGGKPIDEREEERRSAHAIARGRRGMRDDDSDDDMAMDAATTGALHFGGGEDDD
FT                   GFEPTLKRGDHDTPEENGDPNRRKTKKEVMDELIDKSKYHKAERARQRERDEDLLDKLD
FT                   DEFKEISGAGLFRAALSKGVGHLKPDGWERDDYDKLARELALESRGQATDRIRTQEEVD
FT                   AAEAATLETAERARLKRMNASDEDDDDDEEDEDEEEDADDDEEDNDDEEAKEAEEAGEE
FT                   KEELDFSGDKSDSDLWSDSEEQYEEGEPKPAKAKDPKAKAPVPELPFTFPMPETPHDLE
FT                   KIVGHLSVEDTTVALERIRKCHAPTLKEDNRKKMQSFLGLLLQRFEMLSGQSPLPVDYL
FT                   DVLAVNIAAVANIVPFFAVTSARARLEKMAARLRQRLRDGETGWPPARTILLISLFADI
FT                   FPTTDKQHPVSTPAALYLGNVLAHCAVRSTREAVTAVVVAGLAARYSAPAGRIFPEAIT
FT                   LL"
FT   CDS_pept        join(complement(887476..887549),complement(887305..887334),
FT                   complement(886063..887191))
FT                   /codon_start=1
FT                   /gene_family="HOG000241613" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634630"
FT                   /orf_name="MICPUN_106062"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65929.1"
FT                   /db_xref="HOGENOM:HBG316445"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000199BC62"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM4"
FT                   /transl_table=1
FT                   /translation="MGAREQLTWYTPLRKIWEVIGVPIWLTMRLLYHIRFNWLVKFFGL
FT                   CGFAAFLSPAFLRIAWFYYTDRRVKRNLQYGSAPRNRLDLYLPTGCAFDTEKTEAAVRA
FT                   ADAETDAGRDPASRERHENGGSGGGRPVIVFVTGGMWIIGYKAWGALLAQSLMKQGFIV
FT                   ASLDYRNFPQGTVGEMIQDVGCGIGWVVKRAVALGGDPRRIVVVGQSAGAHLSATAILR
FT                   QAEWELSGYGLASAWSPSSLAGFVGVSGVYSPDDQSLVDHFHRRGLHREVFHSIMEAGY
FT                   SGARAEEALPRASPCAILRDQAGVPGLISRQPPVLLCHGSADTSAPPSESAKFAAALRA
FT                   AGVAEVTEKYYPGKTHTDPFVTDPILGGHDALLEDIVAFVRKGEDALKLPALPRLLPKP
FT                   LVDIARTMVPF"
FT   CDS_pept        complement(887855..888433)
FT                   /codon_start=1
FT                   /gene_family="HOG000006174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634631"
FT                   /orf_name="MICPUN_84656"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ACO65930.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG749723"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="UniParc:UPI000199BC63"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM5"
FT                   /transl_table=1
FT                   /translation="MTHRRVGPPASRPGRAAGSRVRRIVTVRAAGESSISEKLELTADN
FT                   VEKVLDEVRPYLIADGGDVELVEIDGLVVRLKLNGACGSCPSSTVTMRMGIEKRLMEKI
FT                   PEIMEVEQIQDEAGGLDLTEENVEATLDEIRPYLAGTGGGQLELVDIEDPIVKVRLTGP
FT                   AASVMTVRVAVTQKLREKMPSIAAVQLLN"
FT   CDS_pept        888745..889485
FT                   /codon_start=1
FT                   /gene_family="HOG000265324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634632"
FT                   /orf_name="MICPUN_61471"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65608.1"
FT                   /db_xref="HOGENOM:HBG607405"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniParc:UPI000199BC64"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM6"
FT                   /transl_table=1
FT                   /translation="MSSKTFKIAMPEGLDTHDTSPPPLPSWLKGFCVTSKAPSDVRRAG
FT                   LEVCNLLADGFFKLSYDDVSVPRSMVKPGETEVPYDTAEAILVPGSPGTIFVALRPDNT
FT                   TVDPVLLARALIEEADHVGAEGWTKTAHTQRIIPVESIAPEMDYLQLAKQIISQRFPEI
FT                   QPQQEPKKSFAVRYEEHSPAVHLNSAEVQKAVADLVPDSYTVNLENPDLTILMVVAGGS
FT                   VMMSVVEGYEKLHRFHIHSASYVA"
FT   CDS_pept        889740..890234
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634633"
FT                   /orf_name="MICPUN_108927"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65609.1"
FT                   /db_xref="UniParc:UPI000199BC65"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM7"
FT                   /transl_table=1
FT                   /translation="MTTAVHAALGRVWNWLEVNGWTAVATMCVVMFTWTNLAEPMLRRA
FT                   RSLSRQPTRERQIDYAERQKLARERQAEAFKRASEDHAARERERRAREAEELRALGSRV
FT                   RGRGHRLGTGADEISPRPKPKPKPKDDKDDPFRRLRERNPLAPDASRGHQPTKRVVNTG
FT                   G"
FT   CDS_pept        complement(892828..893496)
FT                   /codon_start=1
FT                   /gene_family="HOG000238738" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634634"
FT                   /orf_name="MICPUN_61474"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65931.1"
FT                   /db_xref="HOGENOM:HBG562798"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI000199BC66"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM8"
FT                   /transl_table=1
FT                   /translation="MSDQWLVGFEEVEELVDDALATIRERDGCASLGNRAEAARLTATV
FT                   MTKAVTLTSKLDTLEEDLSHAIVTERESRRREGMLRELRACFEDLQIRIGGPGSPEPVV
FT                   MPVETRVDVEEELDNRSILQLQRNLMREQDEELEELSRVVTSTKHIGLAVGEELDLHAR
FT                   LLDDLEDDVERSGSMIRRAHALAKAVYENSGGGCKFFLLSSVLVAVLVSLVILIEKTKH
FT                   "
FT   CDS_pept        join(complement(896306..897785),complement(895655..896175),
FT                   complement(895365..895592),complement(895169..895305),
FT                   complement(894326..895046),complement(893817..894254))
FT                   /codon_start=1
FT                   /gene_family="HOG000100115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634635"
FT                   /orf_name="MICPUN_61475"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65932.1"
FT                   /db_xref="HOGENOM:HBG562799"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199BCF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECM9"
FT                   /transl_table=1
FT                   /translation="MRAPRYICTLMSLALWSSVSGFQGELPATVCPFRDEVMSLDYALS
FT                   SILVHEEGKTVPSQFRVLQEVVDAARSVCGDTFLFYTTAGGQTMFAPTDQAFEELFIEL
FT                   NRGLEELLSDPTLLCGLVRYHLTVPCTQVNNALWGRSCGFLLTNDLVDAQPLETLFSDQ
FT                   ALSAGLELTGVGSASSLLFVAIAQEVSTRKIRIDGYMKRGADVIVPNIVLCESLAVHVV
FT                   ETVLVPAAAFYSSVESLISSLPELSITAEAYFLTKPLRDSLLVPQPFGQQQVSAQRFFL
FT                   GDVVIIPPLIPRGDLPLPFLPDVGMCEPGVVVPGLDMRTVFAPTDTAWKNFFKRVGLSK
FT                   EQVFSDPELLLSTLQYSEVLASFETPPISADGLLAGSRFFSYNLYPLEILQSSVVPELL
FT                   FVLPILGPGLDVLNFFDLIVDITCVGNKRIVTIEGQRYAMLGRNQAVVVAPDLVACDGL
FT                   IHVVDSVLITPALTTLRQLTLRPELSLFTQLITSPVELDSEFPHELSFLSQGYTPEDIL
FT                   VPYIDPYIAFLIRQQLAQYHLILDLVPRGGLIPQEDFRLCLLAETDVFDTRLAYPLLAK
FT                   PCNIFLGFSIIKQVGIYIQGVRSLFSKVPPGLPDPLRSVFIEGRLNFGRVIVPDLVSSN
FT                   GVVQVIDTMLIPPTAELGLTLYDRIARTPWLKLHEEILLLLGLEREFRGSCLPPGDASA
FT                   FAITDAAWLAFFAKLAFSKDMFLESFTAIMYDIMLFSLISDREEVILDLGVALDYVYAP
FT                   LEPQYISNAEVFPTTLSRYWQSPADLQFLRHDSYAKNETQDVQHGNNVYPGNQPNVAQI
FT                   IPPDTRTGQLALNGDLHVIDKVLLPNPRAFCRAGDFEFYMGSAFSSVIASQQDQSGQVI
FT                   NSIVPRAFAYDFCDKLPCTYEIPGLYGRAGFRLSVEATVQFKHVLPLCDPWCDPTQYWW
FT                   CIPCTGIYAQTILTIGGCAPYQTTLHCGGALSIWVTDAGEVRFGFQTFVESFSLLPIFF
FT                   GGGMRVVDLSVPALGFKAHDKQVFKVLATYDGLCNCTKIYVNDKLRGIADPFDMGQYVF
FT                   QPFENVAGNLRESITLGASKHSLTPVNPALQYPDPSAVQAGTGGIGSLNSTGPNLYLSP
FT                   KDWSIPAAGQYATYPADPVLAGRNPTQVYLPWKGNIISTSVWFDNGIRQGIVYPSTCIP
FT                   PPFAGPPT"
FT   CDS_pept        898262..>898846
FT                   /codon_start=1
FT                   /gene_family="HOG000009833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634636"
FT                   /orf_name="MICPUN_71196"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="barrier septum formation"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65610.1"
FT                   /db_xref="GO:0000917"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG447097"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="UniParc:UPI000199BCF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN0"
FT                   /transl_table=1
FT                   /translation="MQKVEFVSATEDADDCPPPDGLPEVAVIGRSNVGKSSLLNLLTKG
FT                   KSGALVSSKPGTTQHINHYLVAKKWWIVDLPGYGFAKASKESTEMWDRFTKEYFTTRSN
FT                   LAGVLLLIDASIPPMEKDLEYADWLITHNVPFTIVHTKCDRNKPGMPAVDTNIDELRRI
FT                   LDEKWHRLPSMISTSSVSHDGREDVLKFISSI"
FT   CDS_pept        join(complement(900328..900372),complement(899161..900195))
FT                   /codon_start=1
FT                   /gene_family="HOG000225436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634637"
FT                   /orf_name="MICPUN_61477"
FT                   /product="Predicted protein"
FT                   /function="cyclopropane-fatty-acyl-phospholipid synthase
FT                   activity"
FT                   /biological_process="lipid biosynthetic process "
FT                   /protein_id="ACO65933.1"
FT                   /db_xref="GO:0008610"
FT                   /db_xref="GO:0008825"
FT                   /db_xref="HOGENOM:HBG289173"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="UniParc:UPI000199BCF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN1"
FT                   /transl_table=1
FT                   /translation="MLKPAYDAFYRSFLQLVERNLVPDFLLRRGIRFLLRTKCLFHFKN
FT                   TEDRLKHEMEFVEDLRLRPVAEQTKAANEQHYEVPTEFYLECLGKHLKYSCCLYSKPGM
FT                   TLDEAEREMLQCYGRRMKIMNRQNILELGCGWGSLSLWMAQMYPLSKITSVSNSTTQKE
FT                   FIDARAKELGLTNLTIITADMVTFEAPEAGNYDRIVSIEMFEHMKNYDKLFERCTRWLK
FT                   SGGLMFIHIFVHKDTPYHFEEESEDDWMSKYFFTGGTMPSDRLFCFFAKGLHLKQQWRV
FT                   NGNHYYKTCEHWLQNLDRSYRKGKAKAILEKTYGKEQSVKWYVYWRLFFLSCAEMFNYD
FT                   NGEGKGNEWYISHYLFEKP"
FT   CDS_pept        join(900527..900678,900797..901718)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634638"
FT                   /orf_name="MICPUN_61478"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="intracellular transport"
FT                   /protein_id="ACO65611.1"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015007"
FT                   /db_xref="UniParc:UPI000199BCFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN2"
FT                   /transl_table=1
FT                   /translation="MGKKRRNDAGDDEEEWGAGARALKAQTGGSKEDIGKREDKCRAHL
FT                   KQLNKQWVKTQMSSRPVKSWAKGVEDYLKHIAEIKSEFKDVLEAHTNGVAPAPAPTAPS
FT                   LFGGATTTTAAPASSPAPLFGTFTAPAGPAATSSLAFPEAANNPFTLKPSSTPLFGAAS
FT                   TPAAGSAPAPAFGGFGGGFGGGFGGGFGATPSPLTIPPSTPEGNEDEDEEQRPPSPSFK
FT                   EKERDENDTEECLMKCKVKFFTKKEATDPWGDHGVNHLELLREKVASDGKTKKARIVCR
FT                   NSIGKAVLNAGLYKGMSKPLVTEKKKPDGSMAKNGVILPLYNAAEEMVKKITMFRLGKP
FT                   DDVEMLNRLITESVATL"
FT   CDS_pept        join(complement(902378..902681),complement(901823..902265),
FT                   complement(901773..901787))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634639"
FT                   /orf_name="MICPUN_61479"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65934.1"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniParc:UPI000199BCFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN3"
FT                   /transl_table=1
FT                   /translation="MSVVTVAAMCVPTKRICPRAGRRASKGARRVLSVRAAGENPSSPE
FT                   EEEDLPKPIKLTPEQAKVAALAFELLYEKDPVEELESMLVDRERPELRAKLQRAIEAAN
FT                   EACKLGATIECAAAWEEVDGLEDAAMRAGMSQNAPSAMAPKPPAKTSTPDAQTSKKKED
FT                   TRMSNPATRAGTDPLAGMNPCGAGECEVPQGTLQARMDFERQMDSGEDDAEDDEALTVQ
FT                   IRDAVDVAISLCEQGASAGECAVAWDVEARR"
FT   CDS_pept        complement(<902940..>903470)
FT                   /codon_start=1
FT                   /gene_family="HOG000195825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634640"
FT                   /orf_name="MICPUN_76613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65935.1"
FT                   /db_xref="HOGENOM:HBG717479"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="UniParc:UPI000199BCFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN4"
FT                   /transl_table=1
FT                   /translation="VVIDLEFGDLMEEKEKKSMAYQLGICYSANCKAVVPAQIHVTGLG
FT                   SGMGDVVRKVCSGVEHWAVHMSDETYLESPALAERKTNLVYLTADSEHELEDFKDDEVY
FT                   IIGGIVDRNRYKNLTLNKANEQGIRHARLPIRDHLKMSGTHVLTVNQTLDIIHAQLELR
FT                   DWDQAMDRAVPMRK"
FT   CDS_pept        904255..908001
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634641"
FT                   /orf_name="MICPUN_61481"
FT                   /product="Predicted protein"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO65612.1"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199BCFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN5"
FT                   /transl_table=1
FT                   /translation="MVGLSFNIEQTPTGGVNVTVQPAGGIQGEVRVNGVSHEVPATESP
FT                   TPRRSGNRGGAGASSSTPNAGPDMHRCTVKGCKDKRGARTKGFKDLMRLAKHVLTEHSG
FT                   STLASTFREEGWHKVKGQSKVKKKKPEKAASKKVETEVKKEKRKTKTSFKQQPPSRAEA
FT                   RQKEPVQWAPNLFAQSPTAQAAARRQASEHMDGSSDSDSDSESVVSDDGLGSDTESTKG
FT                   KEDGIAQTEDEDEGEDVRHRPQVDLVDDSDAWETVVKLEAEDVAEVAMNDPVETEPAIV
FT                   EPEPRVEKPNSRVQSPKSEKKMPQRTPKKAETPRMDPPRLEPVSDEIHPFAADAPQIHG
FT                   TYADDGDSAFTSLALRCLRSRMEGDGRNWGRGRKHADETAPATKFSDATEYASYHRLLV
FT                   LEDCASGAADEFKLNRPVTRWKVANGFTSAAALTNAAKVEGLFSVVMNRDRKAENTASD
FT                   PPTEDDIVEVKYANAESVIGVVDNISPDGNTLSVSVRAADLLGAEALKQGAEVTARTGY
FT                   SLTTTRREFHAVQDTVQRLHAPLVAPLLLGQPFYTGWNNGSTAVTGKALVPGTKQQAMP
FT                   LPMALGNEPKNLSSVNRVIEGWCNNGTFNANQASAIRRCIRPGVVSGAETIRPCMGVAL
FT                   LHGPPGTGKTNTLVGVVSALLLCSPKPRILLCAPSNAAIDELALRMVTGLLDKDGKKCR
FT                   MKEGQLVRVGPIDQVSHRMHPHALNTLVDARMDGLVGRRTKKEEDRQRKATINSAQIVA
FT                   ATTSAAGGAYLTESGMGFDCVIIDEAAQASEAATLIPLRHSGGKEQLEAKRLILVGDHM
FT                   QLPTTAHAEDPSLRKAYAMSLFQRLEASHPAVALTVQHRMHAEIAKWPAKYFYRGELEN
FT                   AADSPTESPFNQCGGDGAVCLDGHLFRLKPYAFLDFHGEEAVGAQSKSIMNESEAKIVA
FT                   AVVKAARKWARVEASVAVITPYREQRELIIKNVDDSSVRVGTVDGFQGQEADIVIISCT
FT                   RTKQLGFLEDERRLNVALTRARESLLIVGSADFMRRKRGPWKDLVDDAHERGCLHPVVP
FT                   AGPEHPNGRRVSIPDYESCVLKRKAETQERALNLDVAKQLELAKKSKAAGGKRPSEASS
FT                   QLAAKKNRIAADVEAVKCGPRVHKFEPNKTDRQARQPQHPQQQQHRKVVKTSPAQKRRE
FT                   REEMARNERNERRVLQEKLAEERRREEAQRRDEDRRHKDEWRRRHQESVDLRDRLGGRG
FT                   PHRYDERNYRRPDNTTRGYDRAL"
FT   CDS_pept        complement(908397..908873)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634642"
FT                   /orf_name="MICPUN_61482"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65936.1"
FT                   /db_xref="UniParc:UPI000199BCFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN6"
FT                   /transl_table=1
FT                   /translation="MATGGGSDTRTLEGRVNALFPYVAGSAAFMAAWVFGPFPGSLYTG
FT                   IPSHDEFIAQVYDGLHFTPVFGPSALITKYNELGRLPALTHALPGAVWCALSAWQLHPA
FT                   SRKTFEGGGAQVGRACNARGGGHTHGRVRTHRRQRAARRHPRLSGTLGRHSGRP"
FT   CDS_pept        complement(909600..910481)
FT                   /codon_start=1
FT                   /gene_family="HOG000280019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634643"
FT                   /orf_name="MICPUN_97888"
FT                   /product="Histone deacetylase"
FT                   /protein_id="ACO65937.1"
FT                   /db_xref="HOGENOM:HBG290975"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI000199BCFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN7"
FT                   /transl_table=1
FT                   /translation="MPEGHRFPMPVFREIYRRLLREGVAVPGKNLFQPARMPSLEELTA
FT                   VHDEEYVNKFMIGAMSDEELRRMGLPWTEDLVERTLSEVSGTMLCADLALTCGLAVNTA
FT                   GGTHHAHRSHASGYCIFNDLAVTAKRVIARGAVERVLIVDLDVHQGDGTASTTAADPGI
FT                   YTLSVHCEDNFPAKKSTSSRDVALPTGTGDDAYIKTTEAALRESIEEHGPQLVLYDAGV
FT                   DVHGADDLGGFNLTDEGLIRREALVLDTCVGRGIPVAAVVGGGYDKDLEALARRHCILH
FT                   HVAREIFESNKL"
FT   CDS_pept        join(911154..911340,911711..913852,913887..913891)
FT                   /codon_start=1
FT                   /gene_family="HOG000031987" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634644"
FT                   /orf_name="MICPUN_61484"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO65613.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG631012"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniParc:UPI000199BD00"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN8"
FT                   /transl_table=1
FT                   /translation="MVQETEDVEPRDGSFEVSHEDGTVLFSKLSEGRMPRLEEVLQALE
FT                   DKMKADGVNPFANPKGGELKTMITVARRRLGLALEPLSRAVLVGRNASTFVARSSAAVA
FT                   DSALLRRLAPGSSSYLRAGLVRSPRGFAASPASGQAAAEETHAFQAETRRLLDIVTNSL
FT                   YTDKEVFVRELVSNASDALEKCRHDFMAKGEDPGELAVAIKVDSDKGTFVIEDNGLGMS
FT                   KDDLASNLGTIARSGSKAFVDEIAGDAKDDKTAATSTAAANIIGKFGVGFYSAFMVSDK
FT                   VDVYSCAGDGSAHRWSSAGDGSYTIAPCEVGDGDGQAPARGTRIVLHVKEQDKTLAAAE
FT                   WAVESVLKKYSAFVGFPVTLNGKRTNSIDALWTKSAGEVSDEDAAAFYRFVGGAIDTPA
FT                   FRLHFSADAPLTIRSLLFAPSDNPERGFAGRQLEGDQSGLSLYSRRVLIQQNARGLFPQ
FT                   FMRWVRGVVDCEDVPLNISRESLQDSDLIRRLGDIITKRMLKFLGERAKKEPEKYVKWY
FT                   GKMGVFLKEGICGDQSYMYKDALTPLLRFETSSEAVKSEGDDKPRHAQISLDQYVERMP
FT                   EGQKDIYYLVAPGGRKQAEISPYLEHLKRKGHEVLYLYAHVDEFVMQHIRSHNGKKLVS
FT                   VEMAEFDEDSKDAKKDDDTTDDGESLGGEAMEKLCQWFAEEALPGRVTGVKASSRLVGS
FT                   PALLTGHEPEAMRRYRMMLSMMSDDATAKKLDDLQMSAGLELNPKHAIVKGIQAALESG
FT                   DEERKAVAKMVAEQVFDNARIAAG"
FT   CDS_pept        complement(<913979..>914320)
FT                   /codon_start=1
FT                   /gene_family="HOG000115835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634645"
FT                   /orf_name="MICPUN_74164"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /protein_id="ACO65938.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG716813"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="UniParc:UPI000199BD01"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECN9"
FT                   /transl_table=1
FT                   /translation="YKAKVRQLSFNLKDPKNPDLRRSVADGLISPKVLLDLKPEELGSD
FT                   ERRNENAAIREAATAEAVRGQKQQASTDAFKCGKCGQRKCTYYQLQTRSADEPMTTFVT
FT                   CVNCDNRWKF"
FT   CDS_pept        join(915182..915310,915414..916148)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634646"
FT                   /orf_name="MICPUN_61486"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO65614.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199BD02"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP0"
FT                   /transl_table=1
FT                   /translation="MPPKRRAPARGAAKKAADTAGNRDILIIEVIEGPATGTKFTPTAD
FT                   VLQVGRTRSSQIYIKGDPAVSQKHASITWNGKQWRIVDLGSSNGTTVNDVELEEDGEPM
FT                   ALSDEDVVMVGTDTTVKVTIEKPAVKEAEPAVKQPAKEENEVKAVPKKRGRPAKKKVAE
FT                   PEAVAEDPEPPSKKPAARGGRGRKKVEPEPEPEVAKESEPVDEPTPEPEPMAEPGPEPA
FT                   VEEEEEDNDDDKENIGITVEQFIAEKVEGFIASAHDVATQEVKGLMEMKEEVKENIRKH
FT                   FAEVEA"
FT   CDS_pept        916552..921123
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634647"
FT                   /orf_name="MICPUN_61487"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65615.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BD93"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP1"
FT                   /transl_table=1
FT                   /translation="MRNPEGSFAAAPASLAEIELQDTEGLPGLPPAPTRRPNGALHGNG
FT                   ASLSPSSSQTNLLGGRGSNEISYDPFRSHTTQVYDDRSDGDDDDARDKPAFGTEDDDDR
FT                   DKGVIAADVMGAEPSRFVRWTVRFPLVAMFLSAVPFILVSGWTLWMFGVNVDFSLDSFR
FT                   IRDHPAAELADALHSSKEQSHLWWTRLREDEGAGRYVLVTGIPGSIKTGSSNRALLSSD
FT                   GFGGDNTSLAMRRRLLVDAPEEPWRHIVRWSCHVIYHTVPEGKNILTASSMNQARALEV
FT                   DMQDSAGYDRFCWQGFEKSTLLDNDCQPANSVVPMFFKLSESGRAGRQFGDVVRVTAQL
FT                   AAEGLYGYTDKTFDPSRGTATGLRAEFNFGTPVDGFTSEKDRSGAQREQFAEFVKAQLY
FT                   PKLKAASNYGENPANGPDRLGVTFGGDVITELEIVEALYRDVSLAGIGFSIVSVYMWAH
FT                   LDGSVFLAACGMAEIVISFPLAYAFHRVVMGLEYVSILQFLAVFVILGIGVDDVFVFYN
FT                   TYAQATRAVGRDGDLTARLSYAYEHAGRAMLVTSFTSAAAFCSNLASAIPAVRVFGVFL
FT                   AVMVGANYVLVVTWFPACIACWEMYIRPVQDRPLEPVMGANMSMTRRFAAFVNRCRPLE
FT                   WGASRFKRKYPWLYRDCTFKNYARFLRRRRRCLIFLCIGLGAGGMVVATQLPGSNEVPK
FT                   MFPDGHNVQRFLDWTQTKFADESLGCASYSDCAQHAADEIKQLDDLTPSPPPRPPIVPF
FT                   TEAEIQTMATDVMTYFDKDGDSELSYAELESAFTAMGLEQLIDAGGGSSGMERLVNGVL
FT                   RDYGTGTGGKLSRDGLLKYLNNTNDTQPGVLRYARAYLDGWLSTVPPPPPPPPSPPPPP
FT                   PPPFPANAPRPPPPPSPPPAIPPPPSPLPPPPSPPAPSPPPPAPVGTPPSPPAPFPPAP
FT                   PPPSPPPPLPPAPPVPRSPPPKPAWPPPFPRAPAFPDFPDAPPPPDGIPAPEAPPAPPA
FT                   KRTNGTNFEYVTLVWGLTNVRRTAVEALDPFSSSGEPVLDQRFDASDPEFQIAAVELCE
FT                   RLRRTSELVMEVEPCFMESLKAWASVESRRLTYGLFPFSPASVFVKAASDFIQNRMSLK
FT                   DSVGLIEGQSYNRGAVTDVRLAYLKVKVKTTVPWNQPSNVIGDWYARWNDFLAEFNANV
FT                   DDRTFLRNLTTDEVGEYLCPANVCNMPKVRITGEMFVRMATEQAAVSGTIRAIAISTTF
FT                   AVGSVIIFTGNAVVALIALICLISIIASVLAIFTMAGWTLGIVEAVSITILVGLSVDFI
FT                   LHLAEAFTKSSFHARGDRGEDAVARLGAAVSAAGVTTFIAVIPMLGCTVQIMYKFGVII
FT                   PVCIVLSLFYSLHMFVPLIMQFGPQGSDMGFLRGLPSIIFRTPARRFSFLFAAGCVACL
FT                   AIPSTLAIVNENVGTFVVVLLVCTAVLYAWLRVERTKEETGAMPDPTVAAGGPETSGGY
FT                   SRGPSSSREPFASIGGGLPDLPQMPSPGGMEEGALPPAPSRGPVKLFQEEVELSSMRSR
FT                   SRR"
FT   CDS_pept        join(complement(923190..923660),complement(922139..923055),
FT                   complement(921249..922083))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634648"
FT                   /orf_name="MICPUN_61488"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65939.1"
FT                   /db_xref="InterPro:IPR019163"
FT                   /db_xref="UniParc:UPI000199BD94"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP2"
FT                   /transl_table=1
FT                   /translation="MASDQLDELMGVLGRMRDAADRLASSSGDDDAFREAATDASLLFL
FT                   ELKATNRAALEGVEATRATTAKAKLDLDHKRLELQNVLYEKGHIQKEIRACQDFRSAYD
FT                   DETIGLCSVAEFKRQAPGEWKEAGDDPHAVMLKRLSHELAERKKLCELEKELEARKRTL
FT                   QDGIKSRRKFLDGLGNQLKGLKRSTAPLQEHLALPITVEEKRKGAARLLPPPLYVTYTQ
FT                   LAAAREAFDDDFEVHIEGSVADAEALQRKAAAAEEEEARRREEGAAAETVAEAEHKAAG
FT                   AFAGDEEETRKSKRARVSENERAVDESDPYAAHPLRVELRLDGASFTFAYLHNLHVVTA
FT                   DVKPREVGAPGANKGNRRGKGGGDETVDDDLLVNLFPGDTGADTPNIANKLRVAGFEYD
FT                   RSRRDRPYRWAQHLAGLDFLAPVPVGRAPGADAETGVAKHQQQARVRNVLAALRARMAS
FT                   RSALNDSTIVHAHPSWVFTSADQNTTHPIASRSQLRALARCDIDGLAVAKRLEMHPKSQ
FT                   LRSWREITPQSGGTVATGDDGPAGDNAGEDARYREETDAGTKLDEPSWTRDDVQARVDA
FT                   SEGWREHGVRTYRAVVRAARQSGGAKHRTVPVDVVAEVSVSPEYPQRPPTFALSLERRV
FT                   PPKPLPASDLDSKDDAVAASKDEDATPGDASNDLRLIEEEVNVRTTALLPPGGEDDILG
FT                   YCVVRLLQAVDACAECERWGGASDEAVGVRQMRRGRERRKELPPLL"
FT   CDS_pept        923849..924646
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634649"
FT                   /orf_name="MICPUN_61489"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65616.1"
FT                   /db_xref="UniParc:UPI000199BD95"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP3"
FT                   /transl_table=1
FT                   /translation="MGACATKPKALTDSGKKMSGRVSPSMIDPRTEPTRQLSARRLHLD
FT                   DGLAPPSPGYRLHDSGEALFDTLEAPGTPPPPPMYRSTSLPPPPFAPPPPGAHPKPMDA
FT                   KMYAHAYVLHHARAQRGWDASGWDYATSVVSIRVKSAVWVKGQRCSHEWDWDGETAPEG
FT                   VTSYVDSEPVPVFDSPALGMYHPGAEDRVGMAEDAALCACMDEIVEWCHEQHGYECDPS
FT                   RDVEQCVLTWELSDGAVGEHRHEGGLDDRMGAYVVAATRVRGW"
FT   CDS_pept        join(complement(924942..925741),complement(924751..924877))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634650"
FT                   /orf_name="MICPUN_61490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO65940.1"
FT                   /db_xref="UniParc:UPI000199BD96"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP4"
FT                   /transl_table=1
FT                   /translation="MAFMLGMAAQVRARETVDGYVETYMRRNPAARKALEAVVMQLTER
FT                   SDHLRFDHLGFVAFGGMDGPGYKPIADVFTGLGWQERDTFELENGLVTARWYQPPSVDF
FT                   PMVVVRELRVDRFGEECVEVCEKYVDDANDAGEETTRAAALTGGTPWRIEPGEDDLEVL
FT                   GYYSPLLAWHLTHGYAAHAVAASVSGLTKSRSSGLAKSGERAETHWHVAGANATVEDVR
FT                   AVLERHGARMEDPAVVMSSDGSMRRVSTRGDEERPWGQSGWGGVHSERRSGSMATRTTS
FT                   REPMATRTTSREPMRRKTMTTGTLRDG"
FT   CDS_pept        join(complement(927596..927682),complement(927168..927503))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634651"
FT                   /orf_name="MICPUN_113320"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65941.1"
FT                   /db_xref="UniParc:UPI000199BD97"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP5"
FT                   /transl_table=1
FT                   /translation="MKVLRKVKGKSRILIFVAVVALLSLALRKLKQDTKKHREILPWHQ
FT                   GGYEDHHGDLDGGFVPDRGVLGAVGAMRGGGGRDVGGESTSTSKVLDDGGVRDAPGGNR
FT                   NIDDISHLVDDDDEDVLGVKDEAFAGMRDSREKASR"
FT   CDS_pept        complement(927827..929107)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634652"
FT                   /orf_name="MICPUN_61493"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO65942.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199BD98"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP6"
FT                   /transl_table=1
FT                   /translation="MSARSRFARALVAAARSAAPVPTSSRREAPRVLSTLACVNHPRVS
FT                   GPSIASLGSTAAPIGSRIHEVRWMSTDAPPGGQNPDHGPVGPAPPLPSSPPPVVDLADE
FT                   KELEEMVHWARANGVALLFDFYADWCQPCKKLTPKLEQLATRSGGRCVLVKVDVDTHTG
FT                   ISDQLRIQTLPTVMTMIDGRFVDTFQGVLPDDQLEAFVDRAIDAAAAGAGTNKHGDEPS
FT                   RGMNADVALDAAFAALDAGDVDTASRAFGAVLGSDPPPPPGARARAYAGAARCALRADP
FT                   SDVDGAKQLVQAARKVVDGKFTEPVEVAAAAAAAELYGAATELGLDMSLSGAELDERLR
FT                   QLRADIDAATKAGDKSAADDKREELSLRALLQRGDPVQAVDVALESVKRGERERGRAMC
FT                   VRMFDALGATHPVTVSGRKKLSNLWFL"
FT   CDS_pept        join(complement(930410..930517),complement(930200..930286),
FT                   complement(929380..930072))
FT                   /codon_start=1
FT                   /gene_family="HOG000165139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634653"
FT                   /orf_name="MICPUN_91669"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO65943.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199BD99"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP7"
FT                   /transl_table=1
FT                   /translation="MSLGDNATWKAIKPFMNGGLSGMGATCIIQPLDIVKVRLQLGATG
FT                   GPFGVAAGIIKNDGFGALYTGLSAGLLRQATYTTARLGIHAKIVDYLKEANKGAPLPLA
FT                   QKAGAGLAAGGLGAMFGSPADLSLIRMQADKTLPVNERRNYTGVVHALSDIVKKEGVGG
FT                   LFTGAGTTSIRAMALNMGMLASNDQAKEMMKENNITGFPATLGASAIAGFFASFFSLPF
FT                   DYVKTQLQKQKPLPDGTLPFKGFGDCCMKTMASGGPLKFYTGFPTYYVRIAPHAMFTLI
FT                   ILDQLNTSMKKAGL"
FT   CDS_pept        930897..932435
FT                   /codon_start=1
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634654"
FT                   /gene_name="SRP54.2"
FT                   /orf_name="MICPUN_85222"
FT                   /product="Type II secretory pathway family "
FT                   /function="7S RNA binding"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="ACO65617.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR006325"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000199BD9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP8"
FT                   /transl_table=1
FT                   /translation="MVLGELGSALAGALRKLGEHTVVDEEVMDACLKEVTKALLQADVN
FT                   VQYVVQMKKNIVKQVNIQELAAGLNARKLLEKAVFNELVNMLEGGGAEVKEKFVPKKGK
FT                   PNVVMFVGLQGCGKTTTCTKYAYHFQKKGYKPALVCADTFRAGAFDQLKQNATKARIPF
FT                   YGSYTETDPAKIAADGVERFKDEKNDLIIVDTSGRHKQEDSLFEEMRQVAAAVQPDMTI
FT                   FVMDSSIGQAAQDQARAFKATVDVGSVIITKLDGHAKGGGAISAVAATKSPIAFIGTGE
FT                   HIDEFEAFDTKPFVSRLLGLGDWTGLIDKINDVIPMDQQPELMDKLVAGQFTMRILYEQ
FT                   FANIQKMGPMSSVMSMIPGMDGMLPKGQEKASQAKIKRMMCLMDSMTDEELDTTSLKIL
FT                   QDPKRMERIGRGAGRGPGDVVELVEEYKRMSKMMGKMKGMKMPKKGGYGHSQAMAQNMQ
FT                   QMAGAIPPHMLKQMGSMAGLQNMMKQLEGKDMGKMMEQMGGMKGMGKMMKQMGM"
FT   CDS_pept        join(<932963..933016,933107..933538,933644..933756,
FT                   933940..>934381)
FT                   /codon_start=1
FT                   /gene_family="HOG000006958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634655"
FT                   /orf_name="MICPUN_68582"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO65618.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG652450"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199BD9B"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECP9"
FT                   /transl_table=1
FT                   /translation="ARGYGTVVTSQANFLRVVTDDVAKLQERLGDEGPYELLCVVRALL
FT                   KKIKQRVLVGDAVDVLGIDWVDQRAMVETVHARRSELVDPPVANVDHALLVFALERPPL
FT                   EAKQLTRFLVSMEATGVPFTLVLNKSDLCSEEQKADWAARLEQWGYVPRFVSVATGEGE
FT                   DGFGSLSGPDPGPRSVTVLAGPSGVGKSSLINRLRAGGGGGGARGSISLDGLELQSVKA
FT                   VSSKLGRGRHTTRHVTLLPLRSGGLLADTPGFGYPSLNTLTTATLPECFPEIVRAKTQL
FT                   GACKFSDCTHRDEPGCVVDELMPWEEDRYDFYADMFDEVEQIERVERERGKRVSEQRTK
FT                   YKSGKGG"
FT   CDS_pept        join(934775..935080,935418..940988)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634656"
FT                   /orf_name="MICPUN_61497"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO65619.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013322"
FT                   /db_xref="UniParc:UPI000199BE40"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ0"
FT                   /transl_table=1
FT                   /translation="MAGKVNPHETSHTTHDEERWESEFEWKIPQFHNMGARGKRHYSST
FT                   FMAGGCPWRLSLYPRGNASMKGSRDHVALYLEAADATSAPVGWRRFVEFKLAIVNHKDS
FT                   LKTIWRSGSHEFNGDTSDGTWGYSQFAVTNVVTSKDGGFVGDGTDGEVTITAGVAVRWT
FT                   RKHGNDINDRGSATLFGTVAGSLGGQSAMEWRTSDTGLDLPAWIGMKYLAGQGRSHPPS
FT                   QPSSHIWAFPRDVWIKLRHGSRSYVCKDLLDLSDDDEQTAVVDKMVDKDYNFDKDLGWD
FT                   ARSDYGQYTGEAHLFFEQIRNMRRTRDGGVLGVSPLEVTGLWTAPICRTLLQVAPLGAE
FT                   MHWQTQALIDGILTDVLVRLCRAAAEVYAGHALKGKMKVKDEGCSRLLDVESQHANPAY
FT                   PELPSRQAAEAVCRDVYAGIAFNGDATKFEPQYPQDYKDGRLLPLIREPIDPHDDASDD
FT                   ASSCSAPSLIGSDDSDSNDVVSNPEPPVPDEKNRPDYPTFLTAHHMQAAMWAVFPTDLA
FT                   EHGMNEIKDALEYNVSMWRVKGTKEPEDPNKIVFHPTLVHAAATEIFTHLKDGKGALRY
FT                   PEGADTKVKQVDVAVNTLLPYCTKAAKVYMAAVLDYISAELVETAHQAAQTATYHRKVK
FT                   AHFDKMEKEGKVDVSEKERKAFEKETWRKEVKEPNYVLPAHLASALRKDKALGTDLAAS
FT                   ASLTFAGVSYASLMSLYTPPQPAAKKTIQKKKADAQLDSAWQKELRKRQKEEAKKEAEK
FT                   RKKEEKEREKERRRLEKIAEKEAKKATDADRERRENDNGTPADEEVTKLIAARVQARIE
FT                   KKQIEIGLDTNSGVGGGPFLLMKCMAANELYEGSGVCSCVECLPYVGDGFSSVECLVPL
FT                   SRYVYMECDKGCKLACHARCYPGLARYNALMNEGDFTNILDSSELANIPYKDGSGDIGP
FT                   GWFPAHSLACPQCFTRTDGSKFLGGVSARVSAQAMAQKIKQELGITLNGTARVTTELIR
FT                   AEMWSRGSKTDIFGLEVPPPEPEPEPDTQTEIQPADPDDARQPSAGPTPDHTPEKKKKE
FT                   KKKKEKPELTAEELEALRRANEEATRLQKEQEAATKARKEAEAEERRREKAEKMAEAQR
FT                   RAEAKAATEARAAAERTAAAARAVAAQLEVEEEENAEDDEAALKAAKKREKNKAKKERK
FT                   KAAAKGGGADDTSFGDSPSSSSVSTSTNTTSLTTTATSNATSTASTAVHGHGTSRPFGS
FT                   ERGAGFDANLQRGPPPGFTASAPASESGSADGFFGTGGDGFFGTGGDGVFGTGAAATSA
FT                   GQRDQLLGRLGHRRSARLSVRERLTLARRITVLGVPKTVPSSQLSAQIEGELARFGSEL
FT                   EHDPPWVLGIQRTESSAAVDFPMCTVAHAALGLRISVPGNPEALTFVKPPDVPEMRDPP
FT                   SSVTDAIQAAIDAGALAHEDIDDDAWESLHLVDPRVVLQMVQSLAPADGLAGAGGAALV
FT                   ERLDAAEAQWEEDARREEEERVAGGRTGSQTTPTTEPDVSFAPSQPVRGAFEAATSPPA
FT                   AHHPAGLSQHHPLAAFIQYRGGSDPVSQQSSQHQQHQQHQQHQQHQRHQQHQRHQRLQQ
FT                   PGHQNQPRTAPLQVHCAWVMSNPVIRARWSEPGPAGGCCLSCGAVVPETHRAHCQFPKA
FT                   NEPAAPGGLELDAGLHRLVHMNRAWEPPCVSWRRGYSGADPGADSDAYSDAYSGANAPG
FT                   VAAPPRSPAQPPQLLGSWSSGSPVATRRSSFGEGSGDGDGGGGGRTGLFTQGGNHPPPG
FT                   FVGQHPQQVQPQQQWPGRQLPFSQPPPLRGDWSNRALQQQQQQQRQQHQHQLGHLNGGH
FT                   NGHGHRHDDDNDDAGGGAGLVRAMGAPKFVAPIPRPFNAPAAPSREDEGKQMECPLCTD
FT                   PMDDTDLEHRPCANCDYNFCLFCFSRLKAGPAEHFKCPACRHPFGNASGSNVNDSGTDS
FT                   DGDSDASESEIGGAFARAAAAAGRG"
FT   CDS_pept        941729..>942143
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634657"
FT                   /orf_name="MICPUN_50621"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO65620.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniParc:UPI000199BE41"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ1"
FT                   /transl_table=1
FT                   /translation="MFGERWIQNGAEAGTSETAREPSERRNVRYLQTHKFVGITRRMEG
FT                   DKRSCALRPWRAQVNHAGKAYRAPGSFSTAEDAARAYDELVRTLGLTGSKRVNFPQSDG
FT                   ERAYVRSDRKSGGKRASAKKVEEDPIVAPQATFL"
FT   CDS_pept        complement(944677..945705)
FT                   /codon_start=1
FT                   /gene_family="HOG000220876" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634658"
FT                   /gene_name="FBAI.1"
FT                   /orf_name="MICPUN_104949"
FT                   /product="Fructose bisphosphate aldolase class i "
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO65944.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG559178"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199BE42"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ2"
FT                   /transl_table=1
FT                   /translation="MACFKSTYADELVATAAAMSVPGKGVLAADESTGTIGKRFDGIGV
FT                   ENVEENRRAYRELLFTTDGFEKYCSGVIMFEETLFQSCKDGTAFVDLLKSKGIIPGIKV
FT                   DKGVVPLPGNTRGETTTSGLDGLGERCAKYYAQGARFAKWRAVLTIGDTLPSPQCLDDN
FT                   ARCLARYAAICQQNGLVPIVEPEILTDGAHGIDKCAEVTERVLSCVFAHLAQHGVMLEG
FT                   MILKPNMVTPGAQSNAGASRAEVAAATVTALRRTCPAAVPGVLFLSGGQSEEDATAHLD
FT                   LMNKASSEARKNPWTLSFSYGRALQTSCLKAWLGNESNVAAAQAALLRVSEANSKASLG
FT                   QC"
FT   CDS_pept        945988..947016
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634659"
FT                   /orf_name="MICPUN_61501"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65621.1"
FT                   /db_xref="UniParc:UPI000199BE43"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ3"
FT                   /transl_table=1
FT                   /translation="MCTVGARWFDAPTHARVSCPRATRRTRATRLVKPPVANGDHPRDV
FT                   VASANNEQLAGSRRGLLAASAFLSASSLLPVDAARALALTTIPDDDQRYMVGVFRRGVP
FT                   SFEDWYGMTFGDRARAIKLVKRFGIVRTLVGGNDAMWSDNKAHAVHVFPVSKYDEIHKW
FT                   HATENEWWPDIALSAARAAQLQTQEKFNGLDDTATLKGPPDAFYFTPSVIADATGGAQG
FT                   VDVLLKTPAKVGSGVAYVETGLGSAGRGSFGAWASDVLGGSASSEAANGKVKILASVGG
FT                   ASVGGAGDRAAALHWFKSEFKAKAYAFDFPSDGVWAAKKKEGGVSAPFHSDNFRVVHDI
FT                   FW"
FT   CDS_pept        complement(947093..947665)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634660"
FT                   /orf_name="MICPUN_61502"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /protein_id="ACO65945.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000199BE44"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ4"
FT                   /transl_table=1
FT                   /translation="MSTLASMRCLAATSTSGRPHERTTSSSAGAPGRTTNARRHPIVGD
FT                   GLLRRLSRATIAVGSAAALALTDPSPVFALGIIDAFAPVPPRAVTFEEVAAHDAPEACY
FT                   MGLAIGRRTLDDSIVVYDMTGFLSRHPGGYERVARNCGTVNCAWEMRYKGHRFFALDDS
FT                   RLGFAVRARGGVALGTLTEYSNGSCLE"
FT   CDS_pept        947780..948667
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634661"
FT                   /orf_name="MICPUN_61503"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65622.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199BE45"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ5"
FT                   /transl_table=1
FT                   /translation="MKTTIWRPNVRVTLDEYGEVEDTESGGEEVTKQGTKRKRAPPTKG
FT                   PCEHGVKSRSKCKVCSACPHGRKRSQCKECGGASICEHGRIRSKCKECGGASICEHGRR
FT                   RSQCKECGGASICEHSRIRSKCKECGGSGICEHGRRRFSCKECGGSGICEHGRRRSDCK
FT                   ECGGASICVHGRQRSQCKECGGSQICEHGRQRSRCKECGGASICEHGRIRFSCKECGGS
FT                   QICEHGRRRSRCKECGGSQICEHGRRRHQCKECGGSGICEHGRRRSECKECGGSAICEH
FT                   GRRRSRCKGCRDNK"
FT   CDS_pept        join(complement(949369..>950064),
FT                   complement(<948811..949317))
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634662"
FT                   /orf_name="MICPUN_66819"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO65946.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BE46"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ6"
FT                   /transl_table=1
FT                   /translation="TFDAAPFSAAVKALLTAKGFTAPSKIQQHAWPVACAGRDAIAVAK
FT                   TGSGKTLAFLLPILHRMEARAATPADESSAPASSVPEPDAMVLAPTRELALQIHAEADK
FT                   FGAATRAGAVAVYGGAPLHKQKEELVAAHGRRKRGAATGTVVVATPGRLCDLMKQGSLS
FT                   LRRCDFIVLDEADRMLEMGFEPQLKEIFGELPSSESGRQTLLFTATWPKAVRKMAASYL
FT                   AKDTESSEGNGDGGDGAELAANKAVSQRFVHATDDEKDKKMYDVLCELPEGSRVVAFAN
FT                   TKRRVENLAKTFWDFGFGTVSVHGDKKQNEREAALKKFVDNQCPLMFATDVAARGLDIK
FT                   GVTHVVNFDMARDVESYVHRIGRTGRAGELGESVTFWNPDYDKECAPALCKIARDAGQE
FT                   VP"
FT   CDS_pept        join(complement(953345..953413),complement(950462..953203))
FT                   /codon_start=1
FT                   /gene_family="HOG000257670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634663"
FT                   /orf_name="MICPUN_61505"
FT                   /product="Predicted protein"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO65947.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG289207"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI000199BE47"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ7"
FT                   /transl_table=1
FT                   /translation="MASSEVTEIHLKDYAAYPYDVENVTLEFDLEEEFTVVTATSVMRA
FT                   KPSSIGAPLVLDGRQSFMELLAIYIDDKPVPSRLCAFNPNAEDTRLVVDSAALPADGAK
FT                   FTLGVVTKFKPQDNLELSGLYKSSGNFCTQCEAEGFRLITYYPDRPDVMSVFTTKIRAD
FT                   KTKYPVLLSNGNLVGSCDLAGGRHMAVWVDPWRKPCYLFALVAGDLAVVESAFTTCTGK
FT                   TVDLRIYAEQKNISRCDFAMESLKRAMKWDEERFGLEYDLDLFNIVAVDDFNMGAMENK
FT                   SLNLFNSRLVLATADSATDAAFARIEGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVF
FT                   RDQEFSSDMGSRSVKRIGDVRYLRDAQFAEDASPMAHPVRPASYMKIDNFYTLTVYEKG
FT                   AEVIRMYHTLLGEEGFRKGTDLYFERHDGQAVTTDDFFQAMSDANPGCDIGKLKNWYSQ
FT                   AGTPTVTCERVYDAGAKTYSLTLTQVLPKTPDTGGDQPKVAQLIPVKVGLVDAKTGKDM
FT                   DVSGNVSVTSAGSTSTCVPVPGDAGSVVLRLNDMSATFTFAGVESEPVPSVLRGFSAPV
FT                   KLAVTPALTADELLFQLAHDSDPFNRWEAAQKMAREIMCRAIRSTWHEGKTELASDDDA
FT                   AEAIVADTAWGKFVDACKGIFRDAASDVVDRAWVEEALSFPGVGSLVQELKPVDPLAVH
FT                   KVVKQFSKRFALACSDEIEACYATCKAEAAASGEYLVDETQTARRSLMGYCMALMGAAG
FT                   HGGEDASELAAAAKTARNMTETVAALGALNRHPTAKSARDAAFDAFKQKWRDDNNVICT
FT                   YLSLVAGNSGYGASPLTEVKATMADESMYSHKIPNKFYSLIGGFARGNTPGFHAADGSG
FT                   YVFLADCLLAMDKTNAIAASRLAKPFTEWRLYDAPRQALMKGEMHRILKAEPSPNMFEI
FT                   MTKSLA"
FT   CDS_pept        953535..954599
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634664"
FT                   /orf_name="MICPUN_61506"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65623.1"
FT                   /db_xref="HOGENOM:HBG607433"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199BE48"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ8"
FT                   /transl_table=1
FT                   /translation="MAECRLATDVFPFCGVDLRIVRRDISGDGGDTDDASTGAASNQSA
FT                   DDDDWVDPNFFDEGYSVAATTGFCRVWEGAEVLTRLLEEGCDGDDVSDASTPSLRSRVA
FT                   GKRVLELGSGVGLCGIAAASAGAHVMCTDLEAVVEGVLYRNIGENTSTDDDEVQAASSS
FT                   RPWSAGERIKGGNGGTCVAQVLDWTKSIDDAVVAQGRLCRRRRVLSREDTSGARWPCIG
FT                   DGTAADDDDDDVASCVNDPRDCELVMAAECLWLRELVDPFCDTVTSLMRSARERNGIEL
FT                   PCVLSFRDRSSKNGGGHAEADDAGGGGAFVPVRDVVAAFVERGCGWRTVRVSPSTEDEG
FT                   YHVHVFEITPPPPR"
FT   CDS_pept        complement(<954952..>955458)
FT                   /codon_start=1
FT                   /gene_family="HOG000242500" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634665"
FT                   /orf_name="MICPUN_71990"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO65948.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG716559"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199BE49"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECQ9"
FT                   /transl_table=1
FT                   /translation="KKVLSEKALKKARADQAKRGVVYLGSIPPFMKPQKLRQLLTPYGD
FT                   LDRMYLMPEDPEIRARRKKFKGNTGKNFVEGWVEFRDKKKAKACAAMLNGTQVGGRRRG
FT                   AHFSDLWNMKYLPKFKWDNLTEEIEYQKALREQRMQLELSVAKKERDFYLQKVEQAKQI
FT                   EKMRER"
FT   CDS_pept        956203..957324
FT                   /codon_start=1
FT                   /gene_family="HOG000235950" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634666"
FT                   /orf_name="MICPUN_61508"
FT                   /product="Predicted protein"
FT                   /function="ribokinase activity"
FT                   /biological_process="D-ribose metabolic process "
FT                   /protein_id="ACO65624.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="GO:0006014"
FT                   /db_xref="HOGENOM:HBG697973"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199BE4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECR0"
FT                   /transl_table=1
FT                   /translation="MSDAPPSEPRDAPKGAVVVVGSANVDLVMNPRDLPSPGVTVLAPS
FT                   YKLLPGGKGANQAYACAKLGCESVRFIGATGDDDFAKLVLGNLEAAGVDVTGVAKRADL
FT                   PTACASVVVDAQGENQICVGSGANAAVAADQLDGRIARGDVLLMQMEVPTPTLEACVAK
FT                   AKARGAAVAVNVAPSANASALGADVYRAVDFLIVNQHELRDVCDAVRAHHPTASPPTSS
FT                   AAADLAVFVARTTEAIVVVTLGAAGAKLFLPRRPSGAPPRVDRGDAPETDVIAVDAAPL
FT                   RDGEAIVDTVGAGDAFVGAFVARVARGDSLIRCAAIAAAAGTMACTREGAQGGTHGAVD
FT                   VEERSRSVGMSADWGRGSEPASEHLQAPAVDWI"
FT   CDS_pept        join(957627..958574,958802..958828)
FT                   /codon_start=1
FT                   /gene_family="HOG000239957" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22634667"
FT                   /orf_name="MICPUN_97893"
FT                   /product="Predicted protein"
FT                   /function="biotin synthase activity"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="biotin biosynthetic process "
FT                   /protein_id="ACO65625.1"
FT                   /db_xref="GO:0004076"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009102"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG405569"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199BE4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECR1"
FT                   /transl_table=1
FT                   /translation="MGVVRHDWTNEEVEALYNRPLLDLVYDAASVHRANHDPRQVQQCT
FT                   LLSIKTGGCPETCNYCAQSSSWKEDTGLKAEKLMGADDVLAAARRAKEAGSTRFCMGTA
FT                   WRGPSQVGKGQFERVLGMVSEVRDMGMEVCATLGMLNHEQARQLREAGLTAYNHNVDTS
FT                   PEFYPKVTTSRNYEDRLNTIAAVREAGISVCCGGILGLGEEEKDRASMLRVLANLPEHP
FT                   ESVPINALVPVKGTPLEKLEPPSGLEMVRAIAVARIVMPRTVVRLSAGRINMSAADQAL
FT                   AFLAGANSVFTGDKLLTTPNNESNEDSKMFEELGLRTAPRGFI"
FT   CDS_pept        complement(958871..960184)
FT                   /codon_start=1
FT                   /gene_family="HOG000264823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634668"
FT                   /orf_name="MICPUN_61510"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO65949.1"
FT                   /db_xref="HOGENOM:HBG562817"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199BEEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECR2"
FT                   /transl_table=1
FT                   /translation="MSAVAAAIHGVPARGWNPGSSHRGHRVVSSSRAPIAVAEESVVTS
FT                   ARTIEPASALLDALGAGERVECGVNASGVRGLFAARSLRRGEPVLEIPLREYGLTDDPG
FT                   ETRMSWSRQLGRKLVHLRRDALDDASSLSGAMRNYAGSLPKMGEPAPGLANDPACVAAL
FT                   AGAWDCTEAVAAMIKFAGQVTDSYAEERTLDPTLALEEWRWAMRAVHSRTFRVEDERGV
FT                   RPTRRALIAAADLLNHTSVSDEVNCEWVADDTYFVVSATRDVPKNGELLFKYGDQSDAH
FT                   FALFHGFVPSTNPHNRVLLFPNATNALDWYQTVVANVPFGAPGWDTEKERVRETTRKTF
FT                   GTYKVDARTGLRHRVIEDLYLREDGVASGSARMLFEEMCGDEAYASEVIARRAKELRRE
FT                   MEESTPAVDAALAALSQHSRELVRRYRQRKMDILSRVE"
FT   CDS_pept        join(complement(961968..>962280),
FT                   complement(960911..961814),complement(960424..960802))
FT                   /codon_start=1
FT                   /gene_family="HOG000044388" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22634669"
FT                   /orf_name="MICPUN_66235"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /protein_id="ACO65950.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG651799"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BEEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1ECR3"
FT                   /transl_table=1
FT                   /translation="VDSILADVFRITTGFRPAQRGVINATLSGRDVFVVMPAGGGKSLT
FT                   YQLPAIIDAPKLTLVVSPLLSLIEDQVEQMNAIGVGARALTAATSSEEQNETLRLLDDP
FT                   ETRPDPTPPRLCLLYVTPEKVAKSKRLITKLEKAHRAGRLARVVLDEAHCVSAWGHEFR
FT                   PDYRKLGIFKTQFPSVPVLACTATATPRVQRDVIDVLQIRGCAKFRTSVQRPNLRYEVV
FT                   LKPSAKKDSDDLLCRIVLGAMGPDATPKPNCGAAIVYCFSQREAEQCAEVLTNGGITSL
FT                   PYHAGYTEESRRAVHTRWSRGDSVRVMCATVAFGMGVNKPDVRLVVHHTVSKSVESYYQ
FT                   ESGRAGRDGKRARCVVMWRPADVPRQSSMVAFDAGSENLGNLYRSCRWLTSTGCRRASL
FT                   AAHFGETTRETAGSVAECFMRLVEKDPDKPVTMLQLASEWIKHAKSEARDELRDAGSGG
FT