(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_7

ID   MICSR_7; SV 1; linear; genomic DNA; GRV; PLN; 1145873 BP.
XX
AC   CP001330_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 11, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001330.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1145873
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 11"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(491..562,594..1709)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635249"
FT                   /orf_name="MICPUN_62215"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66027.1"
FT                   /db_xref="UniParc:UPI000199BC68"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDB9"
FT                   /transl_table=1
FT                   /translation="MDSFRLPSLPVLTSEAVFVLKHIKSPLCTPPGMTATPRESDTKKH
FT                   PVTYGDALPLAIAIIGGRRADKATKTLKQESKLREYLKAAGSFRTRLRSICDQMESFAA
FT                   VETDVDMNDARSALLLRATCDAAASLAPDDQQAPEKNFEFLRSVRAYRLAKLTVASTPN
FT                   IVPAMNGKKVVRAAINASALKIVETMHAADDIPDVFAVSELLLEVLGGKLPLPRSVALR
FT                   YIDSCITSLATETERVRYDRNAKKLRKGPGAINVEGIVHQTLAALLRSYLAAEDKSQRT
FT                   LISHAMTRFACLEDEILASLCLSTCLDLINAHAARVMVDHVAVGMQNERIGFIFHIAEL
FT                   LLRRNATSIKAVSAISAAEASVASSVAKRCMSPLALRIRRLSAMVRLRSELTSNR"
FT   CDS_pept        complement(<3412..4092)
FT                   /codon_start=1
FT                   /gene_family="HOG000200835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635250"
FT                   /orf_name="MICPUN_86737"
FT                   /product="Predicted protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO66340.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI000199BC69"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC0"
FT                   /transl_table=1
FT                   /translation="MDVDISIHRPTGSFRLNFLNNDIANAYTNLTNVVVRVAPKSAQSD
FT                   ARSVLLNAHFDTTLGSPGGADCASCVGILLEILRVMTLPGSPPPLAPILFLFNGGEETF
FT                   MQAAHGFVAHHPWAKTVGAVINVEATGTSGPDVLFRETGGWPAEVYMRTAPRPTATASI
FT                   RDLIRFANLPVDTDFSVFRDPTLPNGNLPGVDIASMLDGYSYHTDRDFANRIRRGTIQA
FT                   YGENV"
FT   CDS_pept        5123..6010
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635251"
FT                   /orf_name="MICPUN_62217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66028.1"
FT                   /db_xref="HOGENOM:HBG557518"
FT                   /db_xref="UniParc:UPI000199BC6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC1"
FT                   /transl_table=1
FT                   /translation="MSLDKVDEEHYEDDEDFEEEEIDIEEEEEEEEDEKVAEDEDRRQG
FT                   MRARALPADGDPDFDSGPPVDGFEYLRRVRHEAKNVPDVMVSPTIDPRAFDHKQTRGYV
FT                   PELGGYVPPKCPDCARPDKDWQREFLADFSDLRAWVLRTAARRETSGQSAGGGKGLALA
FT                   SQAALERMDDLNEPEGVSFDTLIRSDEVSAAAAFRAHARALASRLSAEEDELAKSAEPM
FT                   TPAILHARASWFYALAARVGLPLDAETSASVRALARALAMRRSKVTSSRDPSLPHIQVC
FT                   LAVAGKYFGQFSEE"
FT   CDS_pept        join(6111..6129,6199..7601)
FT                   /codon_start=1
FT                   /gene_family="HOG000265902" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635252"
FT                   /orf_name="MICPUN_62218"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66029.1"
FT                   /db_xref="HOGENOM:HBG557591"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000199BC6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC2"
FT                   /transl_table=1
FT                   /translation="MPPPLDGVGAAGVLMVGVIPRWIYKAAVRTLQLVLAAALFPVLRG
FT                   CYLRVRHFGMTALASFGIRIEPSRRNTVPGLSPKSTVVRGRNQATRRPTLAATTGSQGA
FT                   DGPSQLFVLIHGLGGTPDDLRCLERNLTQRGGTDVLVHKPACNTLVRSFDGVPNGARRV
FT                   ADEIRAVVAEHRASLRRISLVGNSLGGIYARYAAALLFDEDSKTIAGLEPTTFLTTASP
FT                   HLGVGPFGYLGMFPSPLQTVGAALIGESCSQLMLRDGWGNRRPLLAKMADPMNGKEGAR
FT                   GSGGGSGARDEADGLPFVDALASFERRCAYANAVNDFLVAFETASIDPDATRTMREKRS
FT                   REASSPASANIIDAGGFGAAAGPTGSFPFPFTGAPRIADERDHIPTDPASRERSLFGSG
FT                   SDAGDGLALQRKMAAGLQTLSWHHVDVEFPGYLPLAHNKICALQRDPVMEFLFKDGEFI
FT                   VEHQAEYLLAWVREQ"
FT   CDS_pept        complement(7706..8767)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635253"
FT                   /orf_name="MICPUN_102891"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66341.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199BC6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC3"
FT                   /transl_table=1
FT                   /translation="MAGQNVLLSKDVMIAAGAIGFNYSVTMGIIFVNKLLFLRTKFPVL
FT                   TLAASHLAVSALFTRAAMYAGVFKPRDAKMDRMIFAVAALQTLAISLGQASLKLNSMGF
FT                   FQLTKQLQVPLVASIEFFYLGRRLSVKKVGLLVIMTLGVCMACASDVQFSWLGALMAAT
FT                   GTACTSVEAVLYSHLQQSLGWETLQLLYKTMPLATAGMAVVAMYNDFGVSAPGGGVGGG
FT                   GDVYGAGSGNFLTGMDALGMTLFLSSCALGMAVNVSSCFVNGKASALAYAMLGLAKTIT
FT                   VILVGIAFFDGVPTTRVAAGTLTAICAILMYTKLTLDDKAKAAALKNSGLDVREETLEV
FT                   MKAPLMEGGATKR"
FT   CDS_pept        complement(8985..9587)
FT                   /codon_start=1
FT                   /gene_family="HOG000264415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635254"
FT                   /orf_name="MICPUN_62220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66342.1"
FT                   /db_xref="HOGENOM:HBG557720"
FT                   /db_xref="UniParc:UPI000199BC6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC4"
FT                   /transl_table=1
FT                   /translation="MAMGATEGGSSIWSALPDPLRAFANRLDGKRCPKELEGRWRIDNK
FT                   RSEKLCPFVVGLGVPKWACPAIGILERSTELKISCPESTSSGVESIVIEDTTALSKRNV
FT                   TEVRLDGIEVEKATRTGRKRYMLSGSVENDHLEAEVASKTSVVTCRLFQRGPGWETRQE
FT                   RALVHQHDGAVRLRERNVLQRSGEEDVVVDRFFEKVQ"
FT   CDS_pept        9902..15034
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635255"
FT                   /orf_name="MICPUN_62221"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66030.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199BC6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC5"
FT                   /transl_table=1
FT                   /translation="MSGFFKQAWQSVTGGQDEANGAVVATPPEPAAIDQAAKPDANGDL
FT                   AAQPKAEVAPAAAAVPDPPRAEHGVADETAMKSDEKPDSPDEIEGDRAPDTVNGGSGDG
FT                   DDTVAPAPGTPSEGEKDGRKMLTPQDAVNPALVGRCIDVLWPEDGTWWKAKVINLNPVT
FT                   GMATLYYEPKEKQDGGDAPKEEGEKKSDAADPDPNAVRPPSEPKDVEMTDATEEPAKAE
FT                   DKKDGEGAGDEEDEEDEEGEGEIEELDLREAAGNNEVCWSASEVEKMKQEYEAILNGGP
FT                   IAPADKVAVPCPHCDKRAFKYLRSMEKHVWNEHGVKLTREEMDAFEKALRAGRTMAGPM
FT                   PSRRRAPIALPEIITINYDEMYDILTMEDGETQDDEAVKARARERVRVVKEASEKTRAA
FT                   GGPEGQRATLWAAGEQDLCHICGEADPDFWNIENDCIVMCDGCDVQVHLSCYGLSEVPE
FT                   GEWFCQGCIDGIKVGRDRPDDAGMCALCPVPGGVLSRVQPPSRWNTAWGADGTHAHLCC
FT                   AASLGEVIVTPSTTCAPVIDMHRVKNSRMILNCGLCNLAGGCVQCSMKNCFQGFHPLCA
FT                   RSAGLVRLYPDKEDMHSPPIFFCAEHSAPAFAQRRYKAAGMQPPVGMGASSGNLAGMVQ
FT                   APSSIGLADIGGGRTYDAMDNEERMAMNAAMKSEGAKVELRKAKFVARLWHRFVPFLPQ
FT                   PTDPAKRIDMHKRSGAFCRRVMTRAKVPEKEQERIAKMTDAEGEKEVEQEMEAARKKAH
FT                   GDAKKGSHLNEGLRQYQREGVAWLAAQHASGAGGGILGDDMGLGKTLQVLSFLQYLRDA
FT                   KGESGPHLVVCPLSVLPTWVTESKRWCPSLRAVAFHGPEAERNRLKQEVLVQGTFDVLV
FT                   TTYEMLTAEQSMLANRFHFRYMVLDEAQRVKNDSSLVSQAVRRIRTTASLLLTGTPLQN
FT                   NLHELRALVSVLFQDVLEAAGAEKMEVDADAAFGDDSAVSAARALLQPLMLRRTKAAVL
FT                   AKDLPPKTETVVRVPLSDAQRQWYKTLLEGETGLFGKLASTNATSEKGALGKGMCIAEA
FT                   AEEEARVGGQEFTKLSNLLMQLRKVCCHPFIFGDDAAKAIIGASGGNRVEALIEASGKL
FT                   KALDEMLPRMRAGGHKVLIFSQFTMMLDMLEEFCEARGHAHLRLDGSTSLARRRYETAL
FT                   FNKPDGRHFVYLCSTRAGGLGINLQSADTVILADPDWNPTYDQQAQDRAHRLGQKRPVT
FT                   VIRMCHANSVEEGILAVAARKAGLAAAVLAGLEAGADVEALDAAAAAAGEDPAAAAKLS
FT                   FAELREIIMSGANAADLPGPPERKTTRSSKTPAKTPAKSTEDAQAEGAAALARAAQSTG
FT                   KKGHYQWEGMDYTSSAAKSNKKDIADLWVEQLGDTRRNRVSTVEMVDAGFGLGMQAVSR
FT                   ASLQEAREAEDRERRAAAARESARLRAADKASRHETVCCECKGDEEGGCNKPPPAFLAP
FT                   DVAAERLRCRNCPRTMSLGCARLVTRPRMGWQCPQHHCKSCNRTASEAGGLLFRCVDCP
FT                   TAFCAECNGETPFDAVEGNPEWEALGFYLPKSFEYVRCNDCVIEKEIRDREEKKRREAE
FT                   EREMRRNPKLAKQKREAEAKAKAEAERKAKEAEEQARAEAEAKAKAEEEAKKPKPPPKP
FT                   RAPGQPVRCEVCARAKKGGCGTEKAHSKCLKLKQNGGDIDIVKAGVAKAPATTAPPAKP
FT                   PPPSNSKDKKRKR"
FT   CDS_pept        complement(15320..16756)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635256"
FT                   /orf_name="MICPUN_106202"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66343.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR015522"
FT                   /db_xref="UniParc:UPI000199BC6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC6"
FT                   /transl_table=1
FT                   /translation="MSASTLIQLGVCAATMVAEPVLGSIDTFWVAALGTTELSALGPNT
FT                   TLYGCVIAVIVAYGFGTAATRKIAVALELDEAHRRSGTLKPGEKTTAGGTLIAVMGTTV
FT                   AFGLACGLLVAAFPTLIVNLIGAPESVVAPAANYMQLRAIGVPAVGMVVALGGGFQAAR
FT                   DAKTPFIAVMLSGIVNLILDPLLMFTFGLGMKGAALATVTAQYASAILMSYQAFFGKKR
FT                   AMFFGSETESVTANELDIQEEPKEPVQFVEPMAYNFNKKVAMEYTKETGSYMGRVANVV
FT                   VVWALTGSLAARLGVFEGAAHVLLFQLLSILSISAGALTTVCNALCARLFVSVGDEAAS
FT                   AAGKALTILGGVIFSSISALFWVFRKELLFAYTPDPMVVNTALAPYFLLIASVATYWYK
FT                   TLEGGLIGRGDANAVNFIFYVGGAAALVGLWVANQSATGITLMGIWWSIVWYYSALTVG
FT                   CTFRWWQLSRLRKSMPPTVA"
FT   CDS_pept        complement(<17837..>18061)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635257"
FT                   /orf_name="MICPUN_74266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66344.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BC70"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC7"
FT                   /transl_table=1
FT                   /translation="NGDSALHWACYHGDWDVASVLLNAGADVNASGDLRNSPLHMAATG
FT                   SHEVLCAELLARGANADAKNEFQVVPSSTA"
FT   CDS_pept        18786..19235
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635258"
FT                   /orf_name="MICPUN_62224"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66031.1"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="UniParc:UPI000199BC71"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC8"
FT                   /transl_table=1
FT                   /translation="MVRVVRRVLAAVFALVLTLASTAEAKKEVPQVLCESCRATLTELR
FT                   TMVDKTAKKQGRENAVTDAMEAICEDMYNFRTYAYPPPQMQKGCRTIMDRHEEEIETAL
FT                   WRGDENLVEFICGRPKGACHGVDMSEEAVNSKPMEIVKDFEDDEL"
FT   CDS_pept        join(complement(20367..20401),complement(19377..20070))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635259"
FT                   /gene_name="LHCA4"
FT                   /orf_name="MICPUN_104964"
FT                   /product="Chlorophyll a/b-binding protein, psi-associated,
FT                   chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66345.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199BC72"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDC9"
FT                   /transl_table=1
FT                   /translation="MASIVAQQLAAGLTQKSRTVRPRGVASKARASVRVGAVAAARPTW
FT                   LPGSPAPAHLDGTLPCDYGFDPLNLGADPENLKWFVQAELMHCRWAMLGLAGMVGPELL
FT                   TKIGMADLPNWIDAGKWDGYWLGAGPLFFVQMAMMNWAEVRRWQDMKAPGTMNEDPLTG
FT                   ANKGDTNTDVGYPKGLFDPMGYAKDPKKAEELKRKEIANGRLAMVAIVGCFAQAISTGT
FT                   GPVDNLFTHLADPGHNNIFG"
FT   CDS_pept        join(20747..20875,20977..21237)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635260"
FT                   /orf_name="MICPUN_62226"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66032.1"
FT                   /db_xref="UniParc:UPI000199BC73"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD0"
FT                   /transl_table=1
FT                   /translation="MASATLRLGVIASARRTVNLTSRLDRGSSLATPAFQAVHSRKSSS
FT                   INQTDTESSSSPRLTFLFRPVVIADEAVLRALKNPTFIDVRGPGEVEAKPGPVGALNVT
FT                   WDTSTCTFFDPSLLPADKTNPVVVF"
FT   CDS_pept        join(complement(22474..22485),complement(22264..22338),
FT                   complement(21597..22139))
FT                   /codon_start=1
FT                   /gene_family="HOG000030539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635261"
FT                   /orf_name="MICPUN_62227"
FT                   /product="Predicted protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO66346.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG686708"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="UniParc:UPI000199BC74"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD1"
FT                   /transl_table=1
FT                   /translation="MGFKVAVIYYSRRGRLVTLANVIAEGVRQVEGAEVTVYRIRDPVL
FT                   GDAPGTFDEGVLDAPVATPEVIMQSDCVIIGGPGRQGRMCAEVSYFFDSLTEFQTNGCL
FT                   LKGKVGSAFTSVGGVGRGYGGHEAILQSFHGFFLQHGMIPVGVPPSSVMEDAHMASPFG
FT                   VCMTGRPKLDKAGSRLRSLSESEVKLAYSQGEWASIITKQLHDDGD"
FT   CDS_pept        join(22768..24290,25794..27879)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635262"
FT                   /orf_name="MICPUN_102899"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66033.1"
FT                   /db_xref="UniParc:UPI000199BD03"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD2"
FT                   /transl_table=1
FT                   /translation="MAIHAHSGSQADGDGDGFGIDDGRIGRDHRSCFVVDQVVSSASVT
FT                   HAVWGRFRRPDVNDVVLGKTDQLQLLVLAPAGDGTERMRLAHQQPLHGTLVDLRVIPCA
FT                   TANGGGSAGADLLGILSDSGKLSIVGFDRRTRRFAPIRQLHLAPPGLPIAPHVDDALAT
FT                   ATDPFFSSLAVDPGARCVAVRCDTHVSVFFTSYAGDVDDGSASASSIAVDSENASRSNN
FT                   RGIATNPVKPIEFDASGTPLRPKGCIVLDAAFARTTGGEQKPCLVLLLMDEDPDDPDHP
FT                   TILRDRELRVPHVDVFRNLRRRSLREAPTTSEWEKKCEGIGIEAHPRGLYDTATAPTYR
FT                   IRLLDAIVPRGLRARLVEPPPGYEGAPFVGVWGFGAMISIGVSDLSGADGTMPRVTHRA
FT                   HDTAEEEEEDSGLGPEFRRWVWNRAWVTADPRETGPSEQTYGPATSKTSNAAVKQGRWV
FT                   WRGMVATGSPTDKHAILRVKLAIDAAGSSVDETRGVSVRLMGVTAPAAALMTDATTRDI
FT                   GPLRVTSRRKLCESPLTLVPLSDDPEGPVIVLGHGDSWLARRSPGCQRMSVVRLDAPPG
FT                   IATATKFSPPTSDPSRRSRGESALAVVDGRLALVSPDLEQSDAASRCDADARLGEGGGA
FT                   SDVKFLCRDIATGRAVTVTPCRVPHEDDENDPVKSDDENAHTVWEIRAWPPSSRPPEEA
FT                   EDDDTAVSTSSDYVLDARPAPRFRVTALASCHPPKGVIGGIIAVGTSQLPVTYKRRQHG
FT                   PPEPEGRLFIFRLVDAVDPKGGPQMNPCGPCLAQAACIALPSPATCVATAGPGVLFAGA
FT                   GNRVYCIRIGPRDDDDDVPARIPVDVRELGPGDPRFDAAYLSQSLSVTLVAQTTARRRV
FT                   TALAVGPPLLSRSNRHVGGVGRARGHYPMLGGEADVSEEEGYVPVAIAGARESVALSVL
FT                   KTVDTDAASRLAYPEFTPMATDATVRTVRAMAMRRRGEVAGVDASGRIFVLQNRNAPQA
FT                   KKRSPDEPEDDNNGRRKHGPCSPETNFTIAASFTLRSSPTAMLLLPNKSPNPYPEPPLA
FT                   PEARARFDKLAAAVTTGRSFVVGTAEGGVCLVAQVTERDWAVLREVQSLARRHPLLTPV
FT                   LGASHENARGAWPPRVGFGPPGPPAPLWPSVAEAAGGGVARAGSSSVPAPEVIDGSLLR
FT                   EVLELPELAQRELLGSGASPLPVETVLGLIQRVLET"
FT   CDS_pept        join(complement(28692..28735),complement(28042..28495))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635263"
FT                   /orf_name="MICPUN_62229"
FT                   /product="Predicted protein"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66347.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199BD04"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD3"
FT                   /transl_table=1
FT                   /translation="MAQHESHVEKSHMPHERAPSSGKEKPRLRLGNPASKYRQVHHDYT
FT                   WLVESTAKSHTLKEIIRHFKCTEQGAKNAMSRRGITECKDWIHDKNAGWKTREAANQVK
FT                   ITKEYPVSAIVGKRVFDDGAVQYKVLWQGHGDEQTTWEPVSHLHHCQQAVAEYEKEHQA
FT                   CA"
FT   CDS_pept        join(complement(29611..29686),complement(29309..29499),
FT                   complement(29055..29168))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635264"
FT                   /orf_name="MICPUN_62230"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66348.1"
FT                   /db_xref="InterPro:IPR021475"
FT                   /db_xref="UniParc:UPI000199BD05"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD4"
FT                   /transl_table=1
FT                   /translation="MSSVSPDEPEAQTCGDAFNNAWQCYSPTFQMTRYYRYGELDSCEG
FT                   RWDAIWACMDSRKRSGQGLSSKAPVIADAKEERAKPYWNLMDPKEAGARWRKRFGDKVP
FT                   TEEELAERDRAQSADTKSSWFW"
FT   CDS_pept        join(29930..30038,30162..30754)
FT                   /codon_start=1
FT                   /gene_family="HOG000012828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635697"
FT                   /orf_name="MICPUN_102900"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66034.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG610358"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="UniParc:UPI000199BD06"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD5"
FT                   /transl_table=1
FT                   /translation="MASTASFKPCPCCAGTGIRPSARAPARIVASAAPKDASGVETKRV
FT                   DLIRGDDRDAVGASASRSPDASSPAVGRRAGLISLAAATLSFAGAQVGQDANALDDTDC
FT                   LECGGAGIVVCDMCGGTGKWKALNRKRAQDTYEFTECPQCFGRGVRVCGVCFGTGERNV
FT                   RGLLRRPEATEIVKAMQRGELRPGDAQRMIKEAREAKRAAASGAGDAFADVAPAVAEAV
FT                   ETAVDAAVDAA"
FT   CDS_pept        join(complement(31704..31730),complement(30955..31548))
FT                   /codon_start=1
FT                   /gene_family="HOG000006783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635698"
FT                   /gene_name="MND1"
FT                   /orf_name="MICPUN_98019"
FT                   /product="Mnd1 meiotic DNA recombination/cross-over
FT                   promotion"
FT                   /protein_id="ACO66349.1"
FT                   /db_xref="HOGENOM:HBG622687"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="UniParc:UPI000199BD07"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD6"
FT                   /transl_table=1
FT                   /translation="MPPRGMSAEDKRKTVLHLFHESAKPWLLKDVEKAAAKRGVVFQAV
FT                   KDVVQSLIDDSLVHVDKIGTSNWYWSFPGEASAKLRHEVGSMDAQIAALEAECAQLDER
FT                   LEKAAAEFPQTEERQMAEVMLQSATEENDRLKKELESFASGDAAVLETIRGGKENCHEA
FT                   VNRWTDNTFLLKSWVEKKCGDREQAAKFFKEHGVNFNNFDYLE"
FT   CDS_pept        <33124..>33369
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635699"
FT                   /orf_name="MICPUN_74241"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO66035.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000199BD08"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD7"
FT                   /transl_table=1
FT                   /translation="GLGVRPAGTPAAADERELKRQRRKQSNRESARRSRLRKQAECEEL
FT                   GSRVGSLTEENEKLKTEVKRLTEQCQALSQDNTALRE"
FT   CDS_pept        34217..35593
FT                   /codon_start=1
FT                   /gene_family="HOG000243207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635700"
FT                   /orf_name="MICPUN_106204"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66036.1"
FT                   /db_xref="HOGENOM:HBG747619"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="UniParc:UPI000199BD09"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD8"
FT                   /transl_table=1
FT                   /translation="MSPGLSEDEQVATLASIAGLEDLEHARRMLRQHGGNLEAAVNTAM
FT                   GFTAPPDPSNAVGHADPRDGGRSAPGSRPRQRVRPLRPNPLVQLLNIPVDIVRATFGIV
FT                   FKVIGGVLVGLVGRNNARRIAHAATGGDTDDPVESAIKFKRMMTREFGANLPNFLECSH
FT                   ASALRAATDELKLLFVYLHAPEHPGSRAFCRDVLTHPDVVAVVNSPSFTAWGGDVRETD
FT                   AHLLASRLHPSTFPYVALMTSTPGERGGTLVLAVEGAVEPSDLARLLAESAEERGVELA
FT                   GVRAERDARQTERRIRDEQDAAYRAALEADARREREAAERRAAEEEEEARKEALERAAQ
FT                   EEAAAVAAEEEARLRSVEKRREEKSAVLADEPPEGAQGVCKVLVRFPDGSRQQRRFLGD
FT                   DVVEDLYTWVDTLEEHTGLHYSLVSNFPRKVFSRTDDGGVTLNDGDLCPQATLMYRLDD
FT                   "
FT   CDS_pept        36473..37333
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635701"
FT                   /orf_name="MICPUN_102904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66037.1"
FT                   /db_xref="UniParc:UPI000199BD0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDD9"
FT                   /transl_table=1
FT                   /translation="MAATATCSTRVSTVLAATARRLDQYRRGPSVVSAVSRPDRHDSTV
FT                   DASRWSRRGALFSMVGTAAWARSPRPALAEPSAEGVGKPLRPLKEYRTALDGAVSELDA
FT                   VCAELRAAAGSTSSVDEFDVPAYAAPLDAVTRASIAHRLHVDELGAFWVTSRGTDRYMA
FT                   GERSPFARDREDLWKLLPEKSGPLGKLLQPDFDNPDDPLCLIYSCVNDPRAPPSIDVLY
FT                   SLKLLDEGLNTEGVTAVGLLSNAEDCADKARRYVKLVDETADGSLRDEGWRNPAKSSSW
FT                   HRVGI"
FT   CDS_pept        join(37597..37803,37930..39282)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635702"
FT                   /orf_name="MICPUN_62237"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66038.1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI000199BD0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE0"
FT                   /transl_table=1
FT                   /translation="MIPRKKLPSGPSAQADRRQILAMLDERVDAVTLAELRKNPPPLHY
FT                   DSDENGKTSGSDRDDVLASMARRLGALERETISLRSALKRADAELRERSDECERLRDEL
FT                   RSKGAARFDHLRRGSNRHRGASTSTSPSSGDSDGDECAVRRGGDSNARVEKLERENREL
FT                   SLRLQGAVDDNAALKKFLGDYGMTWVGDKGCRVGVPKPSAERKVRSTRLERRVAAARAM
FT                   SSSPDPPEEHRVHEVERSIIAEVERSVEAPAPADLEPRPRPAAKPNKPKPNRPRFEVNI
FT                   EKLKKSIKELNGVAGDGKGVVVTQPNGDRKVVMPTPKQLYLYADGFRVDDGPFRAFDDD
FT                   KNRSFVRDLQDGYFPYEMVHTHPDGVPFRLVDKHDEDWESGFVAFTGAARLLDSQRFRP
FT                   PAPISFANVQTEQRPGTCSEDDGDEDSAEERVGEVTTLRVKAMNGGKTYVVRLGFDDTV
FT                   GDLRRRLEKVSGEDDDDANVGDEFEIMGGYPPRAFTEDEVTLREAGLVPNAALLLKPVS
FT                   KR"
FT   CDS_pept        complement(<40664..>40948)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635703"
FT                   /orf_name="MICPUN_73771"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66350.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BD0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE1"
FT                   /transl_table=1
FT                   /translation="RLHEFFLEGSPDDEGQLSHDGFVSIFGLKADVYTHRLVRIFDLDN
FT                   GGTIGFREFVYGLSKFQVDSFDRRVQFAYRLFDLDGDGSLDKHELMAAAK"
FT   CDS_pept        41668..42030
FT                   /codon_start=1
FT                   /gene_family="HOG000061064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635704"
FT                   /orf_name="MICPUN_86669"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO66039.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG743217"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI000199BD0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE2"
FT                   /transl_table=1
FT                   /translation="MANSGEPTIFDKIIAKEIPSDVIYEDNLCLAFRDIAPQAKTHFLV
FT                   IPKIRSGLTQLSKAEEGHKELLGHLLYTAQKVAKQEKLDKGFRVVINDGVEGCQSVYHL
FT                   HIHVVGGQQLSWPPGC"
FT   CDS_pept        complement(42106..47946)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635705"
FT                   /orf_name="MICPUN_62240"
FT                   /product="Histone acetyltransferase "
FT                   /function="transferase activity"
FT                   /protein_id="ACO66351.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="UniParc:UPI000199BD0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE3"
FT                   /transl_table=1
FT                   /translation="MGQIYSQGTHGSKSQNKTKRICEPVACWFFEKPPRFGFCPNPRAH
FT                   GEGAVARRRPAGCPNMFAEFEDDDDYDEVDEDQQKQEAPAVPVVTTVDPSSMMTTAGAQ
FT                   GAQAAPVGGGGGGGIDDDNYDEDDYDDPLGGGADTPAQTVVVPTVAAAAAVGLGMAQPA
FT                   PVVPTVAATAAVPPGVPMVQTISALEAAAPPKPAVPKRPRTKEERGVILKFTDIAHEQS
FT                   KMQKKLREAYDKDKDKDKDKDKDKDGEWVPSIGDDIPRPRAPPMVPDDPLEEDDEEEDE
FT                   SSDEDGDEEDGDRAAHPPPRGWDQLGRATAGKHRDEHDEYDDDEDDEDEAADEMDAYDQ
FT                   RADPAIATRAGDGHFKGMPAHTPAEHVDWEDDIHWGEDSEEEREPDEDDEVPAALPEEP
FT                   ARLPEVKVEAEIKAEPVDSEPVDEAAPPPQQPKKLLFRLGGAKPPAACKPGESTGDEPS
FT                   AEGGGGGGGGGSGGGGGGGGGGGGGDATNDRDEGGIRAITTGGGGGGGGGGDSELPAPA
FT                   EDKGAVKATAGMRGWWGEDPDAPLDVKHVPFTRHAQYTRLWSDEEPMLATERERLAKLA
FT                   LEKEKEKEDEDGMELDDDANEGDESPDSSADVVTHVGAGVFGPGMETKVEYRASQPGAA
FT                   KELLSRRNQALARGEWLDGVHWSPAEILAARETNGPPRVTINPNDRMMRLRSYFPGGDE
FT                   EMKSTEWATCEAFVKPGRHLQPVEDVDAQLNIGLDSDEEGTGAKKKEFDAKKDKGLVGR
FT                   PGRLDNIFNAAVVSGPPAFRPHSYIKSWPKPEPIFAPPAFQKKAKVGLALGFKTGADDK
FT                   FQVLVKSFTTESPSVKISVRPTDSVDGLLRKLRKKWTDLRGVIHAHFPEGEQGKAYQAA
FT                   CEEAEKNGERRPRAVPLDPASTMEQCGIKRRVPEPLIYVEAPEIYLLDEGTVRLEKPPA
FT                   VAAAQAALARAMGEETEADAAYNAKHQSAEEAAAAAAAIAAGDPAEAVAMAMTKPSDLS
FT                   ATNGKLILVQYAEKDPPLIAKPGMGAKRVTYYRRRTQGDTAGRSLTQGGQRHVIDLRPE
FT                   AASPFISDLSPGQPQESLETTMYRAPMFRRVIGKDEAIYLLIRSPHGAMTMREVTEYFM
FT                   CGQQEPHIEVFQPNTDRLRDFEERAVNSAVIHTLLKQRDEKVPEEDMRVKVSDIEKQFN
FT                   RAIVGNDIKRRIRRRVVQPVRPPGTRRRADEWDDDADEFELNPGYRFEDDLMVHRMCPV
FT                   EEVCAYDSMRAAKAKLEAGRDRDGIARIRKLIGTSMTQMQNAFQSVMRGTTPAQRKGLL
FT                   DLELMLQLQPWNQTVEFLAAVGGRAVLHLNPSRRLREKTGKFYHYVRRQPPKEDQVSAQ
FT                   PKVKPGTVTGTDADLRKLTMPQSERILKGFGVPESTIKSLHRWKRIGLIRELSGAATAD
FT                   KNAEHSGLSRFARSLRVGIQQQMTEQKEAANKIFKNMRKMLSDKKGNRRARAGAGGSSD
FT                   DDDGGSDDDDDDDESSEEEESESDDSLADELEQGMDKDTDGPDEDEERRELEEMRRLMG
FT                   GEGGGAPGEARPLGPTQVPPGKKLVLKRIVTRTFPDGRVEKIEDDVSEAVGDAWMKARK
FT                   FKPDGEVDLEKSREAVMKILYPHGVDPPAFVSGDQAGHGGGRGGGGGGGGAAAGIGAGF
FT                   EGPEDEKAELIRQRKRKMEMLRRRKKRFAQLQAQAGVSAQDLEKLKEMKEAEAAPKPGA
FT                   GPLKLKFALKAAPPPKAKGKVKGRRGDDEDDYTDYGGPRKTTTRFRGSRRDEILQEIIE
FT                   SLQRDRNCDAFNAPVTKKIVPDYREFVDRPMDLSTIMKNLRRAGGYDTAESWMQDVRQI
FT                   LTNAKLYHESEEEVLMRYPAIIAAAQYLVDECEKAVERRAADLKLADQFFDAEKVLGRP
FT                   LSAEAQEAVDNVGKMVFPGGVTASGAPVAPPAVPKEEPREDAQPPPKEEPMEEDDQPAP
FT                   EPDGGFGGNPELE"
FT   CDS_pept        48454..48891
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635706"
FT                   /orf_name="MICPUN_86352"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66040.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000199BD0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE4"
FT                   /transl_table=1
FT                   /translation="MKLAFKRWPDTPNKTSPEGYVWLEANARREDVVVLPSGLQYRVLE
FT                   EGTGPTGRITKDTPCSCHYEGKLIDGTVFDSSIKRGKPITFAPKQVIRGWTEAMGMMRE
FT                   GDRWELFIPAELGYGGRGSPSGSIKPGDALIFEMKIERVNP"
FT   CDS_pept        join(49260..49290,49522..50948)
FT                   /codon_start=1
FT                   /gene_family="HOG000276712" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635707"
FT                   /orf_name="MICPUN_91929"
FT                   /product="Predicted protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="glutathione-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glutathione metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66041.1"
FT                   /db_xref="GO:0004362"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006749"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000199BD10"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE5"
FT                   /transl_table=1
FT                   /translation="MEYDYDIFTIGGGSGGVRASRMSSQAGAKVGLVELPYSPISSATT
FT                   GGLGGTCVIRGCVPKKLLVYGSAFESEFRDAVGFGWDHGDKMPEFSWERLIAAKNGEIE
FT                   RLNGIYGRLLDGAGVEKYEGAGRVTGPNSVEITDVDGNKKTITAKTILLAPGGRAWKPD
FT                   IPGADLGITSDEALAFEHQPKRVVVIGGGYIAVEFAGIFQGLGSEVNIVYRADLPLRGF
FT                   DQEVRETVATNLAARGTSVHAGANPTSVAKNDDGSLTLTLDNGTKIETDCVMWATGRVP
FT                   NTDRPDLGLKEVGVELDSKGAVVVDEYSKTTVPSIYAVGDVTNRVNLTPVALMEGMAFK
FT                   DTVVLGKPTKPDYENIPSAVFCQPPVATVGMTEEEAVAKGMTCDIYTSTFTPMKISLAG
FT                   RVEKAFMKLIVDTATDKVVGAHMVGPDSAEIMQGIGIALKCGATKKQFDSTVGIHPSSA
FT                   EEFVTMRTLTRTVGPKVAEKEAVGAKM"
FT   CDS_pept        complement(51023..52438)
FT                   /codon_start=1
FT                   /gene_family="HOG000100072" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635708"
FT                   /orf_name="MICPUN_62243"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66352.1"
FT                   /db_xref="HOGENOM:HBG561493"
FT                   /db_xref="UniParc:UPI000199BD9C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE6"
FT                   /transl_table=1
FT                   /translation="MSLVTSRVPSAVSARAASSRTSRARASSVVGVSTRLTRTSSRSRP
FT                   AVPTRAVATDKPASDRPSLTKIIEKPPALLSRGERTAAVPYYDGAVDRPVLINDAAREA
FT                   IASSAAKDFIALPTREDPALVHLRDVLEKGWRVMEPTGSGHAGLWPELFDAGADLIKSQ
FT                   FPQFGDDDAVEVLPGTGWLDPSLESDAIDWVMRRPEGHVVSSKIHFATRLHRDPDSWTN
FT                   PKTPQRPKDGWTDLAMPDRDRYQYRFVNIWIARSAIDPTGQVWQSPLVVCLPRDGGERE
FT                   WKFEKRKISMDDTEAEKEYNVRGITLNPKTWIPGTNRLLRPLWQGGAGDAKASGKSTSG
FT                   DGFGGGEEELTAEEIAKFEFPELTSEDAHSFVTGPAMVFDSFDLWHGAARWEEDKAFTD
FT                   ELRRIDVKGRQPFHRARCSIEMRFRVKIDMKADGAAKRWGPFASAVASGKFRDDGLRDS
FT                   EAKYDLAKGVVAK"
FT   CDS_pept        52819..53460
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635709"
FT                   /orf_name="MICPUN_62244"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66042.1"
FT                   /db_xref="UniParc:UPI000199BD9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE7"
FT                   /transl_table=1
FT                   /translation="MDHDDPADTVASFSEAVMREAMWDMYDADTGAALDNSKAISLNVD
FT                   AEDTDEVDLALFVDDDDHPGEFEPNSTQVVQLCEFAHPETCAKAVPYVWAPETFDCGES
FT                   DESNPDAGFVCVDIEAKTDKDGDLAVIAETRAPSPMCVEPDDDGDDTETTDDIVETVVK
FT                   EDPTVVEDGGEKRRRGLTQARINRRSGNRSRHLRTGRVRGTRTSTRGRRG"
FT   CDS_pept        complement(53599..55014)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635710"
FT                   /orf_name="MICPUN_102909"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66353.1"
FT                   /db_xref="InterPro:IPR003612"
FT                   /db_xref="UniParc:UPI000199BD9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE8"
FT                   /transl_table=1
FT                   /translation="MRRRATTLALVAAIWASARGARAVPAVCTEARLEGLPTLCAVAAP
FT                   DTVQTGPNSAAACCDELRELNDARCFCSEPFLGLDATRQGALVPALATAPRRCGVDTRV
FT                   GRACRSVAGDDGAEAEAEAPRLGDETREDGAAETCPTRTLIRLVQDGCAGALTETCCDT
FT                   IDALNARSCFCEDDVVDVLRSFPASFRRMFAETSAECGFVVRGGRRCEPFPAKPPTPPA
FT                   PFPPFPPYPPYPPTPPTPPTPPSEAAIKGSNEGPTRAPDQRVDVVRVCDPGAYVSLLDV
FT                   QRCDVTLLVTAPASDDATALDACCESIGLLDQALCLCDPNIASLIAQTRFASTPMLNSV
FT                   YGSCGFRISTLDSNGTCVRVGSPMFGPPPLRGRPPRPSRPPSPSPPVPGAPRGPSGPPG
FT                   PPGRTVVLAGAGRVPGSAKDPPLYFVSKCPPWVRRCGYRDWKDWEEDDAVFPTNPTRLP
FT                   PSLMMDYEEYFDG"
FT   CDS_pept        join(55110..55148,55340..55537)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635711"
FT                   /orf_name="MICPUN_62246"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66043.1"
FT                   /db_xref="UniParc:UPI000199BD9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDE9"
FT                   /transl_table=1
FT                   /translation="MDLASLCSGSRSSGNFSSAAGIANWTRAKGVALALAPHARPPVHT
FT                   RSITAECSTNDDRLALPRGAHARALRASGRQSG"
FT   CDS_pept        <56718..>57041
FT                   /codon_start=1
FT                   /gene_family="HOG000200836" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635712"
FT                   /orf_name="MICPUN_74345"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66044.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199BDA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF0"
FT                   /transl_table=1
FT                   /translation="EIAGFDHLQVLALDGNDITGIPAAIGALASMEQCYLSNNSLESVP
FT                   PELGDCVSLETLWLNGNQLTSIPKELANLVALETLDLSDNLLETLPSELANLDLLEQLD
FT                   IYNN"
FT   CDS_pept        complement(57221..57652)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635713"
FT                   /orf_name="MICPUN_62248"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66354.1"
FT                   /db_xref="UniParc:UPI000199BDA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF1"
FT                   /transl_table=1
FT                   /translation="MPSTDTTTSTSHFEILPAGLPPSGSRASVPASAKDDPRWARRAAE
FT                   ALASSSGADIARVQATLQELRKCQEAVSEQLGETREAVLWLQRLEVVEQQMILIPDYQV
FT                   KARKLAHDMKNVEERLLKAKKRAEKLIGHELPSHPEEDE"
FT   CDS_pept        58813..60048
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635714"
FT                   /orf_name="MICPUN_109099"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66045.1"
FT                   /db_xref="UniParc:UPI000199BDA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF2"
FT                   /transl_table=1
FT                   /translation="MECALDEEEGTRKLLERARAARGANGTLVSFGSGSISGTSETSSP
FT                   REKASASFITGSTVDSPALLRVGGGYAGSPPKHGHALRAKMARDLEMHVRALTQRAKKA
FT                   AREADLLERHLARVDRFQDESVGELELALWLLRGVDELTRREKAERLAAAKARSDKFKP
FT                   SGQSVKYGKLKSIADKKRTAKKKPATVDDDAAGADEPPSPLHRHRERVQQRRRDDADLL
FT                   RGFDLDGGMIGAVSKRQTGSNDDTAVRKALAGAMESAAVLDDDDDDDRGVEVAPEETTS
FT                   TPPPSRAVAGVHRGSALPPTPGADVSAKILNDGKTPVRLTSVERSSDVRGPDAEGAEGA
FT                   EGAEETFHTPATEPERASRPTPSPRARQTPSPSPSERKSTYILPFGKSTYKLFKRNVLG
FT                   IPSKKDKVGSKG"
FT   CDS_pept        complement(60852..62051)
FT                   /codon_start=1
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635715"
FT                   /orf_name="MICPUN_109100"
FT                   /product="Protein arginine methyltransferase "
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66355.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG715060"
FT                   /db_xref="InterPro:IPR007857"
FT                   /db_xref="UniParc:UPI000199BDA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF3"
FT                   /transl_table=1
FT                   /translation="MCVSRLAAAASDDRAPAAAQDDGPDVVFEFDDFDDDETWDVIESF
FT                   DEDELYELNASRSDADADDTYFDSYSHLGIHREMIGDAARTGAYLDAIEAHRPQIEGKV
FT                   VLDVGCGTGILSMFAARCGARKVYAVDASGITRHTRRLVKDNGFDGTIEVIKGKMEDVD
FT                   IPEKVDVIVSEWMGYALLFESMLPSVVDARDRYLAPGGLVLPNEAAVKVALLSDRDRWD
FT                   GAVTFWEDVYGLDFSALIPAAKRDWHADPPVQTVPADKLASEPVDAIEPIDCATVELER
FT                   LYEPIAGDVRMVASRTCDVHGLALWFDVDFYGKVKLSTGPDADSTHWYQTVLMFDEPVA
FT                   MREGDALCGTIELEPGANPGERRTLNVYFNYDVVEGGKEEEDGLVEPDDRERFQRWTVQ
FT                   "
FT   CDS_pept        62358..64232
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635716"
FT                   /orf_name="MICPUN_62252"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO66046.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BDA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF4"
FT                   /transl_table=1
FT                   /translation="MGIKSRQRRRQQAAGRASAGNAGVPRGFNPRTGEFDGTGMSQDEI
FT                   LALYEELAAEERRRQRGGRVRYSEGNAVMKLWNGVYRLVAVVAVVLIASFTQLFPTAEA
FT                   YDRRRGQDPNARFGDDAGDEGAENVGGAGGSGPEKTPRDEPAKPTDPFETLGLDKSTAT
FT                   ADDVAKAFKRMAIKWHPDKNLDREEEAKHMMQTINAARARCVQILEGGKDPEERDDAEF
FT                   DPTKPRPEGDDDDASDASDDDVGGADCEAKARRRAERAHRRMYEEMQRDYERRRRQERQ
FT                   RVRLEARQPGARFKRQRDAHAARARRSESSEKDTKRSEDADGADAEAGSEPNDSNPADT
FT                   SGGSANRSGKGSSTNRKKNRARKDKSRFAERGETDEEDDRRTGRKRLGGVESCAERMDA
FT                   CVHEIALAVRAHAPTLLAELLMFECPPLAPVDPDGNTPLHYVARYDPGLVEAFLQVVGE
FT                   GWRAAATAKNNHGQTPVDMLSPEVEDLDEKTAAQADRVDSVKGTSPAAVEERERLEKQA
FT                   RERAEASRLGAERIRKITGYAQREEEKRRVLTRRTFDARGAARVSVAATASCATAYFVV
FT                   WTGVWGAWVWAAGVFFATAVFALDRLVPREQVAEFAGNGDGEGDGAAT"
FT   CDS_pept        complement(64335..66293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635717"
FT                   /orf_name="MICPUN_102913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66356.1"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR015411"
FT                   /db_xref="UniParc:UPI000199BDA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF5"
FT                   /transl_table=1
FT                   /translation="MQGRPKPARAFTTTASEREREQAQRDQLRAQQARVETVEKYSGLR
FT                   IKNRVVAGMVVEDRFADLRFYRLKDLRPAVTGRWATAGVLVEKSLKSSSNGGSYSVWKL
FT                   SDLGRDDACISVFLFGQAHTDNWREPEGTIWSVVDAQLNESRGDRDGGRPSATVDGKDP
FT                   RALWKLGTSADFGRCRGVRRDGNNCTMHVNRSLSEYCSYHASAALKAFTRSGRMNVGVR
FT                   RAPKFTVNGKTVMGTRGGGNGGKTPSLPPGVHAAGYRAQHQHQRQQQQQQPARTYGDEE
FT                   RRAIAARHGLSSGSRGAAMLGGLAPRGNTAGAGARFAAAFAKLDDGKDPRKDPENIVLV
FT                   DDGFDCDGDALRDMIKDMASAERAKAVAKALKPPDPNDWRRKPLGEVRVCVGVTNVPAS
FT                   SSGAKAGAKAGAKGLTPGATRTTPGSEGRTRLEAQAGVGKNGPPEMDPRGAKRRGDSQS
FT                   TAKPPVPGSFGDVFGCVLDGQDDTKRSRYADDAEALENERLMTAMDALEKQDKLYTQLT
FT                   NTRSMKVTASKCVHPGCGAVYEQGRRPTRCFEERHQAKAIQAEKRWFKCASGNCQARCV
FT                   TLNKPFPPHKCHKCGCADWDRTGIPASAGAAGKGFEEEVANAKGMLARGVEHGFSLGGG
FT                   GAVYDGGARHFESIIDG"
FT   CDS_pept        join(66508..66723,66937..67239)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635718"
FT                   /orf_name="MICPUN_102914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66047.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199BDA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF6"
FT                   /transl_table=1
FT                   /translation="MSALGSADSSAHGAAPLSTSPPDSENDASTSVHKLEVMVHPRFVR
FT                   QLKEEPAVFCPLDWLPDEVISNVLVHLHGRDVARFSLVNRRARRLCEDDDVWRELCARH
FT                   FDIRPENRDRPECGWNTLYQIHHNVLYSLFRDGGRQSPGLGTSDGFGRGIAAIAQGRAG
FT                   GMSISLGAA"
FT   CDS_pept        join(complement(67649..67785),complement(67392..67548))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635719"
FT                   /orf_name="MICPUN_114082"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66357.1"
FT                   /db_xref="UniParc:UPI000199BDA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF7"
FT                   /transl_table=1
FT                   /translation="MLPLAPVCFPLTCPPVAPRGVGATCADADETASLRRLEHELEVQV
FT                   RQRSLIRKALADVTPMGQKTTRGVVGNDMVTDEVDNAMDDVDSEPDDDRDFE"
FT   CDS_pept        67939..68922
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635720"
FT                   /orf_name="MICPUN_62255"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66048.1"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniParc:UPI000199BDA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF8"
FT                   /transl_table=1
FT                   /translation="MSTVGRAAMGSYADYDPYEARGIPRGIPVASPVAGGGGGYGATNA
FT                   PTPFAVQPPVQQRMTDDPSAGLGFLGAIDGVFLQEKVEMLEVITGCDTHNVYHVTPVPK
FT                   GMLPEGVVPKEWIDYFTNQAHSTPMLKAREEGECLERVCCPNFRSFTMDFKDGTGATFF
FT                   TLHRPFNCTIATPCFMCNPQRMELTDGHGAHAAHASEEFRACWWCTRSFVAHDEAMNEL
FT                   YRVRAGDCATMRGKCNWCAPSCCNESYDLDVLEPAETRGVGATAANVWPGWTCAGITDR
FT                   SNILIRFPPDATPRQRAALLATMMLVEFSHFEWKKGEHEGNLAYAL"
FT   CDS_pept        complement(69130..70818)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635721"
FT                   /orf_name="MICPUN_62256"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66358.1"
FT                   /db_xref="UniParc:UPI000199BDA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDF9"
FT                   /transl_table=1
FT                   /translation="MISRAGRGSGAHASRRDRGAGDGPGTPPEVAFTGVTLNPLGLGLV
FT                   VGHSLTRVARPPAPAPSRPRPSGADATSASSTTTGRPTARAPPAAPRHRSPTQSPTPNG
FT                   RSFQTSTRAFEYSPRSRSASPGARTAAGAQTRVPARPRRSPAAQAATSAWGTAPVASAS
FT                   SSSSSVTGSIRVRPFRATAMSPNPRPTPNRSGRRATTTTSATASATKPASVPPPSVAET
FT                   EKGAPVAKGELHERGDDRNDEAPPGETPEASRNRPSPPSPPSPVPRPVRVRSASTSPSP
FT                   SASAAASAAAAAAAAAARVRSAREDAAARARAALTIGVERTRASEAAAAAAAAAAAARV
FT                   RSAREEARARAAAAAEAFARERADAEAAAAAAAAAAAERVRVRRATSADASRLAAAQLA
FT                   REMEREKEREREREAASAREGAAARVRVAREAASARVSTGNRSAVGSKASRDDDGGDAF
FT                   SGFRRFGSGRRALEGSRASSASSSTTREESRERWRAEVYAFNRLMCASELAATRAFMRG
FT                   FKLEGGGFEKVAGTKGLAGFKAGGWSDAESDVEDVAEPLPRHLRV"
FT   CDS_pept        70964..72877
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635722"
FT                   /orf_name="MICPUN_62257"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66049.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199BDAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG0"
FT                   /transl_table=1
FT                   /translation="MPRPDRNAQWVSTPALLRLSASAAVMNAVVPLALCLQVALAGKMA
FT                   GSSVQAAFGLVVVTCGMGTTVFNFLVDGVVAKVGTAIGARRWDEARGRVRAALVAALLC
FT                   GGTATAVLLTIRTPLFVLFGADRAVTARARAYYAFRASAIPLQCVASSTNGCLGGYGRV
FT                   HAATALGIARAAAEVVGVAAALASADNGSDDGRRERGAMVGMGVVYAACVAMHAAVGVT
FT                   LVACLVPDGARSRLGIFRGIFGGASRREDGYLEVPDAPDGTLDGTLDGTLDGTPDGTPF
FT                   LTDLADFAMDGASMLIRSLLLQGSFFFAMVCASRKLGATGLAAHHAVTQLWMCSAYLVD
FT                   GFATAGTVVGSRLVGAAMGNELTSPGRGGRSDGRTGTDANDEAPGDSPPGDSPDVSFED
FT                   TLASLRSVCARLLLLAVVAGVAICLGFVWCRATLVRAFTSDAAVASALLDEDLWRLLAF
FT                   SQPLNAAVFCLDGLVYAFQDFGFVREAFEVGVGYVFAPTLAWAYGKTPATLAAVWTAKV
FT                   ALNLWRLVALGARIAGWCLTRRGLRAACERRRGGGGTEDGGCEEGRGAREGQGRGRGRG
FT                   RDRRRGRRSADVAEDSPRGSLLRDFDESAGLEEGVGSPATSAEGSFRHWRLRSPEEGAR
FT                   SP"
FT   CDS_pept        73720..78516
FT                   /codon_start=1
FT                   /gene_family="HOG000200818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635723"
FT                   /orf_name="MICPUN_62258"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66050.1"
FT                   /db_xref="HOGENOM:HBG557615"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniParc:UPI000199BE4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG1"
FT                   /transl_table=1
FT                   /translation="MTVGVGRRKLSPVLLALCIAGLVRSATAALNTPTCPAVLDAYTGG
FT                   ASSATLNGGQQHTFSATGVIQVRLDLTFGSDVNTNQVFFLFGAPSQCGGLIGDVTTGGN
FT                   LRLSVNCNYDSSDIGLTSGTGAVSPNTRYVIDYVYNQVTKLAEIYLDGVQIASGTKNWN
FT                   EKLLDGYISVGDEAHASTVNAFQGTLHEVSMYDCDYGCGYDCGYEPSCAPAFTSTAGYQ
FT                   TQVGTGTTHNFDPAGSIYMRAVVTTSDAWGSGSAQTVAIWGSVASNGCGGWRGWIENNI
FT                   IGMDVQCNGGTPGSDAGASVDLTSLGGLYLNTLYTLEFFYDMTRNKVKFWVNGVEVSPA
FT                   GGISRNFYPTDGYLSIGYSGHGGSSPYFGGYTTSGTIHELSVYDCKPPPEPFTDRAALK
FT                   TAVDSCIADSGDGTGATCCSTDLACQDRTNTVYRCGAAACTDMPDWDVSLVTDMSELFN
FT                   SKAQFNADISAWNTSQVTDMVSMFINAAAFNQAIGSWDTSKVTDMQWMFYGATAFNQPI
FT                   GSWDTSQVTSMQSMFQSAAAFNQPIGSWDTSKVTSMVGMFYGAAAFNQAIGSWDTSQVT
FT                   SMVAMFRNAAAFNQPIGSWDTSKVTSMSHMFYGATAFNQPIGLWDTSKVTNMWNMFYGA
FT                   AAFYQDITGWSSASLTDSTDMFLGATAWLDRLERVDGSTDGPISQWVHMPCLVDERAQS
FT                   GWCVPCGGMFSLNAAGDDPAAGGDTVCDGDNQGLKDAVNACLSVVPSGEACCSTDPDCT
FT                   DPSSARCRSAGCVDMPDWDTSLVTDMSKLFLDCSSGDSWCGGVAFNSSSFNEDIGGWNT
FT                   SKVTSMMQMFRGAAAFNQPIGSWKTSQVTNMGAMFYDTAAFNQAIGSWDTSQVTNMGHM
FT                   FLGAAAFNQAIGSWDTSQVTNMWHMFENAAAFNQDITGWSNASLTLFNDMFTGATAWLD
FT                   RLERRDGSTAGPPSEWYVGPPDSAALKDAIAGCLSAVPSGEACCSTDSNCANWVNDLND
FT                   PPRCGVLGCVDMPDWDVSRVTDMSELFRSKAQFNADISAWNTSKVTDISYMFTDAAAFN
FT                   QAIGSWDTSQVTNMVNMFNGAAAFNQPIGSWKTSQVTSMSGMFWGAAVFNQAIGSWDTS
FT                   QVTSMWYMFNGAAAFNQAIGSWDTSKVTSMSGMFWGGAVFNQAIGSWDTSQVTSMWYMF
FT                   YGAAAFNQPIGLWDTSKVTNMWNMFYGAAAFYQDISGWSNASLTTSTAMFAGATAWLDR
FT                   LERVDGSTDGPISQWVHMPCLVDERAQSGWCVPCGGMFSLNAAGDDPAAGGDTVCDGDN
FT                   QGLKDAVNACLSVVPSGEACCSTDPDCTDPSSARCGSAGCVDMPDWDVSLVTDMSELFR
FT                   SKAQFNANISAWNTSQVTNMQTMFRGAAAFNQPIDSWKTSQVTNMVNMFNGAAAFNQPI
FT                   GSWDTSKVTSMWEMFRGTATFNQPIGSWDTSQVTSMAHMFRETTAFNQPIGSWDTSKVT
FT                   SMGSMFSAAAAFNQAIGSWDTSKVTNMVYTFFNAAAFYQDITGWSSAASSTGMFSGATA
FT                   WLDRLERVDGSTDGPISQWVHKPCLIDERAQSGWCVPCGPNFINDKGDIPADGDTTCDE
FT                   MTCCQAKMKRFGMIIKRKP"
FT   CDS_pept        complement(78750..79946)
FT                   /codon_start=1
FT                   /gene_family="HOG000222847" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635724"
FT                   /orf_name="MICPUN_62259"
FT                   /product="Predicted protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO66359.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="HOGENOM:HBG582718"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI000199BE4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG2"
FT                   /transl_table=1
FT                   /translation="MSVSARLLSPAALPRATPAPRRGGRSDPPRARRRVFASSTIIDDD
FT                   DASVSAYDRARLEADASAMRAQRERMTDALERKTADVDDAARDDPHGEWKWAIRKRIWD
FT                   RMEDTNVAQFPRPVHHRIPNFVNADKAAANLTALQCFKDAKCVKVNPDTPQKAVRRAVL
FT                   EAGKTLMTPQPRLRTGFFSILSEELVPAIAADAEVLKKCCTSAGVASHGVPLSLDEMRD
FT                   GRKCDLLVIGSCAVDVRSGARLGKGEGFAELEYAIMRMMGTIDESTLVVTTVHDTQLLD
FT                   GGEIDTRRLLRHDVPVDLIVTPTRTIWIDKAAQPAKPEGIYWDILSPQKLAQVKVLRDL
FT                   RAEVEAELGETLPTGPDETLPPLAVRAEKKKMREVSRGGGGGRGGRRGGGRGARRGRL"
FT   CDS_pept        80154..81509
FT                   /codon_start=1
FT                   /gene_family="HOG000265470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635725"
FT                   /orf_name="MICPUN_62260"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66051.1"
FT                   /db_xref="HOGENOM:HBG557627"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199BE4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG3"
FT                   /transl_table=1
FT                   /translation="MCADHPAVAAELARLDAVADAREAAAAEARDAGDDAAVYVEEVAG
FT                   RARWAADRARALATDASARPVPAKPIPRVHCSRLSLATFRREYVARKEPVVICGLGPHL
FT                   TEDGERGDGLGWLTRHGANKKVAVTRDNAHVNSTLACADTEILDLGEHLARVLPLDAPN
FT                   LPEDAQEFGSRDGDGTYLYDCAMPLKLPSLLNAVRVPRYFVHDFLQRTRDVHAFTASWP
FT                   SLFVAAPHTKSSLHVDQWRGNFWMAMVRGTKRWTLFHDEDVPYLSPDYGRGTLDPAFPR
FT                   MHVMDAAHASWRRRNANAAAAADDDENGKKETQPHSAEDTEPCDSHPLLPYARRWDVDL
FT                   GPGEVLFVPGGFPHVVHNLDVTCSFAGNFIDESNLDFALRDLKLLGAKYGTQMMRTHDA
FT                   IDEVWFDPEDEVWVEECLEPRRLVVRYEDYLGGRAGRWGAADWDGIPDEEGR"
FT   CDS_pept        join(81767..81880,82126..83232)
FT                   /codon_start=1
FT                   /gene_family="HOG000088965" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635726"
FT                   /orf_name="MICPUN_95387"
FT                   /product="Predicted protein"
FT                   /function="O-phospho-L-serine:2-oxoglutarate
FT                   aminotransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66052.1"
FT                   /db_xref="GO:0004648"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG289982"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniParc:UPI000199BE4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG4"
FT                   /transl_table=1
FT                   /translation="MQTPTKWKHNFSAGPSAVDAGVLAKLSAELASFEDTGMGLIEHSH
FT                   RDAGGPVQRCMAATCDLVREVLDVPDSHDVLLMHGGAHAMFAGVAMNLGRTMGSKADFV
FT                   GDGFWSKRAAGEASKYCVVRHVGATSRTLGGVAIPSPSTWNVDPTAAFVHVTANETIDG
FT                   LEFHVDPTMPPDAPPLVGDFTSTLLSRPVDFSKYSVVYASTGKNLGPSGLVVVIARKDL
FT                   LTGEREMAITPGVMSWSAAAKSAPIQNIWNTPNVFGIRALQLVLEDCKAKGGVAAMRAR
FT                   ATRRAWSVYDVIDASEGFYVNEVEPEFRSTMTIPVKCKTPEIEERFVEESEKAGFYNLR
FT                   GHPLFGGLRITVYNQVPDDAVEALVGFMQQFQMKVTAEEGTMFGANGKTTYANSPPSVL
FT                   NSFAFMD"
FT   CDS_pept        84018..84215
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635727"
FT                   /orf_name="MICPUN_62262"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66053.1"
FT                   /db_xref="UniParc:UPI000199BE50"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG5"
FT                   /transl_table=1
FT                   /translation="MDHNQLPAGLFTPERPSGNGGVDNTVRHISRPKSSRLDHGPTLRC
FT                   DNHPFAAPWRARARISRLAT"
FT   CDS_pept        join(84681..84788,85144..86898)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635728"
FT                   /orf_name="MICPUN_102921"
FT                   /product="Tso1-like transcription factor "
FT                   /protein_id="ACO66054.1"
FT                   /db_xref="InterPro:IPR005172"
FT                   /db_xref="UniParc:UPI000199BE51"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG6"
FT                   /transl_table=1
FT                   /translation="MHADQAVLAAVHALAQSPLRPGVLDDVTDVAQLRKQLETHFDVNL
FT                   TEPEAAHAGMARALEEELRQLDGELELEQHATRLVRGGDVAPSPGGNPNDARGANGRRS
FT                   LRGAAARGATGPAGVGAVAAQAAEESMKRSSTTGASTEWPHGLAKTLKNDGRDSPRVQS
FT                   SRGNGKKSANGNAGGVAPGGGGGSKSKKAGAGGGGGGGSIERLDQSANAGGRRGGAQGA
FT                   SDRRLSVSAAATPAVKGERPAGPLTTPSPTKDGEDPSKSCESKKCNCKKSKCLKLYCEC
FT                   FAAGVFCHECSCQNCQNTSDNAGLVQMTRQQIELRNPNAFADKIVASGDGGGQHKKGCH
FT                   CKKSACLKKYCECFQAGVLCQDYCKCDGCKNKEDNGQFGGRGGAAAAKPIRMPTLSGHG
FT                   TQAAAIAAVEEAAMFMASENDHHGLIMEDLMHMKSPGRVGLINAGLMSPGRFGMGLMSP
FT                   GRGLVMSPGRAVLAAVDGLGLDLLQSPPKAAPPEAATPAAGSNASGGSNSVGATPMKAR
FT                   GETVSPLTPGSGRGTILRAGPGRLTLTGGSAINTRSKAPPPRFDGKPNANSAKGPMVTP
FT                   TVTRSSRKTRSFGAMSGSHDAALAGGMITTLGSPVPLSTPEGFE"
FT   CDS_pept        join(complement(88641..89207),complement(88041..88505),
FT                   complement(87874..87991),complement(87249..87601))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635729"
FT                   /orf_name="MICPUN_86239"
FT                   /product="CorA metal ion transporter family "
FT                   /protein_id="ACO66360.1"
FT                   /db_xref="UniParc:UPI000199BE52"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG7"
FT                   /transl_table=1
FT                   /translation="MGSAGEGSHWLDRTPSDELGDPTTLRGDAARRVARRLTDVARFRG
FT                   SVGSEAETSAWLSRRSTPDGVDQTPAAARDPARFNPTPPLGQTLAPAPAFKPGPNAIVF
FT                   TREQRGDPGAQPEKRYNVQRKWLVLDVDGESTFLEATKMEMQRELGVPFRDLMILDPAL
FT                   PTRYPSSVFIRPRALVINLEHIRAVVTLPDVLPEDVLPEDVIPNDVIPNDVLADDVMPN
FT                   GGVSPEATAATTDILGLRQSPADLKVLALPFELRVVEAALFHVCARLLEETITLEDVAY
FT                   PALDSLARHVTTKSLERVRRAKAAMNQLSRRVGAVREELSKLLADDGDMMAMCLTTREE
FT                   KDRHSPITAPRPITAPDGSRGTASRPVRASAVDRRPPPASSSTQHEGVEALLEAYYMHV
FT                   DFSFARLAELRDATEDTEDLAEISLDSQRNRLIKIDLVISNATLAVGVFGVVAGAFGMN
FT                   LPVPLRSNQGAFGEVLIAAGAACVALFTGVLLYLRSQRLLQT"
FT   CDS_pept        89560..90447
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635730"
FT                   /orf_name="MICPUN_62265"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66055.1"
FT                   /db_xref="UniParc:UPI000199BE53"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG8"
FT                   /transl_table=1
FT                   /translation="MNANAAPPLGTRPPVDVASFDRSQLSVYLKDVVTLALENRPEDPI
FT                   AFASDYLRRVLGGAGAVARAHQYLSLSPHTRRAFTDNALLAFEVLSGDEEGEKPVPGRK
FT                   FNQLIDALLEDAPSAIAERVRDVLRTTDDAEVRWWEFQRAAKACFALRELLEELERLYE
FT                   RRGFTGAGPSRTPTEPERLRDDDDDDRRAILEPGCAFEVPPRRSHLPKAALTRVLYETL
FT                   RLEREAIPYHWGPIGKQVRDMGQNAGAALGGVAGSVVGFEAFAGAVVRTATPRKASRAG
FT                   DRDGAGAFNARDSS"
FT   CDS_pept        complement(90532..93135)
FT                   /codon_start=1
FT                   /gene_family="HOG000100069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635731"
FT                   /orf_name="MICPUN_62266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66361.1"
FT                   /db_xref="HOGENOM:HBG557664"
FT                   /db_xref="UniParc:UPI000199BE54"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDG9"
FT                   /transl_table=1
FT                   /translation="MREDPEDPWEDGYLRGDPRSRRSSGGSSSSPADGGISVKTLTPYL
FT                   TSSTARTLNGLAALLVVAGLILVAQVSAPQIGWAGGRVGSRGVAVLDIGADTGATGAAS
FT                   RASSIKNNDEGSTKGPSGRTWTFKEKTGDGLNVPERPKKNNTLSLKTSGAHDTWGRKFY
FT                   ADDSPSNLLASLASLTDATAGKEWSQIPSVRRQLRAFAAVCGDDMVTAQGRGRRTFIKA
FT                   LAEYTQLYEELWRDTGGNGTAVHRPRVLIVRDALARRGRGLGDQQAHLARWLMFGMATR
FT                   RAVFFQHCAEDDEPWEELYPSGALNPPPPRCDETTDDGYFNLGDYFRLMGGIDARWNAA
FT                   TAAKLRELDVAGTHANLTVVGSCNDRTGHVAHGDSPDARVGGFPNPTTTRMFTCDCCES
FT                   CDAVNERSASATGRYVDRFKKFWADEHEAHSVIAFEYRSQCGVPRVIGFRDDPALSWYS
FT                   RDLPRILAHVADANGEDSLVPSDWAADVLDGEGGAGVSGGSNAPPATTPLEFRSIGVDR
FT                   SRWEHCARFAMTQPSPAAQTAATSALRRLTAMGEHRPLVGFYALMNAAAVSGSGGASNG
FT                   ASKGASKGASKGASDADCELRLADTDSLSWVSVDDEFAKRAQLAPGLKGPPSCGFAPYN
FT                   CDDKPLYWTALYGQLSGYLDCARRAPSLGLPLVSIASAGEYTSSRTESGDVDVHAPARV
FT                   YAATDSALVHALLAEEGDEGGGGGDLVVFGNVSSGTSDGAKEGTDANLKAAVDFYVLSL
FT                   ADVIVAPARGSFVDGAARRGFPFKAVLGGPRDACVLLRALAREEPAGGAEPVGADDKVA
FT                   PGSHYSHTFTGPADALRGLEACFRGMRALGLNPHVPNDARETMDRLASSVESNPE"
FT   CDS_pept        94406..95551
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635732"
FT                   /orf_name="MICPUN_109103"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66056.1"
FT                   /db_xref="UniParc:UPI000199BE55"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH0"
FT                   /transl_table=1
FT                   /translation="MTQITDGCELTDATATPDGRFAIFMHRCESDSSVQIRAAPRWAFR
FT                   VDGNRVPSRLLFTLDGRNGLAGAKTPGHMNRGTFAKAAGIHAFAETDENGSPTLALAIV
FT                   SDDDLNADGSSPTTVAKFRVRGDVYADPGQAPWPKDPKDGTSGEHPKYAIYDPPKEAGL
FT                   GAGERSAGVGAAAETSDVNKEGEKKPGLARLGDGPVVVREAFPRLMLDEVDSFLLAEAD
FT                   YMEARREEEEEAYGDDPFTRTGVGPVIRIVTPTEADYDASMGVAEGDLDPYAFERTHEP
FT                   RGSRHMTERLSSGSVKRVFREMFGVDEHGGIGWLAGTFVGVCVFGGVVIVAVVADKVGG
FT                   YESVPEAADVFGGGGDREMDVLSSSGYGGLRNDRKYGDDAV"
FT   CDS_pept        join(97740..98177,98381..99142,99279..100070)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635733"
FT                   /orf_name="MICPUN_62269"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66057.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199BE56"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH1"
FT                   /transl_table=1
FT                   /translation="MAARRAYPPGVDAVDAAFGYGAGALFQQKNIRTWILSVSVIVLSA
FT                   SASPKFCARRPRSGVTETLLVTQATARSDRAPAKVSRSVRVTQTARTHRELPPRPHPEL
FT                   HRDPTGQLIPTAWQEATKRVGTTMSQQYSYPYPPSSGEGYPQAPSGVQDPYATQGNYGY
FT                   PAAPNPAAPNPDYGAPLIPGFGAPPAVSAEYPTQAPAYGRADPSYGGAAVTYDAVNYPS
FT                   IPDLIAHSQRHSSVSAPPSSGYGYGGAAAGGGTAGGSSNARVGGKPREMAGAPRGSNRY
FT                   RCMLFPTCDGGDIESVVCQVGLDGIALFEEDGDRVGERVDGHGYELDKISSWRLADPTI
FT                   LTVKVAGRDGVSALSLSADEATCGAMMDTLVTSAFQWCELRGHDASGTIEDKNGEWFNN
FT                   KALASAGGSSAMNASSSVPSAAAAAAAATIAWHDRPEYCGWLTKKGEHLSNWRRRWFVL
FT                   KDKKLGWFKDVSQANRPGTKPRGVIDLSKVISACTATLGDAGRAHGVELIGSVEAEKAG
FT                   CKFLCADSERECDGWAAKLAEVCNDSGGGGDSAPSGASPHPTHSAPTSRLASQLDQGYQ
FT                   SSVANAAASSATSRGRPFDPDINVSVTDYASGAGGGATTTPSFASDPYLQLGGGNTNGA
FT                   WDTYYTNEGVAYYVNSQTGVTQWEKPNP"
FT   CDS_pept        complement(100135..101082)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635734"
FT                   /orf_name="MICPUN_109104"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amidines"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66362.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016813"
FT                   /db_xref="InterPro:IPR003198"
FT                   /db_xref="UniParc:UPI000199BEF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH2"
FT                   /transl_table=1
FT                   /translation="MAPTPTCVLLTRGVSPGFAAAQRTEDDGGAPLSASAASAEHEKLV
FT                   DKLRPHAGRVVSIDADDKHPDCVFVEDCVVALPSRGFFACNPHVTRRGEVAAVVGAAMG
FT                   VSWPDVGPMFLRGLASERDGERIEGGDVLYVSGGRDTAHHYLVGVGNRSNAAGADALRT
FT                   ALRKCAVAAGALYEPMEESTLFLVHEVDLSGTGWLHLKSALTWAPNVGFVASDPACPVL
FT                   ERALACLDGCEDTAVNRIRDPAVIVPKHCPNVLALPGDVIFTHPNASEAIRARGAERGV
FT                   VVVDAEQPELARADGALTCCAVVLDPDFRWGPNY"
FT   CDS_pept        101239..102564
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635735"
FT                   /orf_name="MICPUN_62271"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66058.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="UniParc:UPI000199BEF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH3"
FT                   /transl_table=1
FT                   /translation="MRAYGDPESPRRGASPTDGDYLTGVASAPASSSSVPRAAPVDELS
FT                   GGWNVTKTAMLATHLALSIAHVFAVFASRSEGGAGGGESDAGADAKDPASSSSYEYSPA
FT                   VVVLLAEMIKWCFSAFMFARECRADAGDFWLTRVKDEVVEATRDYRALRFAVPAAVYLA
FT                   ENHIRFLVLKQLATPITWVVFAHVEIPVVAIMSWWLLRRPIARTQWLAIFFLLDGVMSS
FT                   EIALCHSKNGGDVESCEGADAYPIGALAMVLLCSVLAAFAGIATEHTYKGEYHVSIHLQ
FT                   NAQLYAFGVLGNFLLATARDWDRVRGGDALKGFGFGAWAVVITLAAFGLVTSVVVKHLS
FT                   NIAKVFNSAFGIVVTAALSWMFLGVKLSMPFALSAGVVVGSLYLFYGGDLGTDGRGARG
FT                   GSVLGPGSGGAGVLQRLRAGVGGMAGGRNKRTNGDEEARHLI"
FT   CDS_pept        complement(102641..103129)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635736"
FT                   /orf_name="MICPUN_62272"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66363.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BEFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH4"
FT                   /transl_table=1
FT                   /translation="MPRRVTSLAAPHASLAALCFLALAAIALPSALALECDEAMTGFHD
FT                   NDIKSQAWQDIAHANVQAVRDAVADDPCYAMMRAGDGRGPLFWAHEFYNQEIIDVLVHH
FT                   GADRAARDRGGKRPDQMIRAPPMTFEAPPADDEEEYEYGADDDDDDVYVTKSSSHDEM"
FT   CDS_pept        join(103325..103366,103516..104430)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635737"
FT                   /orf_name="MICPUN_62273"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66059.1"
FT                   /db_xref="UniParc:UPI000199BEFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH5"
FT                   /transl_table=1
FT                   /translation="MVSDPPLREMGLKKLEAYRRAKERRAEEAIRRARERRAGAPVPFE
FT                   EPAANDRAPRRVPTADSGASSGWRRASPSSRRGRDRACERTVADISSLRAFTGLLDAAA
FT                   DDDDEDVRVDASRGLPEREPRRAQRVRGTDAESTENDRLSSENARLREEVARLEGMVDA
FT                   LMMLVDRHGIDASGTGQTKEDAGAESGGNSESGDSESGDDEEDDEAPPIGDCDSMLEHW
FT                   LRNHCVPAAAERLSGEREGTPVSAATRTGGGEENGDEHTERALADSPFEYHARDERDDE
FT                   REGEARKMPEEFAKGKVTAKKEEVLTPEAPTLVKTFS"
FT   CDS_pept        104508..105545
FT                   /codon_start=1
FT                   /gene_family="HOG000275915" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635738"
FT                   /orf_name="MICPUN_62274"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO66060.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199BEFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH6"
FT                   /transl_table=1
FT                   /translation="MRACLARPTVAAAAGPSRPHRSDYSRRRLRSIARVPSRASTPARD
FT                   ATTAADDAPGPASSPRAPVVIHEDDDVLVIDKPAGMSFHNDDLVTNLPGVLSTVRALQA
FT                   KGELRGSDYAGELHSVHRLDKITSGILLLAKNERVASWLARQFARRRVHKYYVALSARK
FT                   PSKKMGTVRGDMAQARRGTYKLTRCSSNSTPAAVTKFVSRGVRGASPGGDRPLRVLLMR
FT                   PLTGKTHQLRVCAKSLGAPVLGDAAYGGADTNKNANKNDGAGGEDRGYLHAAALRVAMP
FT                   GGNVMEVVCKPTEGREWTHASAGFHDAWTSFGFDELIGADEWFGGSVGSGLLASRRAEL
FT                   FEDED"
FT   CDS_pept        105703..106074
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635739"
FT                   /orf_name="MICPUN_62275"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66061.1"
FT                   /db_xref="UniParc:UPI000199BEFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH7"
FT                   /transl_table=1
FT                   /translation="MGGEETATRTIEDVQSEDAAFRAAEATAPPMDPAEEGAALKGMLS
FT                   DAGTCDRCGRVAAARWGACASVADAARAMGDEELGVKIGRVVEDLDAAHLRPTSIRKRL
FT                   DDGVDAACHGVVTLLTNLK"
FT   CDS_pept        join(complement(107577..107637),complement(106153..107456))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635740"
FT                   /orf_name="MICPUN_62276"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66364.1"
FT                   /db_xref="UniParc:UPI000199BEFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH8"
FT                   /transl_table=1
FT                   /translation="MAPEEYSRSSIYSLATGQGSDERASRGSEVIRSALPSPISHMEQA
FT                   AVGRRLPIPQVDADRHPFLDGDDAYHPAVRPSVTKKTPQSFHMESAPDEWRPSIAPMPP
FT                   TSANAAGVTDARRSYKAAHELGSQLAHPENIPEDDKEFDPDARRHKTWTPHSHMLTVGR
FT                   VPYGGKTKDTRASVFPTQDDPEEADCFGRAKSLHGKPSGKARPAGPTQHEATHFSFVAE
FT                   GTTLVDDDPGAANDSTTYSPDAYRRQKGAHAKYAWADNNRPATANPNFLIADRPEKPLG
FT                   LGNMRGRGGITPHPDSMSIEKGTSIVGSEWGAPVDVTTEPVTLNPKGSPAKGVRYHDPW
FT                   GHSVESEGVIAYKHSRGAGALTPKTDDYRLVDPRAEEREKHEAAIMEATARRTEELMVD
FT                   MKGMCQNDAVLAANRERARGSSGVLGGYLYEVRPPKVTLPPTDPNSVAAALVRDR"
FT   CDS_pept        108730..109020
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635741"
FT                   /orf_name="MICPUN_86154"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO66062.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199BEFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDH9"
FT                   /transl_table=1
FT                   /translation="MRYRRAYLSNVCVLPVARRTGLGRRLMNRAMRVAKGWGVERLYVH
FT                   VVADNVGARKFYEDLGFVVEAEESATFAAGLNRPRRLLLTQPVRDVPESEC"
FT   CDS_pept        complement(109239..110225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635742"
FT                   /orf_name="MICPUN_109105"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66365.1"
FT                   /db_xref="UniParc:UPI000199BF00"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI0"
FT                   /transl_table=1
FT                   /translation="MRISRRRSEGGDEFRGGVPGSSGVWGGGAARRRSPSPGPARQTGV
FT                   NPAVGGGGGGGGGGRGGEAGGVHVRRGSSEGVHPGGGSPRASSAFASARPFKFAGESGL
FT                   GSGLGVSPPRSTPPVAPGVGGGSEDDRELILLSLESRASTPDPILLPAADAPSSYPASE
FT                   GTAGDDRPYGTEDDDDDVLEQSAIIASQLAGADTDTDEEEDGDDEERQVLGSGTDDDDD
FT                   ATFDETSERGSGLGGTSSSGGEDDVDDELKDFGFTNVATLAQENLRRLSISQSRGQSAA
FT                   PTPRTSIAAPRVSVRGPRLSQVVHSLRMHQEHGEGDEGEDATTEGRG"
FT   CDS_pept        join(complement(111805..>112313),
FT                   complement(111181..111354),complement(<110958..111114))
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635743"
FT                   /orf_name="MICPUN_69531"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO66366.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199BF01"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI1"
FT                   /transl_table=1
FT                   /translation="DFEVLKLISSGAYGKVYLCRKHTTGDMYAIKIMRKRDLLYKNMTS
FT                   QAMAERDALIHTDNPFIIKLFYSFASHRHLYMVTEYANGGDLYSLLQNLGRLGEDHARQ
FT                   YAAEIILALDYCHERGIIHRDVKPDNLLIAANGHIKLTDFGLSNIGISRDQRHHGGGSG
FT                   ENSEAGGKGTPDYLAPEVLLCEPYGPEVDWWALGVVVFELLVGVPPFHASTPVEIFENI
FT                   LSGNIADEEEDDGLSAAAKDLIKGLLHPDASQRLGSRPGAADLKAHPFFAGIDWDKMF"
FT   CDS_pept        complement(115638..117914)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635744"
FT                   /orf_name="MICPUN_62279"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO66367.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000199BF02"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI2"
FT                   /transl_table=1
FT                   /translation="MPAASAPACIVVTGIQGCGKTTMVNAFVESLLPDSARDPRALEAT
FT                   TTTDVLETCRLEGPPRARGSPAARVAGFAPSHEQISAQERDAMVADPRGRAAAARLARG
FT                   VLPVGLTTRVTTRVVAAPRDAAFAARVSVTYAAEAEIHSLLQRARLAHGQSRGPPLSVN
FT                   DEDAEATDADASSESSAESSSSGAPRVAPTASLTTRDLHRVAAVLGVRPRDVPTALRDG
FT                   SKPYLPTRFVALLGRTRVCEFFATNKQTERPAKKRKRGRPRKNEERGGGETRDVETSTD
FT                   LTPAVVDAVRAYLCRVAHGDWSRWGTIAGDVVVELPMTTKAGIEIAVYDVPGAPRTGSP
FT                   WQNAHSRAHLVRTLGSRPLDALVSVCDGSFGPSRELRGAMRESGALDTMVSDDGGGVLV
FT                   LAWPLDKIASHDPSVTLDPNAYAAMQTKLAERGQVSDAGDDDSASDHNRDTHDEDDEDS
FT                   DDSDDSDDVDSGLDSGTARRPRLLSRGGCDESWTRCLARAAGRNGGVVRGAMSSQPVHT
FT                   FFGAVEPEASCGSGSSTPKRGGRAFRDSFASLAGYLVERAGDALERRRRSCDEGDEDED
FT                   DDDERRRSKAKAKAKAAVIDVARGNGTGIDDAENPSAPRAPPPPPPSLPAPPPPATAAS
FT                   RLTAREPLRDVSAERGRNAECSLKPPVLLKPRRGASGARRMGPLEAAARRAGGTAAGRG
FT                   AQAPSERRVRFTSGVLGGTSADDGGGEEVGKEVAVAKDERAGNRPRQDLFSRDARVVPW
FT                   WERKL"
FT   CDS_pept        118091..119062
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635745"
FT                   /gene_name="CNX1G"
FT                   /orf_name="MICPUN_62280"
FT                   /product="DUF1244/molybdenum cofactor synthesis fusion
FT                   protein"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="ACO66063.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR009654"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="UniParc:UPI000199BF03"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI3"
FT                   /transl_table=1
FT                   /translation="MASTRTEIEAYAFRQLVAHLQARTDSQNIDMMNLAGFCRNCLSKW
FT                   YLKGARVQGDAHMTYDEALEIVYGEPYGDWKKKHQSKATDEQMAAFEGNKHLHAKHEKD
FT                   LLDPPAPRPEGAAPPPKPSPTVLSDVCCTPADECAPPGAAASAAAPGSFQGGPVAIRLG
FT                   ILTVSDRASNGEYADESGPAVFEAVARMAAENPRGLKLDLAATSRRVVPDDKARIASAI
FT                   AEMTATGCNLVLTTGGTGCAPRDVTPEATASVLHKLAPGIVHAMTSQALAHEPHAALSR
FT                   GIAGIRDRCMVINLPGRPRAAADNASALAPVLVHALRQVSGD"
FT   CDS_pept        complement(119189..120403)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635746"
FT                   /orf_name="MICPUN_109106"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66368.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000199BF04"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI4"
FT                   /transl_table=1
FT                   /translation="MDPSDIDPVLKDLGPLLSSPRGGTAVPGHNLISRSVAPAPGQLGR
FT                   MPSVPADAGAFFDENDLANLDGVLDFDVPGGGAGAGLGQSGNFGGPNSGIYNSGYIMDV
FT                   DRANTTGDADHAGGLNTSSEDLDFYGSDHGDDHGGGSGTKGGKGKKGHGRRHSGESFEI
FT                   GSSGLDQVDVSDLDPKDPKYRRRIQNRMASARFRAKAKERQQELDRLKSQVTQLRREKA
FT                   DLEAQCRNLNVMIESAAEQHRTSTMAWIVDHFWLRRKVHFKTLANSVRWMVRGQYRKGM
FT                   TDAVLRAKLAAEGIVREEESSHARDDEPNDDSDVSMDDAGYDKNRPGERLRYDTNRHEA
FT                   RDPRGQTLGEMMSGGAGDGPDGPTLSPGTSWKLWATLQKLGSFGRSKPPVDPDTGEPIN
FT                   RPYTR"
FT   CDS_pept        120981..123233
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635747"
FT                   /orf_name="MICPUN_62282"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO66064.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG608174"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199BF05"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI5"
FT                   /transl_table=1
FT                   /translation="MAGPRRRFTRRVLPALLIIAILGLGSRVGGGGDGGGAGAGDASAR
FT                   EDLTRLDEDRISVGTTTPSSPRVRAGLGDRTAIVDGTDPSPPSIPPRAASKPPPPARKE
FT                   SAGRAWNLGTTTKSKTTKSKSTELVAGIAALEVDHSTHAADDEAARAIANAGKQTSGYA
FT                   DALDTSKIVFATFVSNGFHEFMLNWFEHTKRLGVDNVIVAALDAETEALCVARGIPYHS
FT                   DKDLRYTFEVMATGGQPLHDPNAKVTMEGKAFQQIGALKAAFLLFLLNRGHRVLVSDVD
FT                   TVWLDDPREWFERDDLPTRTDVSVSTDCLSHEEERRSRGCWGPGFNTGILWLRPTEATI
FT                   NLMATWRDALLTTSDKFEHDQDIFNKLLRVEQDGSPASFAAVDPPLGVRSTDSSFAEAD
FT                   GDGRVGEALHMRRVARGIVLGALPLARFCSGHTYFVQRLPQRLGVKPLVVHTTYQFSQA
FT                   RGKRQRLREAGLWLLDDDAYFGKGPGFTKKGFIAMLPDDQPPAELLRDGAGVEKHLAAA
FT                   AWYRLAIRNLVAAADATSRVPVLPRITCVCDRWWGNVLPSCKIPGSDVSPPFGTCPQDH
FT                   IMNLPNMERAGVEWREWSFLDRVGNGSAALARLGGGAEGGADTIGGSFARVVDLPAYPT
FT                   DAEWAKATAELDETIVFVSSGVSSFCTFSDPTEAAAFDRKMAVALQAESHFCESVVDVG
FT                   GEGKPRRACHVGFDVPRGVATDRDCEAMRAKNGDSNAFEARFDRRSPVGGEKRAPA"
FT   CDS_pept        complement(124179..125288)
FT                   /codon_start=1
FT                   /gene_family="HOG000294680" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635748"
FT                   /orf_name="MICPUN_86593"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66369.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BF06"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI6"
FT                   /transl_table=1
FT                   /translation="MTTTTRTIWRVNKTGALSGLERVDGDELAPPGPGEIRVKVKAIGL
FT                   NFADVFSVLGLYGATPDCPFVPGLECCGIVEAIGESDPSLPEGAVVPTVAVGDSVMVVT
FT                   RFGAYASAVNAPLHQCRPLPSGWTHEQGAAFLVQGLTAFYALRALGDVKKGQTVLVHSA
FT                   AGGCGLFGLGICNALGATPIATVGSQTKVTAVLERFPDMDPDTIIVRDRRRFREQVAAA
FT                   AAAAGSERGTCDVVMDAVMGDFFEGGWANLARGGRYVVYGAADLTPAGDLAWFNVLGWV
FT                   KLGWKYLWRPRVDPTNLPGENKSVMGFNLIWMFDKIVELGGLLTDLDALRLPAPKVGES
FT                   FDFDRLPDAIRTFQSGGTSGKVVVTLPED"
FT   CDS_pept        complement(125596..127140)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635749"
FT                   /orf_name="MICPUN_62284"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="double-stranded RNA binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66370.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI000199BF93"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI7"
FT                   /transl_table=1
FT                   /translation="MATAATVRGTKRAAPSQSPGDEDEVDARCGVHPRGRAPGEIRRSF
FT                   AADAASAAQPEEPSTSSSPYVQPANIHVAYTSKQIDAYVRAEFYPNDEEGDSSSDGGGG
FT                   IRLVGLDVEARPSRVKGVTHPVALVQVTTPDNRGCLLAHVYGAMGLSPPTPNRPYVPGS
FT                   AVTKFPPLLARLLHDPNVLPVGQGVAEDLRQIARCFPEVTNPGVPKGGAEPGCRRGAFV
FT                   DLASIVDFYDVPASGLGRLAQHCGFSDVSKPKSVQVSDWSRTPLTDAQVRYAAQDACLS
FT                   LWVLERLFAIYAPPGVNLHTWASAFAGCETRKDVASRCKRLDGVIDVTMRAHMRARLER
FT                   WRDEEGDANYVKAFRKCSLALARHDAGVDAGERGVNARSTLAQLAQFLNVRIRFDHARD
FT                   RNPDGGLKGGPNGGATATCILDDGETIGRGRGVNKKRAIMEAARDALRHLRATKDGEWW
FT                   CESLVKTLRGHEDAADLMRATGGVAGGLEWACGHGDGGGCERARSGVAAYVPRNAA"
FT   CDS_pept        127551..128963
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635750"
FT                   /orf_name="MICPUN_62285"
FT                   /product="Knox-like protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66065.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR005539"
FT                   /db_xref="InterPro:IPR005540"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199BF94"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI8"
FT                   /transl_table=1
FT                   /translation="MTRPDPSPVLARRPPPDAPHVALPRTPFADDEDGDDIDGEGFAFS
FT                   LPDIDALIAGPLPSLGPDDLTFIATIDDLDKLPTATPASSAPPTSPGGMLSSPRSSFPP
FT                   GAFSFATSSRAGCPDGAAERAGLAPWVPRWSVDESVHPGRPTGGVPPPAAAARPPPDAQ
FT                   GVLDDERGAMRAAVRANPRYPKLLDAYFACRRVGADATSKASLARRRRQLLREATEVSC
FT                   GTMRAALDACVRRYGAELDEFMDNVTDELTAYAEELGACFDEVDAACREAEARVAATAA
FT                   KKLNALNVSAKTSRPVSTAAKKSVKVEPNAERESDSDTGGSDEDEASAWVRRRRRKAAK
FT                   ESKIPDTREDDLRKSLKRKYASSILALKDEFLKKTKKGKLPSSATKTLKEWWLANLLWP
FT                   YPSEDAKRALMKLAGLNQTQINNWFINQRKRHWHRLFDRDEAQPISETEARHMILEKYG
FT                   NVEAFLEVARAA"
FT   CDS_pept        complement(129021..131381)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635751"
FT                   /orf_name="MICPUN_62286"
FT                   /product="Ca2+:Cation antiporter family "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66371.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG609412"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI000199BF95"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDI9"
FT                   /transl_table=1
FT                   /translation="MWANPRRRWAAFALALAVMAAAGVGTDAAVGIGPEKRNNARAHVF
FT                   GTQGAGTGPLQAPNETAPPPGSPPAPLPPMPPMPPMPPMPPMPPMPPMPPSPDAPDAPP
FT                   EPSAPSPPERAPPSPPNPDAPVAPPPTPPPHQANSSSWPTRCSPRRVAPEDRCEFVKTT
FT                   PACVSEHRLVPYLTMHYCWTGGGASSAAAQALVIASLFYVLATVAERFFCPALENIASA
FT                   LRIPEDVAGATLLSFGNGAPDCFAQIAALSRDDADAVREGVSLALGANLGAGIFISAAV
FT                   FPIVVLVTPSRFARHRRPIDDDDVLDDDDDADPVVPDATGGTSGGIWSRFDAWTRRGGV
FT                   EVERPAFVRDVCFYALAVAGVVLSLTRGRRVTRTEALALVGVYLVYLGVLLIPSRLARL
FT                   VAHVTNRGAESDELEWENAHSERLTAGLLDEDDEIDDYAALIEDGAPGLLARSSDGGGG
FT                   TDASADDRRYPGGRGSSGVGNVGPEPSTAAEEDGESAAAVAAGGSSHHAMNASFLSDGG
FT                   SAVKRGIRKVTSVLTTAAEAPVVTLIRCTMPDLGSDPARRSRLLTSLLPVTAPLFFVFV
FT                   ERFLGVNSLITPAGAAYGAVCGLMGSASLYIAWPHVKYSRVMNGILTVVAFVISVTWMD
FT                   GTAGELVALLTALGKIHGVSETLLGATVLAWGNSVGDIVADITVAKEGHPAMAIAACFA
FT                   GPLFNLLMGLSAGLAIATEEHGTIAGIHLENELVVLAGALLVSLSFQAIATPLMHKWRY
FT                   SRGMAIASLSYYLVFSVVYALISVGVLFPGDWY"
FT   CDS_pept        join(131556..131850,131955..132643)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635752"
FT                   /orf_name="MICPUN_62287"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66066.1"
FT                   /db_xref="InterPro:IPR013861"
FT                   /db_xref="UniParc:UPI000199BF96"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ0"
FT                   /transl_table=1
FT                   /translation="MSEIEPILNPPAAPAAAADGATRIGAFIERIKVPQATRATVAILI
FT                   AMFLCGAASPEFVAHVALVPGRTIPYMWNVFTASWLEVNPLGLIVSCAAAVLAGRIVEP
FT                   AMGAKEYCRFLAVCTACVGCAAFVSMLFVYYGRRDEKLLYEPFCGFHGVVASLLVAVRQ
FT                   LMPDAPVNFRGLRTFKCRHLPAIHLGAMTLLAAATGRHLEKFGFTFFGGYASWVYLRYY
FT                   QPRPDGQVGDPDSEHMEFVSFFPAHAAAVLGPFADGAHACCCGRRVARSIERRQLHDGL
FT                   STDKPGVTTRDAEEARRRRERGAKALAERLAEKQRQREAAAAAEAV"
FT   CDS_pept        join(complement(132817..133532),complement(132737..132758))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635753"
FT                   /orf_name="MICPUN_62288"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO66372.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199BF97"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ1"
FT                   /transl_table=1
FT                   /translation="MVDPSKMTVAQLKEELDARGLSTTGKKEELKERLIEALDANEEED
FT                   EEEEEDIGPHYKEWDDKKAEVCARLGMPRQSPCLIIRSYGEDRSDSEDESPPTADEVAK
FT                   IRVILGTDARMKATDRAMKFAQGQSPGGYGSDSDVMDSDDDYDEGFFCFTTANSNAVVM
FT                   GLEAQINKATDAKKPKSTQFDELSMLTYAIHYNNMWFNDNEFWEEGDLVESSCEKLAAA
FT                   WKKLLAHSDEELGIDPEIRGVSG"
FT   CDS_pept        133910..134395
FT                   /codon_start=1
FT                   /gene_family="HOG000100117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635754"
FT                   /orf_name="MICPUN_109108"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66067.1"
FT                   /db_xref="HOGENOM:HBG557739"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199BF98"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ2"
FT                   /transl_table=1
FT                   /translation="MVAEFSSPSVPEITAKALMAQMRDAGTGNPKPYVLVDVRTADERV
FT                   VSAIPGSISSLEYESDFDAKYRHERVVAYCTIGYRSGKYVEKLIRERGVDAYNLRGSVL
FT                   AWTHAAGELAEDGGSGAPTKRVHTFGKKWALAAGGYESVWFNVPVVSYVKNLLFRRR"
FT   CDS_pept        join(complement(134906..135001),complement(134513..134851))
FT                   /codon_start=1
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635755"
FT                   /orf_name="MICPUN_86311"
FT                   /product="Predicted protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66373.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG557740"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000199BF99"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ3"
FT                   /transl_table=1
FT                   /translation="MVGLATFMIVSREDVPLYEADLGKGIEASSSAAQKRDDAAHLHQF
FT                   VMHAAQDFVEERMWETNGMYLKLVDRFNDLYTYAWVTAGGCRFLLLHDARNEENVRSFF
FT                   DEVHQLYLRVALNPFHTPRTPIENEVFDRRVRQAARRHFP"
FT   CDS_pept        join(135342..135698,135957..138680,138960..140846,
FT                   140934..141434)
FT                   /codon_start=1
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635756"
FT                   /orf_name="MICPUN_86297"
FT                   /product="Predicted protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66068.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG413465"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BF9A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ4"
FT                   /transl_table=1
FT                   /translation="MLAAANSKRHAELITRLKELVKGLDEGRFVASAPADADAAGAEIS
FT                   AEDVGDAELPATLTDDQVEEILAPLRLAMESKSPKVIRAALAALQRLIAHGMLSGDADL
FT                   RDEDAGGADASSAPAAVALICAGAEIVDERCELECLKGLLAAVSSRSFRVHGRALLRVV
FT                   RTCYNVHLGSKSEVNQATAKASLTQMLTVVFHRLETDDPSTLPPPIVVADLLGKNDLAT
FT                   HTKSATSDDSFENLAGYVQGLLNKAIADTNASIAGIAVAVGAVEPDDGCVDETRGKNEV
FT                   TSREFDEESEPATPKSNVSVRSGSVTPRHSVGEGTDRSRAVLSARKTLENDAFLVFRAL
FT                   CKLAKKAGDLTVPAVLRGKTLSLELLKILLANAGPVFASTRRFVDATKEYVCDAVVTNA
FT                   APGVPVAYQLSLSIFLTLLEKFRSALKPEIGYFYPLLMLKPLEVVIGAPLAPYTQRQIL
FT                   LQCHRKLCGDAQLLVDLFVNYDCDLDSSNLFERTVNSVVRVAQGLPGVAEQTGQELARE
FT                   SMLAADALGCITKLLETLGGWVDDKLGVGAAADAAAKARKLAASRTEEGEDDGEEANPG
FT                   GGNESAVVGIERAKASKAEYQRAIALFNKKPKKGVALMQKIGRLGETPEEIAAFLRHTP
FT                   DLDKTVIGDYLGERDEPMLSVMHAYVDAMDFTDQTLDEGIRKFLEGFRLPGESQKIDRL
FT                   MEKFAERFCKQNPGEYKSADTAYVLAFSVIMLNTDAHNPQVKNKMTKEGFLRNNRGIDD
FT                   GADLPKEHLENLYDRIVNNEIRMKDEDPELLAQKAEMNAKDGASSFNRTMKDMSNRLGM
FT                   DVLSQMMFGATKREQMVDASGFMEEVRERAKRDNGRFQTATDPSCVRPMLDVAWPAMLA
FT                   VFSMSFEVSEAPATVDAALAGFSRMIHLTCVTGMTETRDAFVLPLANLTSLHSPGALRG
FT                   KNVVAMRELLKVGMDNANTLGGAWTHCLKAVSRYDRLYNYAMGFDDVSLFTDEMSNGDR
FT                   GGEGLGGGDGGGKRGGASRLFRKSGKGLGSGGRFGSPAFEPPPKEILEALTPDDASVVF
FT                   GSTDQLDSEAVIEFVRALCEVAREELGARSPRVFSLAKLVEIAVMNMSIRPRIIWSRMW
FT                   SVLADFFAEVGCHSNLRIAQYVVDSLRQLAMKFLERGELANYSFQNEFLRPFVVLMRQS
FT                   DAPEIRELIIRCTSQMVSGHVDNVKSGWKSMFMIFTAAANDEERAVVQLAFETIERIIR
FT                   DQFEHITETDATTFTDCVNCLIAFTNSPTAPEEVCLNAIAFLRFCALKLADGSLGKLEL
FT                   AQLGDDAADDTDGAFNTPPGSPDHRDSSRSPKKPRERERGATDFTDAELDLSYWFPLLA
FT                   GLSELTFDARRDIRRSALEVLFDILKFHGDHFSPGFWARVYESILMPVFDHVRAEVCDA
FT                   DVQTASPFVQQSPHSPPSAGKPPAHPRHKPPPWDRNAEADAWLYQTCQHCLELVVDLTA
FT                   QFYPAVTQSPDILPKFLALLSGLAVKNHEALAACGIGALSRLLLGAGHRFDENAWTIAI
FT                   DALADAMNKTAPDAKGLVKENASGDMVPSASNGVKVEMTAEMEAAVVLGTHPSAWLRAS
FT                   GTCACHASTQRLLVSAAAEAYFRHGRRMSAGRLETLTSALERCAAHAADVNGDGELCGR
FT                   LARATAAAAMAVAERPSLPDPPLVALEVEASQAALAVLLHLHTAGEEPGSASGGTKGVG
FT                   DDASQSDAQAAAAAASRHRLAGLAMRILRDFARLASGEGGEAHVVAQARDEINARAPLA
FT                   VDALKALARFSDDLFAEKVGEAFPALTALVRCEHAPAEVSRVLGEVFTAKIGPLVIGSL
FT                   GKSRRRG"
FT   CDS_pept        join(complement(142369..142793),complement(141865..141904))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635757"
FT                   /orf_name="MICPUN_106215"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66374.1"
FT                   /db_xref="UniParc:UPI000199BF9B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ5"
FT                   /transl_table=1
FT                   /translation="MLATQGDSGESYWDGTAMRRVGSVPALRVIGFEASEHIQGLRVHS
FT                   NTSPPLVSSPLARLLSLPADSKGGDGRDWSGYSSRSSGDSGNDTLSRSLSNDHIMSTTS
FT                   STNSDQGNSEEDLELHMFTAPTAPMDIPFARGHRHFRRNNISREKQPRRV"
FT   CDS_pept        join(complement(145357..145634),complement(144288..145266))
FT                   /codon_start=1
FT                   /gene_family="HOG000005911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635758"
FT                   /orf_name="MICPUN_86589"
FT                   /product="Predicted protein"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO66375.1"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG704164"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199BF9C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ6"
FT                   /transl_table=1
FT                   /translation="MKRFFQPAVPDPSKRAKGSGDDPTGLGGTAKGLGDNDKRSDPRSF
FT                   VTWNANSLLGRLRKQPDKDALFEYLREKDLPDVICVQETWLPAAAPNRRGTLKDDTKAA
FT                   REDAALIHLCLRQKPLSAYRPYWSCADVKRAGCAVLVKKDVDVVSVRRSLTASNGANGD
FT                   VAHDEGRVLLLEFRSFVLLNTYAQNNGWTQESFAKRRRWDAEVHAFIAGNTAGATPRPR
FT                   FDDSDLNATSRRFKPLMWTGDLNVCHKEIDVTHPRFFATQKPEGRKGKPPPETPTDPGD
FT                   CGQPGFTRNERTRFERLVTAHALVDAYRRQRGDVKDAMTWMGHPGVVAVGKYRGMGMRL
FT                   DYFFVETELANRVEVCEQATDGMGLAAMAERPASAFFGSDHCAVYLRLKDVPLDGAHDG
FT                   GDGSGKSDGEGATTPTVGT"
FT   CDS_pept        <146054..>146638
FT                   /codon_start=1
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635759"
FT                   /orf_name="MICPUN_70678"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66069.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000199BF9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ7"
FT                   /transl_table=1
FT                   /translation="DAFLSSISMILVSELGDETFIIAAIMAMRHPRVIILAGALGALAV
FT                   MTVLSTALGLIVPNLISQNVVNKCAFVLYTFFGCRLLYIAWRADPNASIQEEMQEVEEK
FT                   LEAGAGGQGRMMGRVRRILGRVCTPIFLEAFVLTFLAEWGDRSQITTIALAAHKNPYGV
FT                   AIGGTIGHAFCTGLAVVGGRIIALRISQRLVA"
FT   CDS_pept        complement(147004..147726)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635760"
FT                   /orf_name="MICPUN_62296"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66376.1"
FT                   /db_xref="HOGENOM:HBG557743"
FT                   /db_xref="UniParc:UPI000199BF9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ8"
FT                   /transl_table=1
FT                   /translation="MSAAALTITAPAITARAVRGTGARAPSRGSAVVRRATMKGAPDTA
FT                   LSSANQITDDDVSSWEEIDRQIFNMCAKYAGDSSVNPRIMAATELGRDKTYEALDDITV
FT                   VEVYQAAYDGGLDECTTIIDTHLRMLAECIIQDDVELVRAVYDKFRRLPPLLQKSSLIA
FT                   TAAVAEAGLLFVREEYELVEAMLRDEVGGDDASEEAKMEYDKSKVIIDVMDRVIAVMHE
FT                   EKGEVNGEIVSSMPSVAK"
FT   CDS_pept        join(complement(149011..149181),complement(147878..148921))
FT                   /codon_start=1
FT                   /gene_family="HOG000255249" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635761"
FT                   /orf_name="MICPUN_62297"
FT                   /product="Predicted protein"
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="ACO66377.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG526211"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BF9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDJ9"
FT                   /transl_table=1
FT                   /translation="MVRQTRRQRPVCACGRLHEGQEGLCGLVSQASSVVPTDIAVARSS
FT                   LTMAPSYPPVPKNCTVTGGMGFVGRRLVEMLVERGATRVVAFDIAPKPEDAGDDPRIVW
FT                   MQGDLTNPRDVDKACEGSECVWHIAALVGPYHALDMYMKVNYQGTVNVIDACKKHGVKK
FT                   IVMSSSPSTRFDGNDINGLKETELKIPRKFLQAYAESKCKGEEACMAACDGENLLTVAV
FT                   APHQVYGPRDMLFLHNFLLNAKRLRVFGDGENLVSVCYVDNYCHGLILGERALYPGSPA
FT                   LRNFYICTDGKPVKLWPFIDRALMDVLGQPSLFTKFKLPGWSFMYPLGYCVESIGALLG
FT                   KKFKLTTFSVRMLLINRWFDPSLSKRDLGYEPIVEPEEAWRRTVTWFKEEWMPVHGPQP
FT                   EFQSF"
FT   CDS_pept        join(149301..149351,149513..149689)
FT                   /codon_start=1
FT                   /gene_family="HOG000217518" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635762"
FT                   /orf_name="MICPUN_62298"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66070.1"
FT                   /db_xref="HOGENOM:HBG527247"
FT                   /db_xref="InterPro:IPR009643"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="UniParc:UPI000199BFA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK0"
FT                   /transl_table=1
FT                   /translation="MSNQGEGPQSTADLTAFVQNLLTQMQSRFQQMSDSIINRIDEMGE
FT                   RIDDLERSVQDLVSQAEEGDGENKGAVSKQ"
FT   CDS_pept        complement(149744..151462)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635763"
FT                   /orf_name="MICPUN_62299"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66378.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C045"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK1"
FT                   /transl_table=1
FT                   /translation="MARRKPPAPNVKKFGAPLYASAWIDDRVALVAGGGGKKSSGIPNR
FT                   VMQASFDSVELTEPLASVHTDETAPQVLCAHPYGAELLVAFSGDVAVYVVTANDASTQL
FT                   AETEESDAPPPEASAPYRISPRDLDDASGTATRVTLATCDVKCAAFSPDGASLAVGLES
FT                   GEVRLFAWPTLEPSEVRLDGSHADAVNGVAFSPDGTQLLSTSSETVKDGRGPIVWNVST
FT                   GAKVATLVDEGREKAAGKARFGRQYRFCGFTPCGAFALTGLNDGGEGHVCKWACDTWKP
FT                   LGTARRVTREPLSAMAFDPTGRTVACGNSEGHVLIVDVKTLAIKKTIRGAHMIFVTTMA
FT                   YSPDGSTVLSGSADASACCTVVSRKRTGAGGTNGGAWNDVAEKAYALLVAAVLAWLFFT
FT                   VGRLAARLQTAAIGPDANGGAGGDVERIDMLAGLKYGDIKRLAADVRRRREAGGDSPGG
FT                   DASAPAVNDESHKPTPDDTERLFADEDPTPYECVDGENIRCEDVLTEPEAWEMRVKKKG
FT                   AGGDDDGQTHTKPKSREDARAATFEAVPSEAMETGDGRVPSLGAPGWGDRTRDEL"
FT   CDS_pept        151596..153845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635764"
FT                   /orf_name="MICPUN_62300"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66071.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199C046"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK2"
FT                   /transl_table=1
FT                   /translation="MPASDGAGTGPKRTQFAASDGKYRLARSWSHPNGPVPFNPAGGSK
FT                   VTVAKLPAPRGHHRPARYLVFNVNDTLLVYDYDEPSVAAEGAAKRSSFYGGYGGYGGYG
FT                   PSSKPAANPTPDDPNATKPADPIRTLQFPGTLVTCHAFREQGGGHQNQNDLLIGLANGE
FT                   VVLTSLRALVGERNPVHRPGSTSLDDDPTAPAGTGATSSATSSTTSSAKLPPGTLRFNT
FT                   DGGGGFGGSERARLESPANASRCNHVAWCGNGGVDRLGGFVTCHGDGNVYAYSVSRDAS
FT                   MDPWFPAIVGDPNAPSVTPGRSGVDGQTLANPFARWHLGAGPMSCASFSPDGQYLAVAG
FT                   GADGICRILDVTHWERPRLCGGFKSYYGGLRTVRWAGDGHYVLAGGESDLVEVWAVPEG
FT                   RYCAAWADGHASWVTCACEDAHVLDDADHDHDSDHDDDGDLNRGLNRVKSPGPVRMQQD
FT                   VSGTPVGGGANYDDLLVTDDRAETLRFGSVGQDCQLCLWDLPLEAPTGVDAGAGGDPTG
FT                   GVNIPGAPSTGTNDGFESDGAFEPPPPPPPPVPIPVLPAGTAPPNAGGGSSLLKSPSGM
FT                   IRSASKSMLSSMGSMGVSGGKSGLGKSSKAAQGGAADGGGGNVNGNGRAGVDSGAASAA
FT                   SSPTASSPAVSRRASLDAEAANEADAAAAGGAAGGAAGAEGADKSAGPSIHSYVGGLIC
FT                   APATRREVPETLAATASYKIHAEPCTDVVFTEEGVVTACAAGVVKLWIRPLHGEK"
FT   CDS_pept        join(154129..154162,154314..154441,154807..154992)
FT                   /codon_start=1
FT                   /gene_family="HOG000216922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635765"
FT                   /orf_name="MICPUN_86588"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66072.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG553083"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="UniParc:UPI000199C047"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK3"
FT                   /transl_table=1
FT                   /translation="MVQRVTYRRRHAYATRSNVIRKLKKPGGGLTVHYVKKKTKGPQTP
FT                   SGDHGRIHGVPRVAQVKYSSKHMAKNKKSVTRAYGGVLSAGAVRERITRAFLVEEQKIV
FT                   KKVLKMQAGKK"
FT   CDS_pept        join(complement(155616..156177),complement(155283..155476))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635766"
FT                   /orf_name="MICPUN_62302"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66379.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C048"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK4"
FT                   /transl_table=1
FT                   /translation="MEPEATEAPDPAPGEPGETQWLWCHDCRRHLAAGPDHDPDAPACP
FT                   SCRGAFVEYAEEYQPPDPARQAEEALRQHMAQIASQFSNILPGIQVSVGMGPDGAQGGQ
FT                   GAAGFGFVGGGQGGFRAPEAFMPMMQQLFQPGGAQVSAARLFEDFLNGIGQDINIAELD
FT                   TRTFHNPAPPEVVAALPKVPMPAPEHGESTACSICLADIAVGETCYELPCSHRFHGESC
FT                   ILEWLKTKDSCPVCRRKLTATEGNDAGTN"
FT   CDS_pept        156442..157296
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635767"
FT                   /orf_name="MICPUN_62303"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66073.1"
FT                   /db_xref="UniParc:UPI000199C049"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK5"
FT                   /transl_table=1
FT                   /translation="MAPMDRRRRRSTARQCAPDGGASPTRLDVDDILHSLMSSQVRRRL
FT                   LAAALEYAVEATMNEFPGANTDARGPPVAAAYLRGFLQKNLGANLHIDDHKQPPSPAHA
FT                   LLASLPPERPGGGEWTDDDVRRIADTLRALMLARLDLRIRALDLHGTRVLFRGRDTNLV
FT                   TSAAASWSHSGARRRRADAGTPPPPAIELREALAIGDEAFARRVAEAHGAWRAAATDAG
FT                   GGGGAGAGAREGEERPVLTAIDVLRTLRNLANPNPAAVAPTAVPCTYDRGFMDSRFADD
FT                   ALP"
FT   CDS_pept        complement(157432..158565)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635768"
FT                   /orf_name="MICPUN_62304"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66380.1"
FT                   /db_xref="UniParc:UPI000199C04A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK6"
FT                   /transl_table=1
FT                   /translation="MTVPSHAVGDVDDVDDRLDALRKRLARGSDVSVTVGTAGLEGRVS
FT                   PERLSRESSKELSVPPAASGPRDERPQRPRRAEPVDVMPSPTARSPRPSSPRSSTTAAT
FT                   HRRWNAHYDVNTTPALTSPGRGRERAAAYGSPARFGIVPISPAPSLGVLAGDGDGRGRS
FT                   IHDGRGDSTRHSTLRRHPRMGDDLFGEDNRAAGRFATSIGDDVATVTMTLRERDEIHAK
FT                   LVRLTGERDASRAECASLARNLTETTVELDRVRSRYADVAARLDAVAEDLATHRARVGA
FT                   RNGGGGGFGHPALAGATADARVAASELRAAVEDLIAESSIDDDDRVGRRRVAGVVRERT
FT                   RALIARAEDVAIAAMGELAAAASREATGGRRYKLPIY"
FT   CDS_pept        join(158716..158830,158996..159858)
FT                   /codon_start=1
FT                   /gene_family="HOG000265964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635769"
FT                   /orf_name="MICPUN_62305"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66074.1"
FT                   /db_xref="HOGENOM:HBG557749"
FT                   /db_xref="UniParc:UPI000199C04B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK7"
FT                   /transl_table=1
FT                   /translation="MSARAPTLAARPRPSAPGAGPRRRADVVAAVGYRPSSTPVTYVER
FT                   AVTPREAWRRMWTRADRYHVHGISGAAFTLLGGYVLAAWAKRDLGALGVIDDHGASANA
FT                   VRDALEAHGGAPEFWALASLSLALAGVCALSGTPLGTKRGWRKVELSVRSTLFQLVLTW
FT                   QALRLGPGGESLAGLDEFAWQIALAPFAWQCVTSAYIIAFTDDDKRSAMLVLIGTWLFG
FT                   AQVFPAASVIAGGAGGVASLALARPGLVTVWTHSLLGLVWLLNWSTLGASMRARRVIDD
FT                   AGYRASFLLRPSAAWIALFALDVAAYHPFASIWEYFATAGGARL"
FT   CDS_pept        join(complement(160504..160511),complement(160152..160344))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635770"
FT                   /gene_name="PETM"
FT                   /orf_name="MICPUN_109111"
FT                   /product="Cytochrome b6/f complex subunit PetM "
FT                   /function="electron carrier activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytochrome b6f complex"
FT                   /protein_id="ACO66381.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009512"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR012595"
FT                   /db_xref="UniParc:UPI000199C04C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK8"
FT                   /transl_table=1
FT                   /translation="MARPTKLVAGSRRAATTTASALPLAELAAVGPEIAEVAITCFSIT
FT                   LVGLAVGFVLLRVEAAVEGEE"
FT   CDS_pept        complement(161314..162891)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635771"
FT                   /orf_name="MICPUN_102945"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66382.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199C04D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDK9"
FT                   /transl_table=1
FT                   /translation="MHALTTSATAAANASATTAGALANSRGSARVAHMPRRVDAPVCRV
FT                   PVADRRAVVASVATQSEIVAPAVDAPPAKTVYDAVLYSFAEDGSATILTRADLDAVNAA
FT                   MHVNAVAMSAEKGTEQVADTATVTDTDSIADTDAAEDGECEEACPLVFGEPESSEPDKN
FT                   VDKKKSEINAPDASLASAAMSQAEVTQSLGDAAGVGASAYSSDDVLCMMYGVDVDKEDA
FT                   KHKVAFFSVDGAVASCDAIAAAASAAADLAAGRVPATSNPGDSNVGGGGVAVLFRNIWS
FT                   AIVGVFGSSGNNGAAIGAAAFAGVSTSKAAAIADRIDSEHVAKAVYPEAARYAKQLRYD
FT                   GYKIVLVTSQPDWLVAPLAKSMGASRVIGARLEVDDAAGTFTGGTLADAEDGQGDALGR
FT                   RVRAFAAEAGVDLAKSIAYGAGERDLPLMRVCGKAYAVSPDAAVAAAASENGWQTLGWA
FT                   EDAERKAARAGQLAAEAAAMDAARAEGILQPAYATVTVNGGAVSAKSRAWTVMDPDQYD
FT                   PENDRRRG"
FT   CDS_pept        163272..163976
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635772"
FT                   /orf_name="MICPUN_62307"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66075.1"
FT                   /db_xref="UniParc:UPI000199C04E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL0"
FT                   /transl_table=1
FT                   /translation="MQSTPHRVTSRRHRATPTDSAHGTMAAVTCVAASITASLSKRRRV
FT                   RVPEALATLQPRAALDASPATLRGSSDIRFSSSRGVRTRAAAPDVSAIAQIALRDDYDP
FT                   VVFLFCLNALFLSVVINVVNYGMDKDEETGMLKMPEGGVGAILAKTKRGMADYFMAVPK
FT                   QFKEMYAGKDEALERAIEELEDAKMAAYAARGTANAESTAKAFMDARRRAVDAGLSPGS
FT                   ELLNPGLPSNTE"
FT   CDS_pept        complement(164086..164640)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635773"
FT                   /orf_name="MICPUN_62308"
FT                   /product="Predicted protein"
FT                   /function="ribonuclease activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO66383.1"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="UniParc:UPI000199C04F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL1"
FT                   /transl_table=1
FT                   /translation="MGAVVPDGRDRFPVSQRTLDLKTESAYFRVRLCVPRPRAPCVRPT
FT                   NQPSAHPPVPRFPLSVRSELVGSSEPPSAATFATAITHALAKTHGVVGGAIPLDHLSFE
FT                   PDEIGTKSGRGRDGHSCGCVGVARCHASDARKVRTALAMLTTTPDGTECRASVLGESGS
FT                   LVALAGECAARDLARRLIART"
FT   CDS_pept        164762..165673
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635774"
FT                   /orf_name="MICPUN_62309"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66076.1"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199C050"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL2"
FT                   /transl_table=1
FT                   /translation="MAATATASLARGTFPAARHPRRVYPRGVAALAARFQESRRVAAAV
FT                   RAARDSQPVDDDDDESARRAEMTYADLPSVPGGSVLDCSRAYTVDIPRAIVADALPNRG
FT                   VLQYVRLPAEEYNVLDSSAVTRIDVGTFRVNAGAQKILMWEIEPVGTLRIVPTDDGCEQ
FT                   ILLGAVMNDVKARRTGKESVVIKAMNASLKDLTMRNAVSAVKSGSEGGTAIRCQIDVAG
FT                   TFTEGPFAAAGSQRLCAMLDWCLRSVLPWFLEQLAADYADWASGKTRGKRAVNVTQVAG
FT                   EILAGGKGKLPPGVAESAVERR"
FT   CDS_pept        complement(165769..166341)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635775"
FT                   /orf_name="MICPUN_109112"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66384.1"
FT                   /db_xref="UniParc:UPI000199C051"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL3"
FT                   /transl_table=1
FT                   /translation="MRLLALVACLALVRVGVSADGDRTAAEPFNGAVHSDPGADVVDDG
FT                   MTEPSHAVRWMDVEVNADAFVTRKSWQPPQYHLQDGTYVRMRGWVSTIRAAAVGEAVFR
FT                   LPEEARPGRGEPWRVTMKGTDREILLGEDGVARLLRDIPADNWLPLAGFAFNSWRAGGA
FT                   DVAPTAELGTGSVTYEEVEVQPPKDEL"
FT   CDS_pept        166449..167816
FT                   /codon_start=1
FT                   /gene_family="HOG000230731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635776"
FT                   /orf_name="MICPUN_62311"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO66077.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG557756"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniParc:UPI000199C052"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL4"
FT                   /transl_table=1
FT                   /translation="MSVQGVVLACGGERRFGDLVTQDRPRHMLDLGFNPIVWHALQTLE
FT                   HGGVKDVRLVARGDHAASRFEAWLREGYDGGCDVQVVAAADDADTADALRAAMPTVNPD
FT                   AQVLAVISGDLVTDVRLSDVLATHVRGGAVATCLLAKRRAWNGVDMKVGRPPKGAHYVG
FT                   LANDKLLLMADEEDVDKVLKLRRPMLGRVRDLVVHTDLLDAQLYVLDRAQVKTMLDDKP
FT                   RMTSLQLDVIPALVRRQFRAQPAGSAGPEQAVQSHVTSETSDDGLMEAVFGVANQGAGH
FT                   GGGTSTPSPPTTQPCCAHLAPDDAYCARVDTVVPALLEVSREIASSQPGDAAHLNGRKM
FT                   SKYENFVDPSVVIGGKSTIGPGCVVNAGTQFGEKCSVKRSVVGAGCHVGSGVKLVNCVV
FT                   MNRATIEDGATVQGSVIGPRAVIGAGASLRECLVEAEFEVEEGDDVRSETLRNKSR"
FT   CDS_pept        169272..170114
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635777"
FT                   /orf_name="MICPUN_109113"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66078.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C053"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL5"
FT                   /transl_table=1
FT                   /translation="MAMKTTIWRPNVRVTLNEYGEVEDTERGGEEVTKQGTKRKRAPPT
FT                   KGPCEHGVKQRSRCKVCGACPHGKRRSDCKECGGASICEHGRQHSQCKECGGASICEHG
FT                   RQRSHCKECGGGSICEHGRQRYRCKECGGGSICEHGRERSQCKECDGSGICEHGRRRSM
FT                   CKECGGGAICEHGRQRPYCKECGGSQICEHGRRRSRCKECGGGSICEHGRQRSQCKECG
FT                   GASICEHGRQRSYCKECGGSGICEHGRIRSTCKECGGGSICEHGRRRSQCKDCRGERL"
FT   CDS_pept        complement(170319..171404)
FT                   /codon_start=1
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635778"
FT                   /orf_name="MICPUN_109115"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO66385.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI000199C054"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL6"
FT                   /transl_table=1
FT                   /translation="MFSTVAAKPTTFASSARRSAVSKRRAKLAACPRASAEEIPAESVV
FT                   TRSDQVSLTRRDALLAALAVPLVMRDAPAFAETKKRAGAAGAAPKTPEESFASLRSDVE
FT                   ALMKKDGDFGPTMVRLAWHSSGTYDKMSKTGGSGGGTIRFKEELAHGGNAGLDKAVARL
FT                   EPVKRKHPEISYADLFAYVGVVAIETMGGPKLKFSYGRVDEMDPAAVTPDGRLPNADVG
FT                   DGPGPKERDHLRAIFNRMGFNDQEIVALSGAHALGRCHADASGYVGPWSGTPLLFNNSY
FT                   FVLLKGLKWAPNDEAAKFQYKDPSGQLMMLPSDIALIEDAKFKKYVDVYAKDQKKFFAD
FT                   FAAAFEKLESLGTSGLTPLSA"
FT   CDS_pept        join(complement(172957..172965),complement(171764..172639))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635779"
FT                   /orf_name="MICPUN_109116"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66386.1"
FT                   /db_xref="UniParc:UPI000199C055"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL7"
FT                   /transl_table=1
FT                   /translation="MATTPSAATTPSGTPSGTPARPRRPEDAAGNATEVAGARELDSKQ
FT                   PDASEKAAAAYEAMLAYMKAKEEEEKKTEKETETETETEATRGNETSPETSPETRPEDP
FT                   AKDTAVNGTQPAAAEAHAAEGDETGVPDVGVAEVPGAVGASAAARGGGGEDTAGGNPGS
FT                   ELVVLESDGRSPPVGLALIRGPQLAAGVAAFGCVGLIAAVWAARRATSGPHSSLERGWS
FT                   SVKLPSGFRAKDNNAGGSEKDVRYRELQMTEEAATEGVGGSSSSSSSNEGRRGGRKKGG
FT                   RRMTTEEESFYDL"
FT   CDS_pept        join(173691..173707,173865..176496)
FT                   /codon_start=1
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635780"
FT                   /orf_name="MICPUN_62316"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="ACO66079.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG604608"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI000199C0F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL8"
FT                   /transl_table=1
FT                   /translation="MSTRLRELIRSVRACKTAAEERALVAKESAAIRASLKDAEAHYSH
FT                   RNVAKLMYLHMLGYPTHWGQMECVTLIARASFPEKRIGYLGLMVLLDERQEVTMMVTNT
FT                   IKNDLKHRNHFIAGLALCALGNICTAEMARDVAPEVASLLHSKNSYVRKKAALCSVRIV
FT                   KKVPDLADEFVPGTSELLSDRHHGVLLCAVTLALELCVLDQAHVTHFRKHVPVLVKILM
FT                   SLIRAGYSAEHDVGGHADPFLQVKLLRLLAKLGAGDADASDAMSDVLANVASNTDGSKN
FT                   AGNAILYEAVNAIIGTESVGGLRVLAVNILGRFLGNKDNNIRYVALNTLAKVVAVDTQA
FT                   VQRHRHTIVECVKDSDVTIRRSALQLVYALVNDSNIKTLAKELLDYLGVADVEFKSDLT
FT                   RRIAQLITKYAPDRRWHVDTMVELLSKGGSYVAEEEARDFIVLITNSPELQGYAGRALF
FT                   RAAFESEQHSNRFQLSAVAAWVLGEYGDAVVAQSTRLQGEVHTVIAEADVVKLLESILG
FT                   DYHAPTAVKQVAITALAKLGTRFKTQTSAVRGAMGKVGTSANVELQQRASEFCGIFDRG
FT                   PALAVPLLERLPPFVMKSKEALHGVAGRGKHEGTAVHSAPGGGGGTAGGVGDLLGDFAG
FT                   LDDSVPSSAAAGGTGGGADLLGDLMAGYDATPGYAATPTGASVDPLADLMGGVSMQPTT
FT                   TATAADPFAGGAAAADPLGDLMGTGAPLLAPQTRPQPAADPLADLMGGIAATPAAPPPM
FT                   NAAAFDGAPPAATPSFIAFAKDGVEVSFVCAKPDPMDPSKTTVTATTVNRGGVPLLGYV
FT                   LQAAVPKTMSLSMRAASGDSIPANGTVTQRLDVTNSQHGTKALAMRLRLAWNAGGAAVV
FT                   EQATVDFPPGL"
FT   CDS_pept        complement(176649..177449)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635781"
FT                   /orf_name="MICPUN_109117"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66387.1"
FT                   /db_xref="UniParc:UPI000199C0F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDL9"
FT                   /transl_table=1
FT                   /translation="MPSRFGVRKIFAAFGTAFVLLSSQPVAAHRASNSASTIRTLLGEE
FT                   DHAHAKVKGPQCACLADAQGWKIDCADSAAMSAALTYLETAGNNCKTKSHSTECEKNYN
FT                   IISAHHDHCDHDQVPEEIEKEIHEFEGYYTNCDIKRKYYTLGGECAAIECHDASAELTT
FT                   AIADLAANQCDVAANCASKSKCYETYRKILMAHDTCDDDDLPTTLEKALHDYEEACDAK
FT                   RCNTVSADAAALSLTCQSSGAAATRTAGALLLAAIAVATTLVAA"
FT   CDS_pept        complement(178054..178464)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635782"
FT                   /orf_name="MICPUN_62318"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66388.1"
FT                   /db_xref="UniParc:UPI000199C0F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM0"
FT                   /transl_table=1
FT                   /translation="MFLGGGGTSPVRSRLGGSGLRSPPPTRGGGGMLSGGPARGEWDGR
FT                   CAVSSYRRDSRKRREEIQRSRARGLGGTHSARRSCPGARLSATARPGTGGARDRRAPPW
FT                   MGRNASPSRACLLRVGRARHPTAFALGVGGIK"
FT   CDS_pept        178520..181846
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635783"
FT                   /orf_name="MICPUN_62319"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66080.1"
FT                   /db_xref="UniParc:UPI000199C0F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM1"
FT                   /transl_table=1
FT                   /translation="MGMGPGPALGRFNPGGGFKPPVDISDAMRLPRVGAPPRGPGTPPQ
FT                   GDDGMGLGIDDFPPPRPTPPGSRGNGGAGPNRGPGPRRLGTPNDVRELEDRLVAAESAA
FT                   AAHASRLRNMERRMAIAEAARKEDSGGARGVTEALEQRVSNLQMENARANGLIAELKGR
FT                   LDATESDVKESRAQAMRVEAAAQVATVAARDAFDQIQQRIGIEQGSDARRLDLLSAEIA
FT                   RITREVADARGEDAAKRQILEANIARVEGQKAVDNTSQQFIDVRQKLNQTELQVVALTE
FT                   ALQDERRLRSEAETRLDVAINRMAELNDAREGSMIRKFSAELDNARLELQRALSDEKEE
FT                   AQTRDDHIVRDKDEQLAQWEKAATRERARNLEHQLILEKAVREEHDQRVHQMDALNKGL
FT                   DRVNHEVTQALRDEMLTREARENKLRGQISQSVLKLHAANKDTRDKLTRERDEIHATLK
FT                   TEIKSRMHHLALLERHMRDAQTDTKQTIRSVEVSLANRINATDQKVDIEMNMIQKLIAR
FT                   QSKLETDFARFTDDIVAAFENMQEDITVAAVSQAINTECDNVQAEYVTDTAADILEIVE
FT                   AQDARDKANHEKLSRAVFGDDPENGGVGLLPRAQKTEADVARLQRQELRIRDDIDGVNE
FT                   RHEELRAEVESAQCLHAVDVESIQAELDAGAADRAAIFDDVEHKVKEQIKRLREENVAS
FT                   MKTIEAGIDDKFVDFRTKFGRKLGALEYTTEEFQDFVVHQHLENEAIRIDAETYAEARL
FT                   GAEQDKRLAALADLKQHVAGIVADEANQRRLGDSDLRRALEDDIADLEDTAADAVRELR
FT                   EGLRNEISERRHESESLHRDLGDALDAARSRLEADVRALEEQASGNIAAQKLEEEIMRA
FT                   ELDDAMQCLQDGVEEVKAKVGEGVREALGSEIEKLKGECRVMVEESGAEAKTEMAKVRK
FT                   ETEDTMKERLKDVVTSLTELTEDVEAVKARAAAAPAAAPALAAAPAAAAAAEPAPEPVA
FT                   AEEAPAAEEAPAEAPAAEEAPAEEAPAGEAAAEEAPAEEAAAEEAPAEEAAAEEAPAEE
FT                   AAAEEAPAEEAAAEEAPAEEAAAEEAPAEEAAAEEAPAEEAAAEEAPAEEAPAEEAPPA
FT                   E"
FT   CDS_pept        complement(182163..184235)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635784"
FT                   /orf_name="MICPUN_106222"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66389.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199C0F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM2"
FT                   /transl_table=1
FT                   /translation="MAAMRAPQHSTLTTVASRSSEFSRNTLGNSRVLAGARERRPVRTG
FT                   AFTVRAGPASDTVKIEFEIKQKLRYGEQLVVCGNSNKMGRWNPNDGVHLKWSDGDVWKG
FT                   SVEVPAGGYVEYKLAIKKKHGQPAYWEKRHNRIVQLYEGGSTIVAKGIFGRDVDLKRKD
FT                   DKMDKNVKVSFNIHQKIMYGHEVCIVGSAKEFGGWNVDRAFPLKWSEGDVWKGEVEMTP
FT                   GGVAEYKMLTRRIRTGGEIKHEFRRDFKRMVQLYSSGSAVQITGEFKGLVDIRLKGASS
FT                   EKKEEKKEEKKEEKKVEAKKEEKKEEKKEEKKEEKKEEVKAEKKEEKKEEKKDDKKPAG
FT                   DKFTALAQGVKEEKKEEKKDDKKDVKASAIFDFGAAAKEAEKKEEKKEEKKEVKAEKKE
FT                   EKKEEKKEEKKEEKSGDKFTSAVSKWGALKAGADAKDDKKEEKKEEKKEEKKVEAKKEE
FT                   KKEEKKEEKKDDKPKLPDPAKLAEAAAKADAAAKAAAKAVEKAMSTPPGGAEKDVEDML
FT                   QSFRDSFAKSRGSSPAKPPPPPPPPPPAPTPAGGGGGGASKWGALKAGASPGASAAPSF
FT                   TPPPVPKPAAAAPSAPRAYTPPPPPPPPATPARPKMDAPPAPAPAKSGGGGGSKWGALK
FT                   SGADGAKEESMNAVARMKAAKGGSSADDLDVVAPGGDSFTARIKAAQEAKSGGAR"
FT   CDS_pept        complement(184879..186612)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635785"
FT                   /orf_name="MICPUN_62321"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66390.1"
FT                   /db_xref="UniParc:UPI000199C0F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM3"
FT                   /transl_table=1
FT                   /translation="MSAAQVRHGLRRLLRVARRLDGDRAMLRALLPVAGAHLPSLPGGE
FT                   EEERDDTVRGVVMRAVREAGGVAAARPEGVRAMSRNAAALEAVIARADLATAAERVFLE
FT                   SESAQGETQHVATSNSSPVRFGSIDASGDERCARLRSWRHLKDVLREHPEVAHRIARHR
FT                   RRPGRTDGAREAAHSDDAMRAVRAAVDSTLAGASSESALLAEEPPGGDGDPSAAWLRRV
FT                   SWETLVARRDRARRRAEAREIARRDPVELWTSRLHLASDEDDDLEHDSFDGANEHPNAA
FT                   FYRSRLDAVLEEPGGDVLALFREMHDVGCPPSRRLYVDAMRGAGCPEIATRLLWMLAHE
FT                   SGEASEAALRATPLGVSGVFSFQSARGRHPGGGKHAVGVRRVGIDGICTAVADAICTAV
FT                   LADATGNDDDPPAGSIDDASPPRRRTRGHERALAAMGAMTDLGASPTSRVANDVLTRCA
FT                   LAFAARGPSLNEGNEEKSRRLLRCVTNAATRAERHGTRLETSTWHALIECAERLGSLRD
FT                   FFVACEAFAARGGSVGAETVASLLEWAREVGDEAVAGWAEHELWSTGKGAFLAHLNRPT
FT                   C"
FT   CDS_pept        187083..189635
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635786"
FT                   /orf_name="MICPUN_102956"
FT                   /product="Chloride Carrier/Channel family "
FT                   /function="catalytic activity"
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66081.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000199C0F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM4"
FT                   /transl_table=1
FT                   /translation="MVPARVLASGARTVASPGRTAVISRAASASDEADGDADEDDTSKL
FT                   IVACAIGLATGLGVALFNVAEHATHDLVFVATNLDPSRFQLEGERQAGPAADTLFQAFA
FT                   AVAAPTAAGFLVTGMRFACGGFEGEEVPRAPRWRGLRSDRAREDDEDEDEADEDDASTD
FT                   AEGADDDASDAEGAPIDGWARRAAKPVLKAAAAVVTLGSGASLGPEGPSVEIGASVAGG
FT                   VSELANVTSSAKTAQRLGLIAAGSAAGISAGFGAPIAGLFFAFESILQPAASRGSLPTR
FT                   GGGGSTGFGPLTTESVILASVLAAVVSNQILGDTPAFVVPAFDIRAAAELPLYLPLGFL
FT                   CGATAVAFRASSSALGNAFNALERGDGGAGGSRWGGVPREWHAPLGGFVFGLVALYFPE
FT                   VTYQGFDNVNSILNAEGSAFRLPYPPDLLLELVLVKIASTALCRQSGLVGGVYAPSLFM
FT                   GAALGSAYGAALVPLALAGVPVAAPQAYALVGMAGVLAGICRVPLTAILLLFELTHDYR
FT                   IIVPLMGTVGVSSLVASAAERKMSMWSASAAAGTKSALDSLNRSFDEDELDRVSREAAL
FT                   ERAAAEEEEDDVECAEEDEDIGLCEIRNPDETREGDALDAADEEALRSLRVADVLRRDV
FT                   PRVSALASAADAATEARDSAMNARDRSNGSVSCCAVVVDPASGTFVGIATAASLRGALD
FT                   VMRRRAAAKRGADGRAKDDSGGLGPVVAADACDFSVPAVASGSSLWEARRAMRESGASV
FT                   CVVVAAAGSNARGVSVSQSDGDGFAVGVRALGVVEASAVELERESARLRKSLKLLRRTQ
FT                   ETTAAAEGEDEDEKAGDGDSDAGEEARESRARNKGAVR"
FT   CDS_pept        join(complement(190826..190864),complement(190419..190676))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635787"
FT                   /orf_name="MICPUN_109118"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66391.1"
FT                   /db_xref="UniParc:UPI000199C0FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM5"
FT                   /transl_table=1
FT                   /translation="MSAAAACQSLARVAPALRPRASVARRGVRPQNFFTVRAAAPPCEC
FT                   EIEGETRVAKVNGKDVSAAALRGVSVMDRRGGTTNLGEQIGDKGVLVLLRHLG"
FT   CDS_pept        complement(190967..191329)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635788"
FT                   /orf_name="MICPUN_109119"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66392.1"
FT                   /db_xref="UniParc:UPI000199C0FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM6"
FT                   /transl_table=1
FT                   /translation="MAMRLMVHSAATVARPPLFLCDPWWGARMHVATMVGAEIFRVRYE
FT                   RLVVLEVAHAIASGMYDHISPKSLCVGPTAAVERDLLTVFRVVGLIVPLVMWTYAREAQ
FT                   FRRFPKVWDKVVKKMV"
FT   CDS_pept        194319..195071
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635789"
FT                   /orf_name="MICPUN_62325"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66082.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C0FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM7"
FT                   /transl_table=1
FT                   /translation="MAHVVITGCNSGIGLELCRQLTARGDVVYAACRNSSPELEAVGVK
FT                   GGVVTGVDVCTDAGCETLRAYLAERSVRVDVLVNNAGGLGAAPGHTWDEQVAQQTFGAN
FT                   LDVGAMSRAFEVNVVGVVRVSKALESSVKAPGGKIAIVSSLMGSCGDNGSGGFLQYRVS
FT                   KAAVNMAGVTMACDLKEKGIAVGLIHPGMLQTNFGNLRQAPKSKQKYFRPVEPGVAGVV
FT                   QAIDALTMETTGSFIHGNYGNGLKPCPW"
FT   CDS_pept        complement(195142..197073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635790"
FT                   /orf_name="MICPUN_62326"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66393.1"
FT                   /db_xref="UniParc:UPI000199C0FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM8"
FT                   /transl_table=1
FT                   /translation="MSRYASPGYSAAELTAAVRERGREAVHWLMAGEDAGPPPGLIVDP
FT                   LSGNYAASPSALAAARARRTGDGTGELHPPSSAAKEALSSRVKQQQRLRGAVTKIGAAS
FT                   ALANSNSTPTPARTPTPARTPVPSPHGRPASRREVTPPKPPRFGSPSRAAAAAASRSTH
FT                   PPAGRRTPAGSSTPKSTSGRRSIRDDPPSPAFRPTPTPTRSSRLGRDGGVDHTHHSPRS
FT                   PVQYNAALIDELERSREEEAERSRRARMAEITRAAGEATAVATAAAAVAGATAVASAVR
FT                   RQLQQRRDLPRAPSQTPLSYPDPPTVQQTTTTRSVNTEIVVERVSPPSATAGGPTASSY
FT                   LRSGDRIPTSLDPREPDPPSPSFHPRGFVPDRRDAEATVMRTAIKLEKERRKLREEREI
FT                   FQKRQWDLDARELGLKQREARCAEAIELYQIREDRAGEHISASNAALLRESEDARRDLE
FT                   GLKNAAIEAEERARRAEARLRMIEEDATRKRDELESLRAKARARAANDARRIEQEPEWE
FT                   RASLALNRETKLRELLAETFGVVGDVNRALEHGFARCGALAEGVLARVGAVADATEAAP
FT                   APAGGTREVHHHLRGVARELRAESARFEAAWSELHKAYRRGRREVDRHAATIEMESGMS
FT                   LDDRPGYY"
FT   CDS_pept        197215..198903
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635791"
FT                   /orf_name="MICPUN_102961"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO66083.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C0FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDM9"
FT                   /transl_table=1
FT                   /translation="MRWWALAGRQWRTPRAHRLPWRESSSSSFLRDDPGACLYSLLGLD
FT                   DPKATRAEIKHAFRSRARALHPDAANDDAAVDAFVRVVAAYEILSCSRRRAAYDATRRA
FT                   GAFTGDASSWGGGRDASSSSSSSSSPRRQSPFDESETFRTYAASIDALVPRWRLRDELH
FT                   AALAHVIHGGTQLDVAEVESGAAFPRYFEAEERAAKVTATRGVDLMHVVAGRTLLAAVR
FT                   ERVDAEITAGRGEGRRMLEGDVEEPATTTKGELDAFAKEEAEKEEKKEGEEGNDGVDAR
FT                   LELVVGGRIVATATRRRRGGDVTVFDARGPTAENENAENEKKEASLLRADVNNWGGHPR
FT                   AGTAVAGDGTTSDEDAYASRGARGEAFTISGLRGSFDRATVFDADGAPRHVVVAHATPG
FT                   VTHLHWFDAITGVCVGRGTRAWVPPSDLWLFAPRSDDHDAGGWYFELPPGAPNRGDEPL
FT                   PGEREPSRRLEPSRGGGREPPQQRHVFDEFVEDFERGLGFKRRGEGSSEGSSLSERGRR
FT                   RGAPLPPAAALFTAAFRLLDRERGEDHGVGGAVRRAWAGVFGSRY"
FT   CDS_pept        complement(198978..200042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635792"
FT                   /orf_name="MICPUN_109120"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66394.1"
FT                   /db_xref="UniParc:UPI000199C192"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN0"
FT                   /transl_table=1
FT                   /translation="MRRSWGPNTPGAQSTRAPDAAAPAGNPGTHAVAAQEGMGAAFHFN
FT                   PATGMLENPGGSGGEAMSKSRFVESSSTGGFRRVGAGPGGGGDDDASGIQRSVAQRALD
FT                   SQGDLTMRAVAVAVQSVVVWLGFMTQGLLAGFGVLHVFMTYYMDDAQTDGFLHYYSPIA
FT                   VPAQRCFVTLSALALITAVDKYARDSLSGFMLQGFTLQKVDALAVLSFFLCFVLSVVCV
FT                   PFEDRVFYANKRVPSWWEYESATSSFKSSVATYMGTNFARCFFALLGWACVCYTNTPQV
FT                   IDVLDRAEEMKNAPRRGRGGGFGVVEGQTARRNGGGDGAKEGGTLQLGWRDGNAGGGNG
FT                   GGAGRRQRMDGYGR"
FT   CDS_pept        200606..202174
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635793"
FT                   /orf_name="MICPUN_102962"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66084.1"
FT                   /db_xref="UniParc:UPI000199C193"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN1"
FT                   /transl_table=1
FT                   /translation="MITASSTITQIAAPLARIPPLSWRDTRRVTDGRAGLIASRRGGVG
FT                   APPRATVPRRRCVVVTANGRHSRSKLRDKEDARERARDAAYRDMRREETRDALVKVDDG
FT                   AVTVDFKNTGKAATGVVARVKRAHKRAMKKLKKKVDKTVSGLTNYGEGNSRAPTFRAGY
FT                   QSPGVGFRDRAGYGYYGPPPWISSLVGWGVTLGVVYALGRVFGIIRPGGGAGGGALRLP
FT                   SLPGFGGSRRKPPPGSGPGRWVKDRTLGGREIWVEDKYRTATRRNFGGAMDSLAEPTYS
FT                   GGLSERAANERKAKEAKERREAKAAEDAAEPRWWDPPSPGYCPESQREQRLLAARAVYA
FT                   ALSNKRVSGLQYNEGDLAALRDACAEARASVADRVKPESARVGIYKSAVEFAIDAAARR
FT                   SSTGVIGVPTKFLTGIADDVGIRPGKAGRLVAAAVAARTRAELLQAGAELRQDDQGAAM
FT                   MTLDKIIGVLTVFTPEVGSAEFEMCAVGLEPRLNATERGALYDLFGKIGGGDVAPFVAE
FT                   ALGLP"
FT   CDS_pept        complement(202339..202914)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635794"
FT                   /orf_name="MICPUN_109121"
FT                   /product="Copper transporter family "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66395.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI000199C194"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN2"
FT                   /transl_table=1
FT                   /translation="MYMDGFAGWSDPNQPCVAFLHRDAALTTPWLMVCALACTVAMGTS
FT                   VEYLASVRRWRVATQDAAIAGYVECGGSAVTAARVIRAQILFLYLVQVAAGYLLMLISM
FT                   TYHAVLFAGVVGGLVMGHAMFNVSAPVVAGGASACCQHVATPSLACTGGAAKDGDGDAS
FT                   ISSIDSGDAVEVDVMNGHVHGDKAAARV"
FT   CDS_pept        complement(205942..208884)
FT                   /codon_start=1
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635795"
FT                   /gene_name="SBEI"
FT                   /orf_name="MICPUN_104965"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66396.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C195"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN3"
FT                   /transl_table=1
FT                   /translation="MSVRCGSIAAPIAAHVVARRSVHARKGRVVRTHGERRPERAGRPA
FT                   TTAAHPAHTKRGSLAAVARAMAGNASPTGYSVDGMGCAAVDEQLLEHEGHLKYRWEKFM
FT                   ETKGRIEEAEGSLEEFSKGYLKFGFNKTPSGEITYREWAPAACSAFLIGDFNEWSPDSH
FT                   PMKKDDFGVWEITLPAGTIKHGTRVKIKMRKSDQGWVDRIPAWITYATQEPQLGAHYDG
FT                   VYWDPPAGEKYVRQNPRPPRPAASRIYEAHVGMSGEDPKVNTYREFADDILPRIKAGGY
FT                   NTVQLMAVMEHAYYGSFGYHVTNPFAVSSRCGNPEDLKYLVDKAHGMGIRCLLDVVHCH
FT                   VSCNIEDGIAGYDFGQHTESSYFGTGDAGYHWLWDSRLYNYGNWEVQRYLLSNLRYWVD
FT                   EYGFDGFRFDGVTSMLYNHHGLEMEFSGDYKQYFGMETNVAAVNYLMMANDMLHECYPG
FT                   IEVIAEDVSGMPTLCRPVKEGGVGFDARLAMAIPDLWVRILKSSREGKLKDEDWSMHEI
FT                   IATLCNRRYTEKCIGYSESHDQSIVGDKTVAFWLMDAEMYDGMSTFEPPTDVVARGMAL
FT                   HKMIRMITMAIGGEGYLNFMGNEFGHPEWVDFPREGNKWKHDHCRRQWTLADTEHLRYF
FT                   ELNNFDKALQDLEEKYSFMSHEHQFVSMACEERKVIVAERGPLLFVFNFHPTESYEGLE
FT                   VGLGMPGKYRICLDTDAWNFGGAGRVGHDEDHFTSPGGPKTFVGPYEQEPRPCSLKVLS
FT                   PSRSAQVFYKVPEDDIDMSLSSAGENVHNLRQPGGLRVEPIGSVPPPRSNAPPPPPPPP
FT                   PPPPPPPTPASNAVGRAQRDGIIYDPDQWDPENASRGRAAPSQSGSFGSSQSFGHPVPP
FT                   PRGRFEPVAAGNSGFEDTVPSAKNMAATPVGAPTHVAKKQLMHDPDQYDPENAARGKSR
FT                   AVAAAPRPASNGASSSSSSYAGYGKAAAPVRVTRGKDGVIYDPDQYDPNP"
FT   CDS_pept        complement(209444..210505)
FT                   /codon_start=1
FT                   /gene_family="HOG000246853" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635796"
FT                   /orf_name="MICPUN_86747"
FT                   /product="Predicted protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   activity"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD+]
FT                   activity"
FT                   /biological_process="glycerol-3-phosphate biosynthetic
FT                   process"
FT                   /biological_process="glycerol-3-phosphate catabolic process"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="ACO66397.1"
FT                   /db_xref="GO:0004367"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0046167"
FT                   /db_xref="GO:0046168"
FT                   /db_xref="GO:0047952"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG586392"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C196"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN4"
FT                   /transl_table=1
FT                   /translation="MRWSRRVEEKNSKKEDVLATTKKVAVMGGGSFGTAMATLLARNKA
FT                   DLDVVILVRSEADAESINEDHKNAKYLPQYELPTNIRATTDPAHALPGSDFIVHAVPVQ
FT                   SSKAFLAGVKQHISPETPLLCLSKGLDRETCEMMSEVIPEGLGRKQPLAVLSGPTFAVE
FT                   LMQGLPTAIVAASEDKNLAWRVQRLFASTHLRVNTSADVVGVEMSGALKNVLAIAAGMI
FT                   EGLSLGNNALASVVAQGCAEIRWLASKMGARPETLAGLSGTGDIMLTCFVNLSRNRTVG
FT                   VRLGKGESLEDILGSMNQVAEGVATAGAVMKLARRYKVSLPVLTAVARILEDDLDPRDA
FT                   VEEIMNLPQVPEV"
FT   CDS_pept        join(complement(213043..213328),complement(212558..212904),
FT                   complement(211241..212506))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635797"
FT                   /orf_name="MICPUN_86424"
FT                   /product="Predicted protein"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /protein_id="ACO66398.1"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG557411"
FT                   /db_xref="InterPro:IPR003874"
FT                   /db_xref="UniParc:UPI000199C197"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN5"
FT                   /transl_table=1
FT                   /translation="MLVERDKFRFAYDELRQDSRECPVLVYVSTADVDSCAAFSILKTM
FT                   MRSDGIPFSAYPVGGYQELQNLGERLPKDGKNRSIVLINCGGTEDVVTLLGLPEGTRVF
FT                   VFDSHRPLNLENTRADNRDVLVLRDEKEGEEHFPEPDSDYGEDDSSDDDSSDDDDSSDE
FT                   EESEADEDEDGDKENSSGGNEGDANDDDERAAKRRRKAEKAERRATRNRIAYYSRGSFY
FT                   GRAAGLLMYDIAHDTHKDSLEKHLPLWLAIVALTDQYVHQRLSHESYTAGVMELATQVS
FT                   NLPGADAPTSRVLDEGVVVRAFEDRRIQYAEEFRFSMLRHWSLYEAMLHSPYVATRMQT
FT                   WRDVGRQAMNSLLTHIGLPLEVCKQQYSHMSPTHVKMLGEKLEEHGGSHGLTDLKFWSF
FT                   SFSHGFKVKLAASDVVHGVTALLEGLPSTTGADEDAEGDDGEGGGGGGAAFWRAVNALG
FT                   MTRSDEMSAGLGHAMRAQRALMRQGGLALANKAVIRTVGGLRYFSLLDHGSPADLPYFK
FT                   HPLSLRRLALFLQDALRTVKKIERPLVVVGPCVEAEKGMAMVVGVTGKPVNDDTAGGNH
FT                   FAHSFRRAAEHIRAKFRHDSFEASVLTVSERNLGEFMESLSDFDAERLARERMAAA"
FT   CDS_pept        213478..214002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635798"
FT                   /orf_name="MICPUN_62335"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66085.1"
FT                   /db_xref="HOGENOM:HBG557412"
FT                   /db_xref="UniParc:UPI000199C198"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN6"
FT                   /transl_table=1
FT                   /translation="MSNRVHVAGDAKAKVGAVGKGMTTNDRAAREILRRMLSVEHKMGL
FT                   QAFWMKFLLLPDQNARVTRLAYTLELYAVLSGLVLFFVADIVDVDADGVLGKISTIFAV
FT                   FSVLNLMCVIACCLHLGFAVVATTGPAGVVLLLQPLGQEFVQIVIGIVSGLIAFALKLA
FT                   DRTDGKFCIAQ"
FT   CDS_pept        join(complement(215312..215428),complement(214436..215227))
FT                   /codon_start=1
FT                   /gene_family="HOG000158093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635799"
FT                   /orf_name="MICPUN_95396"
FT                   /product="Predicted protein"
FT                   /biological_process="autophagy"
FT                   /protein_id="ACO66399.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="HOGENOM:HBG676980"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="UniParc:UPI000199C199"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN7"
FT                   /transl_table=1
FT                   /translation="MCLECAASLREELELRIEETKSECETYAKCLEELGVAEGEEAETR
FT                   KLEAELGAELEKAVELRDELDELRRERLELEAEAADLDARESAYWDDFNDFKLALERHV
FT                   DERDSLVVSVEQTGRQLERLRRTNVFNDAFHIWFDGPFGTVNGFRLGRLSNVAVEWDEI
FT                   NAAWGMACLLLSTMANAVKLQFSRYALKPMGSFSKVVDGKGNAYELYGPVNILSSHKYD
FT                   RAMAGFLQCLDEFGAFANEQDVANGVNPPFELPYKIDGDKIDGRKIGFPFNRYERWTAA
FT                   LKIMLTDLKTCLAWLSNQQRG"
FT   CDS_pept        216127..216675
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635800"
FT                   /orf_name="MICPUN_109122"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66086.1"
FT                   /db_xref="HOGENOM:HBG609588"
FT                   /db_xref="UniParc:UPI000199C19A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN8"
FT                   /transl_table=1
FT                   /translation="MSTTSLATTARVARVTAKPARRAAVWRAPVVTRASHDEKSNVETS
FT                   SWHLDARRAVAASLCAATLAGTVAPTAALAIDLVIADPSVKQYMDMRDDAMRMKCEGGM
FT                   MDCDGDRREYAKKQAENFVARNSGEERVLPECKVEEACTENILGAAFAGVQGLTTSEKL
FT                   EKMGRDGDAINGTRKYFGQ"
FT   CDS_pept        join(complement(217585..217804),complement(216747..217432))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635801"
FT                   /orf_name="MICPUN_62338"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66400.1"
FT                   /db_xref="UniParc:UPI000199C19B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDN9"
FT                   /transl_table=1
FT                   /translation="MPNALDSLRSLRAISRGGALSAFARRFTAGRALFAGDDARDGGET
FT                   DGASSAQARRQPAEIVRIDVMGRVQYYPVSAGDRLNGYPDMTVRQLCDALDARYASRKL
FT                   PAERHVQQLVAKVATADDATTAAAAMAKFHHRRAAAFATMKLPRKRHGLTPQSLMMFIG
FT                   ACRRVGAASAALAAAENHNAIGLPMIRPALLKLCEACEDVDQVLRVYELWQKEGWEVDG
FT                   AIAEAVVMAAARVGEPDAADRWLNEFKGAGIDSFDAAKCETAVAAKRAEMASPPTDDGG
FT                   EDNGGEEEGGDDAEGENESK"
FT   CDS_pept        join(complement(219013..219033),complement(218242..218613))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635802"
FT                   /orf_name="MICPUN_62339"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66401.1"
FT                   /db_xref="HOGENOM:HBG609428"
FT                   /db_xref="UniParc:UPI000199C19C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP0"
FT                   /transl_table=1
FT                   /translation="MPGSGPRGMRPTARGKKRSRRSHDPFELWMGKLDRWVDKNPMKAN
FT                   ALTGVILGLAVYVFWAMFGESLTSLYAKHLGPSLDPLLVKHVVPHYITVRDVVVDAARK
FT                   TGLDKVGGFLSAVAAKAAALSQAKEL"
FT   CDS_pept        219362..224779
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635803"
FT                   /orf_name="MICPUN_62340"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66087.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="UniParc:UPI000199C19D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP1"
FT                   /transl_table=1
FT                   /translation="MRQPPPPFAAGPLMDKENVGRRASSQSATASSSSIRELATKLAVA
FT                   TKDGSRPKMGRDTAPVLLRLGKGTEDAPLLRFTETRVGGSKTLPLRLRNDTPVTQTVTF
FT                   ERIPREEGFLVDPCRATLPPGAEELVRVSWLPSRASAGPYCGVMHAVLNDGVGGSAAAL
FT                   KVRLRAPPVPQISGATGNDDDVHRRRASTASSVGSHVPARRASVTAYGARRASALQPLS
FT                   GNHPRRRFRASLDESAPDLASPGFKRSRADCDRLLPSAGGSFDRVPSTAAGACGGIVPS
FT                   VLSFTASEQSAQRRRKLPKIAAVGKTLRLRGNSGGGPLGLGALDDGHRPDFASFHTEFW
FT                   VRQQEVAFTHWLNATIVPHTHSASEACADRRARRLASEAARTRLWSLYSVDAEVRSVIL
FT                   RVESHIDDGFLRLRGTEDDGGFKSGGSFLEDVKLRDEFERALGSYSLFWLRAAVDTLLG
FT                   NPGDVVEDELSSESRGDGNNGGWGDGRNGFGNGKAERNRYATERAERTALVAALVRDRA
FT                   LELEFGVGSTGAPPFADGYQEALAGTVLKRTLLLVFLMDRARSGLPPNTPLLFRGDAPC
FT                   KSSAAVAELALRASTYGTGDVLRHIGHMGYRLYHAQEPIREYDFTVRNLAVDLRDGVRL
FT                   CRLVEVLAGAVGDDGCVRDAKFPADSRAARTHNVRLALDAAVAAGIELPGKWKDVSPAD
FT                   VVDGHLANTLGLLYALMMHFQAPRMLPIREMDDEIARWRSRRANQILAGRGAFAFHGAT
FT                   LAPAKREEDSNRHGAAYSNRPERTPEEIDEDEAARSAALFADELADAALATSGSDTYSE
FT                   CEVRLLRWARGVCACVGVDVTDFKSSFADGTALCALVHAYAPRLAPLRAISRPPKTLNV
FT                   PGAPPSWRSVSYGYLLKERRRMEDGDDDADGDVSSEALEARARATAACKANFKLASEVC
FT                   RALGGVPELTFGPADVASSGGPDAKVVAGYLLFLCARLLCHRREDAAATRIQRWWRFKH
FT                   WRPGRLRRWCRAATTVSKNKRALDARRAAFARMCAIVRVQSAWRGLLARRIKAKAVAAA
FT                   CTIQRHARGKMARDAYADVQFATLIAQTHARRAIARRAYLTLRHHTIRCQAIHRGALAR
FT                   DAYMEMLWMNEAATTIQSAWRGWRQRAAYVAFKEMVVHIQAMARGATTRRMFLRYLSMW
FT                   RGATRIQAAFRGYLERRDRAALVAAAVCAQKTRKRAVARRAFLERKKSAVAIQAAARGW
FT                   IARERYNDVRFTAVLLQARVRGVAKRREFLELRGAAIAAQRRFRAARLANARERAAIKI
FT                   QAAFRGWSANQSYVDLRFTSIVLQARARGARDRTRFQALKRSVAVAQKHRRRLVAARED
FT                   ERTRREARESAAREAAAREAAAATAIQAAWRGAAARRSYKRLTSRLRRRRDVAATLIQT
FT                   NFRCWAARCDFLALRWASSVVRHAWRAKKTRDAFVSLRAAAVRCQAFARGAKARRAFLH
FT                   QKRLGAATVVQACFRGWSTRRRAKATLGPRVAELAALIKRSRARAAADPSRALGARAAR
FT                   AVATLHAPRRLREVRDALRDLAVATRWSGACRRNLAGDDKALAALLRTVRRCDRSSSHE
FT                   PVLAAAYALFENLSADATCARALFECRDSVNVIAEHMQMCRDRPELVAAAVRTVVNLCG
FT                   DERRAAEVAAMGKILGRIRSIAEIMQNNVDVHRHRRVAYVEQRRPDKAAEEATAAAKLE
FT                   LSIASMKNLISHLEPHVHKNARQAAGSGSKKPPRSALLYPRSRSRLGRVGSPAVSTAVG
FT                   SPAGKGGAFCDKENAAAAAAAAGKGYNAERERRGALERERIHGGVLAAI"
FT   CDS_pept        complement(<225130..>225753)
FT                   /codon_start=1
FT                   /gene_family="HOG000243779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635804"
FT                   /orf_name="MICPUN_76248"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66402.1"
FT                   /db_xref="HOGENOM:HBG587951"
FT                   /db_xref="InterPro:IPR020532"
FT                   /db_xref="UniParc:UPI000199C19E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP2"
FT                   /transl_table=1
FT                   /translation="PSKHHAEVFILRYSACWIVSVVVVIATAAYESWGKWGYMSYCGAC
FT                   AAPAVLYPLMFPLRGDVGRPLRDWYILKANVWIGVFSFIGNYWYTHYFYVVLRANYTFD
FT                   AHRLNDVPIALYLMTHAYFMFYHVLSNAALRKIRSRYRPGRGRFAFECGAIAAMSYSTA
FT                   FMESLTICGFPYYSFEDRDMAYTLGSAFYGIYFLVSFPMFLRVDE"
FT   CDS_pept        226222..226794
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635805"
FT                   /orf_name="MICPUN_53305"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66088.1"
FT                   /db_xref="UniParc:UPI000199C23E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP3"
FT                   /transl_table=1
FT                   /translation="MSGPYLYSDLPPPRSSRRGDARPRARSGVPPFFSRARTIADLCSA
FT                   PPSPNRQKRTSATIPPTRRRRRTRRRSRRRTPTTKTPTTRSPSPRRPRLRAKTRRRKRR
FT                   SPRDRTTTTASTPTSSRTCRATRWTRRTSSREVEGPGRDGPPFSPTPPPIWPRTPTRTR
FT                   SPQTWSAFHQFLHCSFYTHPVTATRPD"
FT   CDS_pept        join(227671..227777,227920..227977,228173..229621)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635806"
FT                   /orf_name="MICPUN_106228"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66089.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199C23F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP4"
FT                   /transl_table=1
FT                   /translation="MKQAEASKTRKPYTITKSRESWTDQEHDRFLEAINLYDRDWKKIG
FT                   DYVGTKTVIQIRSHAQKYFLKVQKNGTGEHIPPPRPKRKSAQPYPQKAAVGGGRDGKQA
FT                   KKGGGAGVGKGTGVSLAPPEGGGGPPMGVRHASPGVMGAPPPVNLVGPGGVLGGGYPMA
FT                   TSVGRWDGGMRGPHPAGPGPMSSMGAMGDGSWGGGMPSGMGGMSDGGFGGARGDGVMRG
FT                   HQQGVMTHHRDVMIGHGGGNGMNPPMGSYPVGPMGLKGFGNGQGGGGGGGGGGGGGNVI
FT                   IGRGGNLKPSPSNNPDFVVVYTFLAECFDPEVKGHAEKLRAMSPIDRETTTLLMRNLSS
FT                   NLMCQRMWEDQVQLIGAGCPTFVNATYDEKGVVGVNVPSGAVVHAGSGQVASGNDENSN
FT                   GDGSGAGDGVTDPLNGGGSGDGSGAGGDNGGRGALKGSAKNVPATAKDGRPSASNGPNG
FT                   GGTTYVHASQFTRLQPHPVVDVGTWSDQYVGEGPGASYPGGGDDKGFDKGGRSRSNSGS
FT                   PTEDLIGKGVPEDVYITGGA"
FT   CDS_pept        complement(229848..231113)
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635807"
FT                   /orf_name="MICPUN_109123"
FT                   /product="Rvb1-like protein"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /protein_id="ACO66403.1"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199C240"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP5"
FT                   /transl_table=1
FT                   /translation="MSAGWVGQEQAREACGVVVDMIRQKKMAGRALLMAGAPGTGKTAL
FT                   ALGIAQELGSKVPFCPMVGSEVYSSEVKKTEILMENFRRAIGLRIKENKEVYEGEVTEL
FT                   TPEETESTSGGYGKVISHVVIGLKTVRGTKQLKLDPTIYDAMQKEGVQVGDVIYIEANS
FT                   GSVKRVGRCDAYATEFDLEAEEYVPLPKGDVHKKKEIVQDVTLHDLDSANAKPQGGQDI
FT                   MSVMGAMMKSKKTEITEKLRQEINKVVNRYIDTGVAELVPGVLFIDEVHMLDIECFTYL
FT                   NRALESSLAPIVIFATNRGICEIKGTDMSAPHGVPVDLLDRLVIIRTLPYAAEEMVKIL
FT                   AVRAAVEGLRVDEESLARLGEIGDATSLRHAVQLLTPAAVMAKTNGREEIVLGDLEEVG
FT                   DLFLDAKASAKLLTEQADKYLS"
FT   CDS_pept        join(231854..231965,232242..233350)
FT                   /codon_start=1
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635808"
FT                   /orf_name="MICPUN_106230"
FT                   /product="Predicted protein"
FT                   /function="branched-chain-amino-acid transaminase activity "
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="ACO66090.1"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI000199C241"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP6"
FT                   /transl_table=1
FT                   /translation="MATYATPAAAAPAGVSSSLRARAGSPLRSKPLAAPKRGGGGKRST
FT                   LRVAAVSTPAKPSGGTPKQDFDWDNLGFGLVETSFMYRTECAIDGEWTKGTVVPYGNLS
FT                   MHPSAAVLNYGQGIFEGMKAFRTAGSDDVVVFRPDQNAARFAEGAGRMSMPPVPADVFI
FT                   DAVKKCVSANREWVPPEGKGSLYLRPLLIGSGPILGLGPAPSYTFLIYCSPVASYFKGG
FT                   KMAPIDLTVEETYHRAAPGGTGSTKCIGNYSPVLKVQLAAKKAGFSDVIYLDAVENKYI
FT                   EEVSSCNFFCVKGKTIATPALGGSILPGITRKSIIDIARAKGFTVEERNVSVEEVLEAD
FT                   ECFCCGTAVVVVPVGSITVKGEKTQFQGGKTGPVAQEMYDELTGIQSGKVEGPDGWLEV
FT                   VPEEYHL"
FT   CDS_pept        233781..236618
FT                   /codon_start=1
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635809"
FT                   /orf_name="MICPUN_62346"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66091.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="HOGENOM:HBG354397"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniParc:UPI000199C242"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP7"
FT                   /transl_table=1
FT                   /translation="MDPMKEWPAQRIRQTFLDFFEGKEHTVVPSSPVVPHDDPTLLFAN
FT                   AGMNQFKPCFLGTADPKGPLAKLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLG
FT                   NWSFGDFFKEEAIGWAWELLTKVYMLPEDRLYATYFGGDPAQGLPPDDEAKEIWLKYLP
FT                   PHKVLPFDCKDNFWEMGDVGPCGPCTEIHYDRIGGRDASDLVNMDDPNCLEIWNVVFIQ
FT                   FNREEGGVLKPLPAKHVDTGMGFERLASILQGKMSNYDTDVFMPIFDAIQAVTGAEPYA
FT                   GKLGAEDVGEKDMAYRVVADHVRTLTFAIADGAAPGSDGRNYVLRRVLRRAVRFGREKL
FT                   GAKQGFFATLVKTVVQLFGDVFPEIVKEEKRVTEIIAEEEESFGRTLLKGVEQFKKIAA
FT                   KAKEEGRDTVSGAEAFLLWESFGFPVDLVEIMCEENGMKVDNAGFEEAFKEAQEKSRAA
FT                   GKKGGGRQLLFEAEATAWLANNGVPLTDDSHKYAAGSVPEATVKAILTLDGFVESTENV
FT                   EGPIGLVLDKTSFYAESGGQVCDVGVIKSGSASATVEDTKVAAGFVLHSCDSVDGAVAV
FT                   GDAVRCLVDYDRRANIMPNHTMTHCLNYALRRVLGDSVDQKGSLVDDEKLRFDFSHSKA
FT                   MTPDEIEKVEALVRDQVNAKLAVHTREVALAKAKEISGLRAVFGEVYPDPVRVVSVGPS
FT                   IDDLLGAPASEDWKGYSIEFCGGTHLANTSDAADFVLLSEEGIAKGVRRIVGATKGAAA
FT                   AAMKTAADLAAQVAACDALSGAELEKAMAALKGTVDTSVMPAVQRAEIRDAMAKHTKRI
FT                   AAAMKEAAAAAKANAIAAVEERTTEAKAAGASVFVAQLGDFTDPAALKDAAAVAFKQGV
FT                   ACALFSKDPIKGKAMCYVSVPEGVSLDVKGWLAACCGPIGGKGGGGKGGVAQGQGSDVD
FT                   GLPAAVDAAKAFAGL"
FT   CDS_pept        complement(236741..237898)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635810"
FT                   /orf_name="MICPUN_62347"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO66404.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199C243"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP8"
FT                   /transl_table=1
FT                   /translation="MWSSLAACRALAGPPMRAKPAIPRLPTRHHRVGGARPGLLGADAS
FT                   SWVARGWVNEYGDEYEDIDEDDDLDVRRRGGPRVGRTGVPPRRGARPPPPGMPRAQPPR
FT                   QRASSSDEARRDDDDDDEGSRVVMETVQCRSEQEIGRVIGRGGSTVERIQAETGTKIQV
FT                   DSRTLCVDIKGYPSDVREAVRIVTLVTQEGFGGSVERVPCTGSEGAVIGPKGARIRAIA
FT                   KETRARLEVQVSDDGDGSSECVIRGSPPEVAAAAAWVRELVAMDRDDRDAAARRGGNDR
FT                   GGWHKPYYNDDGYDEYADLESPAWDEGRGRGGVRDWDSYTRPMRNPPLPFGYDESGERT
FT                   TRDGRVKRRESSTTSGAGGARGGRGGGRGGGRGGRGAGRARGREG"
FT   CDS_pept        238208..239173
FT                   /codon_start=1
FT                   /gene_family="HOG000005941" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635811"
FT                   /orf_name="MICPUN_86134"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66092.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG318705"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199C244"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDP9"
FT                   /transl_table=1
FT                   /translation="MLNHPGRPGKLYCGLVALCYMALAVALLFFNKAALSSYKFPNANV
FT                   ITLAQLACSNVLLYAFRKLGWVRFTDDVALIPRDCIDAKSGFPTQKMFRRVAPLSAAYM
FT                   VYMLLSMASVRGVSLPMYTTLRRTTAAFTMGAEYFLAGTSQPAVVVRAVGLMVLGAFVA
FT                   GLHDLEFSVTGYAYVFANNAATAAYLACIARYGRTSGLNSFGMMWCNGMMSLPALTTMT
FT                   LLTGELQSLHNYGHLYDPDFQSVLMASCVLAFSLNYAIFLNTSLNSALTQTICGNLKDV
FT                   VVILVGYHTFGGVAFDPLNFLGILLGFAGSVSYAYVKLVR"
FT   CDS_pept        join(complement(240262..240304),complement(239953..240055),
FT                   complement(239429..239780))
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635812"
FT                   /orf_name="MICPUN_86515"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO66405.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199C245"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ0"
FT                   /transl_table=1
FT                   /translation="MSDQAVLLLRKQLKELSRNPIEGFSAGLIDDSNVFEWEIMIMGPP
FT                   DTMYEGGFFRANMVFPKDYPNNPPSVRFVSEMWHPNVYNDGKVCISILHSPGDDPLGYE
FT                   QANERWSPVQTVETIMLSIISMLSSPNDESPANIDAAKQFREDLPGFRKKVSQCVRKSQ
FT                   EM"
FT   CDS_pept        240715..242076
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635813"
FT                   /orf_name="MICPUN_62350"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66093.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199C246"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ1"
FT                   /transl_table=1
FT                   /translation="MAHEPCSVEDLWAGDRSRVGVCVSITPKDGVRYEDLQREVFDRVR
FT                   WPDRDLRWHAHRRARDDGKSDDDAWVMEATASCLASSGDESQVAYRVEGVAHDVVEECE
FT                   VLVSAPCHVPFMDLTLADVDISAAAVARASRDEARDDGDGRGPGAFGRDAAGGEPRESP
FT                   VQMFLRTGLAASAASAVDPDDLARLVAVAARRVASAEKALHANHPAIRVGEDVFAFREM
FT                   GSRGGRRFDLLFPKPEWDADESTEARTDAAFVRDFATRAPWVPTLVEPILGKNDKSADD
FT                   DAHASIESGTARCDAQDEPPRRHRSNAWWCDVSVVYSKPGAPAQDWHCDGRHLAGEARA
FT                   DFTGLGASPPYAVCVFCPLIDLDATVGFTQFWAGSHVTDGLIGFGAAAEVLRGCVDGIA
FT                   NKGGFVAYDYRTMHRGMGNRSGDTTRPVLQFLYARSNYRETKNYGVRSVFRPGT"
FT   CDS_pept        complement(242179..242682)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635814"
FT                   /orf_name="MICPUN_62351"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66406.1"
FT                   /db_xref="UniParc:UPI000199C247"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ2"
FT                   /transl_table=1
FT                   /translation="MATSTSRAAALSLMRRMLRVSRGWRGEGGADEARYIVQETSRVFR
FT                   ERKDLRDAEVIAGALDEGEGRLQTALHYGIAYPRMTHTPLAGGGDVKNVLPPAEAGGSS
FT                   WASHVGEKGVSDAARNIAAHAAPVNPRANAAREAARAKRLAMMKATATATAEARTADDE
FT                   DATG"
FT   CDS_pept        complement(<242990..>243148)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635815"
FT                   /orf_name="MICPUN_76700"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66407.1"
FT                   /db_xref="UniParc:UPI000199C248"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ3"
FT                   /transl_table=1
FT                   /translation="SLGERPGVHSVDSFQGSEADVVVLSAVRANDRGAVGFLSDARRLN
FT                   VALTRARQ"
FT   CDS_pept        246581..262195
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635816"
FT                   /orf_name="MICPUN_62353"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66094.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG557421"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR022099"
FT                   /db_xref="InterPro:IPR022105"
FT                   /db_xref="UniParc:UPI000199D586"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ4"
FT                   /transl_table=1
FT                   /translation="MKLVISGWLTKKGQSTAFSSGKQWHRRYFELWQEPMDGTAALKYF
FT                   TSDEPHEKPRGIARVHAGSSVRVLDDEASLIDHGLDRSLAGRRVFVFQATPAKDKAELA
FT                   KAKFSFFLEAENASVMHSWVTALSEAIADNRHHAAAGGDGEAGVVGGASGAADLDLNGG
FT                   DTAGGGAGKIAPRKRFLGALERAGLCGPLGGPAIPAVPGAVWETPAFIDLLADGMLTPE
FT                   ARDRRRVALSTGSADGALRPLVRSSTEVARALGQLMMPATEAEQHALADARQGLVALGD
FT                   LSLSCPAGSKDNTRFLVWLEEIVERCRNLPRGRTLLLPGGWCTKNGGHPLVYSVRRNDA
FT                   DFSLLVTNTGDGLEYHPREADPVLDGFRAMHTIQLDEIEPATLFDSSSWALLYRPLIFS
FT                   APGKKQSEHIYGKVLPFFNKRPLMCSVGAVGEGGDRVEHRHPLAAVSRGGDASGARLAL
FT                   EAARACVAAAEGVHPRRADALAEMGVRHVLVESALQDLNSSSADVLGAAPAAALEAACR
FT                   TLAATAGPYADALANATAQEAAAAGVATFMQMQARELHRQAREAAEKAARMAGAAAAAA
FT                   GMGADPFANIAGAPPVVPGLDDTLSSLPQLEAFNGPVVEAETLARVIRCVEAVIQKTAA
FT                   LRQPALLPPPLLKASVDDGDEIAGGFRADLPDMRTPSAACSAPLYGRLAKSNEDIEALA
FT                   GAEQAPPIVRPVELTLVPDSVATVEEASGAMRKAVHCCVLLANQAELLPNTFQLRASLL
FT                   THLFCSVLPAPLPLTHPRRRAECFWASQTVRYETQAELLRCLRLLLLQFGAAALSMTAT
FT                   RSFDAARLLTLASFATTADAILRLRVNDHPSPFCLHYSGDADGPVTPFGFEMGPFGVEA
FT                   EYLRFHCPERTGRLTQVLDYFHGIKEAVTDDHMVFRWEKSADFGAGDARLLSQVCLQMG
FT                   FPMDPDELPFYLSGESRELGDNYPEMPVMRDIVFFFKALMTPTSESLPELRRWRPRDAA
FT                   LWWKYRPGQGFETHGFARRMEVHPWKEGDSGDKGTGWRSSMGGGFLASLFGSGDKRPRC
FT                   PPSGGNPSNLAGKEVNSEEDVLHLQKLPTFDGLLRPSESELLLTYLTAPYLRVPLVLKH
FT                   FADPQRVRALGHKDVQGVLDACFFEPGPWQPPGTVDVPSEVPAPSRAHMATPCGLLLHE
FT                   LSNAPAPLIDAAEEILAMTLELDTGRHDSPCAAGLLYAVRLMTRMHCFVRYALVESGLG
FT                   GEVDGVEASGPGGFSESFSESRGVDGTRRDSPGPGPGPGGWAGGSGARGVRCPPAAAAP
FT                   LLHAAHRLRRALDDRVLPCLKRWLHNAARSGENRAACAIHAHLAYLHWCTPPHAITRRA
FT                   AQTLLTAQAYILVNHRFVDAAEAGAGSKLRGKATDAGRVDDALGFAPSEIFDLFQRQRR
FT                   SVLTWMERNPALADAVLEEVVRVLTLNSSGLDDYGDANADKENKIVPKKGLAGWFGGKK
FT                   KNEEEPPEEKPVETVLPGVKVESNADLRKVDRRWVRVPGPGGAGRFIPETEAASAAAAA
FT                   GVELVTRPADENSPQPPTPPKAGAPNAGGDSDVSPSSLGGDALTGAAAVSADARAAGIS
FT                   YEDWMRSVTTMAVEMEINAQLGEFTVRKNRLKALQHSVREMPDFIAALGQTLLASHIEA
FT                   KATRGSKTLADVPAEDAPRGDTFRRTDGANAGRGEEAGAEGIDGGGGDSDVESDDDDGV
FT                   DGVVVHCAEVKRTEHRLWMRLVGLRHDVQLWDKDARAPALPFNRPYKPLFTDTDIAAGL
FT                   AGAARGVADLAASVGAVGLAESERWISERLDPVAAGPAAGYLDGVELFLPVQTVKGPIA
FT                   HLAGFAKMPAGVGQPGGPPSDAWGFEPGQNERFPGDPTAVAKASAAAKDGDKKDDKRDP
FT                   ATPPAQLGALTEVVVLRDPPLVQVYRVESHGRKWRRALVFASSASWCLADVDPDGHPAL
FT                   EDPAERYLLSSTRLGAASSSLVISRHLTEKQGRQQFVPARHLRGLIPAAILKDYAFWQD
FT                   EKGDLHGDPVPGASHPRSVIHAKLVKGAGADVAGAFSAGVGEHAAVIRRIPLRKDDDDA
FT                   DAPGVRPGAKIPVGHVKGQLTLIDLLYAPAVLGEAADAASTPSETKAAAVALRSVARCL
FT                   AAVEGLAHCLAWTAAPVDASRLGGGGGVIGALASAAKALNIGGGEGGDTEGQPTHRSVV
FT                   GIDRIELPRLGISFAATAEDPAESRDESLGGVVGPGGSVRLECEEHAGLFLSARRSPEL
FT                   DALLVGLPHSLLLEGRDGALSVLLPAGAAPRPALDRAASNSKNGTAAKDVAVVAAEEAA
FT                   AVGTKGFGTDMVLDRWDAEWTRNAFQGGGGHYVYPVHGGHAALSAASLPSALYLALLRF
FT                   LARRYADVCKLSDLCVSDNAPTPEEQQLWLAFAGVAMDPAPDACAARLRLSVAAFATPA
FT                   ESLLPWDTQEELRSYVGSWRHVSASCRLSAREEQELLDSCDPEMVARSPLMSNRGSYLY
FT                   LRANGSVAAAAGVEGAKSACPLAYPDAPKQSTYDAVEDRSALEEGITGEGPLGALGGLK
FT                   HSFSQYEEKEVTGVAALKKIGEWIDGGSLALDASHGFPLLYELLNGSVPLRVLPSDDPH
FT                   RWGSALMRFVPPEQSCKRGTLMSVLRILSTSATLAKNAPKVEEKTMGAKFSAMFTQDGA
FT                   IGMLMRRVQPYLRDRAAQPGGIPMTLATRWLRRGGYAAPDMVEVPEQSGATSGGVSRDA
FT                   ARWALPNFEDTDRASRVFPLSHHLGGEAGPWGGPNLERTNLAALVDQPMAELGLEKYFD
FT                   AGSETADLEAARISALESESTQLGSVSGLPFDVGQHAAATTPIARQTLQRLKSDVKGAV
FT                   EKINASGKSTDVRDVLARAHLKHLTPADAARIAEEAVTGQATGQATSDARRALRQILVA
FT                   IRGLMARDVAAAREAAAAAASTANGLSRDPAAARSMLRLGLNRRSGAWAEATFDDLIEA
FT                   LLARDGAGTLAKITPGVDVTRAEAALHLAAEALLLISRHALGARAALAAENALAALDAA
FT                   PKTVAIAGRDACVFEVSLAAKGLANLLRTRRFYFDVDPSDVSGFSRTYDPRMLVFEYAQ
FT                   GIILRERQVQLVRDFTAAALDEKRRSECAQMLMGEGKTTVVCPLLGFMLASDDALVTQV
FT                   VPQSLLEFSRSCLRSAFAGVVRRSVLTLRFDRFTPLTPAPLYALRKAKRARAVVVTTPT
FT                   ALKSLVLKFLECAHLLDQSMVAKMEGGLVEGHIGRLTLLFEASSETRSRSERVAEAGGL
FT                   RPSEIAEMRKEGAVAAEIVKLFQSAGVLILDEVDLILHPLRSELHWPLGRRVPLDFSKS
FT                   RSGDGLRWKLPFFLIDGIFACTLGRAAAEEAQGSNEAAGIVKRIAEVVNRAVETKGVQS
FT                   TPHVVLLDQSWYNAELMPLLAEWAELWLRAHGAARGVADHHMRAYLTRSKGAAEAARII
FT                   EKEAEDDSLKMINLARDWLCSLLPHVLSKINRVSYGLLSAKDVQLLESANGSRVPTSRR
FT                   LLAVPFVGKDIPSQTNEFSHPDVVIGLTICTYRHEGLRRGDFRRVLRSLLEKLEQETGP
FT                   VGKRPSAKRWAEFVRRCGRRVRGEAREAAAAAARRTGAQLRASVTSVGASRISGLVSGA
FT                   APRGSHSHSSAVNLMDGSADSLETAAAASAADALTSSQSHSHSSDSAAHVQAAAALLAA
FT                   SEHEVWPLQLVDLRDGDQVEELYRLMRLVPEVIEFYLDDYVFPKTAKHQGMKLSATGQE
FT                   LGGDLIFPRRLGFSGTPSDLLPLELGAPKFEPGTDAKVLATLTDVDVVSARDLGGDWDV
FT                   RSLLRSVATADPPVHALIDVGALVTGLSNLAVARFMLEEGLVWAEGCVFLDEGDCQMVL
FT                   LRKGWHVVPLARLAALDSSKRFTFYDQVHTTGMDIRQAPGATAALTLGKDMTLRDYAQG
FT                   AWRMRQIGRGQRLELLVVPEVAKLIASAAAAGEGRGAAGRAAELQQLRDAGEHREADRR
FT                   RLRDALAWLVVNGMRSENVQAGLLAEQRAANIWRKHAYRGLLKAGIAVAGVQPAGIGRY
FT                   QQFLDVFRERVSFVVSNAVPTGGFASKRLAMAVSEHSSLLIDDPEASRALQKILREVAE
FT                   TEESTAALRAKLRGAQVGGGGVGAGRSPLADIADLLANAGGTAGDADAVENDNFDGGVG
FT                   GSGERERYLDGEQVQEQEQEQEQEQEREQEKEEERQEEREEEEFERLKYSRDDETQRGW
FT                   RVGDLKEEPNSGNSLGFHPLNEFSLFMGIGHQTPTLSFPDYLHLSKNYFRLGWSLNSHR
FT                   RLKNLIIVMDWVPDMTVTFGEEDPEDEEGSLNPAHAELEDFLSTPDKGGEKSFLQSVTD
FT                   AFQESVDAFAQATKRKRRIKSSWKPRELTKEQEAGLQSAFTLFDDAGIGRLDESQLREV
FT                   LRSADACVGGDEAALSALARRIANNASGGADAGVTLEDLKNAVRNMNIYGIQDGRYYVA
FT                   LSLAEAESLRAAMHGAKRELLEGAGDGKLVPFASTEVGLRIAAPGGGGALIEATSGYEP
FT                   AELFQAATATQCFRFVDSQVDFEDHELSLLLRSLQGNSCADRAEFFERVRAVRRRAKTP
FT                   WQATPLAKALTTADEFAMLASRATSARVRAALRKHKMRLLDAFRAFDGEQLGRLTYEGL
FT                   YGGLTWLGMDITPSQMMELAGKIDKAGDGFVSFEEFTEAFGPDDYVIGDGDDSDVPSAS
FT                   ALASQSAAMDDDIFGLNAMNNNAVNAQNSIADPLGALGADGAAGTDGWGGDEDLINFDG
FT                   AQGAGRVRIEARSLAGRSPQKSPSKSGADGPRAPVSRDPATLGVPLSRDILGGFRLALK
FT                   QHGAFERTWMSEGSGCRRAASFWNAKIETSSFARNRDRVSLGSYAVPAYHDPTRAVGQP
FT                   ANALEIADNKAWSMTGSVHMAGVIDALFPHPVRFRQVWGQEWKHTAAYAWAAVSPPGFS
FT                   ALGMVLTSSSAPPPLTAMRCVPTRWTKSPSSQPRLVWDNGGGGGRPASIWIVNSLGTAH
FT                   VTVGFDAPTHADGILELVPASQMLPEDVLDPGAGDVRKGADNNKAVNNSSGADNKEGLR
FT                   GRAAMFESVAREQREREAEATRRAQAALNARGASGDDLLMGAVDFLTGGGVGEPEPPPR
FT                   HAVDHRRVYEAWLEEDERPTHNAGDPFGLSGGGSGGGAPAPAPAPPRSAAAGPMRLGGG
FT                   RGDKDVNPFARMDPLGGLGGLGVPSAPAPAVRPPAINPPPSTQTRDLLSGDSLDPLGVL
FT                   GAAPVREKPKESIFNASSRKQLKKKD"
FT   CDS_pept        complement(262482..265331)
FT                   /codon_start=1
FT                   /gene_family="HOG000029906" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635817"
FT                   /orf_name="MICPUN_106231"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66408.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG317579"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000199C249"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ5"
FT                   /transl_table=1
FT                   /translation="MARDMIERFGNPVPMDEPVRKSYSRRPATVPSNHTPIVWDTPYDT
FT                   EGSLDGAANRFFNRGNERLYEAYSQLHNMAQEFDKPFDSPAILVVGHQTDGKSALVEAL
FT                   MGFQFNHVGGGTKTRRPIAINMKYNATAVEPRCFLLKDDSYGREEEMTLPDLQRYIEAE
FT                   NQRLENDNGFWAKDIVVKIEYKYCPNLTIIDTPGLIAAAPGRKHVSTQHASRQVETLVR
FT                   NKMANKDYIILCLEDNSDWNNATTRRVVLDCDPELRRTVVVSTKFDTRIPQFSRAGDVE
FT                   FFMKPPAKLLEPTLLGGGPFFTSVPSGRVGGSRDCLFRSNEHYREAVVQQEKRDTAELE
FT                   RRCDRRLHSSERSRVGVSQLRHFLERLLQQRYLENVPTIVPVLEREHRAASVKLRETDL
FT                   ELKNLDTDKLKEKGRAFYQHFLEKIPELLRGTMAAPPRVFGETLAHEHIRGGAFVGQDG
FT                   RPVELAYLDVPNGEMRLFGGAQYHRALEEFRAIVGQVQCPVVSREDIINSCGVDEVHDG
FT                   VNYTRTACVIAVARAKDTFEPYVHQLGFRLAHIARRLLPVAMYLLQKEGRILTGHEAFL
FT                   KRIGSCFAKFVDQKVKACQDKCREDLASTTQFVTWSLHSGNKSGLKSVLAGREQEREEQ
FT                   RDRDRDMHPRDYDRRDPAAEYDDERYERESNRRESNRREHDRDRRGRGGARDPLDMNED
FT                   FIDYVDERDERRGRRDKHRRDDKKESREVAKRGGSADDKVVAGPIVDVGSKDMISLMDN
FT                   TLWNRNMKDVTLDVVDMLVRQIYAGIRAYVVQSVELKFNCFFLMPLMNEFSGFLRQEME
FT                   MAFEENLDQVFDVRMVRMALEERQRKLESELEQMEHIQEKFAAIHNQLELQAQGSPATA
FT                   AAQAAAAGKGSFQTIAEREIEASRAAMRASAEMAEEVRRANKEFAHHSPSKKSFGSPTR
FT                   SGRVPLSSMSNSADLHGRV"
FT   CDS_pept        266573..268027
FT                   /codon_start=1
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635818"
FT                   /gene_name="DLDH2_GCSL2"
FT                   /orf_name="MICPUN_104967"
FT                   /product="Dihydrolipoyl dehydrogenase "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66095.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000199C24A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ6"
FT                   /transl_table=1
FT                   /translation="MTMKISAHDYDYDLVIIGAGVGGHGAALHAVECGLKTAIIEGGVI
FT                   GGTCVNRGCVPSKALLAASGRVREMRDADHLKMLGIEVGDVRFERQGIADHAENLASTI
FT                   RNNLTNSMKGLGVDILLGNATFRDNHTVSYGNKKCTAQNIIIATGSIPFVPPGIEIDGK
FT                   TVFTSDDALKLEWLPDWVAIIGSGYIGLEFSDVYTALGSDVTFIEAMPKIMPGFDGEIA
FT                   KQAERILIGPRNIDYVTNVLATKVTPGIPGEKPVTIELSDFKTREVVDVMEVDACLVAT
FT                   GRAPFTDGLGLGSINVETQRGFVPVNERMQALDKDGEVIEGVWCIGDANGKMMLAHAAS
FT                   AQGIAAIECMCGRDKVLNHNSVPAACFTHPEVSFVGMTEEQARAKGEEEGFEVTVKKTS
FT                   FKANSKALAEKESDGMAKLIYRSDTGEILGMWIMGLHAADLIHEASNAVNQGMKAQDLK
FT                   FAVHAHPTLAEVVDEVFKQVGSTVAH"
FT   CDS_pept        271899..>272225
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635819"
FT                   /orf_name="MICPUN_86685"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66096.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C24B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ7"
FT                   /transl_table=1
FT                   /translation="MSSGALLGAYSNLRLDSEEKLEEGLQEDVFALMAKFGFSKTEEES
FT                   EMQKFREVFDSIDEDGGGSLDIEEFTLGFQKVNPDMTDEQCRKIFDEADVDGSGDVDFE
FT                   EFVEI"
FT   CDS_pept        complement(273207..274124)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635820"
FT                   /orf_name="MICPUN_62357"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66409.1"
FT                   /db_xref="HOGENOM:HBG557423"
FT                   /db_xref="UniParc:UPI000199C24C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ8"
FT                   /transl_table=1
FT                   /translation="MSTLALASAPVIRLASGRHAASTGRACPPRVHLAPRARPRRERRR
FT                   RWRQFVNAAVDPDDVDHPGQDRDDYADWKAAKDDMSEAFKRAAAQAGRKEDFVVGAAPL
FT                   DEQMLSRVMLQLLNNHARGVPAAPFLDKIKDDMCLDGYKSVLVGIGRTRQWALAREIVD
FT                   WVRAQGLEQGRKGSEVLTSNWFVALIRRRVDDREWEAAVEVFEYMRDFDGVPSGECIEM
FT                   FAQVTDHEGAMNSMTVTRCRRVGEWLAGSDAGRALWHLSFGTPGQAAPEAAPSRSVRIA
FT                   MPTEEFDINGDIDKLREQFKDYLE"
FT   CDS_pept        274103..274612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635821"
FT                   /orf_name="MICPUN_53315"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66097.1"
FT                   /db_xref="UniParc:UPI000199C2F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDQ9"
FT                   /transl_table=1
FT                   /translation="MRAPALTSSGSPPVGRVRAMWAHAKSFQRWSGCTQVALTFFRRYV
FT                   SEGPAARREATERIRFNRKSPRSQTLARLSSHLVVQSTVPSLRSLFPPERVVSQRVRQL
FT                   GRSVGQTEDAKHQQRRPDGDHHPERQRQRRVRRVGVAHLHRFRRLWAVQGVLLDRADAG
FT                   DATAGK"
FT   CDS_pept        complement(<275336..>275938)
FT                   /codon_start=1
FT                   /gene_family="HOG000045364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635822"
FT                   /orf_name="MICPUN_70293"
FT                   /product="Predicted protein"
FT                   /function="copper ion binding"
FT                   /function="peptidylglycine monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="peptide metabolic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66410.1"
FT                   /db_xref="GO:0004504"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0006518"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG046476"
FT                   /db_xref="InterPro:IPR000720"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniParc:UPI000199C2F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR0"
FT                   /transl_table=1
FT                   /translation="KSLGQVAGIVTEPDGRHAWAFHRGRRLWDGDSFDPSTHKMKDLES
FT                   PIAENTIARIELATGKIVKSFGANEHYMPHAITLGPDGDVWVTDCGLHQVIRYNASDGA
FT                   RVAEYGKKLIPGKGKDGFCKPTQVAVAEDNSFWVSDGYCNGRVARFDSRGEYAGEFKPG
FT                   TDGDSTTGFEVPHAIELDSRDSTLYVADRERSRITAHS"
FT   CDS_pept        277268..278176
FT                   /codon_start=1
FT                   /gene_family="HOG000100118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635823"
FT                   /orf_name="MICPUN_62359"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, hydrolyzing N-glycosyl
FT                   compounds"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO66098.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016799"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="UniParc:UPI000199C2F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR1"
FT                   /transl_table=1
FT                   /translation="MLSASTFEKFRFTGGRAVAAASVSRKREGSPLTPPQPPRARAKPD
FT                   DEVSDDPSVRQHPYIAPAPARWRERYAPACEACEAARVPCVHHPEVPLKLLIIGHNPSE
FT                   HSWGSGWSYSNPSNNFWKLLAKGRIVPEDWTKEDCPRLPGDLGIGFTDAGTVPGNDAGA
FT                   YNRATMKKWRSDLYARLRGHVARCADASGDEDARVGHRSSMSIASRHGPDVVAFSGKRQ
FT                   YAQLFDAVPSRVDAGRQPPESLPPGWPLCPERTEVWVMPSSSGRAAMTREAREGPWVEL
FT                   GTRLATIPWPRAEYRGAELSD"
FT   CDS_pept        complement(278350..279711)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635824"
FT                   /orf_name="MICPUN_62360"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66411.1"
FT                   /db_xref="UniParc:UPI000199C2F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR2"
FT                   /transl_table=1
FT                   /translation="MASDRQDERRPLIGRVDGSGAPLDPSSPRALEEGAGGPHRRATPA
FT                   GSTACARVTMCAIAAMGLIAAAYHGLNHHHPATAALLGLGDAPAGTPGLLGRERAEARI
FT                   DERRATARLARVDARRAERARAVHDTARTVATRADSHAEGDSNDSCRIIFYYHVPKTGG
FT                   GSIVRYFGEMRGVDVIRYESTKYITPEMGEIYTWNSATADDHWDRYVLPRALKPGNHLV
FT                   VEHWGRPGMVEMERKLADLRARAAAANCEVMTSTTLRDPIDRDVSDDVFRRMRGGGDAG
FT                   IDYLGDEQTRFLLLNSERARDGVAPRDLYGDHRARVEAEGALRAAMRTLRDDFDVVATI
FT                   ADLEAQKDAFVDFLFGAKANKGEGSDEASATEDEDDREEAAKVSSAVVSLLSQPLARVH
FT                   AIDYEKEGVDDARMRALRTKFERSNDLDKQLYRLAAEMSANDPRLAKHRQAPRR"
FT   CDS_pept        join(280555..280602,280966..281304)
FT                   /codon_start=1
FT                   /gene_family="HOG000248813" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22635825"
FT                   /orf_name="MICPUN_98038"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66099.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG746222"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniParc:UPI000199C2F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR3"
FT                   /transl_table=1
FT                   /translation="MSATTDEIIEKMKTLTLLEASELVKQIEETFGVDASAPAGGMVMA
FT                   AGPAAAAEEAAEKTEFDLVITDVDASKRIAIIKVVRGLTSLGLKEAKDAVTNLPFTILE
FT                   GKTKGEVEEAMKELEAGGAKCEMK"
FT   CDS_pept        join(complement(282395..282429),complement(281494..282268))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635826"
FT                   /orf_name="MICPUN_62362"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66412.1"
FT                   /db_xref="HOGENOM:HBG609435"
FT                   /db_xref="UniParc:UPI000199C2F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR4"
FT                   /transl_table=1
FT                   /translation="MTAAQETGGDDENPDEQPQDRRARPPLPSLEEKTPAGLIRRFFSV
FT                   QERRAASYNRFHEGFDSHLSGAMGAGDYGRLCGEITREMAALSLEALAVEEALNAASLE
FT                   SPAACIRVVQLGEKAKLRMTCTLQVLKKSHSERRWSWQRTTEEAEEAEAAAAAMAASAH
FT                   ANEAAIREENSSSNAGSTGGLGRLNPGWANGNFRARCDVPEHAAFGGFRCGCGERNDAE
FT                   HAPEPTEEEYDGACAEATRELENAVTGINDALEELRQELADLLEDDE"
FT   CDS_pept        282555..284291
FT                   /codon_start=1
FT                   /gene_family="HOG000174281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635827"
FT                   /orf_name="MICPUN_62363"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring pentosyl
FT                   groups"
FT                   /protein_id="ACO66100.1"
FT                   /db_xref="GO:0016763"
FT                   /db_xref="HOGENOM:HBG557427"
FT                   /db_xref="InterPro:IPR007306"
FT                   /db_xref="UniParc:UPI000199C2F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR5"
FT                   /transl_table=1
FT                   /translation="MQWDDDPELADIGPQSIYKVVRALKKDDHGAYNCLASVVADASFV
FT                   RDVCARYPNLPVFANLRCGLWYVDPETRGRRTRTGDDDDDDDRGARSDASLAASDAVGT
FT                   CYFKSTDGHCNNWSFSATRLNLHVAEAAATSGGCVVVDATRSSTKRFPDSLSKTIPVWA
FT                   ETLSRAVARRRGEPIDDRIDWRAGPHLPVWVGDNERNSIAALMPAFEETLEGVFGDGAP
FT                   DDALASLAAKLAKPLRCVWASRENATSLPCLGAGGRSKWDGDFVPLVLVTASEPMARHG
FT                   ERRSGADGAPYAYVPGAGDDEESWSRGLTPSVFWQNSTEILHAGPRGCAAVVDRVVTRT
FT                   HSLGGDEGHERARVTNKGGLGYEPAGGGDDSSRLAPKGCAEVGARTAPPGETPLRAGGV
FT                   RLLDAFGVSLALGSAAALATEAAWERVDAVLYVGEDTPPLPPGWANEESLREPVGEKTS
FT                   EDSQRAKAPRGYPKPFKHVPMRYAKAARRDVADGLDACLQFIRSNARGRTLVACKDGVD
FT                   HCCGVATAALVDASMSGEEAGAVSKEEVRRRLADVARAHPECRPSRGTLKQVFNRMFEM
FT                   RR"
FT   CDS_pept        286411..>289522
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635828"
FT                   /orf_name="MICPUN_53321"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66101.1"
FT                   /db_xref="UniParc:UPI000199C2F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR6"
FT                   /transl_table=1
FT                   /translation="MQLTVVIEVLGQPAKARKKDKDDGEKKEKVDKKEKVEMKEDGEMR
FT                   EEVEKKEESTEGREVDGFWIPDEDEPPASTPAVSPGDEARPGGGWGEWRTVIPKEGECD
FT                   GAVGAAVGIINALCTHPVLFHVIDGHPRLDDLIRAVTRASASQCSCAWATFSCVVNLSA
FT                   RAARVDDDTDAPSHELGDALLSSPAAGHLLRGLRNAVCDRWPIMSLEEMPDVRCLPPPD
FT                   SPERAARRREREERRKRREEKRNKRPRRDTWKEKTPKEKAKERRREARRREKEARGVKS
FT                   SEAAAEPEAGVDAAPAGAPGSSTPSEHVRPEEEPTRPPTVPERLEATDGESEDETDEDA
FT                   EDPNVLHPNDPMANPANRLLLRTTAAAALCSLARVQRRWDEEDLRDSGGLYSYDASPAD
FT                   AIDVDRDDFFDPVTGRRPWVAPDIVSRRLADRIMGDTGRIAKTIKEARKLADRIIGDTG
FT                   GFAKTIEEAQDSYDRVIASFEEAHEAWYARRGGAAAGRPRENDRPVPTIDGLDDDDDAV
FT                   WRDHALTARWWRLRLRREWAEANDREAVERRDAPETTAMVDSDDEDKKSDNSSDKKSVN
FT                   PSDSDSDSDKDDPEPFEPDPDAVKAASWPDRRDCPKGPLPGGVDPEGILATVPLLDDIL
FT                   AALSKADTEDVGVAVEAVETLAAHEDARCLLIPSAPAVIPKLIRHIASTARQMEEARAN
FT                   GGVVKQPTEKEKKKEKKKEKKKEDGEEGVREGGFWIPDDETKRSKKRSKKKRSKKKRKR
FT                   GKPPTNVANLCARNALLVHTLYSVAKEAENFEEGSAWHLLLESTDELLPSFLTLLRPVP
FT                   VNDATPWLNDMAPLDETAGGPSQQSSHTQRRPSSRSPSADGDVNTPSPHVNAHKPEQHP
FT                   NGHSLSATREMIGELGRNALIVLAEMADPANSRFDSEKGMRWAKHVIAHRRDLIMVLLD
FT                   IMAITRANDAVEAERVKLAEERAESRPSSAGGTGTGNGTLGVVAAVHGENHGAQENSRG
FT                   GSVHGAGAKDGLVGIPEDEESTYAEPPPAYATLADVSEVADLASNDQA"
FT   CDS_pept        292003..293151
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635829"
FT                   /orf_name="MICPUN_91960"
FT                   /product="Predicted protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66102.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI000199C2F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR7"
FT                   /transl_table=1
FT                   /translation="MPPRGGVLVKFKGERGAGAAVRREWMSLVAAAAGDRSNLLFASND
FT                   GGVTLHPNAMSGEVTPEHLEYFASLGRLAAVALYHGETLPLRLTSAFCKRLLGHEMALS
FT                   DLESVDPALYRNQVVYVREHGVGGLDLTWSDTMDPTGVFHPGETRRLRKPSDWLDVDAG
FT                   TARHVEDANGAASEGGESEASEVTEAEVGAYLRALVHHRVLGAVRDQTSAFAAGFGAVV
FT                   PPQLRARMRGILDGSDLSLLIAGAATIDLDDWRQHAAYQDARLAFAFSTECFWRAMEEF
FT                   TREERIKVLQFATGLTSPPAGGFRNLVGYLGDAVPFTLGELAAPGRDEDGALPMAHACF
FT                   NVLRLPRLVEGAFGTGIEGGAKEMARRLRIAVGVGVQGFDDF"
FT   CDS_pept        complement(293862..294476)
FT                   /codon_start=1
FT                   /gene_family="HOG000205213" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635830"
FT                   /orf_name="MICPUN_98039"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66413.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG314635"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="UniParc:UPI000199C2F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR8"
FT                   /transl_table=1
FT                   /translation="MSEKKTRLFRIRKTVCKMLNARGYLVAQAELDRDKDSFTEEFGED
FT                   PRRDALTLQFDLREDPTQHIFVFFPDEEKVGVKTIKEYAKRMKDEQVNRAIIVVQQSLT
FT                   PFARQSLLECQAQKFYIEQFQEAELLVNITDHVLVPEHILLSDEQKRVLLDRYKVKETQ
FT                   LPRIQMHDPVARYFGMRRGQVVRIIRPSETAGRYVTYRLCV"
FT   CDS_pept        295083..295979
FT                   /codon_start=1
FT                   /gene_family="HOG000012454" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635831"
FT                   /orf_name="MICPUN_53323"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66103.1"
FT                   /db_xref="HOGENOM:HBG557430"
FT                   /db_xref="UniParc:UPI000199C2FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDR9"
FT                   /transl_table=1
FT                   /translation="MRNAAIGPQADSRKSNAPAFGFGAADRNASAKVYVSKEHSKVDFG
FT                   KLGPGAVYETKSSFGKQVDAKKRSPASVGFGSADRFLQPSASRAKRNPQVPGPGSYPLP
FT                   KAVGKQTQSKAITEGSFGFGTSTRDHAEKVFIGKEQAKVFFGMESPGPAAYKVSSGVGK
FT                   QPESRNTTEPGFTIPRGGRGKDVDMERARKLPGAGQYRTVASVGAQPRSENRTAPKYGF
FT                   GTGSRDGANKVFLGKEQAKVFLGMESPGPASLGPKAFGGTGKQLLSTRASAPKATFGTG
FT                   VRGSYDVNANPGPGAYA"
FT   CDS_pept        <296551..>297399
FT                   /codon_start=1
FT                   /gene_family="HOG000006000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635832"
FT                   /orf_name="MICPUN_68841"
FT                   /product="Predicted protein"
FT                   /function="protoheme IX farnesyltransferase activity "
FT                   /biological_process="heme O biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66104.1"
FT                   /db_xref="GO:0008495"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0048034"
FT                   /db_xref="HOGENOM:HBG611393"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniParc:UPI000199C2FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS0"
FT                   /transl_table=1
FT                   /translation="RVYHDLSKFKLSAFVVSTAAAGYVLGSGEVIDWEQLGWTSLGTML
FT                   CSSSANTWNQIFEIKNDSVMARTMRRPLPSGRCSVAHAALFGVVTGMAGVGLLKEKAND
FT                   TTAALGAGNVALYALCYTPMKRVHWLNTWAGAVVGAVPPLMGWAAAREGAIEPASGVLA
FT                   AALYFWQMPHFMALAYMAKDDYVRGGYRMLSHPSSDPTGRRLAGVAMRNAFYMFPLGAL
FT                   AVGCGLTTAPFAYEAALLAAPMALSAAVFYRRPSIPNARNMFYGSLLYLPAFQALACLH
FT                   RV"
FT   CDS_pept        complement(297755..298405)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635833"
FT                   /orf_name="MICPUN_102989"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO66414.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C2FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS1"
FT                   /transl_table=1
FT                   /translation="MKKKSAAKSDGKAIPPAPGTYPINPTKVYMGNLAWSIDENAIKEA
FT                   FADCGNVLSINWFEEKDTKKFLGAGVVEFDTQEGANAAIAASGREVHGRETKIRGWEQR
FT                   GTEASEKRAARAAQKMEVKPMGPKPPGCYTLFMGNLNFAIDDDAIYNFFKDNAGVEMSA
FT                   VRWLTNKDTGEFRGVGFADFATDEDLDKAAALNGQDCMGRPIRMDWQAPRQAS"
FT   CDS_pept        complement(298783..299658)
FT                   /codon_start=1
FT                   /gene_family="HOG000185005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635834"
FT                   /orf_name="MICPUN_86550"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66415.1"
FT                   /db_xref="HOGENOM:HBG332706"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000199C2FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS2"
FT                   /transl_table=1
FT                   /translation="MGVAFDGTLTPEQVDTYRKDGFLVIPDFASPDEVAGMLRRADELV
FT                   EAFDPSSVPRSIFTTKDQKRTSDAYFLDSGNHLSFFFEEDAFDESTGELRQAKSQSINK
FT                   IGHAMHDIDPTFRAFSRSTKVGKLLKSLGMTKPTPVQSMYIFKNPRIGGEVSAHQDSTF
FT                   LRSDPMTCTGIWIALEDCSIGNGCLWALKGSHTNGVSKQMVVDPQRRDGISFEGEYPAW
FT                   DLTKFSPLEVKAGTMVVLHGENVHYSAPNTSDASRHAYSVHFVDGDATWDPRNWLQRAG
FT                   DFPFAALDDE"
FT   CDS_pept        299871..303131
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635835"
FT                   /orf_name="MICPUN_62371"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66105.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199C2FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS3"
FT                   /transl_table=1
FT                   /translation="MTTGRDAPAAGFHRAAATVLRDASSPDDVAGALALVRRVVLGPNA
FT                   ASPAEDDEVVAETSSVRALASECAAAAEACAASKNPATARWTGFDAVGEEMLHAVAPRW
FT                   LPLMRSARRRALHDEILAAMPPTTAIRVLVPALAPSSTTAGRDLDDASKTAVATEAARA
FT                   LAAALERGIARRLLSNLEPAQVDDATQLCAALFSAADKLELSPGSHGCAAALHPVALAR
FT                   TVAAQLCDAARHSCAATGHSCAVTVAAAALARACRRGAADAVADALLDAVTDSSTSDVA
FT                   RPDWANELIDAISDAHAVAKLAQSFVLRCASRGATWRACERGFRAAFSVRFGRCASTRH
FT                   AVCDGMLLRRPQPRAMLPALIRVALVDPPRMINHPVNEGGGDKEAEAEAEAAARARHRA
FT                   TTAAACVDAWSQLELVRGGSGALQGHVAAVVAASLTAGALIGGSIQSGGGADVVVTPAA
FT                   LMRGISARLDSPDARTRAHGRKVAVALSRVVSPDRPLTFHDDEDFGASDIENGGDVSED
FT                   EEAWEAEAWRLGVDGVEDGEEADAEADAEADAFAAAVLGPEAAAGDKEEADGGPDEEGE
FT                   NDDEEEDDEDEDVDDPDGAVKLGGGAIRRADSGTDDDDDDDDSSVASALEPYDISDEDD
FT                   EEADIDGDPNAVAVSADDAAARRLRAVRATARRIARLPRPKTLSSCVDALRQARRGDET
FT                   AASKSSIDRADEAEGAVHAAEALIRAAPEEIIGAAPAMVSALLHAHPATPDPEPLGAAR
FT                   KKALAAMCAVVPGLAGPALAFEAFASGRCDAGQKLEVLDAVADAARELAALPPVPDRDG
FT                   DGATRLPSTHGDARLLGDDWKKPPGGRVRKVGRERVFAPASLARLRAGPSAVAVADAAS
FT                   KPRRTRAHLIGASLAGPLLAGAVEMVRQAEERAFAAAREEAAVRANPDAVHVPGGGIDA
FT                   LVLGRALGCLGECCAASRNAPDAAKIAGAVLELALSPGAMNHPQPHVRRAALFACVGAV
FT                   TSVPPAAAWHALSGGVGGVASGSALARGLAALEDAAGRARVTDPDGDARGLALRAQLSA
FT                   ADLRQRAVAVGTAGGVDPNRADPMYLLKNVSSLMIGDA"
FT   CDS_pept        303246..304646
FT                   /codon_start=1
FT                   /gene_family="HOG000030497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635836"
FT                   /orf_name="MICPUN_113572"
FT                   /product="DUF819 protein"
FT                   /protein_id="ACO66106.1"
FT                   /db_xref="HOGENOM:HBG557432"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniParc:UPI000199B947"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS4"
FT                   /transl_table=1
FT                   /translation="MAAAATTRGTSWSRVVLPRCTRPGGRGRTPAVRAPRRSPAPDGPV
FT                   KTRGRRHSPRAISAFDPSPDAVLAVLATCAAGAKLAEEKTKFGAKVSAPLLAMASAMLL
FT                   ATLGLIPAASPALDLVWRALMPLAVALSLLGVDLRDAARTSGPALAAFAVGAVGSVLGT
FT                   AVAYATVGPALGPDAWRVAACLCASYVGGSLNYAATAQALGLAAAPGGQAALAAGMAAD
FT                   NLAMAVFLSALMVAEADPPTEEEKAFASRAMEEDGGDGIVGEIGGNERVCVANGGTVPT
FT                   AIPTARTAACALATALVFLECGKLLARSLGLPAGTSLGVSSALVPVAAAAAATATRGAL
FT                   DASRAFAGSDAVGGALMLVFFAALGASADPRVAIKAGGPACVFIAVQLATHLAFVAAVG
FT                   VGAMRLPAWAVLTASNACVGGPATAAAMASARGWTAAVQPAIVAGTIGYAVGTPIGCLV
FT                   GQALRAWF"
FT   CDS_pept        complement(304722..306749)
FT                   /codon_start=1
FT                   /gene_family="HOG000268792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635837"
FT                   /orf_name="MICPUN_62373"
FT                   /product="DEAD/DEAH box helicase"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66416.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199B948"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS5"
FT                   /transl_table=1
FT                   /translation="MASVKAIKNAFVEDDDVVIPDTSGMPVTKRAKMGGENEAPNGVGA
FT                   GEEKNEKEWWEVDETEEEYVPLRKRRDQGVNAAAARMGQKLRAPGGGEGDERAGSPGIQ
FT                   DAAGPSSNKGGDEPGGPSNIREFAPPKEKTSLLSRAAGLKAMASSITPAEKLAQEEAAI
FT                   LKSINDKKALMSVQELSKDVAYTHSIETGWKAPAHIRKLTEEERDDVRNKWHIIVEGVD
FT                   IPPPIKTFREMKFPKPIIDELTRKGIARPTPIQIQGLPVILSGRDIIGIAFTGSGKSLT
FT                   FVLPMIMAAMMEEHRMPLEGGEGPVGLILCPSRELARQTHEVIEGFTVELAKQGMAQMR
FT                   IMLCIGGVDSREQSDIVRNAGVHMVTATPGRLKDLLHKKRMNLDICKYLCMDEADRMVD
FT                   LGFEDDIRDIYSFFKSQRQTLLFSATMPEKIRKFAESALVNPIVVNVGRAGAANLDVIQ
FT                   EVEYVKQEAKIVYLLECLQKTAPPVLIFCENKGDVDDIHEYLLLKGVEAVAIHGGKGQD
FT                   ERDWAISEFKAQRKDVLVATDVAGKGLDFPDIQHVINYDMPEEIENYVHRIGRTGRCGK
FT                   TGIATTFINKNQSETILLDLKHLLREAKQRIPPVLAMLDDPMDQEAELVALTGTKGCAY
FT                   CGGLGHRIGNCPKLGNYKEKQISDMGRKDVFGSGGFGGEM"
FT   CDS_pept        306929..307846
FT                   /codon_start=1
FT                   /gene_family="HOG000201142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635838"
FT                   /orf_name="MICPUN_62374"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66107.1"
FT                   /db_xref="UniParc:UPI000199B949"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS6"
FT                   /transl_table=1
FT                   /translation="MSARRAVTTLGRVLGGAVSARGAAPRAGVWAPALSSFGSEQGGGV
FT                   GWDHRRRAVDPASCAHRAWSSFHATSRAEDAENDSGHRAGPATLGARRVVPGASSFASP
FT                   IAARHPTSRARSSAAGEVTEAADDDTPGGAVDARPDGVEYEAALAETVRMVKLLSLASL
FT                   GATIAGTPLLLELASPDLPANAKLTVSLVVDTFGAFTTGLLQWFVSPYVLKMRMADEHT
FT                   VAVEKLTLFARRYEETFAVADMREAETTRPLVTWEACGKLHYVEMGRVPGYLYDRLGLE
FT                   RFDAQAMAEKHAKERKEEDEEDEY"
FT   CDS_pept        join(complement(308201..313183),complement(308140..308157))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635839"
FT                   /orf_name="MICPUN_62375"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66417.1"
FT                   /db_xref="UniParc:UPI000199B94A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS7"
FT                   /transl_table=1
FT                   /translation="MDHGLHAQRGHGHLCVYSAPRVGTVCVRCVAEAISATRGGAGGAV
FT                   ADPAAHGSSQGFGHPSPPSNERRAPTPPPRQRLNTTRARHARALAGILRDPASGPDVAR
FT                   RWGHVVVACVVDALAAREEEDAEVATLLLDCALAVSTAAAASDGGATLDACISRALVHL
FT                   SSADPARERRGADTPPLHPRANLPTNLGGSGGSSQPSQEHFYIAPGPRGGSQGYGTQDG
FT                   YHLAVGSSWEATWDGGWNATGAAVAPAAPPASQGQIQLDSPAFGVAAHLASPQPRARHR
FT                   GGTDCGRARLLGLIAELLALDVPRGSLPAAFLAGVADVEETGEWFGGTPPARTALHAAT
FT                   HLRHAPHPDPCGVSSPLAIVIDALRDPAASGDARLAALSLCAQLASRTAGDRGCFRGVL
FT                   AWEPGAGQAMAAGALAAVARIAGERGGVGPGTDAAAAAVAEALLVVAACAVADDDFDLD
FT                   ALLREYPPGVAIAKVPTFAGVINDALLSPRLALRADACDCVEVVVSARGDARSVDRLLS
FT                   FDVAEHVFELLRDLTRARAMTPAADGPRTTTTRGGGRGVSVTSVTRTERDAAARTALAA
FT                   LAALAEQSHRGFNPRLACGAAPVASTLAAAQRDRDVEATSAGCRLLFAVASGDDPGNVP
FT                   GESTAAFAACLADACDEAASINLSSDPFSDPFSDPSGGCDVTVTEEGERARAAALAAAA
FT                   LAGFLRGWGGRDLDGDVAARAFATFVADVSRNLREFANGTPTLDPPGLGRNARNARDGY
FT                   PEALPGGGGGGVFGRVRWRLGAAVPAGARTACVRLLATGGGDRVGECAAVVRDAGLPAA
FT                   TFEATRRLSTVRRSGRALTGRDAEVADGVAAAAAASTRLLRALIAPPSPRSRARRDRLT
FT                   GGDEDEDEAEDAAAAAAAARRELALEMVRDHRAIESCLDGTDAGVFDYDPYPGMPDPAA
FT                   DAWGASQGCNVFYDVPDSDEDEENDRSGGTSDHDPDHPTPALLCNFLAVLVPAALGEGS
FT                   AIGMDVRVVDALAAKVPPFGSRSAWARGPGPDGRRVGLFDVMEAPDSTHGTLGTTLGTL
FT                   GTRVGVAAASDALIACAFARATFGADVGTDADEFSRGMAGPLCGYLVARGPGGWCPGGL
FT                   CASLAVWRACVQSLDGASASREFNPGLKRLASFVTETEGTIGANFVAALAGLHKLNAAG
FT                   WRRAEETLVTYAMDSVSDSAGRTLLSWLADNMPRYMNGVDACKSLFFSALDGENLATAM
FT                   SADDEISADAPAASRTFASWFADDVQTCTFLAGTCFVDSGGTCDAVVRGLRFVLRRRPP
FT                   TKGALAICSTCWDACVRLSGLRSTCSTPVQHQHVVGREIAADVALLQADAARGGFDPPG
FT                   SFGFASDPARLAGYLHDLIAVAAESPGAASVVNAVLLNALLSKVHEATGATESCAVGLP
FT                   RSVVRCLFEASVFPAVLAYARDVAVRWRSRTFSSLAGATSAVSLVGGLLGLGVRAIDGR
FT                   AACEAAGDKTTVIDETFARALCDVGVECEDSICRQLAFEALAATGVFRGDGGEIRRIVL
FT                   ESGRAGMCGGTSEGERDAAAMCAIPFEADADDAGDTPVDEYYWEETLLEEWLLGAASFA
FT                   RRDAAEPTVDSHPIAGRLAFARHVTSRSGRITCRVLREPEMRGTLVSLALTAAWRSRGA
FT                   DRAPIDLLRTLFVDTGVHTANDEGASTP"
FT   CDS_pept        313383..314699
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635840"
FT                   /orf_name="MICPUN_62376"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66108.1"
FT                   /db_xref="HOGENOM:HBG607769"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B94B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS8"
FT                   /transl_table=1
FT                   /translation="MFEDGATGRRLRLIVTDELGILRRAEAAGRSALGSKETFTMNARW
FT                   GQASRARGFVKGCCSAGQSGDSGVVTTSDDAPSGWLAVARNDKTAEVIEMATGAAMGGG
FT                   PVDVGGTPVAVDLFGPGSAREGCRLVTVTEEGDAVVHACGYEGVVTGFGDLSLGVGAGQ
FT                   ERIVEEWSEESRFKVIGNALSARVGGGGDRLICGGKGQGNDVKMYDVEEQKVIYKSKPP
FT                   PPNWLGYRAPPYVSAMHFIPGTDCREFLVGTGEHMLRRYDVREKRAVMDVPIGEWVITS
FT                   LQMNHDQSVAYVANNHGNLFGFDMKTQRMAHKFKGHQGGIRQIAVHPEEDLIVSAGLDR
FT                   WLRVFSMSTRKCLGQVYMQQVMCGVQWDARSPAWEEAFAEAEKKAKGKKKKKKARAVED
FT                   ADEEEVPKKKKKLKKSDGEKVAKKKKKKVRRDDDDDDEF"
FT   CDS_pept        complement(314795..316213)
FT                   /codon_start=1
FT                   /gene_family="HOG000200838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635841"
FT                   /orf_name="MICPUN_62377"
FT                   /product="F-box profile protein"
FT                   /protein_id="ACO66418.1"
FT                   /db_xref="HOGENOM:HBG557436"
FT                   /db_xref="UniParc:UPI000199B94C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDS9"
FT                   /transl_table=1
FT                   /translation="MPPKKKPKGKSPSVSLSGMSGDILDNICSHLAPPDVFNLATSSKK
FT                   LFRPFGAKLLQSSLRRQLDEVMQRVTTAQGPRVGVSDQGVDMHHPRRQFTVQDLFPDEE
FT                   RQLDFDSSGRPQVILSGSAVVQCALGPDFRGVEDEFEDDDSQGKDDDDSEGVDDSEDED
FT                   DEHDDDSESEVNHWKDADIDIFCTWDAAPMIRRRLFQRCGLICSGVDNTYMQSGRDLAG
FT                   DIEESTSSVVHHVESYSSRPTEGKTQWTHFHVDPEKEVDYDSDQYANKLREWGEDALKK
FT                   HSELEGDCGVFVWHGVGIPGGALNTEFLYDYELRDLKFVQLIVAKPEVKDARILLKNFD
FT                   LEICKCSFNGKGFTIPAPADTFAGRTIITPARRDIIEQFVKGYSKQILDKRSEGFDPLK
FT                   LLKGMTKKSWKGVGLGPYKQDDYYDRYMFCQRLFERLKKYRERGLEITNAPHMALYLAK
FT                   DFPPMPSDVGCVVM"
FT   CDS_pept        316382..>317651
FT                   /codon_start=1
FT                   /gene_family="HOG000200838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22635842"
FT                   /orf_name="MICPUN_62378"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66109.1"
FT                   /db_xref="HOGENOM:HBG557436"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000199B94D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT0"
FT                   /transl_table=1
FT                   /translation="MDPPAKKMKTSPPTLCDMPDEILAHIASHLEPGDVFNMVLSSKKL
FT                   FRPAGVVDLTADEDANREEALGFKLVKWSMRHRLKKILTLFTKKKFTFDDLFPEEERNL
FT                   DFVSGQPQVSFCLLSHQPPAQLLHRLLTRGMASQMLIAGSVAVKCAVPRRSGKWRPGDI
FT                   DIFCTWDAAPMVRRRLIQRCGLICGGVVNNTSYTDDGPYLAGDVENRAAAVIHHVEEYA
FT                   ARPMNEDEWGEWKYKPCDAGGLEAYYKMAKQWGAEVRAPLSNMHPYIGQPGGALGGDFL
FT                   FDYNFEHKGSVQLIIGRPDVKDATKLLRHFDIEICKCAFSASNVYIPAAVETLAGRTFI
FT                   TPARHALAESFMKALNKVKPKFPDGTCTYDDSEMPKVLAKIKHKVWKGIGLPPYSGSQY
FT                   DFEHKYTVIARLFERIQKYHTRGV"
FT   CDS_pept        complement(317784..319145)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636278"
FT                   /orf_name="MICPUN_62379"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66419.1"
FT                   /db_xref="UniParc:UPI000199B94E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT1"
FT                   /transl_table=1
FT                   /translation="MRAVGGRSASRPMPKRRKSPAVPPGQRKLTGVASLGASAHVTPRA
FT                   GSRFAACPICAKNFPRHAVETHAGGCLGEPSPTPSTSAPTQPPPSNDPTRRPAARLRST
FT                   SGPVARVRIGGPDASWMPCAVESLREMVPDLPFVLVERVMPPRDADALLEDLRAEATTW
FT                   GQDEWWIAGEARKAPRLTAVYEMRVDDARAEALRMAGLDDDDDDAEDGGGSERVPPPGM
FT                   RVAAERASAAVTAALRSVPSRHLPDDVLESIGDDSYQWAPTYAVANFYRDGSDRVGPHA
FT                   DQLTSLGPLPAIAGLSLGATRSFRLRKRWPGRPGEDASDRSGDVWVDVPLPHNSLAVML
FT                   PPCQELWTHEIVREGGGGAGGGARDGKARVSLTFRRRARDWVDRAPTCECGRRCVLKTR
FT                   RGDAPAPAFAVNTDNDGVMDAEDGKTPVMYYYTCDPVNGGKPCKFYKPVKVVAL"
FT   CDS_pept        319290..320270
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636279"
FT                   /orf_name="MICPUN_62380"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66110.1"
FT                   /db_xref="UniParc:UPI000199B94F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT2"
FT                   /transl_table=1
FT                   /translation="MGRTRGDRRGSWDPSDDRVFSSVAETLARDAGPVEELARRAAESF
FT                   AAPLAASTAAFLVTARLARRSAYALGVSCATPMVGAVMSVCAVGGSAALAGQAAREATS
FT                   WASAGRGDARVGGRASWLFPSGFGRARADAPWDEREMTADAILGSLMYAALGRGLKTAM
FT                   PSDVSHPGAMARKSLPANGAHYASEGQKRTLARWMARHGCHHCGTKVGAVIGDHMPPNK
FT                   VAFGSSAAAEAFREGTQSLWTRAWQAVGGVPKQRFFPQCRGCSDLQSVAVRTGVKKLVM
FT                   HGGGVKIGAVVAGCVAARHYAMARHPEEYAKWEAKLEELKFRFAP"
FT   CDS_pept        complement(320338..321729)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636280"
FT                   /orf_name="MICPUN_62381"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66420.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000199B950"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT3"
FT                   /transl_table=1
FT                   /translation="MRVASSVAAHRPPRTSVRASSSGRTTSSTSSPSRSVGPTRRPSHR
FT                   HRAASPPRAAKDDLLADLVFALATQARDKIQKDFNELVVEPFADPDPGPLPDLVPPSQL
FT                   ADPDSKFVAVDVRGTRVVVHYKEHVVRDDLGDDDADGKGSTDEHGVDALVCLHGANGSE
FT                   FSFRRLLPRVAAAAPGTRCIAFDRPPYGLSTRPDPPGRSSGDGSEDASSSSGVDFVYTA
FT                   AGQAELTLALMDALGIRTAALLGHSAGAPVALDTALVAPERVRSYIAVAPAVFLGDPPG
FT                   EKDEDGTSAKKGGGGGGIKLPLDRQLRFAWFRFLVSQDGPGLNVVRGSVRRQMAAIEEG
FT                   RTYADLPPETKAAYMRPTKAENWDVGLLQLFRGGSFGGDGDRLRAEMPKLAANGVKVAI
FT                   VVGEKDRTTPPPLSEALRDACVDAGVGDVRYELMPMASHLPMEEEAGGVREKFEAIVVD
FT                   VVSAL"
FT   CDS_pept        321908..323092
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636281"
FT                   /orf_name="MICPUN_62382"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66111.1"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="UniParc:UPI000199B951"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT4"
FT                   /transl_table=1
FT                   /translation="MAPAEDGPEPRAAQVDDPPPFVKGVKGRKDMHVPKAVWRQHRPRK
FT                   PRAADHVEGTGSKGGPTSARVINGVLRSLEELAIACPRNLKRWGLASEDEYFEHVRRRD
FT                   VAKAALDQLLRDPSVSADDKHDAAASFSMNHGPAAFNCRRCWLLRGCCVCRMLVSLPVQ
FT                   ALGPHRIAVYLHHHEFGRGSSTGALVSACLGGDAYVAGLRRDEEALRELCEREDGRVAV
FT                   LWPGRGAVGVGDLPGIVVGGGEKKGRDGDEKGGDGDDEKGGDGGGRGWTFIAIDGTWKN
FT                   ARNMLKRLPKDRVVLVSLPPEAFRFVREANAGITGGTGDGASLLAPVRKYAGAPEGRTS
FT                   TFEACVALLRALGVDEATCKAQLENVKTKVDAVKVQKSMAPVYEKVTGEGDFET"
FT   CDS_pept        join(complement(324293..325390),complement(323480..324223),
FT                   complement(323204..323455))
FT                   /codon_start=1
FT                   /gene_family="HOG000238966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636282"
FT                   /orf_name="MICPUN_98042"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO66421.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG666023"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR004106"
FT                   /db_xref="UniParc:UPI000199B9DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT5"
FT                   /transl_table=1
FT                   /translation="MSTSDAPDDVFLEDLRGERSMEWVKAENERALAAIAGPTGKPEDD
FT                   PMFAKLRAIYDDKRKIPNVRLRGDFVYNFWQDEHHVKGIWRRTTMDDFKTPEPTWETVL
FT                   DVDALAAAEGKSWVWKGPQFLDYGPGDDADRVDRCVVNLSDGGTDACTVREFDVVAKAF
FT                   VDGPNAFVLPPGKNSFCWVDRDCAWIGHDFGAGTMSPSGYPLTVREWRRGQPLTDAVEI
FT                   WRGEPTDVVASGSAYWDKGHRYKVWYRAKTFYDTVRFVPHPDRPTEMVHVDIPTDFSFA
FT                   TFADHVVIHCKSEWHVGGGKGGDGGTKFVAGSVVAHPANDFFRGERSDFTVLYSPADDR
FT                   CAYEGSSETKDYLMVHALEHMVTRVYSFGAAGVDSERSNELFVTTEGFLDPTTLSTATA
FT                   PDLDVSTPLKTNTAWFDASGMSVELREATSDDGTKVPYFLVRGQANGGSNPKPAPTVLY
FT                   GYGGFEISMSPGYSATVGESFLTKGVCYAMACIRGGGEFGAQWHRAAKKEKRWRAYEDF
FT                   AAVAKDLVATGVTTHATLGCMGGSNGGLLTGAMMTHYPHLFGAVVSQCPLLDMERYVLL
FT                   TSGPSWIDEYGDPSIPEERDALLGFSPYHNLEKSVHVAESAKRGEHIPATLFTTSTADD
FT                   RVHPSHARRVVHKMRALGIGDKVLYHEMTEGGHAGAADNVARAKVKTIENRFLVNALKK
FT                   NEA"
FT   CDS_pept        325731..327389
FT                   /codon_start=1
FT                   /gene_family="HOG000221827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636283"
FT                   /orf_name="MICPUN_62384"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66112.1"
FT                   /db_xref="HOGENOM:HBG503524"
FT                   /db_xref="UniParc:UPI000199B9DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT6"
FT                   /transl_table=1
FT                   /translation="MQASALQSISRCYRLGLRRPAREFPARGFQSARPRRWIGASAAAG
FT                   GADGGTAVEDTPATKGGKGGKRDLQEAYREVREMLTDPSRLVRAVASGKAKGADPEWRR
FT                   LEMRPVALKGGVKLQVVKYDERQAFTSNHAYAGATPSAPRGRRGRRATGGGDPSRTAKS
FT                   PPVDADEAVDEALRCGFGHWRVETCEEVLSLRVTKSGEAAVSRSRSLLANANKGGGDNA
FT                   AATNRPLAHDRQKRRLLSPSDPFLVHVGVSTKDGASIKADRRDKYKQVEEFLRLVDAAV
FT                   ADARTGGHMSHGSSERPTRLVDLGCGNAYLTFGAYAWLNRTQGQPLEVVGVDVKRQARE
FT                   TNRRVAAALGWERDCVFVEGTIAGASLAFPTPRGGDGGDQSPGKSEPPEVDIVLALHAC
FT                   DTATDEALVRAVRWNAPLTLVAPCCHHDLQTRVRENTQLAPSLAPTLRHGILRERLGDV
FT                   LTDAFRAHVMRLLGHRVDVVEWIGGEHTPRNTMIRAVRTNARAAPELWREYDEMRELWG
FT                   VTPWLAEALAPELAAAREEAMRDPVPVAADGEVER"
FT   CDS_pept        complement(327525..328472)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636284"
FT                   /orf_name="MICPUN_102998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66422.1"
FT                   /db_xref="UniParc:UPI000199B9E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT7"
FT                   /transl_table=1
FT                   /translation="MARISLLALLVALLALSHGVTAAEVGSATDYDCTCECCAPDKCAT
FT                   EGTKTYTIAVGSRDKCTDEACSAQVSQCPDKGSHNSGATVTATYHDCTCSCCRSGTCQN
FT                   GLKKYTFDAGSPDKCTQSACASAFAQCPDAGSHNAGSAQPEANNMVFATYQDCMCSCCK
FT                   EGKCPTLKYSYFDAGSKDKCTQKACASEFYWCPDAGAHNDGTINVALYTGPKEAATLAP
FT                   TAAKPSGVTVTKETTQMPTYGAALLSIFLIGLVGTVCGMFVYRRVQRERGFRWVQFDDE
FT                   GRMMGDQSSKPTTTVEMNGNGGSHGHVVSPFDKV"
FT   CDS_pept        328775..330433
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636285"
FT                   /orf_name="MICPUN_62386"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66113.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557442"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199B9E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT8"
FT                   /transl_table=1
FT                   /translation="MGKTKKRQAKRAAVEAARLEQAWGASGERVGSALAAGGDGMHVGD
FT                   ARDANDPRWIAARDNAMDPDSRFKVAQVKLKRNPMAGVSKPKTKQKTGILRIARAVEAS
FT                   LTQEACVALDTLLAECERGEREVAAPMDLCGKVLAMCQRGSFGKPAIRLLGRMERVGLP
FT                   VGPVQLRQVFFACAGKGMVPECLSLMSRHDIDTGRRLLGKDVLVRGCGLMPGGVDGPAG
FT                   LALLEGTLRGIAGGGWEGAPSSAAGGSVRVHMHPTWAPPRVEGAEGADGAVADPAADAE
FT                   RLAPTMYPGGDDGNASFWFVCDDDGRRRPADRNSLELWAPATASTIPLVASGLELETER
FT                   HDVPNVPGAFALTDVFSAKECGALRAAAHAIGWRRDEPDPSDPGRGRLDYCELVVWPET
FT                   AGRIWDRIKMHMPAGAVGVNARMRFFRYGPDTIYRRHVDGSWPDGRLTEEGEYVTDASK
FT                   GTLRSRLTLLFYLSEGFLGGNTTFYTSTPGHPGLISARGVAPREGCALCFPHGDAEDSP
FT                   VHEGSAVGVGPNGVRHKYIIRTDVLFESAGRPGSK"
FT   CDS_pept        complement(330496..335088)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636286"
FT                   /orf_name="MICPUN_62387"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66423.1"
FT                   /db_xref="UniParc:UPI000199B9E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDT9"
FT                   /transl_table=1
FT                   /translation="MSFAHERRSRRMVELEAAELHAARERSERFERRAAASASPRRVRR
FT                   RGRFWNRTYAPIEVESLPPELEAASLLRGAYDTTPRVPPGLGGERWETWRHVPTVVSPH
FT                   DDDHDHDDDDAAVPASAPPGLNPHAAPMASVVGKVTAKCYEVDTRDPKRVAQILRENRE
FT                   RIANESGKDGTASDAATDTEADSSESEVELEPSRTIKSRVFHDKTTRVPTQPEGSMRVV
FT                   ATVRDTRGVEMLPPPPPDAHFDAIAKFRRARHDKEAERRRRARERSRERAEAAARRREE
FT                   KRLAEEEKRAARSAAKDAKAAAKNAAKERTRAAKASSDSESERSSNPEPAKTPRQKLPR
FT                   MPRGFRRRDDASAGARGAWASACVRSLRHGAVHLRSGAVQTLKHGSNAVQTLPRAAVHS
FT                   AAVVGKSLHDAGHAMDAAVGSVAKNVVNASVNTWRGVRDSDLAKSAVVATRRFLARRPW
FT                   EPHLERCSWNVATPPAVSVRVGPARGPGWFRVLKVGPRSFPDLTPPIAPAAVDAHETRH
FT                   ASSSGERERSMAILVKAAGVPVAAKTPADALRMLGMEVRNAGNAVRNSSLRTLEFTLDS
FT                   AAKTVGAASRTVGGAAEGVGRTLFSAAERLAQRTEFYEELDIDMDDPDAPWPNGCYEDL
FT                   EGYTHKAEAWAVTPHWSKGMRVPPEESEDDEEEDKFIRSLEPKEARYRDAEDIAAMMLD
FT                   AGDDYDSYGNDDSYSYRSSRRHSPRQQPKPPRPSFNAPLSPLPPQPTEAEDDEYRHLSP
FT                   LFVPPEEPRGAEEGAVPLRSLRLDDYEESLATRVRMLQKSFPEVAQEIADAVYDYAGRI
FT                   GESGAPGERVAASGMSTKPVDVAAATRVVQELEAASMSVLMHGKIPTGETLRAWLDDVV
FT                   EGRGMGREAWREDNTDFFRGGSHSGSDSKGFSSLDNQETQYSLSPTMEVREVREVRTNG
FT                   RTDGADVGDAFTPGSKKFVSDIAGAFEGWAGREPRSYPERYDGLLARTFDGRDPREEAA
FT                   RVMENEARSRRFIRAWHAACHEGPIANAVRGIEHERFEKSPATAVKGAFAAAEGAIERV
FT                   ENVSKFFADTDDSSMDISRDEVAAAGVQSPKDVKSPPRATRKPWDFSDSSQSDIEVDPA
FT                   TPAPAPKPAVEGTAAAVEGGSGRKPGARVIGGLLSPFRTIKNGLKMLSQQNSPEMALKP
FT                   TTIAPVSETTSLPVSSAVSESPPASPSVENASEESVNAASASVSVSESASRSPSGSLTG
FT                   SPSFVAAVEASEEKIVASARDAVTSRFAGKDLEDALVADDDDDSDSEKSPSPAMQSARS
FT                   KGAQPTMSTGGSSMVTARTGGSVAFSGGPGFSNGGWSATKTIYFDDESPGGTASVSKPT
FT                   KTAPKTVIKPSSVAVSTKKIYEDESDEDDFEDRFSRFPRAIGDKTMDEMLDALDKDLES
FT                   SMEESPGPVRFNPFNRFKGFANTKTASVVDASADKENEENSGGNSSGNTTDSDTKEWRR
FT                   AVDRAKNVQPVQPVQQRVAAFGKVSSPLKPSRVRSPARELAGYGSARAAFEREASRLDA
FT                   SMDRGSRRRR"
FT   CDS_pept        complement(335453..>338254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636287"
FT                   /orf_name="MICPUN_62388"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66424.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="UniParc:UPI000199B9E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU0"
FT                   /transl_table=1
FT                   /translation="AENEVAFDVTSTLGTALVVAVPRNGCTTDALRRAVAAEHEQCRPE
FT                   FGKVTVRNLYGLRTHEAMGASQWVAVTDVALRHRADSMSWLMADLETSKAVPGVETMDF
FT                   ASPGMSLTNRSTWEAIMHGRAGVMPSPSMAGGTPLMSGYGGGGAMIPTPTGAPMSGTPM
FT                   SGGGGLRPIALANSLAVLGKRNAPSEGRDVDAMPPPPSRARVDDAAERKARQERAETAA
FT                   AAHLKDGVAALFKHGGEEKGSVPLRNVVFAKSLLANNKFITAVEKLDTSSLDALLRTVE
FT                   PAVAAILQVQKDSEFDMFDDLLGRLESLNATAARAAALAADPSGGTGNDTPGYSPGVAA
FT                   PTDVTNLLAVGVLCARVQKNGYKTKRSLPTRVTHALNAALDMSPGRFGAVGVAVVQASL
FT                   RELGYEGGAAPLPAAVPPVGVPPSPAASRSAEREREEARRSAPTPAPVSSSSDSSDDDD
FT                   DDDDDDDDSESGAEEEEVAPTQPEPEKPKPAKTQPDPEKSKPAKTQPDPEKSKPAKTQP
FT                   DPKAMSILANITLDDLHAKKAPAREEKEESSDSDSDDDDDDDSDSDEAPAKEEEKTETK
FT                   ISGIDSDSNSDSDSDKSSSSSSSSSSSSSSSSSESDSDSDSDDEDEKKSTSSSDDVPIS
FT                   QLANHKPKEKPAAAKEPAAPAKEPERAPEPSKESEPAKAKRAPSAYILFCNEERAKLPD
FT                   TLDAKAKMTELGARWKALDAKKKAKFENMAKDGKEAAKKAEAAKANADANPTKEASKEQ
FT                   PQKQQRQQKQPQGAKSGNAPANKPPAEKRKNPAEDARFAHLAVSPGNLSKLLKAATKTP
FT                   KVKVPAAGAGSGAAAAGGDTLAAGKKQRPPKKKDEVPKDNDDLMTVRCGGLVGSYIISE
FT                   KMVLCDGKKMTPAKFEEKSGVKTRRWKRTIKVDPAPETGAKPMAIGDFFSMMGVDFDEA
FT                   TKQ"
FT   CDS_pept        complement(338600..339430)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636288"
FT                   /orf_name="MICPUN_62389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66425.1"
FT                   /db_xref="UniParc:UPI000199B9E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU1"
FT                   /transl_table=1
FT                   /translation="MRRQRNGVSPRWAALVALAVVLGARGAVASERTTGLSSSARSVDP
FT                   RTRPGGGLHHDEQLACSGCSVLTRRLLHHLDRPPRDDISRTVTEPDPNDPTSTVEVPYV
FT                   RSERFLHDAMRRTCGDRSLSTITRHTTWLGDVTYRPDDVPWGDPTHADPAVDADLELMC
FT                   KRLMQHYRPELEDAMARREPWTACKALGCEDVDASVLDAIAHAIARLILKPWLALKLAP
FT                   VALAAFVFPWLWRPMFFPPRDPERIAMKPGEVERMIERAQASAGLDPISALKAE"
FT   CDS_pept        complement(<339613..>340146)
FT                   /codon_start=1
FT                   /gene_family="HOG000200839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636289"
FT                   /orf_name="MICPUN_71396"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66426.1"
FT                   /db_xref="HOGENOM:HBG611474"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniParc:UPI000199B9E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU2"
FT                   /transl_table=1
FT                   /translation="LVECAMLSALTGLLFHLSTLFRLDAYFGALFPLPIVIAAARNGPK
FT                   AASRVAVVTSMLLFLISGPLRAVNYYCLHGAMAYSLGWAWTKRFSWWVSIPLSATVRSI
FT                   GIFCSLMFTSLVLRENVMQLMVTQMMGLLDQIAANIGMSWMPTLGWVWAMALFFVLLNS
FT                   LSYVVILHAVFTILL"
FT   CDS_pept        join(340669..340673,340955..341600)
FT                   /codon_start=1
FT                   /gene_family="HOG000207014" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636290"
FT                   /orf_name="MICPUN_95416"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66114.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316566"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000199B9E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU3"
FT                   /transl_table=1
FT                   /translation="MSKLPSDTIRDGIAFVLEKAKAKPRKFTETIELQIGLKNYDPQKD
FT                   KRFNGTVSLPTIPRPKLKLCMLGDAKHCEEAVGVGIDHMDVEALKKLNKNKKLIKKLAK
FT                   KYNHFLASESVIKQIPRLLGPGLNKAGKFPTLCTHNEALENKVNGIRSQVKFQLKKVLC
FT                   LAVAVGNVEQTEKEIFVNTQTSINFLVSLLKKNWQNVKSLNLKSTMGPPFRLF"
FT   CDS_pept        343505..344017
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636291"
FT                   /orf_name="MICPUN_62393"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66115.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="UniParc:UPI000199B9E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU4"
FT                   /transl_table=1
FT                   /translation="MTSIAPTSIARASTVRATRGPAAAAARGPRADLRQVGMVFAGPDT
FT                   ARVRTGRARGKGRGRSAVVTAMGPDELEAAQLWSVAGLGLFIGIAAVGSGLKGEPEPCP
FT                   ACAQRGGEECIFCVGTGRREAPIKVTKRELNDDSVLGLTRRNPLECTACKGAGMILCKT
FT                   CRGTGFV"
FT   CDS_pept        join(complement(346067..346144),complement(345841..345945),
FT                   complement(344131..345705))
FT                   /codon_start=1
FT                   /gene_family="HOG000259651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636292"
FT                   /gene_name="ODA6"
FT                   /orf_name="MICPUN_96653"
FT                   /product="Dynein, 70 kDa intermediate chain, flagellar
FT                   outer arm"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO66427.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG524376"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199B9E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU5"
FT                   /transl_table=1
FT                   /translation="MEIYYMYTKTGKEFGRHASFDDQPTEVVTDIRPEPDLRDGYIERN
FT                   PVVTNVQVAPDMSEHEANTQQVHFENRGFAHTEGGWPKEVDPTEIEHVMRYRKKIEKDE
FT                   EYITSIAGMIGEVEELVKQNNAVDIYEEYFAGSVADHSTEQPYAKTLTVFRDPSPIKRA
FT                   ASYISWSPDSSAAKCAIAYSILGFQEQPEGMSKRSYIWDVNAPNKPDFYMRSPSQLCCV
FT                   NYNPKDPHILSGGLYNGQVAYYDTRKGHNPVDLSPIEKSHRDPCYDMDWLQSKTGTECF
FT                   SVSTDGYVYWWDIRRLGEPVEELLLKERGGDTVLGAVSVEYESIAGPTKFMIGTEQGTV
FT                   LMCNSKAKTPADRVGASFHGHHGPVYSLERNPWFPKYFMSVGDWTARVWMEDIKTPIMT
FT                   TRYHGTYLTGGTWSPTRPGVFFTIKMDGEMDVWDYYYKQSDPTLSVKVTDKPLTAFNIQ
FT                   GEGATSDPAAGRLVTVGAADGSATLMELCDGLAVMQPNEKPTINQMFERETRREKNLEA
FT                   RQKELRNEAKRAAARAQQDDDGKAATTSNGAVMEAEKEFLAATGSRTSQSGAGVFEDIS
FT                   PLEVPLRDE"
FT   CDS_pept        join(346395..347059,347126..>347462)
FT                   /codon_start=1
FT                   /gene_family="HOG000083524" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636293"
FT                   /orf_name="MICPUN_86619"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66116.1"
FT                   /db_xref="HOGENOM:HBG319349"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199BA73"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU6"
FT                   /transl_table=1
FT                   /translation="MRWTEASFTNGQPPPSPRSGHSATVVNGGEVVVFGGLHTSNFIGE
FT                   TVVLSLSEGRWWRPPSAAVGGPGPRAFHCAVAVDKQLFVICGRTGRQQHGDTWVLDTTT
FT                   WEWRPMGRMPGAVGSDTIAPRDFGTAQRVGGTDKIVLFGGYDGKKWLSDAHVLDTANGV
FT                   WRALNFPSPSPSPRSGHAMSTAQNGRHLLFGGQGPNGTLCHDLWALRGVDETRDDDHDE
FT                   WTRLQLRGDAPAARAGHALVALDRFIVVFGGGGGKGWMSKQQEYRNDLHVIDRESMRWR
FT                   RLAGSAPSEAGRGGLAPTQPGPRAFHAMCRVGERALLIGGFTGSEALNDAWWL"
FT   CDS_pept        complement(348202..350079)
FT                   /codon_start=1
FT                   /gene_family="HOG000265295" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636294"
FT                   /orf_name="MICPUN_106237"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66428.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG607559"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199BA74"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU7"
FT                   /transl_table=1
FT                   /translation="MAPEAPKGMVDLLPAQKKKGAKNAAPANGASPIPNWPPEALREQG
FT                   NELFRRGDYGAAAARYAEALKVKADDAMTLANRAECYLRVRQFHLALVDADAALAADPS
FT                   HHKALYKRAMALNGLGRYPDAIKTLKQLLDKEPEDPAALNALAECELLQSQAFAGDYHM
FT                   PSLLFGRSATSFRRCADYVGPVKIVGDRPFGRGVVTTRAMRAGELICVASPLAVAPLTA
FT                   GAEAALMGGLVGAASRNPQDLSVILALPSGANDDADAGKVPPIDVAKFRRHLSKGDEVL
FT                   PELPPQEVFARLAANVVKTSAVRNANSVGVYPFPSFLNHSCAPNACKLMVGHTMFIRAA
FT                   RDLVAGEEVFMKYFDVTMPKPERSAVAKRWGFECACPRCKLEAVGEDEAAAATERASKQ
FT                   AKAAKDAAVADPANKKKGGDKDGEKAAARAAAESLGAEDTGSVAMLIAQLRAKAKELHG
FT                   DISRQMAEYKRTKGKSAAPDPNHLVELTVWFEAQMDALGLSETQKAWARTSVIQVYSNV
FT                   QLCLNAAGQLEARAEMLGKVAATLNATDPCSYDHVKQTAIKVIHQRVAAGGAGKDKIIA
FT                   AAEAEAAAVHSLRYGCGGGSDEEEKELMAEMIKITGHAVEEGAQEFCEA"
FT   CDS_pept        350321..351025
FT                   /codon_start=1
FT                   /gene_family="HOG000210721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636295"
FT                   /orf_name="MICPUN_86763"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66117.1"
FT                   /db_xref="HOGENOM:HBG557446"
FT                   /db_xref="UniParc:UPI000199BA75"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU8"
FT                   /transl_table=1
FT                   /translation="MERHRLQGTPPGTRVCLLEDWCTPAEEEYLLGRVYRPSGTACDPW
FT                   QRVSGRKVQVHGGEVHEKGMIPRQLPEWLGKMLKSVRETCGDDMFPINVQLNHALVNEY
FT                   EVGGGIMPHQDGPLYFPAVAIVSLGATAVMRFTPHVSQDDVGAEESAETSSSMAPFGVW
FT                   LPRRSLLFFDGAAYTHCLHGIDGVAEDVLDESVVNWRSAVDRCGDARKREGTRVSVTCR
FT                   NVLKVRKLLMFK"
FT   CDS_pept        join(complement(351693..352007),complement(351102..351623))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636296"
FT                   /orf_name="MICPUN_62398"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66429.1"
FT                   /db_xref="UniParc:UPI000199BA76"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDU9"
FT                   /transl_table=1
FT                   /translation="MAKKRKAEDPNAPPKPKWTPPKDDPMWQDYMKDCLYDGYEMNRAT
FT                   LPQLLPSKLPWPFKPCPDRSKLSKNAEAALVRAIGVFENRLSAVENALPIRELVKAEER
FT                   ELDAFECRHRTHWRPVYKFYSDDAYKPLLDFHLPAAAFKVFESIVSQWPGCNARRCDAL
FT                   TDAEKKDLGFKCKTPICFTEAAISREACEAFIDGRVEKPTESQLTAKKHFEEKVRIEGP
FT                   PKGFNLFRVCIPNDVSRDNCPRKPEPIPDIYGDIIHKVYPVADGSGDSSSDSATEL"
FT   CDS_pept        352108..354792
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636297"
FT                   /orf_name="MICPUN_103010"
FT                   /product="Anion exchanger family"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66118.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI000199BA77"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV0"
FT                   /transl_table=1
FT                   /translation="MSVPTLRHDDSLSSDDNPENHTPVTPASASDATPIHRRTSSGATV
FT                   GSLFRRLSALSARISLTAPRHPRGLVWAETRVLPEKCIALEIQARKDLVALSLDDDDAN
FT                   PDSPASFAAVVKRSDKALASFFVLGVRATSPGGIVRELISRAARHGLVPSSHRFREQCV
FT                   EAMLREDADDEELEKTGNSSWNSSAALDHSFVSSASTSARLAPRGDMGTASPWNRAING
FT                   RGFIVAVAKVPGLTRRVVIVGRLKTPSLLGIDSCARVRVVALALSGADSGSEPPAKTGA
FT                   ATAHTVATLLNDDAFFSAALRAKDARDVRAAVLTFVERKSGSGGTNAAAGEVDSIHRTP
FT                   PPLHPTRAKSRSLTPWSSFEWPFASVARDARYRLPHYVSDWTDAFRDGYSFSKTINATV
FT                   WLYFSTLAPALALGVVLWEETRGAIGPTEVLLAEGVGNMAFSLVAGSPLLVLRVTGTAV
FT                   AWMKILSGWFHGGGGVFAGEDFLAFHAAVGLWCAGFVVFIASVGGAGLMRHAGSFTHEI
FT                   LAALVSGIFIRSGVAEVVAIAAVADEMDDAEVDEHPAFFLKHLMLFLGTFYVARAVLGF
FT                   QRSPFLGKNTRTVIADMAPAISLVSLTLLSYAVAPDVGVKRANITDDTPMPRAQLGTSS
FT                   LGNLSRSLAALAAVPGAAFAAQVFVESNAASILTAAPANALVKGGGRGLHLDMLGVGCV
FT                   IAAASVWSCPMPMGTIPHSPQHARVLATVVEYEQRGEVKSKVVSAIETRVSNFVSHALI
FT                   VLTVLLARDVISAVPTAVMSGFLCYTGWTSLESNGMFKRALLAVTSRECHPTSSYIRRA
FT                   PIKTLHLYTALQALALLAVFAVETDFFGASEPSSDGFPASLLFPVALAATILVKAYLLP
FT                   FVPAFSFAFLSAVNGRDDSEFFY"
FT   CDS_pept        complement(354885..355121)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636298"
FT                   /orf_name="MICPUN_62400"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66430.1"
FT                   /db_xref="UniParc:UPI000199BA78"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV1"
FT                   /transl_table=1
FT                   /translation="MKGKEAEVVAAAEAAIAAAETRVAPLRDPTLHITHSMDIADKVGE
FT                   LEERARRLAREEVEEMRRGRELNIITTPVNPTK"
FT   CDS_pept        356638..357609
FT                   /codon_start=1
FT                   /gene_family="HOG000235998" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636299"
FT                   /orf_name="MICPUN_86513"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="lipoate synthase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66119.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016992"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284542"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199BA79"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV2"
FT                   /transl_table=1
FT                   /translation="MVVPTVTGANTTERDIPGKPAGLTKPPWLRQRAPGGDRYEYLTSG
FT                   LKDLKLATVCEEAMCPNLGECWNGDTGTATIMILGDTCTRGCRFCAVNTASTPPPPDEM
FT                   EPENTAKAIAEWGVGYIVLTSVDRDDIPDGGAEHFARTVRTLKALKPEILAECLTPDFQ
FT                   GDEGAVKHLANSGLDVFAHNIETVERLQKRVRDPRAGYDQSLRVLRHAKATGPTGLVTK
FT                   TSIMLGLGESDEEIAQTMRDCKDAGVDIFTLGQYLRPTPNHLDVMEYVTPEKFEHWKRY
FT                   GEEVVGFRYVASGPLVRSSYKAGEFFIETMLRDEREKANAAA"
FT   CDS_pept        complement(357850..358353)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636300"
FT                   /orf_name="MICPUN_109129"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66431.1"
FT                   /db_xref="UniParc:UPI000199BA7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV3"
FT                   /transl_table=1
FT                   /translation="MGKGYKGKNPAGGKGGKGGKGGFNEQPAQKWRKGQEESSSDEESE
FT                   SEEEGSGSEPEGETQPVVEEVNTRGRPGELPPNSSDEEEEEEESESEDDSDDELLNPHR
FT                   RAPRPKAVEPVVEKSKKELEADMEKLRLVRERRAQQAAERIAKEGFDRFAPPGSANGPP
FT                   LPKS"
FT   CDS_pept        360080..360763
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636301"
FT                   /orf_name="MICPUN_86560"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66120.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG557451"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199BA7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV4"
FT                   /transl_table=1
FT                   /translation="MRVLLQIWKSRRPNSEQNWLEIRRDLSALYSRFYGGFLLGFVIMY
FT                   WCANSPWFIALLCNSYWLPQIAWSAWHNAKKPLMPAYVLGTSAIRLLVPLYVFGCPENF
FT                   VRVKPQFWVCWLLVVWVAAQVAALAAQHVFGPRCFIPDKYLPEVYDYHRRVEPEVLASA
FT                   GAGDEECGEAGGVDCVICMNAVDAKTPRERMVTPCNHFFHQECLERWMEVKMECPTCRG
FT                   ALPPL"
FT   CDS_pept        360981..361154
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636302"
FT                   /orf_name="MICPUN_62404"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66121.1"
FT                   /db_xref="UniParc:UPI000199BA7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV5"
FT                   /transl_table=1
FT                   /translation="MNPAVYVGLFMIGAAIAAALPRPLQEDRRATNEYRKQKRSSVSSA
FT                   SSKKKAGGTKRP"
FT   CDS_pept        361839..364463
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636303"
FT                   /orf_name="MICPUN_103013"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66122.1"
FT                   /db_xref="UniParc:UPI000199BA7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV6"
FT                   /transl_table=1
FT                   /translation="MRPAAAPARAAAASAPGTGHGGRIPATSRASATSRAHLSVGRRPR
FT                   RDVPVARIPRRRPATAAAAAPRDDASEVTEPIPWADRRDVDAPRALPNANERGDATLED
FT                   AAFFVGWRVVHVRTGEDIGEVREALGMASGEVVAQLGHSDDEDEDEDDGWTVEVDPFSD
FT                   GHDDYYDDHDGDLDEDEEDGFEVIYEDASASSSYDYDGDEDEDEYDEDDEDDATYDGDE
FT                   DDEKYAEEPSTPTGPPPMSLVLRVRGHRDVAGAGGVTNKEPITHLIPLARAIFPRWNRE
FT                   TRTLAADPPFGLLDLGARQSKIRGLRRDLQPYCSRVAKGEQGMPKKTALARAGREDLIE
FT                   RIDELGGWYEAAAQLGLRSNRKPNGYWENLDFLRDELLQLIYAFWFQEEDEDTGERMWY
FT                   NDISGALTYEEPDVASGGGLDVPVMPSISDIQEAKRYDLQHAIIFHGGFIEVAEQLGWM
FT                   QKRYGENRHLLSFARYAEEMRDFIEEMGEDAIPRGRLPTLRMMLDEDREDLVNAARWHG
FT                   GMWEIAGRMRMQPYAASPLSMLPDAARAIREFALEEQGLEAGDAAPLMPSHEFIVSRGR
FT                   HDLGRAYYLHGRTRLADAAGLELRTRRYTYEECRRFMRVEVKPRVRNSTAFRRWRESGS
FT                   RPRLVPADPAKYYGETGEWVDWAHFLGVRVKPGDPEARIRATPFLEYEDAKRRVRAMRE
FT                   SSIAARESSKQKSSSSALIGDDDAFDVPMTSSEYRQWRGKPPSLPRFPEDVYGRRGEWR
FT                   GWDDFLGRDAAVDETDDTAVRDGSTRQSTRESVRRRRRRARHASYRDARAAMHALARSG
FT                   EAPRTSKQFQLWRARPREIPPNPRATYLRTGEWAGWDDFLGREVGEVLARGVASSRGDG
FT                   ART"
FT   CDS_pept        join(364868..365014,365362..365877)
FT                   /codon_start=1
FT                   /gene_family="HOG000078811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636304"
FT                   /orf_name="MICPUN_62406"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO66123.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199BA7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV7"
FT                   /transl_table=1
FT                   /translation="MRVALLAIALMGLVLGANAGAVDLTSSNFDAEVFESGKAAFVKFL
FT                   APWCSMKPAWDKLGDEYKSSKTVIIADVDCTKEQDLCQKYGVQGYPTIKYFTGATAATG
FT                   DAYQGGRDYDTLSKWAKDNLGPTCGAENIDLCTDDQKAIIKEKQALSDADLDAEIAAAE
FT                   GEIKQADTDLEELLKSLQAQYEAGKKAKDDTIAEKSPALALLRSVKRAKTGGAKTEL"
FT   CDS_pept        complement(366311..366658)
FT                   /codon_start=1
FT                   /gene_family="HOG000184883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636305"
FT                   /gene_name="SRP14"
FT                   /orf_name="MICPUN_86200"
FT                   /product="Type II secretory pathway family "
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="ACO66432.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="HOGENOM:HBG629003"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI000199BA7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV8"
FT                   /transl_table=1
FT                   /translation="MVLLENDRFLTELTKMYERNRESGSVWVTIKRSMLKRLPKRNQLP
FT                   PPERVFTDPEWVRLVRASDGKKKISTTVDTKAAEKFSRSLSLVQMASMDGLQEIKKPSK
FT                   KERAKGSTKKA"
FT   CDS_pept        join(366810..366962,367190..367321,367469..373357)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636306"
FT                   /orf_name="MICPUN_62408"
FT                   /product="Predicted protein"
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="ACO66124.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniParc:UPI000199BB29"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDV9"
FT                   /transl_table=1
FT                   /translation="MAAVDMQARVASLEQELATVRAQADSDAINAEHQSQAMEARYNAL
FT                   EAEHSEAIAERDAIKTQLTSARDELTAAKAQSATLDVSILQLTASTERLKAELNEANAS
FT                   RRELAERLELKNSEIAERNKTAEEHLAKLVAAQEERSRVEAQLRDANNKQAAFESAKAR
FT                   MEQQQQLLQQHNEWLRAELSKKSDELLSARKAASADALEAANELERVKKEAAAAVRDLG
FT                   GAKEEAARASASASRANEELRGARESAAAAEAHFDKELVTAKRLAELYKKQAETRGAKT
FT                   TELEGVLQALRDHLSEIKEEHARALAEAHAAREKAEKAAASSAAELDARPHSGAPASPN
FT                   ENALPAPTLAADGAASGRQAGALLAMQLPDTAAAALRKENLTMTELYSKYAEAADAWRK
FT                   ECAERRRLQATIDGMLSELEQRAPMLAEQRREYERAVAAHAEMRLRLEDSTVELRRMET
FT                   ESRAHAADKRHHERVVKGLEAQSADLSRQVQLLLNEVTELKGGAPTAIAPKSIAAGDAA
FT                   AVVTAELVDFRDIAELQEQNRRQLEVIRTLSADQEELGQRLKDEYEAEAAKLRAETAKA
FT                   VEEIEGRKSKTQTMMDAVTRQRDMYKALYASASVPGGAATADAAAMSLAAAAAASLAKT
FT                   EHLALPHGSNDAETASAQLAALNAELREELAKQKEESAANADLLRKQADEHRGAAATAK
FT                   AEAAAARAQAEFERSRYASLQESADAARKDVDALVEKNSQAQRLLAEHEAALRERNARL
FT                   DAAEDRCARAESAARRADAERELLTRAEQRAAEAAAKATAEKSKIEAARDAALSLKEAR
FT                   EREIGAERERLATELARLQKDWAAARTDLDTERERTRTAAAAAAAAAEKAASRAAADET
FT                   AAAALRDAKSDAETRATVAEEKCKILEQQLKKADERVRVAMQASARVTSAGGGTTGGVS
FT                   IAAEAAGVVAAAEHGAAETPREMELLAAAMRAGEDAATAREAATAAEGHAAHYRAIAEA
FT                   NDAAIKEMQTAFDALKTESERAKADFAAESEALRARASEAETSAASKWQQRAEDAEAKA
FT                   ALVDDARAEAAEARRLAAEAEQNAAAAEGRVAALAADVEEHRKQWRQAQQMYEQELLHH
FT                   AEDVKKLNAEEQRRAEEAAAVEAARELARAAEVRLAAAESKWADERGSMEKARRDAEAK
FT                   TAALGSQNRLLHDQLEDALKAAKIGDGDAAGGEEAEKSLREVIAFLRSEKEAATCQLEV
FT                   VSLESSRWKREAETARHQADAARATLTELENQLGTRGTADGEEKYASLMAKVEHLNVVQ
FT                   ESNSTLRAELTGLKTQLADAKNAAATAAATAEQANKEAAEAKAAAEGAAGERELLVADA
FT                   RRWEQRTQQLLEKYGTVDLAEHNRVKEALEKAEQSANDKVAAKVAELEAKEKAAQETAA
FT                   QLAAVTAKAEKSTSQLEIAKKHIATYNPEKDPLPQWKQKQQQLRAKLAEFEATAATWEK
FT                   ERAEMEAKLETASAAARTALTEGAAAADEAAVAAAVAAASAEWEKEKAALEAQVSGGAA
FT                   DGAQMTKMKNIALKNKQMVTKLQEQVQQVKSQADEAASLAAKEREKMELRLKILEQEKA
FT                   SLERKAAGAKSPAKSPAMSPRPSTGAGAAVAAADAGAEAATEEEPAEEVPEEEAAAAAV
FT                   DEATAEADAEAKAKADAEAAAKAAATKAAKEKADKKKKEMEELRAKLAEAEKKKKELAA
FT                   AKKAKAEAEAKAEAEAKAKADAEAAAKAEAEAAKAAEAAAPVEDEGDAAEGYDAEAFLD
FT                   DLISSPADAMNAEGGASEPAAPAPAAAPVNPFMRAAAGASPFGTAAATPSPTNPFMAAG
FT                   AAATPEPAKNPFMAAGKPAAAKPEPAAAAAPAGATGTTPVAKKSTAEMLAEKKKATMLQ
FT                   QQKSAKAKKEKEQLAKQMAERQAQMEEMRKKIAETESKKRKASGGTPEGTPATKQLRPD
FT                   APAFTPGGPAGATTPAAAGAAGANPGGGRGAGRGKAAAGGGGRGGGAKAATPPKSPPGA
FT                   GAVGAGDDEGKKSPKAGGASAAGAGRGRGRGAKGGRGGRGGRSPGRGGDGSGAGGGGNS
FT                   FAALGE"
FT   CDS_pept        complement(373521..374849)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636307"
FT                   /orf_name="MICPUN_109130"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66433.1"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniParc:UPI000199BB2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW0"
FT                   /transl_table=1
FT                   /translation="MCAPNDEIIVVGGYTNTELLAHTPAPCDDPARCGVHVLRQCGVTG
FT                   RLTHLSTNAIGPNVAFIVRSPTNPSILYASTERIDDEGEIITLRMTPDFRLVEETRIKA
FT                   GGRSTCYLNFNASREWMMAVNYWDARVSMFKLGKDGRPDIEAGRDPRWVLQQPGADYVD
FT                   RVKPTREEHWKFRQRWPHSHCCVTEPYAGLVHFVVDLGLDKVFTYRVNSKTGVLVPKGS
FT                   TRLPPGKGPRHLVFHPTVRSAYLVNELDSTVSVFKVNIPEEWTTPHHWDAGASREDGCE
FT                   EPGAVLELTQCLSSLPESEQGKTTISPQGIWKAASHSSEIRMHPNGRYFAVGNRGHDSI
FT                   ALYAVDQSDGTIALVDIVKSGGECPRNFNWTCGGKFLVVGNQNTNCMATMSFDEASGAL
FT                   KIVHEAGAGVTSPNYVYAIPARELPSLISSADGFGGALPAIAA"
FT   CDS_pept        378839..380092
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636308"
FT                   /orf_name="MICPUN_98046"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO66125.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199BB2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW1"
FT                   /transl_table=1
FT                   /translation="MESFRKTAEERLARIEQLESEALEADAIRRKLHNQIQELRGNVRV
FT                   FCRVRPTTSETAIVDCAPDGTSVELKRSDADVAGFEFDRVFGPSSTQCEVFDEVSQLVQ
FT                   SALDGYKVCLFSYGQTGSGKTHTMLGDQHNEETRGIIPRAVAKVVEASEANAKKGWKYR
FT                   MCASYVEIYNEQVRDLLKAGSGHSDKHSIAHVDGVTEVSGVNKEPVESVEAAAGLVRRA
FT                   AAARAVEATQMNAVSSRSHTIFMLYITGEHEASGSRLTGCLNLVDLAGSERVGRSGAEG
FT                   ARLKEACAINKSLSCLGDVFQALSNGQKHIPYRNSKLTYLLQPCLGGDGKTLMFVNINP
FT                   EAPSAEESMCSLKFAAQVNAVELGRGGAKRNIVSGIGKKEDKEDSSSGDKKPDDKKKVG
FT                   KRPATARTAAGAAKKSKR"
FT   CDS_pept        380089..381390
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636309"
FT                   /orf_name="MICPUN_53342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66126.1"
FT                   /db_xref="UniParc:UPI000199BB2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW2"
FT                   /transl_table=1
FT                   /translation="MKRRWTAGDTTRQHNGGGWGYKRKHRRLNDDTRVRLAHYESHHRK
FT                   ISLSSTRAHPLRATKYLTQCGLVLSVSKTTRFFFILRSARFSKLSAPPALTMHMVASYT
FT                   ARCSCALPSRSWGCSRSSRASFTSRRTSATAAYASSAVASSSWGASPNTAPRSPPLSAV
FT                   FSPATLRTSVVVSTSSSGGARCSSIGTSMNGTYRSRRVTAASIRAGSRNTLPRDDSVTA
FT                   LLHSLLPPQRFQKRTFRSSARVVVPLSVPPTVHLPPPCVRPSPVELSVSSLLLSIPTLA
FT                   STRAVTVRIAPPAAAIASRRRALARASLAAAESSRSGGGARSASKSFAATTSTRSAKSP
FT                   CSRRRCTKSRAASRGVRSWSAAGWAASALATPPPSPHPFGTSRGVTAGLRKRYNDATLA
FT                   RRKSGSSKSAAAGCAADAAVDAASSSLSMSDAAG"
FT   CDS_pept        381993..382754
FT                   /codon_start=1
FT                   /gene_family="HOG000075267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636310"
FT                   /orf_name="MICPUN_109131"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /protein_id="ACO66127.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG589325"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199BB2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW3"
FT                   /transl_table=1
FT                   /translation="MAAMARCVGVRARRPGALTAPLHRRRHRRASPMITTPRATTLTEE
FT                   AAAAGATLRLLREVTAETEVKRSRFVARAAPVTSPEEAMDFVRARSDPAASHNCFAYRI
FT                   GTEYRFSDDGEPGGTAGRPMLSALEGSGFDGVCVLVTRYYGGTQLGAGGLVRAYGGAAS
FT                   AVLDDALSDDAHSKVSFPTVTCTAIVPDASHVDAVYRCLARFDAVKEDEEYSDDGSVYV
FT                   ELRVERSKTDELGTALADLTQGKVAFRVLDD"
FT   CDS_pept        join(complement(384007..>384435),
FT                   complement(<383317..383886))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636311"
FT                   /orf_name="MICPUN_68730"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66434.1"
FT                   /db_xref="HOGENOM:HBG607578"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000199BB2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW4"
FT                   /transl_table=1
FT                   /translation="RGVTLAHLIDARLIAPGHGAVSTTYNDVVHHADVLPDGYVAWDGR
FT                   EFASVSAFSLAVKRKTNPGRKADDGWKCVSYMGTPLDRLKRRYEEESKAGSSRGDGQEN
FT                   LSATETMGPAVAAAAAREIAAKTAAAKLREESRPKPPPRRRGVNRALMMTALPGADGVN
FT                   GDLQMVECEVYDDDERAQPWRLSATPEASFLMDFHSHLCRHEIIGFLGGTWDPRTKCLT
FT                   VKRALPARRLVLGAPGENANVEVELDPESVPDIVEALDRDGLRVVGWYHSHPVFSTHPS
FT                   LRDIENQSNYQRLFRDDEAKGGGTPFVGAIVGPYATTNKDLSSDVRWFHVAP"
FT   CDS_pept        385269..385835
FT                   /codon_start=1
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636312"
FT                   /orf_name="MICPUN_86605"
FT                   /product="Predicted protein"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /protein_id="ACO66128.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="HOGENOM:HBG671982"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI000199BB2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW5"
FT                   /transl_table=1
FT                   /translation="MSKLRPVVMCGPSGVGKGTLINRLMADFPGRFGFSVSHTTRAPRP
FT                   GEEDGVHYNFVQKAAMEADIAAGKFLEYAHVHENIYGTSLAAVEAVAQKGQVCVLDIDV
FT                   QGAEIVKKSSLDALFVFISPPSMEELEARLRGRGTEKEESIQKRLANAAGEMAKTKVEG
FT                   FFHAVIVNDDLDRAYGELKTAIDAQ"
FT   CDS_pept        386132..387094
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636313"
FT                   /orf_name="MICPUN_103020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66129.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="UniParc:UPI000199BB30"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW6"
FT                   /transl_table=1
FT                   /translation="MQISGVIKFGAPMYNKGDARGCARLYRQTALSIARDASVTSEEIR
FT                   SCLRDAVAKADEIARKAAEEDPMGGEEDQRTQERVAWALRRGLDRVVDLIMDPPVDEPT
FT                   VYRPSDENDTAGDDDDDAPAEDEAAAPRTPTVDAETAALFDFAKTPDLAGRWRSLNDGV
FT                   MGGVSDGRMRAGSGSGDRHAVFEGTVRLENNGGFSSVRASFGSGIDLSQFQGFYMDVRP
FT                   GDEASAGKEYLLIVKDDECMTTQVNFKAKFGTGKKGGGKWERVKVPFAAFDRPERMGRA
FT                   VMRGALRTEAVCEVGLMVLKGEGNVGAFALDVLELGCFK"
FT   CDS_pept        complement(387169..387690)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636314"
FT                   /orf_name="MICPUN_62416"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66435.1"
FT                   /db_xref="HOGENOM:HBG557459"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199BB31"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW7"
FT                   /transl_table=1
FT                   /translation="MSGEETRELHVWDFDGTLVNTPVPDTGRAQYERETGHPWPHRGWW
FT                   GRAESLEPPLTWEPGPAMRDFVLLANRPNVRRVMMTGRRSKLAPRVMSILGEFGVFVDE
FT                   AVFNSSGHDTFTYKCGELGRMIRRAGSSLERVRIWEDRAPHARGFDKFVRETFPELEVE
FT                   VTIVQPSIEG"
FT   CDS_pept        388187..389164
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636315"
FT                   /orf_name="MICPUN_62417"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66130.1"
FT                   /db_xref="UniParc:UPI000199BB32"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW8"
FT                   /transl_table=1
FT                   /translation="MSSAVTAAATIASRAGRLRRLRSTHASASSSSDDVRVSRRGIALG
FT                   CPLAVLAGVGTNEARAVDYFTTPPNTLEFENVAFPRYPGFVTLPSGVQVRDLCVGSGPA
FT                   AATTRSLDVIVKMWTVHQGRYAGEARVVFVPGDETVIRGLEQAVLAGGNMRVGGTRRAL
FT                   IPPKASVSWPYVQSGETDADEDATGARTRFGMAPAYDPALGVQTPLTSGVGPVPKREGG
FT                   PRAADGDGDEKSAPGDGDGDGDGAWLDYVLRRNAFTIKPSDRSVLVDVTLVAVGGESGG
FT                   RGVVPRVPTREDRAALGEANDRSGDGGASWWTAALPGASEYCPG"
FT   CDS_pept        complement(<389586..>389796)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636316"
FT                   /orf_name="MICPUN_74776"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO66436.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199BB33"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDW9"
FT                   /transl_table=1
FT                   /translation="TAFVKNLPFKCSEDELAAWFDARGGTVTARIVRDKATGRSRGFAY
FT                   VEFTEEGAVQAAIMRDGEEFQGRAL"
FT   CDS_pept        complement(<391236..392919)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636317"
FT                   /orf_name="MICPUN_53344"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66437.1"
FT                   /db_xref="UniParc:UPI000199BB34"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX0"
FT                   /transl_table=1
FT                   /translation="MLVMRRLTRTRVVFRGAPRRYQQLVRFTYAAFALAGRPRFFFSGS
FT                   ALAGVPPLSVTIVASNDLTFFFSSSSSFSAAFRSFAADCGAITTGVAIFFGLPGVPFGF
FT                   GVPAAEFGVFGGLPRPLFGVGVAAGFATGVAFGVVAVFGGRPRGFGVPSAAGFLGGRPR
FT                   GLLAGDDNWAVPALRFLSAVLFNVFTNAPSGASSSSGKGTLATAASASKVFLFLLPGGR
FT                   PRGIVGWRARDNLNINCPPPCASRVSFLGYTSPNSIVASKSRSRLKHKGGSIFIFTIKS
FT                   PIKAATNGHRTLSCMSGRSDAPTGVGCFHRLSLRVHNTMAPEEDAAMEDADPENVSGAS
FT                   DDDSDSASEDDSDSGSDSDEGDEDVAMPDESAMAKIMKLERRLESDPGDYGAHVQLCAS
FT                   LREWPSLRRRLRDAREAFAERFPLNETQWREWISDEVRATKGRRKRRGKVVGALFERAV
FT                   ADYQSVALWLGYAEFSLDQGWDVPARRSLYERALELAGLHFVDGHKIWAAYRAFELSKL
FT                   ELDAKNDPPAVAKQEETVRALLRRQLAVPHAQLDETLAACERWE"
FT   CDS_pept        complement(392943..395039)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636318"
FT                   /orf_name="MICPUN_103022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66438.1"
FT                   /db_xref="UniParc:UPI000199BBD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX1"
FT                   /transl_table=1
FT                   /translation="MAPRGGKMGIGRSPAAKARAGLPRANPNDVRVKGFENHAERMSTL
FT                   FRPDSSGSDPTCRGSLDLAAAGDDDDDDDDLDFIRHAKEAARRLRELNARNAAARPPTP
FT                   ASRWTAARAKISATARIAGLFQGMEPGSLRPPSGGNKVHPASTPSSVRVVAPTAVAGGG
FT                   ASTAAADAGMVTPRARSEHGSEPGGWGSVPNTPVTVLHQDAHSVPSSSAPSLAPSVVTD
FT                   PDPGDAPRAHPAHSAPAWNARPASPQPAPPTMVEVDATGRWFVSYDDYHVSMQMAALAL
FT                   RAKNIALDAAMKSGAAEIEQLRREAAAGARGGGGGGGGGGGARKLTGWFSPSRKRNSAT
FT                   KEDENAAENEDDQTGNEHGTEEGAGEGSGSSSSGPAAAAAAKTKAEASKKTIEAVAEEP
FT                   SLEEEEQDDEDEAAAAASAAEAVAIDAVADAAVAAAAAESSAAESKRQLERALAAERAS
FT                   TEAERAAWSMERSQLLKERDELRALASNPALDVSATFSDAAAVDASMSWDGDAESLAIE
FT                   ALVALATALRGEDVGFDKRRQEMRATAVAKAGGVAAVLGAMASFPGSRAVQAAGADALA
FT                   RMAGASERAREVLVAEADEVLGGGGVAALARAVDEFGCGEEGGHRDVRVAESAGNALLA
FT                   IAASGRTEHGGMENVGRSALRRAVEAHPGASWDPMRLGRLHAWIFASCTQPQVHSSDDE
FT                   DAPY"
FT   CDS_pept        join(395355..395469,395583..396697)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636319"
FT                   /orf_name="MICPUN_62421"
FT                   /product="Predicted protein"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO66131.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG725117"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000199BBD1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX2"
FT                   /transl_table=1
FT                   /translation="MRGSAAPSGAFSGYYADKRRLARRNRPWRQGVIFGFIPATIQNLA
FT                   ILLGGSLFVTFTLISALMRAEQSPPKPARDVASSAPKRAPLTPAQLEGTPADALAIGPT
FT                   NAFCARPDDPLVCAHGTVGSRDWPANVDPVPSGATPGANTIRPLPNTVPALAAAVDAGF
FT                   ECVEVDVSRTKDGHLVALHSRELRHLTNGAKTSVAEITLREAMALEMPSGSYGVATFAE
FT                   AMATVVNRGLRQITVDFKEDGRPGHAVSFAQTALAEIAMVDPDNGCPECVYWGKDDSVM
FT                   LDVLREFPEARVGYTVANFSAAMRDGGLDNHADARARPIIARAYCAAVQSEMASHKLRR
FT                   ECVRAGVSKVYAWTINDAAKVRRVANEGVDAIVTDEPGEAMRQIRALRDGCPRPESTKS
FT                   GRAAERHNRS"
FT   CDS_pept        complement(396802..397449)
FT                   /codon_start=1
FT                   /gene_family="HOG000234390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636320"
FT                   /orf_name="MICPUN_62422"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66439.1"
FT                   /db_xref="HOGENOM:HBG715823"
FT                   /db_xref="UniParc:UPI000199BBD2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX3"
FT                   /transl_table=1
FT                   /translation="MAPGAAQVDNTARRKWDKDEYAAKAKERERLEDEKEKGKNIRPPP
FT                   GAIIERKTLSLDTIIQRDYKKELEARVGTKTIVNLDTGEGLGFRCKETGVILRDSIAYL
FT                   DHINGKKQQKALGMSMRVERSTVEQVRGAFERAKRKKEEEEKESAADFAKRVKAAEENE
FT                   EELRARRAEKKKAKKEAKRAEEEKAKAQQEMEFGLDPDMAAMMGFSGFGGNK"
FT   CDS_pept        join(397720..397762,397881..397948,398140..398367)
FT                   /codon_start=1
FT                   /gene_family="HOG000009762" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636321"
FT                   /orf_name="MICPUN_91968"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /protein_id="ACO66132.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG692582"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniParc:UPI000199BBD3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX4"
FT                   /transl_table=1
FT                   /translation="MASFAEAPAGDAEKGAKIFKTKCAQCHVAESGGGHKQGPNLGGLF
FT                   GRVSGTTEGFAYSAANKNKGVKWGEETLYDYLLNPKKYIPGTKMVFAGLKKPQDRADLI
FT                   AYLKAACK"
FT   CDS_pept        <400144..>400666
FT                   /codon_start=1
FT                   /gene_family="HOG000007810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636322"
FT                   /orf_name="MICPUN_70725"
FT                   /product="Predicted protein"
FT                   /biological_process="phagocytosis"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="ACO66133.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006909"
FT                   /db_xref="HOGENOM:HBG447003"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="UniParc:UPI000199BBD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX5"
FT                   /transl_table=1
FT                   /translation="CLFAPPRLDGDELKRDRDEMFATARTKLDDENEVHLAVLHTLYTR
FT                   LMGTDRAMPRYGKHWEDVGFQGSDPATDLRGCGMLGLTQLLCLVTRSFTNAAAIHELSR
FT                   DSTQEFPMAPLSINLTHTALKAVRRGLLNKEAKRLGSVWAAADAFYCGAFYEFYLRWRD
FT                   GGKTIMDSGHV"
FT   CDS_pept        join(400977..400989,401148..402436)
FT                   /codon_start=1
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636323"
FT                   /orf_name="MICPUN_62425"
FT                   /product="Actin superfamily"
FT                   /protein_id="ACO66134.1"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000199BBD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX6"
FT                   /transl_table=1
FT                   /translation="MYGGDEVSAIVVDLGSSTVKAGYAGEDTPKAVFPSTVGWLAKDQE
FT                   SAGKKDGGDVEMKDAGDGKTYFVNDMSYRRDHMELASPFNDEGLLEDWDVVEAIWAHTL
FT                   RKRLVVEPNEHPILMGEPVHTTREGREKMVELLFEKHNPPAVFLAKNPVLTSFASGRAT
FT                   SMVIDCGGSGTTVAAVHDGYALQKAVTRSPLGGDAITDVILKHLEKKKKTPVKPRYEFK
FT                   RTARADGETFDVTDVKCPDVAASYRLFKQREIAADLKETVCRLSDTAYSEAENQNMPSM
FT                   QYELPDGNVIDVGVERYKIPELLFQPDLINGFGLGADAPAGVKDAKGLSQLVLDNINRC
FT                   DVDVRKDLFGGMLLAGGGSLFPQLRERLEAELHDAAPTNVRVKVTASQNAVERKFATWI
FT                   GGSILASLGSFQQMWMSKQEYEEHGANLVHRKCP"
FT   CDS_pept        join(402635..402661,402828..403625)
FT                   /codon_start=1
FT                   /gene_family="HOG000173970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636324"
FT                   /orf_name="MICPUN_95428"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66135.1"
FT                   /db_xref="HOGENOM:HBG628655"
FT                   /db_xref="InterPro:IPR009360"
FT                   /db_xref="UniParc:UPI000199BBD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX7"
FT                   /transl_table=1
FT                   /translation="MARNEEKANNMFNRWVTGKQTAIAGGPKGRRPYLASECRDLDQAD
FT                   KWRQEILREIGKLVMEIQNEGLGEHRLRDMNDQINKLTREKHHWEKQIIKLGGPNYIAQ
FT                   GRRAMDEAAQEGFVDGMDQRGGGYRYYGAAKNLPGVKELFQKPEKRTVRRTRAQMYRNI
FT                   DMDYYGMRDDDDGVLIKLEAEATEKARAEAVAEWEAEQARREADGGKKRRQQEDDDFEA
FT                   LTGGFKAYVPLPDNKDIEALVLAKKKKDLLAKYASPALQEQEAEAKAMLNKQ"
FT   CDS_pept        join(complement(405041..405063),complement(403739..404876),
FT                   complement(403681..403707))
FT                   /codon_start=1
FT                   /gene_family="HOG000237867" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636325"
FT                   /orf_name="MICPUN_62427"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66440.1"
FT                   /db_xref="HOGENOM:HBG557463"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199BBD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX8"
FT                   /transl_table=1
FT                   /translation="MLIRLRTRDGTERVEVDDKCTLSQLRTVIEEKFGVPTSDQRLSLD
FT                   QGLLMSKDPHAYDDLKPGRKNDGKPLKSLKIEHGTIVYMTYSVERKVTVCTAAAHNDAR
FT                   GLTGGKMTVEAMIAAQTRIETQESPNVESLSLDGHAANAFQAYVNGTLGFNQMRFGWMY
FT                   GTCSDDGEVRVHAIYEPEQEGTEDAFVVVEDADEDARAEAIAESLGMTRVGMVFNVTTT
FT                   KERPDYTMSAFEIRQMAKYQSKYGDKFVTAVVMMLEDEDEGTPQVSFEPFQVSNQCVRL
FT                   YSEGWFHDEPCEKPGHTRLTKDVVVVDKVSKDVTEVDNDRWLVPVKILDHEGPWRTSFP
FT                   IENRLHPVQTVEDLKDAVSKGGQYCVKLADFHLLLFLSKHLDANDMARSRRDTSS"
FT   CDS_pept        join(<405267..406151,406338..>406547)
FT                   /codon_start=1
FT                   /gene_family="HOG000187275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636326"
FT                   /orf_name="MICPUN_68601"
FT                   /product="Predicted protein"
FT                   /function="acid phosphatase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO66136.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG562779"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="UniParc:UPI000199BBD8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDX9"
FT                   /transl_table=1
FT                   /translation="APSGVHIAFGTRDDEMSVTWHTLASNPGDAVVEYSLLSDVSASSR
FT                   VEGTTRAFVDGGPERSVRFVHRVVLSNLEPGATYKYRVGNPATKAYSVWFDFVAKRSRA
FT                   QIAAGPPLKLLALCDQGHRESAGVLQLVAAEVADPSTRPDALVHCGDFAYDLDTYSGRN
FT                   GDRFLADIEPVAARVPYMTSQGNHERAYNFSHYAERFTMPGAGASNGNAYYSFDVGPMH
FT                   VVAFNAEAFFWPEFFDATYRSRMYEWLVDDLRAANDNRGNVPWILVHGHRPMYCVDAKV
FT                   PDLTPHADKPEFDGSPGDFPIEKALYENGVDLYLAGHVHDYERYFPAFDERVVNGTDVT
FT                   LERYVNPGATVHVTSGSGGNPEMWT"
FT   CDS_pept        join(complement(407852..408111),complement(407003..407729))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636327"
FT                   /orf_name="MICPUN_62429"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="ACO66441.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="UniParc:UPI000199BBD9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY0"
FT                   /transl_table=1
FT                   /translation="MERNDAVAAERDDPGVGADRRLVPLEIKVTFAFTNAPQAQYLMHY
FT                   TTIDAWSDGSDTLAGIKQKFSDKEGVPVEFIKFMWLDEPIGRIYMGKMPKQARVTEAKT
FT                   MKELNIFGPDTWLDEFPHWRCLCATIAEEEKRDALEEVHRAVATQIKGYEEGPELDRHI
FT                   QHKRKTKKWNTLVFGAPTPYDSRYPETMPKTGDDRYTNCFDDDWDKDPEEEAEKLRPKS
FT                   QPQLVVKKAPAAADNAGVQAAAPEVEEEPKMSLEEVVTNVSRLSSKMIGTKELDVDAPL
FT                   MESGLDSLTSVELINELSSAFGVQLSATTPYDYPTVRELSKHIVEKL"
FT   CDS_pept        complement(408277..410427)
FT                   /codon_start=1
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636328"
FT                   /orf_name="MICPUN_62430"
FT                   /product="NADP dependent malic enzyme, chloroplast "
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /protein_id="ACO66442.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BBDA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY1"
FT                   /transl_table=1
FT                   /translation="MTSALTCATASRPVTRAGPRPRSTRADARHPRVVNARARSTSAPG
FT                   DAIGRDVVPEPASSETIEGIVVDDDRDGSPVRISGNVRASRRGVLGGLGGVGAALGLTS
FT                   STSAIVGPGAAEAAAAPASSPAPIAEIAAASSRATSASPASSIVGYANLHDPRVFNGLA
FT                   TPDRTNRSLDGLIPAGEAPPDVEVARAAAALEACDTPMQKYRQLVSLQNTDETTFYALL
FT                   ELKTAELLPVLYTPTVGDACLQFGTLTQRPPGLYVSLENIGNVRALVDNWPANDVRIAV
FT                   LTDGERILGLGDQGVNGMGISAGKSMVYAACGIKPGWLLPVQVDNGTNNTKLLADPLYV
FT                   GTRRERVRGEAYDRLLDETVQAIQGRYGARTVIHWEDFAPRNAFRNLQRFRTKGAITYN
FT                   DDIQGTAAVTVAGILASLRVTKRALREQRVLFFGAGQANIGAAELLVRALTEEGVDESL
FT                   ARSNVFLFDSKGLVVDGRPAEYTISDDKAPFAAKVGTPFTSSLEEAVKSVRPTALVGAA
FT                   AQPQVFTKRVIESMCAFNPRPVIFALSNPTSKAECTATQAYEWSKGKAVFASGTLFAPV
FT                   NYKGVRFAPGFANNAFIFPGVALGSLASGASSVTDAMFLAAARSLASQVSEENLAVGAV
FT                   YPPTSTIREAAVVVGAAVAAAADEGGVAAPGACRGGAIPGRDGGRSVVVPSLDALTGGG
FT                   NPGDGTCANWEACVRDYLKTCV"
FT   CDS_pept        join(complement(411446..411515),complement(410975..411315))
FT                   /codon_start=1
FT                   /gene_family="HOG000100124" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636329"
FT                   /orf_name="MICPUN_62431"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO66443.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG557465"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199BBDB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY2"
FT                   /transl_table=1
FT                   /translation="MDPTAPSITFFDKDTGKGRATYIGSLQPARMFPPTVGIWFTNQGD
FT                   EVCARIDPRRSRDTPRPRPIRCPRICPEICFPTHPHSRRQVFKKLKAYYEEEPYPTQER
FT                   MEELAEEFGAPDWTKIENFFKNMQLKHQEQFQ"
FT   CDS_pept        411736..413562
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636330"
FT                   /orf_name="MICPUN_62432"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66137.1"
FT                   /db_xref="UniParc:UPI000199BBDC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY3"
FT                   /transl_table=1
FT                   /translation="MPRGASVDDEDGYAGIARARRETPAAWTHLPAKRRSDIDVGGSEG
FT                   TRASDGRTPVPATPASPKRADRLIPLASAPKTVGAASNGVAARKPGKKRGRGKRSVAEG
FT                   KPTKDIDARIGRLLRIAVDPKGEPLTDATDTDDTRWHWQAGIVTECEVFDGGRLYFVYK
FT                   GRFKDWYSAAEVLDRNEEAGVPSPHFPDWLDIIELEGRGLVKYLDLHMEPHPRSPERLG
FT                   VEPRRTPEPTGREADNTGLDILAEATKQMKAGGSAATPEASGDRPTSGSAFISGLIGSE
FT                   GFVAARKKPRPARGRNLRFEDDDDEADEADEPDPTSHRPVTDQSPTTPAGIVRTEPDGA
FT                   WTEAARLMNQLRGGEESMETLGRALGEKTPRGTAARAWREVSSPPPPPTREDEAARSAS
FT                   PAEAPRSATPARLRLETPLGKVLGGMGANLLRKLPEFLPMDEDVEEEPPRDRGEEEGPG
FT                   GEDAPGEDAEAPGGHFELVESPCDDVDETKEDDTEEEKETDEEENDDEDEEENCDEDEE
FT                   KRGDGEERKVSEADTPEPDAPKPDAAAAAILAEGVAALIARIESNAATRASLTTRADAI
FT                   IAHVAAIEAENEELGRTIAAMTAAIDTLTGKN"
FT   CDS_pept        join(413656..413829,413931..413966,413999..415591)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636331"
FT                   /orf_name="MICPUN_62433"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66138.1"
FT                   /db_xref="UniParc:UPI000199BBDD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY4"
FT                   /transl_table=1
FT                   /translation="MNGFDVVGALLLFVPPSEGRLRVKRRVAVDATLERIGTFFGGGSA
FT                   LHAVSWLKHYLQMKCHVAVDNAEPLWITFAAVFNTRRAPHGAPHPAGAMSTGTVAAVSV
FT                   STSSRAVASSRATTARRTTRASSSPSSRLDRCCATRAVPSRVGSARTSGVGFASIPAPR
FT                   RSTLTRGDDAYSGTDRSGATASALSAAGASSAFAVGVDAFFSFLGTALAALVAGFLALS
FT                   AWRRNLGLLRPRLTLSKSPRIARLVDSCPALHRPLRPPLLLQTSLAQLIAYLLKRNLVP
FT                   EARWTRETLTTGDGGEIALEWYECCDEDDVWNGLEGDGSVTASLPSDAPVMCVLHTLTG
FT                   TAADFVVLAREATRRGFRPVVCLRRGHLDAPLRTPKFNLLGNCDDLDVHLEAIRMKFPT
FT                   AKLFGYGESAGTGLAVRYSGEKGTRNPFTAVSCVCPGYDTTEGGAFSRFEPLLDRHLLA
FT                   SVKEMFLSANEELIRGFECAYVAPGYDELIAAPDMAELQRRLYGVEGYSSLAEYHERTN
FT                   PMGTVRDIAVPMLVINSDDDPICAPSNVDDNLWAFEGDVDRALVRTPIGTHCCFYEGRT
FT                   LRPRSSWAHEASLEFFESVLNEKG"
FT   CDS_pept        join(complement(417508..>418176),
FT                   complement(<415657..417432))
FT                   /codon_start=1
FT                   /gene_family="HOG000007959" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636332"
FT                   /orf_name="MICPUN_65741"
FT                   /product="Predicted protein"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="ACO66444.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG601918"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR015697"
FT                   /db_xref="UniParc:UPI000199BC75"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY5"
FT                   /transl_table=1
FT                   /translation="RYAVRLVGSCLATSVEPDEGATADAIKRKLTREGSATAAVKFAEL
FT                   HRRLAQQPGLKARWATLHALLRVSEDRRAEDRAVVPAGGGIGAGAATARHIADPLSAAA
FT                   AAGGLPALADPDPARSLAAGDGSTLGLDHPGSRALAYRELAAEAETNLEIGEQELVRDV
FT                   LFACQGIDGRHIRYNPQMASYVVDPAAPVRPGARDLARKLTELGWLFRRVRAALGGVDE
FT                   AGLGGDGGSVRQAFRAAVQAELADYYRLIAVLEAQAQVPMASALEAPTTGTGGGTAGGG
FT                   TYLTLRRLSVWLAEPLRRLRLLAVLVDAAADARGGALLRALHEHAKHGDPATRATVERL
FT                   LAAAAEPALRMVRAWVVAGELEDPRGEFFVASDPAVGEEDLWRSRYFINDEMRPPFISE
FT                   ATAADVLRVGKSINFLRRRCDDENWERERAPVAAAAAAAGGLSYGNPAALDALVSEAKR
FT                   RIDRALRGVLFDRYKFAEHCDAVKRYLLLGQGDFHHYLMDLVGPDLAEPASTVSAYKLT
FT                   GTLESAIRASNAQFDAPDVLDRLRVRMMPHAGAEEKGWDVFSLEYVVDDPLSTVFTEQA
FT                   MGKYLRVFNFLWRLKRVEHSLCATWQTMKPNVAAALQREGVAGAAGAALSGELRRCHTL
FT                   RGEMHHFIANLQYYVMFEVLEGSWELFSREMEEASDLDSLIHAHERYLDTILQKGLLGP
FT                   KSQLLTNTLGTLFEVILRFRGFADRLYDVARDAAMRRQLAQLRVEQRAEESKWGSLPGE
FT                   DAAGGDGLLSEDFVDEMREQLDAISADYAKMLDGFLNLLPLQTHVDLKFLLFRLDFSEY
FT                   YQR"
FT   CDS_pept        join(complement(419287..419633),complement(419025..419214))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636333"
FT                   /orf_name="MICPUN_62435"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66445.1"
FT                   /db_xref="UniParc:UPI000199BC76"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY6"
FT                   /transl_table=1
FT                   /translation="MRCRESARYVAPVSAPIDPFARCDHPRPCLRRECSCLAPSTSPRA
FT                   RAYRAGTDALLTRSCAPTLDRPSPFPTAEELLDEEIQAEEEGGLGMEPGPARFRYCTPR
FT                   RNPEKGHRTFLSARAVELRCEADCMDDASDALREAHARRLRRVLESLEDASCRKRREAD
FT                   ELERRAMALREELNG"
FT   CDS_pept        join(complement(421330..421458),complement(419989..420951))
FT                   /codon_start=1
FT                   /gene_family="HOG000035569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636334"
FT                   /orf_name="MICPUN_107145"
FT                   /product="Predicted protein"
FT                   /function="acyl-[acyl-carrier-protein] desaturase activity "
FT                   /function="transition metal ion binding"
FT                   /biological_process="fatty acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66446.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0045300"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG479880"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniParc:UPI000199BC77"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY7"
FT                   /transl_table=1
FT                   /translation="MPKSAAVDSPRIIVEGDKESKMAGLTQLRKEVIMDMEDFAENELM
FT                   GLLKDPNKNWQPQDFLPNPESPDFLDEVAAVQKRGADLPDDHLVVLVGDMITEEALPTY
FT                   MNMLNTLEGTKDKTGADGTAWARWTRKWTAEENRHGDLMNKYMWMTGKVSMKPIETTIQ
FT                   NLIGSGMNPKTENNPYLGFVYTSFQERATKISHGNTARFAIEHGDEVLGKICGTIAADE
FT                   GRHEIAYQRIIEEVMKRDKDGAVLAFADMMKKQIVMPAHLMDDGEHKARTGRDLFADFA
FT                   SVADRTGTYTAYDYASIMDHLIKRWKIADLDGLSGEAAEAQEYLMKQPARIRRLADFAA
FT                   AKAKKKEAQEEAFSWIFGRKVSI"
FT   CDS_pept        <422350..>422604
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636335"
FT                   /orf_name="MICPUN_74643"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO66139.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199BC78"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY8"
FT                   /transl_table=1
FT                   /translation="SLLVRQLPPDARAEELEEAFSKYGKVIDVYIPRDYYTKRPKGIAF
FT                   VQFPNPEEAADAERALDGTTLCGVENISVQVALQKRKDPS"
FT   CDS_pept        complement(423247..423735)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636336"
FT                   /orf_name="MICPUN_103036"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66447.1"
FT                   /db_xref="UniParc:UPI000199BC79"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDY9"
FT                   /transl_table=1
FT                   /translation="MSSRFALPLRSTLAAAAVFGLLLGRGVDARRLKQDSSEPPCPEVS
FT                   LDNLSELAGPCSNADQACDMDGGCIGAVIGYVESRLDLSQFDEMPSQDYIAGCIAPFAL
FT                   SDEVTDTIPQETLGAMIGCDYDAIAKRFEDSYNAQRAAALEGESADADAEDTDTDPIE"
FT   CDS_pept        complement(423967..428829)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636337"
FT                   /orf_name="MICPUN_62439"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="ACO66448.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniParc:UPI000199BC7A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ0"
FT                   /transl_table=1
FT                   /translation="MAHPRDPIARRRGKAKGNNDASKRANARKVPGVLRCAYADISSLE
FT                   KMVTRVCADAGILPPTLRREGDDRTYSDSLLRGTLCAIHARAPRLPSHAASFEHASSLE
FT                   EVHARALAAHFKTHSAPNNVLCYGVRRKRAPSRRDPPAPDRGTPGGANIASRADLEVVT
FT                   ASAATKSLLGARAWRTFHERVGDALMTHLLVHGSVFVPSGALTRHSLAAAKHGSHLQLC
FT                   GAPVSAVGASRAAAMARSKRAAAEAARVDRSTPEARKRKREKRRRIEDGRREEEKEEAT
FT                   TGSKRRRGKKTFERPGSADSGRGWDVLGTQSQESQPEPDDSQCEPETHSQESPAVVMLR
FT                   RVGGFVANVIRNGSNVANVIRTANPFMSPSSKTAPTDAADDPPGEPRGGTRTGTRRRRR
FT                   KRRRRRRKTKEKERGGDGEMMKENETDVVAESEPDQSGGSGEPKPQDATIGDARVKPSR
FT                   LSSWRRKKLARERAAAAMTDADPTPKPPSQATTVGEEEEEEEEEEEEEEEDSFVPETPD
FT                   VDVVASSPGDAANDVAWARLGAAAAAAGASSSDSVAMAWDRLGAMAASGDDDDDAATPA
FT                   KGSKEQRLKRGRVKVKSPGGAKSRAKRKPRRMKADPVRATVERPSEVVFDTSGFMHKSS
FT                   YSRTPGLPRGHALNVVGRGTAGARRLYSIVFGKKPAAGGLKTKSGDRRTSASPLKQVKD
FT                   QTTDGGRGRDKQTSRVPKWHRAALLPLLQTMIRKAARCPYASILERHCPMPERVRGGEP
FT                   AAEAKSLLASFTPPAAVASFLWSVVRNVAPREMLGGVKSRIALRRFLLRLVVLRRFEMC
FT                   TLHEAMTGLKVSEFPWLFGRAGVADEKRTRRATRAGPASAALARRRDLQRWVRWLVADL
FT                   VVPLLRSHFYCTETESHRLRVFYFRKGVWARLTAAHLAAMTEDPAGESRRPTSLGGTEL
FT                   PVTLDPTRPTPGPADETDEMDEDGWDSTDDADDPAAAAPRAAYRRLPKRRARLMLQRHL
FT                   LGFSKLRLLPKSAGLRPVAMLGRPAVASFRSLRPSGGGKRGVAGAAAGGTKNGAAAARD
FT                   VLAFRPVNTSLQGVFDVLRHEAGARPGVMGANVSDYRDVHRRLGPFIRRWRATQRQLAG
FT                   RKRKKTRGEVGNRVKRTEDDVPIAGPEPVTRPPYIVAADVKGAFDSIPLAALERVACEL
FT                   VGSGEYSVCRLARVVGGAAVGVRTKTQRIATPVAKPGAPTLDEPGNERSKPRKGSRRER
FT                   KVGGVVIDLANPIAVHKNQVLELLREHLRRNVVRSGGVYLLQTTGIPQGSVLSTLLCAV
FT                   FYAHLEQTHGLRGKSPSDNTSQKVLCRWTDDLLHVSFDRDPADSFLSAALEGFAEYGCE
FT                   VNTGKTSLNFDYSPGGAEPTRIATRSAAANNAEPKPPMIPRRETVIGHGPNARRCIAWC
FT                   GLLIDSNNLEVLVDYTRYAGDWAREAVTVPGRVGSGLKTPSPFSRLDRRVVAYLRPKCT
FT                   ALLYDHSVNSPLTARLNVYQSFLLAAIKTHCFVAAASEHPSARNSNGDGKGKVKTRGPS
FT                   PAAVHAAITAGIRYMEGAVRHHMAVARATLGATGRIQRTHVRYLGLHAFAKIFSRKQSR
FT                   HAGTLALLQRDIGAATMRVAARRLATVVDDELSTTFDQIRF"
FT   CDS_pept        join(429134..429423,429551..430052)
FT                   /codon_start=1
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636338"
FT                   /orf_name="MICPUN_103038"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO66140.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG557472"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199BC7B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ1"
FT                   /transl_table=1
FT                   /translation="MGAAVGYGTMLGTVPRECPHCAGEGGTRAVSKASFSSGGRTVGST
FT                   AVEEALRRKAYDDLAPTFDEELEWHEFFTGIKLMRWWMMRQARGNVLEVAAGTGRNFGY
FT                   YPEGTKLTATDCSPAMVEVCRAKATGSSSAIDVRVEDVQAKKGMGFESGSFDTVVDTFG
FT                   LCSYEDPVAALREMARVCRRGDGRGEGCGRLLLIEHGRSRSHAWLTNILDKHAAPHATK
FT                   WGCYWNRDIVGIVREAGLEIVQQHEFHFGTTHLIVAKPPEL"
FT   CDS_pept        join(complement(431331..431660),complement(430206..431177))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636339"
FT                   /orf_name="MICPUN_106244"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66449.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG732679"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI000199BC7C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ2"
FT                   /transl_table=1
FT                   /translation="MLHAATAGVVVPAASRSRGVARRTSVSRGVPDANVKCHGARLGHG
FT                   RTGLGPRHVCGGARGRVGFGVRGGDRVAAVNGAGGALEARRSREPKRTRRVRADAAAAD
FT                   AGSSDSGIVKPKVSMGKLQLRIASGVTLAMAGLGAIIFGGWIWAIVMSLTATLSAREYF
FT                   QMIETMPSELPHPPPKWALDMSIVMCALFIPVVYLAGAKQGHITMAVLGAFAAVGLRLI
FT                   QVESEPHFSKFTSTLFGIIYCGALPAFWVKLRMLNFSAASTAIYQSLQSSRSAFVNSWP
FT                   SALGGPEAWTTGLIVTVICVACIIASDVGAYAFGKTFGKHRLIAVSPNKTVEGALGGLT
FT                   CTMATAYGLRWLLGWHAGPVQTLVLGAVIFVAAVAGDLMESVMKRNAGMKDSGDIIPGH
FT                   GGFLDRFDSYMFTGIAAYFYVVTVMPHWFLGMTL"
FT   CDS_pept        join(433381..433710,433882..436743)
FT                   /codon_start=1
FT                   /gene_family="HOG000100125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636340"
FT                   /orf_name="MICPUN_98056"
FT                   /product="Histone acetyltransferase "
FT                   /function="histone acetyltransferase activity"
FT                   /function="transcription cofactor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66141.1"
FT                   /db_xref="GO:0003712"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG623378"
FT                   /db_xref="InterPro:IPR000197"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013178"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199BC7D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ3"
FT                   /transl_table=1
FT                   /translation="MMMGNGGGSGNMMMANGAPVLRGAAANGATFMGGGMGNQQQQQQH
FT                   QMMMMQQQQQMQMQQPPADQKPGGKQKKLTAAQQKKLAEQMKKQQQQQMMMMQQQQMQG
FT                   GDGQGRDGKPMTEEEIKKAYIVKQQRWLLFLRHASKCQAAEGQCQYTPHCHVAKSLWEH
FT                   VLKCTNSQCQYPRCLASRELLKHHQNCKDARCPVCGPVRSAMLKQRSQMLMQQQQQTGG
FT                   PNAKRMRTDGQFMPVGPPVAQVKGSVGQKRPGGEGTSLMECFTPDEVRTHLASLRLSET
FT                   ANPVAKGQPMSARRRDAEAEKAIAGASESACQGCGVERLTFEPPPLYCYACVGRIKRGQ
FT                   VYYHIPPSATGGEVRKDAWCNGCYNAIQGHVELEGQKWPKNVLAKKKNDDDLEEPWVQC
FT                   DYCNSWYHQICVLFNGRRNEGGEAPFTCPQCILSQLEKKERTPTTKRPSSQLPASILPQ
FT                   TKLSFFLEERLRKVLGRERQERAKLLGKPVDEVPHAEGLTIRVVSSVEKKLDTKSNFMR
FT                   VFKDQKFPESFPYRSKVLLLFQKIEGVDVCLLGIYVQEYGSECPAPNTRRVYLSYLDSV
FT                   KYFRPSGIQVATGEGCALRTYCYHQILIGYLQYVKQRGFTSCFIWACPPFQGEDYILYC
FT                   HPKEQKTPKSDKLREWYLKMLRQAQKEGIVLSLGNLYDEFHLGNQNHDIASATELPYFD
FT                   GDYFPGVAEDWIPGIEKEQAENAKKNKGKKPAPQSKTRGKKLPNAEVGDDLDVELAKKL
FT                   GATIQNMRHDFIMAHLAHQCTQCRKCIADDNRWYDSTPSDKGTVFELCQECYDVESALP
FT                   AHDKVLTKGRDLVCERVEALVEKTGDDVEEMQSEFFDTRQAFLSLCQGNHFQFDSLRRA
FT                   KHTTMMVLYHLNNPSEPAFVATCNVCQRELEPGKGWRCETCPDYDICEECKISVGHEHA
FT                   LVRSGQRHSGAAGGMTEEDRRDRQAQIQRTMELLVHATTCKLANCGSPNCTKVKHLFKH
FT                   AMSCTMKAGGGCQLCRKMWTLLQVHSKGCKATNCPVPRCRDLKEYRRRATEQIEERRRE
FT                   QYRMYINQQNAAMGR"
FT   CDS_pept        complement(437045..437326)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636341"
FT                   /orf_name="MICPUN_62443"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66450.1"
FT                   /db_xref="UniParc:UPI000199BC7E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ4"
FT                   /transl_table=1
FT                   /translation="MPSPPSLVEISFETVLVNIQRIPSEALVGLPEDFILALFEGILAR
FT                   GMLNEAIFDTFEEVAQRGGNGRLEERIRELNIRRLPPLPKSTREWLRH"
FT   CDS_pept        437514..440732
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636342"
FT                   /orf_name="MICPUN_62444"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66142.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199BC7F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ5"
FT                   /transl_table=1
FT                   /translation="MSGYHDDEEEYEPYEEDEEYDEYEEEALAAAGRAVQIAPRAFSLA
FT                   DEGEDEEDEDEDEDEDDARMMPPPPPRAPRGPGVPSSSGRDYAAALAGRGTGRDEDESE
FT                   EDEEDENEELFGDGEDLETYLKDAGPNSYNILADRRRKALRQRHEEEDAFNRELKVKGY
FT                   ENSQDLIDVTNADKLELLAKNPNYAMFFQGAGGTAPTAGPRGKIGRGKVRRGVRRTRRR
FT                   VISAEAAKKLGEANLLFTQGEGQYTRAIELLTEVIRLIPNEPDAYATLGTIYSELKNDK
FT                   KALDFLMISAHLEPGNKEKWNNLAEMSIRLNNPRQALYCLGQALRLDPDDHDNRWDQAR
FT                   LYVDIGEPKRALEQFQNLRERIPDNPEVAVELAKMHYQMGNPDLAESTLDELMAAHPTR
FT                   ADATLVNILAELKMDRREFNQTVSLIESSREHMRSLSARQREAEHAKMAGAAGAAAYNA
FT                   AIDEGTDRDAAFDRAKAETAAKLAKEREANPTDIPLDLTTRLGMSLLYLGRFDEAYAQL
FT                   EKIKEEDVESYDDLYMDAAETCWAVANLADVSVSQIDSHRLVTQAEFMWTKLLDVQKYD
FT                   DEPMWSKIAECIRVRIERGDGSARTASAASLRSKAAEAVVKFYRTVLARHPDSIRAKIP
FT                   LAEALIAAGGDEEAVEMLPAASDLDDLDKSVALRILDIHRQMGETGGDDDFLKYTLPLA
FT                   RQSLEEFKDKEEAKPAKAKAKKTKGGRKRKKAEKDDANDLFNLGPRGRRKAVRVEDDEG
FT                   EDEEDDEGEDDEVKLQEELDDAAAALELGAEAEEDQIPEEDSFGIILQCASALHKARRN
FT                   EEAYEMIEKCLAQAKSRGLSKTQVRDLNHVKALVCHALGARNVKGMKGEAAKAARHVAL
FT                   NNSTDADALNLYVRLAMDAGQRADCAKTFQSIVSMHDVHGVDSKKRVPALIMSGIVHSQ
FT                   QGAWATALADLMHAIALGPEESTAALSGGIAALQYSMKHIDVPEARHHWVLKAVAMLQH
FT                   AGRLRVKQEGTRGMHEGDYNLARGLQQLGLNHLAVPLYERCLEKGADELQQECAQNLSL
FT                   IYEQSGATALRDQVLRKYVNHDEA"
FT   CDS_pept        join(complement(441806..441831),complement(440878..441670))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636343"
FT                   /orf_name="MICPUN_62445"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66451.1"
FT                   /db_xref="UniParc:UPI000199BD11"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ6"
FT                   /transl_table=1
FT                   /translation="MDRNSVVAGKKVSRARREKSSQVTAERSAGLKRSADGPTRPATAT
FT                   AGFTDSTITSPAKKIRSKRDKQARASPRRNDVKDENAKKLNDKLNSKLNTVTNGRVAKK
FT                   KARRVRFKTAPGAPINSTQKIIHHYNNRRRNRVVPASSLASPRLSRHAAAVAVERLLEG
FT                   QIDVYGTHLPVRRSARLTPSRASSPARSMIFSPMRGECEATPGREEWYADNLPAEVFAV
FT                   AGGGTQRREEEYDEWVDGAAATPTPRPEYLTSPRVQWTPRSPAPHRGAVA"
FT   CDS_pept        complement(<442626..>444293)
FT                   /codon_start=1
FT                   /gene_family="HOG000294940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636344"
FT                   /gene_name="SSIB"
FT                   /orf_name="MICPUN_66536"
FT                   /product="Glycosyltransferase family 5 protein "
FT                   /function="starch synthase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ACO66452.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0009011"
FT                   /db_xref="HOGENOM:HBG596384"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniParc:UPI000199BD12"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ7"
FT                   /transl_table=1
FT                   /translation="IVFVTAEVSPWSKTGGLGDVCGALPAALAARGNRVVVVAPMYERY
FT                   GDAHDTGHHSTFHLNHGDQHVRYFARYKDDVTYLFVAHPALERGGGGRIYGGSPGNPYH
FT                   DNDFRFALLSMAAIESLLAVPWEDLFFGGGDAGAERMKRAYFETAPVFVANDWHAALVP
FT                   LFLAARYQANAEWTLKPRREWGTDGAAASIARASCVTIVHNLFHLGIVAPDRYRSLGLP
FT                   EENTEWFPALRWRWRDGGESMNFLKAGLATSSAAVLVSPSYANEVQTNELGCGMDKVLR
FT                   SVGNFGSDVDLGFLNGMSGKLRGIVNGIDVDEWNPATDPHIPAHFDVGTSEKGVVERAD
FT                   GCTVWDVARGKAACKAALQRELGLEVDPNAPLVGFIGRLDYQKGVDVLLDVVPHIVHNG
FT                   GQVVMLGSGDPGLEHGMRTMEQNHRGRAVGWVGFSVPMSHKITAASDILAMPSRFEPCG
FT                   LNQLYALRYGTLPVAHATGGLRDTVRGRVGWPFAPCEPGALRRAMDRAMETYKASEGNT
FT                   RLDSRWRRKQERAMTSDLSWNVAAEKYEKLMGKIAMDPP"
FT   CDS_pept        complement(445175..447043)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636345"
FT                   /orf_name="MICPUN_62448"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66453.1"
FT                   /db_xref="UniParc:UPI000199BD13"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ8"
FT                   /transl_table=1
FT                   /translation="MSATRWDDYGSVPPPTPLFRDDETRRRRRDWDDWDARDRYRDDGP
FT                   SLFSVTLFGFLFFAALVGVGYVASGARGSLWDNGPRARNVDHRTRTEAADLGMCQPQCD
FT                   YVNNAAPRSLIIYNTTWRAGLADRQDMYSGVLAQLAALTCARVALMPPKLALDPGHNNG
FT                   VYMPYEWRWDTYIANRSLVPFASPLDVDAYYDYASYDEEAFDASHGPREPVLMDWSNDA
FT                   VVIARDYMDPYNNPGVVIFGDHAEALTDDKILANLRRAIECARNGVPFIWKMNFEIAWG
FT                   PRYDWWVREFVGDDAGKAGLMYAVKQASLERELRAFGALDPGVGLRDCTLAEVTTSDVI
FT                   DRLADIATARALSASGLGRSVEDPAGDPAGDPGAADPGDAKFAALHARRGDELAWCDTS
FT                   PGALDDFVECALANATDPDVRAGKVPVIWFTDDSEEWYWNESTASMRAGMLRYIRRDGG
FT                   DHFPGVVYGESLVNATVEEMLVRVADEMGVDVGGFGTDRRHAGDNYLRYQIGVEMMQRA
FT                   EANADAYWNIHYSYRGGKPFKYGTCARGRGHPCARDGPVLRMARGEEDALAEFDHLLDV
FT                   GNNAYLVGGVELQRDREALKANATANITTNTDPGGVVTAGRDENDG"
FT   CDS_pept        447564..447938
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636346"
FT                   /orf_name="MICPUN_109138"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66143.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG557477"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BD14"
FT                   /db_xref="UniProtKB/TrEMBL:C1EDZ9"
FT                   /transl_table=1
FT                   /translation="MGCLASKELPTNAPAGRGPSALDQELWKSTQDLFNRLDRDRDGRI
FT                   TVYELREGALRELELDTTATECATFIGEFSNDSAAMDFPDFLEVMCSGAGTPEEVLLRR
FT                   FNSVRKKLEYNSEDSCSRAG"
FT   CDS_pept        complement(<449294..449956)
FT                   /codon_start=1
FT                   /gene_family="HOG000198041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636347"
FT                   /orf_name="MICPUN_86471"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66454.1"
FT                   /db_xref="HOGENOM:HBG706367"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BD15"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE00"
FT                   /transl_table=1
FT                   /translation="MDARGRSLLYVAARAADPAAVKRALILVNAETASARTASGKTALF
FT                   AAARGGCREIVEILAKRADADPNARANDGRTALWTACYHGHVEAARVLVQHGADPSIPD
FT                   ASGRTPLLAACAAGSGTCARFLLSGACDMPRRVDAEVKEASAGCSPLFAACVDGDVSTV
FT                   TSLLCAGAKVDAENKHGRTPLMAAAMCAHADVVLALMCRGADPNRADEGGETALHLAA"
FT   CDS_pept        join(450679..450798,450932..454855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636348"
FT                   /orf_name="MICPUN_103047"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66144.1"
FT                   /db_xref="HOGENOM:HBG557478"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000199BD16"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE01"
FT                   /transl_table=1
FT                   /translation="MGWVAYAVLLTVAACFASVPTAMAQNDFYGISEDIVQPPTITWLS
FT                   PPKGHISGGTVLTIYGSGFKRSRVAKVRFATESQFDEVDAEYVSESMIRCVTPKRATPD
FT                   TAHITVANDGMQFSGWPLVYTKGSGTFLKFIFDNSRPGCLDCLNSAVPLSGGRVYAGLN
FT                   PSKVVERWVLDNATGPYIGGTLVTITAAGLEWTRAGVAEYDMYIPGTTQRYNGPVGGPG
FT                   TPHPHNVDPMSSGNGPPVTGTFYPSEHLMCMWQCYFDFDQNAGTGENLTAAGLPAGVDE
FT                   ITESDWVPATWIDYTKISCESPPHKVPGRSNEEIAPTTCRVRVTNDGEKFHEGSYAVWR
FT                   YEDKRPTVTNIKTNQFSVWPARGPFAGNTEVVVTGTNFLPSKYLKCRFGGVNTADTGGA
FT                   YEQDDVSHIVGEVGGRVRYISSTEIICVTPIFGPAAAASQYPAGSPGTIGSGAELVVDG
FT                   YGGESSFLTYPFSMKLLDGTVVMTNRSDSVGNITVVSGGKGYATAPTITLEGGGGCCYN
FT                   ITCAVDEHGTITSVTVHDGGRGYNQGADAAATATISTVADGDPGSDKRQIVHDVKVTEG
FT                   GSGYLVPPDVYFECSGGPDDRSCFSSGEDSDGGPVPSWVPGEHATAIAVLGEYDPKCDN
FT                   SWQPCDAQGAVVRVDITFPGRYYSSAPVVKFRPQTPKVIVTPNERILDFADPPKVGYYS
FT                   NQGKGWDELDPEQSHGSWTNGQKDESIPYDVTGMPNGQNRLPGVSASQNCATPDFCPEA
FT                   RNPEDRGPLLPPLGKAWMDGSIKPGHQELVRVSNNYHKFGAMRGNDQDQVRTHFGYRNQ
FT                   TKNASIGEDMGYWMWSNSGMTEAEMNRCRVSNNPPIHQFSSLQGHGLDAALGLGTADDE
FT                   FQLIGPTNNLRYLDGSSVGGAPGYGAAAIVTLSANDTVCASTKKCYVSHVTVTNGGKGY
FT                   MYPPTVTFSGSSGYGAKATAVISGGIVVRIEVDPLARGIGYESNTLTEVHITAVRQPTV
FT                   YDAAAPHEGVYIDKGALTYDDSQTAHYDHALPNGTDGGDPPPRSVGHGTYTIDQSARSV
FT                   HVGQFASTSNYMVGHGAFPGHPGNQNLGHPRKDCIYFLYSDIYVSPSGSDSTGQGTAGR
FT                   PYRTLQKCIDASLAGSRDYYVYKRADGGDRDPAIPDGTPRYGIESAGERVDATKAGMNT
FT                   GTGRDKGYTGRQVRNYNERRTGWREATTGRLYGGRSWSDNTRDTQKGFGYTVNRDRCVL
FT                   KDGVYWGEGNRELQPHGHMVEIWAENAQNVIIDCGGRGVGKNVFTADRHSGERASVLGS
FT                   VTMHGVVMRRCTVRADPKANHRPYYPGRPGYGPGAKNPNGQSCWPGATGCQYRQAVDGQ
FT                   AAGQ"
FT   CDS_pept        complement(454976..455251)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636349"
FT                   /orf_name="MICPUN_62452"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66455.1"
FT                   /db_xref="HOGENOM:HBG609376"
FT                   /db_xref="UniParc:UPI000199BD17"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE02"
FT                   /transl_table=1
FT                   /translation="MAKFFSGVFNYVFNELLVDTLANSRAFQRFAVRTDKALREAQASG
FT                   KLTDVAKAPGEAAKTATEYGRAVWDELTRQAAEMERNAKQKAGGGK"
FT   CDS_pept        join(455445..455507,455612..455701,455885..456334)
FT                   /codon_start=1
FT                   /gene_family="HOG000079152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636350"
FT                   /orf_name="MICPUN_62453"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66145.1"
FT                   /db_xref="HOGENOM:HBG557479"
FT                   /db_xref="UniParc:UPI000199BD18"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE03"
FT                   /transl_table=1
FT                   /translation="MNGGPFKLPTKENADAAKKKREAIARIKKWVESRIPDKHIKDRTC
FT                   VVDVSEIVCGDPECAPIDTAVRIIYEGKAEGPVGTAFAFPCQSVELTREALDERMPPAS
FT                   TFEDWYEGKPTHWPPPPDDVTLRFEVGARVECKVGKKEWAPGAVTMHWFRQGDWPPGMF
FT                   APYQVQLDDGRLIFAPDDANKCIRAEGSGKGWCCFGG"
FT   CDS_pept        join(456490..456549,456697..456786,456951..457436)
FT                   /codon_start=1
FT                   /gene_family="HOG000079152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636351"
FT                   /orf_name="MICPUN_53360"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66146.1"
FT                   /db_xref="HOGENOM:HBG557479"
FT                   /db_xref="UniParc:UPI000199BD19"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE04"
FT                   /transl_table=1
FT                   /translation="MAGPFKLPNKAEAEAEKKKRAAIKQVKEWVESYIPPEHLANHDCV
FT                   VDVSEVQCGDPNCAPIDTAVRIIYKGDDQGGNVGTVFGVPCEAVDVEQSDIDEMMPPAE
FT                   YFDAWHKGETRHWPPPPENPEPGEPPDVELRFKVGDRVECCIARGPDGWAPGTIVSHWF
FT                   RAPQWPTGQFAPYQIKLDSSENLIFAPQDRDNCIRALSEQGMSFGFQQ"
FT   CDS_pept        457851..459791
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636352"
FT                   /orf_name="MICPUN_62455"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66147.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BD1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE05"
FT                   /transl_table=1
FT                   /translation="MAETAGDANPAASSGAVAEDDGDVAFLEAARSAAAASLEKRRAHL
FT                   RAREARARSATVATRAPNLGSIDESRVVNGDGRTDTIAGASNASGVARKVVARASGGVD
FT                   RLAGTPASHRRGDGNENARDDGKNASKTALGDDVSPALVRGREGARAVVDGSDPIGVTA
FT                   VFIETDRVSAGGAFETIFCGYADGSIRRFHRPAPASETVGNARGKTTRAGWTELDAVHA
FT                   PEPWNDAAGSVRIIKRVGSGRAGKADDEGGGGRLFAAFDNGSWVRFEMTRGQWRLVETP
FT                   VLGPHPDFANAFRLRPQLRGNKWVSKRARCLAMCHVDTRDGTDGVLYLSSPVHGEHCVY
FT                   RWEIPRAVCDVVAEAEAEANASASVEPPSTPEHKTAVGDVTQCAPAKEPSVATADDPGA
FT                   WERFKLDVWGVATKMDRHADAVAAIAPFPALGPDACVTGGNDGLVCVWSNVLNTRVGGE
FT                   TGDSHDAPLYPACAVNASAAVRAIAVAPDASTVFTAGSDRNVQAWAVHRKHRKGHGADV
FT                   RLVYTRSFAGGHEGFVTALAVLPGRGAAGQRSRCDFLLSGSEGGTKGDLFVPGDGGVKV
FT                   WRVADGAEVQTADTMKKEGTCEALVVRTDRDGGAIGVLRGGGDGAVVEWDVEWGVGSGN
FT                   RRDFPRGFLTQ"
FT   CDS_pept        complement(459869..460759)
FT                   /codon_start=1
FT                   /gene_family="HOG000165297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636353"
FT                   /orf_name="MICPUN_62456"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66456.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG557481"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199BD1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE06"
FT                   /transl_table=1
FT                   /translation="MSDDEYTDDDSASDAPNDDGLDGKTLYEVLGVAKEATPTEIKKAY
FT                   HRMALKLHPDKNPDDPDAAKRFQTLQKVYGVLGDTDKRKVYDETGRIDDAELSGDKFDS
FT                   LYEYYRGVYRKVTEEDVDAFHDSYRGGDEERRDVVEAYVKFAGDMAKVFMWVMCSEESL
FT                   DSHRFADIVEAAVADRVAPKFNAFQTWVKAIRKKPAPKDPLKKRSGRKLPKSGGKAKSG
FT                   GAGGDGDGDGDGGNLMALIRARGASRAAAADDLFARLEAKYGHDDGKRKKKGGGKVSGA
FT                   TGVKNAGVAKKRGGK"
FT   CDS_pept        461158..462681
FT                   /codon_start=1
FT                   /gene_family="HOG000085414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636354"
FT                   /orf_name="MICPUN_109140"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66148.1"
FT                   /db_xref="UniParc:UPI000199BD1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE07"
FT                   /transl_table=1
FT                   /translation="MTMIIFAILFVVPTFMHVSGYGQRLTDHLLDDAPRATPSAAAPLS
FT                   IGPDPTSPAEKALNAAEDASSPAPAADQAPAADQAPAPKKSSWLPSIPSLKPSAGEPPV
FT                   VLGPKHNRFTDSGIAFPLACSMQQALDGMMGAGKGNVAKGREYLPDIDFTKCRTHPDEL
FT                   DAVFARMFAVVPPVNTFDWCGGMQCKITMGKYTSKASEDWEKFVQTSKDDAPPPRAQAV
FT                   FPKQERWGRYLDCAVDDAWNCMFGVTTPSKAPADEDALKTARNIWSQRSCIFDRSCGEP
FT                   QSQYISKLLHGWMFRWSMPLNACTEGYRNACSNRVVSNINLPKSTKNRVFMSIHMRMGD
FT                   ACDRVEQKERMTSWEWEHGRGRPCIAPHGYDDAIERMSKKYGVTDILLASDQADAIAWA
FT                   KEQKKHDVHWLDTDRSKLNHGSGWIENRMDIGKEETEGALEAIDFLAHGQVFLGNMGSF
FT                   FSRAVYKQMIGRHNAVVPWTSIDGRPLDREWHEFLGRRRATRRALSVSD"
FT   CDS_pept        join(complement(466068..466424),complement(462783..465860))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636355"
FT                   /orf_name="MICPUN_103051"
FT                   /product="Ligase/ankyrin repeat fused protein "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="ACO66457.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG557483"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199BDAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE08"
FT                   /transl_table=1
FT                   /translation="MRQGPALGGVGPFRLPTRGPDGQLEIHRPNCLCCIGPPDDAFERS
FT                   CAAVVALRIEGVGPAEAERFVRLCTRAGGGDATPLSKGKLKAACKSVRSKASGAPPLDL
FT                   ATVELMQRKVLECYGIVRWSYGELWSVASSAAAEVRRALEGVDAPRLSDMQDLDGLSPT
FT                   VGLLVEDGVELPVAILAILLAGAAVVPIGATDPPARIKDVLDDAGCSVEIASDRAGDGG
FT                   ATQRLREAWAKAGRADFKVIPAASLLSNESREISREAHTYDYQTPPPAFPANKLSHVFF
FT                   TSGSTGRPKGCLATHGGLSLYCDEKNQSLGVGDDSVVLVASPHSFDPSLGDFLGAWRAG
FT                   CVAATAPRSHLFASMGACLAASGATHVLTTPSMLSTIEPATEVDPSGEETLPNLPNLRV
FT                   VALGGEPMPEALARAWLPAVQRLVNGYGVTECTVYQAFRDVTSVETRRAVGGVLAGCDM
FT                   LLAKDPGDDPSDLLDERRDPDGTLAEVWFAGPLVGLGYANAPTLTTERYFVNADDGRRF
FT                   FRTGDVCRLVRRDGQPAFVEIVGRRDSQVKINGQRVELGEVEAAVCASAPGLVAECAVS
FT                   TPRLDAAEPRSKAIVAWCVPPQSGGRRSKTLENAQPPTPEDAGGGREPFSALRADALRW
FT                   LVASRVPPHMVPSRFGVARFGLPTTASGKAARSVVAKWGAPPLPNRDAMFEGEGSTAGE
FT                   RGEETEAAGKSGFEPVTSEETRALDAFARVVASAWSTELGSEVTLTSRFAELGGDSVAA
FT                   LRVCQAIAASFADDDASQGHAGASMNGRMGGTFGEALVGALAPSRVLVGAGSLSLAAHV
FT                   RGLRSAAIVGELGTRAATLARGDSDDEASGVATERAEDGDGDGESAPEGDERTEEGASL
FT                   LRRAAFEGDAVVVEQLLDAGVDVEGAVGVPSRVPSSTPLHIACGGGSRDRDGRAAAALL
FT                   SRGASPRARNRRGQTAFIVAAARGPNSLLAQILERGGDAGAADDDGQTALHVAARAGAP
FT                   ASVVAAVAAAADGAPSPITTQKNAQKNARNDKSKGPKANARNDKSRGEQARRYGGKVAA
FT                   VDRVDAWGRTPLHWAAVNGHRAACVALLDAGASASAVDDAGETPTDAAERRALCSARER
FT                   PDGARASTWGDIATLLGGSGRTKHLKAQLAARASKGT"
FT   CDS_pept        join(466619..466836,467284..468136,468182..468727)
FT                   /codon_start=1
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636356"
FT                   /orf_name="MICPUN_86118"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66149.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG322449"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI000199BDAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE09"
FT                   /transl_table=1
FT                   /translation="MPLPAHIQSRRDCLTFVVLGATGNLARRKLLPALFQLYLTGHLPP
FT                   RARIVGVGRTELTDEQFHEFVAAAIRQASSIDDDAAAAADESLRATFDLCERWEAENPD
FT                   APRRNRLYYFAMPSELYPPVANAVHRGGRAVDGGWTRLVLEKPFGSDAVSAAALNRHLA
FT                   KAWKENSLYRIDRYLGKEVIDNLLVMRFANRLLTPIWNRDNIANVQIIHKEPFGAISDY
FT                   FDRHGIIRDVLQNHLLQILAVLAMDRPVSLDPEDIRDAKLKVLRQVDRVDVEHRVVAGQ
FT                   YVAHEGKLGYKDNPSVAADSRAPTFAMIVLNIRNERWDGVPFILKAGKALNEKRSEIRI
FT                   QLRQTPGDIFGDQPAADQNAYAGPNEFVLRLQPHEEMYMKLTIKEPGLGVQPVPSEMEL
FT                   SGRWRAEQLRKEAAGEAPRRAYERLLLDAVHGHQAHFVRGDELEAAWSIVDPVNAAIAR
FT                   GDVPLHEYPFGTRGPTQADALRAAVGHVAFVVPRDGVHLSSADDLASYDFSPKYASVPV
FT                   GDVWGRAMDTGPGLMPPTHPA"
FT   CDS_pept        468873..469190
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636357"
FT                   /orf_name="MICPUN_62461"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66150.1"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR019083"
FT                   /db_xref="UniParc:UPI000199BDAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE10"
FT                   /transl_table=1
FT                   /translation="MLANLARRALARPCVVSASRVPVARRFSAEVEGEDGEKPSEVAIF
FT                   MNAIGIEGHDEKFADLKALLHDTKTEKLKEFGMSVQQRKKLLSHVEKYKRGLWAPKELR
FT                   R"
FT   CDS_pept        469317..469832
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636358"
FT                   /orf_name="MICPUN_109141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66151.1"
FT                   /db_xref="UniParc:UPI000199BDAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE11"
FT                   /transl_table=1
FT                   /translation="MTDSAEPTRVASMSGDEKAAALCDDVAASVHPDTEAVAQHCGQIE
FT                   RSAEDMLARLDELVAVLNKLREDSKEQREALTPALEAWASGLARDFAYLDSAEDTVEAV
FT                   KGAVANVEHQLAQLESTEFRRARLADIEKARKGIEGLFQGWGGGQGSVEGGYWTSIGGG
FT                   GDAKDPKR"
FT   CDS_pept        470170..470631
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636359"
FT                   /orf_name="MICPUN_62463"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66152.1"
FT                   /db_xref="UniParc:UPI000199BDAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE12"
FT                   /transl_table=1
FT                   /translation="MWGPTRVELVELVERPRRRPDSDDDDDECPARRLDAVAKHPRDAA
FT                   ADVPGLVARANVTFETVGDLSAVLARSSRVDSSVFAPTPDLSKSFIRSTPSLTSAATTF
FT                   RRAAVTGDRGSARDFGRGLSTPGFSSRRAPFHPPRRRGAMRAPLNAPST"
FT   CDS_pept        470669..470959
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636360"
FT                   /orf_name="MICPUN_53363"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66153.1"
FT                   /db_xref="UniParc:UPI000199BDB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE13"
FT                   /transl_table=1
FT                   /translation="MTKTVARRSSRRSEELARTETARRRLRTSRCASRRSLWKPSSRRA
FT                   RGGSNGGSREYVTRGPVLARGCSFLGERDWRVRGDGCRRYFLVARSVPGRH"
FT   CDS_pept        <471704..>472744
FT                   /codon_start=1
FT                   /gene_family="HOG000198129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636361"
FT                   /orf_name="MICPUN_67917"
FT                   /product="Ca2+:Cation antiporter family "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66154.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG444187"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI000199BDB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE14"
FT                   /transl_table=1
FT                   /translation="GGWLLHVLAILYLFLGIAIICDDFFAPSLEIICEKLGLSEDVAGA
FT                   TFMAAGSSAPELFTSTMSLVSDNATNELGVATIVGSAVFNILIIVAATVIFSGETHLAL
FT                   DWRPVTRDCAFYAVSIAFVMGVMWDGKVYWWEGVVSVCLYLGYVGFMTINGSAMDWMER
FT                   VARGFRRRTLGNKIASFREETREETDDLERSVVELSLSPEDDKAGGNDGTVDDEDEANN
FT                   PFAVPDDWRKYPMWALSLPWYAAFTVTVPDCGKTGWERWYLLSFFSSVLWISAISYGMV
FT                   DAAAVVGCVLDVPEVVMGTLVLAAGTSVPDALSSVSVAQAGQGDMAVANAVGSNVFDIW
FT                   LGLGLPW"
FT   CDS_pept        complement(473130..475880)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636362"
FT                   /orf_name="MICPUN_62465"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66458.1"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199BDB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE15"
FT                   /transl_table=1
FT                   /translation="MGGGADGEDPGGTPPPEDVAGIDLDPAQHSKDEPEPDPVAAHGTA
FT                   DAQSESIGTEDSASEDDADANEHEHEPLFEPDDGFEQMVQDITDPAGVPWPGIPDDWSD
FT                   SASDEDDYSGESGEFSDDDGDYDSDGDDGDMSGFDEDAMHFEIEGTIQGHPHRACDPEE
FT                   RGHYLLHDGRVPSSHTGMNHQQGSDSVCAAGDGLLLVTGDVDVRLVDANAIVSDGAYDA
FT                   DGRFNEPDPDGPGPVRTSPDGPDGAEYVADGTPPEYVAKQELPFSVYSVDYDEANRLVA
FT                   VCGDVRRYAQDVNLAVFRVVRHQRVGQTGNGPVSASFVPVAERGVGAMGRFGRDMVNCV
FT                   RFGKRVKASDGGVRLDGVHRPTGGEGKRAIEDVLLCASQDGNCYAMSVDVKDDAGGALE
FT                   ALGDDDDDALDGAGQGQVGGFSPGGQGGRGPRRRPRLDARLVDCCKISFPVASNAAAAS
FT                   PDGTCVAVCGDAEFVLVNGGPDGYGDHGATQHLAINGDPSAAGVVSGEAAGGMYAAWSP
FT                   TGEYLAATSDSLHALAVWRVTVHDDSRAADEAGGGISAGDISGDVVDPSATTATSAGRS
FT                   RSVPSSPARAGRGFGRDASTADSRRSRSGARGPPLAARAARVGAVVGPLRIQRVAYFRD
FT                   HAHPCLPVRFLPSDGHVVVWAERGGRVHAYDLRCAHAASLGSSSAVNLSPPPEEDGHPS
FT                   RGRGFDAGAGRGADEDSIITVIGADDDEDEVGSGADEDGGDRNLNQWRSEIEPARSEGV
FT                   EVCLQPRTDRLFRPLRLRGADDDQRRFVQTIRSRVRGKYVTGLCVVAAASKPPPASPSR
FT                   GSPARIGGSPAPPRDLVFVGTPDGVLRFRCPVAWTPETHQDFPVAFRKASRAFVQCAAA
FT                   DFARKAETGDEESSSALSLGDLPQEVLLHIVGLAAVPLSDWANVS"
FT   CDS_pept        complement(476320..477819)
FT                   /codon_start=1
FT                   /gene_family="HOG000033687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636363"
FT                   /orf_name="MICPUN_109142"
FT                   /product="Amidophosphoribosyltransferase "
FT                   /EC_number="2.4.2.14"
FT                   /function="amidophosphoribosyltransferase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /protein_id="ACO66459.1"
FT                   /db_xref="GO:0004044"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG392416"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000199BDB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE16"
FT                   /transl_table=1
FT                   /translation="MCGIVGIFRHEGQVSAELYEGLLMLQHRGQDSAGMVTFDGVRFQE
FT                   RKDNGLVANIFDKKAIDSLKGSVGIGHVRYPTAGGLSATEAQPFFVNSPLGIYLIHNGN
FT                   LTNVDELLMGLGGRMMKTTSDSEVLLNVFAEDIAQSITSNPGSDMEKVAFDAATKTMKK
FT                   VRGAYSVITMINQVGLFAFRDQNGIRPLVIGQRKAVDGSDRDEFCVASEDSAFGPLGFS
FT                   RVRDVNPGEAILITPDGRLESRQCVNGKISPCIFEYIYLARPDSMLNGISVYEFQLELG
FT                   RRLAKRIKDRCEDDDWEIDVVVPVPDGSRPSAIEIAQCLDLPYREGLVKNRYVGRTFIM
FT                   PDQRTRELSVRRKLNAMRSVFNGKKVLLVDDSIVRGTTMSQIVQMCRAAGATKVYLASS
FT                   APPVKHPNVYGVDMPSREEFVAHNRDEEGVCDLLGADGLIYQTVEDMLQAGRGMNPQIE
FT                   RFDASCFDGDYVSGDVDDVYLENLSGAGRGKGRKGASAPAR"
FT   CDS_pept        complement(478500..479066)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636364"
FT                   /orf_name="MICPUN_109143"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66460.1"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniParc:UPI000199BDB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE17"
FT                   /transl_table=1
FT                   /translation="MSAATRHAARRLAESLSRRLSLARAATSSGAADRAIHEAPRRRNG
FT                   PADPRRREAEPAPLPSPSPSPDVVNRANRRGAGASGLTVGELRAQLAQRHGGWGGDEDD
FT                   EDWYGDHPLDAVMERLAKETMGPDAKTVRIGDGVTVVMPGQIMNVIDGFGDGHGIQAAS
FT                   VKLKRKRKMAKHKHRKRRKRDRNKN"
FT   CDS_pept        479572..481341
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636365"
FT                   /orf_name="MICPUN_62468"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66155.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BDB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE18"
FT                   /transl_table=1
FT                   /translation="MGVMDTLTRSTADTVAKTDSKKWAMDRSEALRVVFHALDGDDSGS
FT                   IEIEEVLHLATGMCQTMSEDDARAWFQEMDKDGDATVDEAEYLEAMLKLTDDLSPQQFE
FT                   HRVKDLLARTNKEVTDPRWYYHCENNREYLEAEVVPLLESGLNEMMRAIEAERLRVASG
FT                   KDWDEDGHVPPDWRPMRPLQFLGEYLRENSRTMVRKREEEARLAAEAAAKAEYLNRTFD
FT                   EMDREQKLRYSFDKIDGDGNGALDFDELVFVCRKINPGKGVEEARMQLSWMDKDGDGQV
FT                   DQDEYVNAILEIMQDVDEETFVNGVKRVLTAVQFAKADRIEKLKMVFERVDEDDSGELD
FT                   RDELTKLAVALVPGGDEVKVRKTMKWLDANGDAAVSFEEFKGPMIEATEGLDDDQFDAA
FT                   VHKLLAAEGEAVEPDPADDLPPKFGAYVTQFPSHAKCKWIGVKRVDSMTRDEKKICVVD
FT                   CRSPDERAVSIIKDSVPLGDVKFVSFEDNNVEAVAGGADVSAACEGADVVVCVSAVGAE
FT                   GGIAAPILAEKLEGKVEVRNLVGGIVAWYNAGGEVVDGEGNPVEAVHPGQRRCIGFVTR
FT                   ARKNAFKFPKEEK"
FT   CDS_pept        481410..481601
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636366"
FT                   /orf_name="MICPUN_62469"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66156.1"
FT                   /db_xref="UniParc:UPI000199BDB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE19"
FT                   /transl_table=1
FT                   /translation="MSKRATAVALVAFACCTFSVPFVLSGISGPSMYASEKPLDVAAVR
FT                   RGAFMNSGSKDIGSSTNR"
FT   CDS_pept        481782..482663
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636367"
FT                   /orf_name="MICPUN_62470"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66157.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniParc:UPI000199BDB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE20"
FT                   /transl_table=1
FT                   /translation="MTEEAGDAAGADPEKKWTKRDLRHTSAVVICPPSSQWGPIQEIRS
FT                   FNDKSYARWMPHINLLYPFLLDDDDGDDAPRRNFDAATAVAREALRGIEPFTVTLRSFG
FT                   RFEHAKSCTVWLHPSEPLEGNDPARRHLANADVDADPPPVSRGITSTQAALERAFPFAD
FT                   HLSSISSHSGYTPHLSVGQWDDVASASAAELALRDAWEPLTFEVDAVYLISRAGADAPF
FT                   EFKARVPLGAAGGAWRRGDDDDDGGGGEWWIDAYHPPPPPEGARCLRPRPKRRWRGKRR
FT                   GKGGGGRGDGAP"
FT   CDS_pept        complement(482798..483271)
FT                   /codon_start=1
FT                   /gene_family="HOG000232456" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636368"
FT                   /orf_name="MICPUN_62471"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66461.1"
FT                   /db_xref="HOGENOM:HBG309995"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="UniParc:UPI000199BDB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE21"
FT                   /transl_table=1
FT                   /translation="MAGWVDNTAEVTVTAPLPVVWELWQDKTRIPNWMPWIHSVEPVPG
FT                   VPGDTKWLLKTNQFGQDFEFSWVARDLPPVKKEKIHWFSTDGLNNKGAVTFVQRPDGRT
FT                   VVRMNISYEVPDILVPFGSALSPLVASILQADLERFGTFSSKVVAAMGAGKRR"
FT   CDS_pept        complement(483541..484506)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636369"
FT                   /orf_name="MICPUN_62472"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66462.1"
FT                   /db_xref="UniParc:UPI000199BDB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE22"
FT                   /transl_table=1
FT                   /translation="MRASSAVRLSLPTAHRSASTRAPPAGRPSGAAPRAPRTHVAVGSR
FT                   PRGISMLRSHRTSPRVDRRGDVAVAHAAAATATAASVVPEIAIALSLGYLVASFVAFWW
FT                   GASHPRSAAATYLRSPLPLVPLCVAYLALLCASWSPDTLSLMMPGSLAEGLATGQPQFF
FT                   PKLNGIMTLLSRRVTASSAWLHIACINFFVGRVAALRAAELRIPVAHTLLLTLITGPIG
FT                   LLSHWVTQEVFAGSKARARRRTLTASESEPALRLVVGVNGGGILPERAPYGEGYGRGYG
FT                   HGYGDVPKVGRVGDNKGGKPMSRARFLMLARLASFGETKK"
FT   CDS_pept        484663..485706
FT                   /codon_start=1
FT                   /gene_family="HOG000201024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636370"
FT                   /gene_name="MGTE"
FT                   /orf_name="MICPUN_62473"
FT                   /product="Mg2+ transporter-e family "
FT                   /function="cation transmembrane transporter activity "
FT                   /protein_id="ACO66158.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="UniParc:UPI000199BDBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE23"
FT                   /transl_table=1
FT                   /translation="MRALASVRPFPAAAPRRRASEGPKPGANPSGPARRGCRRFFAARG
FT                   GHDAEGPNTRETQYVAKTATQATDAKENLTESQQVQRDLALRMMEAQSRWLEAPGTPRR
FT                   TRKKSKMRRPVDADPAADATQTAASSEDVAGDGDLIGMDAETVVGEAWERGRWLLGLLV
FT                   LQSSSSVVLQHYGDLVRDNLIITLFLTMLVGAGGNAGNQSAIRVIRGLATGEMVTTREC
FT                   FVETLWRQARVGFLLASFLSAGGFARVMVTEATGGLDAAGGAAGINDPPAAVGAFGIAL
FT                   SLFCIVTLSTVAGTAMPFALAASGQDPANAGTTIQVVMDIMGVVITCVVCSLVFTQVPG
FT                   MLAAVGG"
FT   CDS_pept        complement(485780..486625)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636371"
FT                   /orf_name="MICPUN_62474"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66463.1"
FT                   /db_xref="UniParc:UPI000199BE57"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE24"
FT                   /transl_table=1
FT                   /translation="MWGSPKPKDARGESADPGNALVPAQSASMQQQGAQPAEFVDQPTA
FT                   TPTVRPEPKKILKARTLAEDFAASGWGKRFTLGLTWWTPMSPIVGYDGVGNAVSRLWEN
FT                   TVLLSGLIASLAGFAVVFPNSQVLEATPGWTTAYFVLWTLTFYFTVTSGFVATILLNKM
FT                   CKCAPQNMPLWFAKFGGFVEVPQLFLYLGGWTAFGGLLACLHPLYKNDVAIYGLSGVSI
FT                   GLVVLVTKIYSQTTDFEKACAKVAAKNTTGPGVGDALVMADYSRRRKDAGEQVDEYFNY
FT                   "
FT   CDS_pept        486849..488867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636372"
FT                   /orf_name="MICPUN_62475"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66159.1"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199BE58"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE25"
FT                   /transl_table=1
FT                   /translation="MRRPGARGWASVLLLALVWSSACVGADARDPWYRRGRRERPGIPL
FT                   WKPPGSADVEPIVVEVTESAPEDAAPAPRIDTIEAIENVDLEAPGALEKALAARARASD
FT                   KELMVLAVGDTRDHRRMHKDPALSQVSVDFAINLVENLAALGLRNYLMLTSSAQLCDEL
FT                   RRDADVDGCAHSSHLTDREKELQRWGLKPGDMFLLWAQQWRVVQRALEAGYSVMRVDSD
FT                   VVFLEDPYLALRGPLLSPFAMVSQTDVFDLGTRPRCDADTGVTNEPGHPDVKRCDSSSL
FT                   KSQPQLNIGLVYFRRSAMADDGPTLGVIKDMLKAFTAKLLGDVQVNDDGNPIAEALLDQ
FT                   PLFREAVSQRVRRGSGWKVASGSSGEVYASIGSDGDASDGAAVGDECPHARTTCDAIAA
FT                   ERRRTDIAFASLGEGEGSELAAGAPDWLFGRGCVKTVADAPRALAHLRSIRSTNAPASI
FT                   DGSSENGTCETRAGVVNRAPGVGGVGGGVVAVHMVYSKARKRADAMEAMGWWRASVRRP
FT                   GGGRGGGEVGGAEEEAGMAKKDGEAGEQSPSGVASASAGGSSSPGDGSVDGCVGRDGAG
FT                   VLFSHTYFRQNPPGARAFVCAGGTPTGTCPCCEPVPDEDGEDRSWVRNVAKGVGLVALS
FT                   PEDREDALTGQRLEDHIATAPGCGMHQNGGWNEFWDR"
FT   CDS_pept        complement(488981..489280)
FT                   /codon_start=1
FT                   /gene_family="HOG000029137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636373"
FT                   /orf_name="MICPUN_73368"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66464.1"
FT                   /db_xref="HOGENOM:HBG748209"
FT                   /db_xref="UniParc:UPI000199BE59"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE26"
FT                   /transl_table=1
FT                   /translation="MPPWERRELMKKAAMEKGGLPWPAYLGLSVIVSIAAIGSCFELNY
FT                   GNPIFGVVGPDSFLYKPILYWFIGTGFPLAAFLWTKGIAGANEAAELQDELDGY"
FT   CDS_pept        join(489822..489959,490090..491211)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636374"
FT                   /orf_name="MICPUN_62477"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66160.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BE5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE27"
FT                   /transl_table=1
FT                   /translation="MPSKLELDAYDSMRQTRATLRASNRDLAMETSKSAEFKMQSVKDL
FT                   RKMLTGADADGDGRLDYGELANIDPDLYIDVLGLKDAESMLRRFDKNRDGHIDAHERRE
FT                   LIKGLIPKLKEETIAMRESGEFVASGVLWQNRKKFMESLRESHVKDVEHSQKAFEKRYF
FT                   DTVEDEETAFFRVRVEELHDALRAHWEGKDAYIERVIQQKWELFKSTKDTCKDPTAPLT
FT                   PKMSKRVFELRALLTNLSRARHPTKFQLEEGERFKVELHELEDEAHARHATLQPAWYKL
FT                   KERECKEELKAMRAKHAQLKRASFDRFFEYVNEARQLLGARHGAYHQRMEHAHKVGLAD
FT                   KVIDELWHPRPLNMQPTITSYSPRMPKHKGSGNLDRVANGLGAYQLAHHERTPKPEHIL
FT                   RVTASGPPKRLDRKLLTTMF"
FT   CDS_pept        complement(491317..>492000)
FT                   /codon_start=1
FT                   /gene_family="HOG000200840" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636375"
FT                   /orf_name="MICPUN_86755"
FT                   /product="Predicted protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66465.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG596607"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="UniParc:UPI000199BE5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE28"
FT                   /transl_table=1
FT                   /translation="SESGPPTDDNGGDGNDGKGPRPGTGDDIYDAWPEWVPEGLRLNTD
FT                   DVYTVLVTFAVSLAFRATIAEPRFIPSLSMYPTFDIGDRLIAEKITYRFKHDPFPGDVI
FT                   IFHPPKTPKTSTALTKEVFIKRVVAVAGDTVEVKKGELYVNGISRGKELKLEPATYNMD
FT                   PQVVPAGDVFVMGDNRNNSFDSHIWGPLPKENILGRACFKYWPPQKFGGLPKYPSQVAA
FT                   VPERY"
FT   CDS_pept        join(492780..494080,494121..494127)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636376"
FT                   /orf_name="MICPUN_62479"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66161.1"
FT                   /db_xref="UniParc:UPI000199BE5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE29"
FT                   /transl_table=1
FT                   /translation="MRSAAERILLGVGSRPQMPPRPASRRESDEGDAYFSDDSPVIATS
FT                   QRDRERLDKARERDRERARKAAEKEDERARKAVDKAAAKADKEAAKERAKADKAADKRA
FT                   RELSSGKHRMRQITCVWDSRLGTTGKDVGYMLRSQLKTGVNDQNKVCECLNTAQMLPVP
FT                   RSVTWRFHPPSDQPAGFRTLSGLTADVTDGVPYTIAYIPGDEFVEMAWVDHVAARDAGY
FT                   SRGEWDAPEPPGGFRRFIRAAKTSLGRDHVLCLLVTNINGACTTRERRDVRANRGEVGF
FT                   SKAPVDMEVARIHARKYHNVRLTPVPDVSTAVEHIVNMHRAWAMKPYAKETTILGILGS
FT                   NGARSTVAEQAALEAAFVAAKSVAPDGTVYESQDLDSQFSQDPADVRDAAGHRRRTKTP
FT                   AQVWAAALMKIPRVAEKEAMAIVLKYPTMMSLMEAC"
FT   CDS_pept        complement(494305..495096)
FT                   /codon_start=1
FT                   /gene_family="HOG000263862" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636377"
FT                   /orf_name="MICPUN_62480"
FT                   /product="Peptide-methionine--S-oxide reductase "
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO66466.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000199BE5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE30"
FT                   /transl_table=1
FT                   /translation="MEQLMAMLGGGKKGAMIAEDKALPGRQQAMKVTNKHYVLGNPIQE
FT                   PFPDNLETCVFATGCFWGTEKMFWRVPGVYSTSVGYCAGYTQNPTYEEVCSGQTGHTEA
FT                   VQVAWDPTVISFADLLSMHWTCHDPTQGMRQGNDAGTQYRSGIYCSTKAQLELAKKSAE
FT                   VYGAALKAAGATRDITSEINGPGDNCVYYFAEDYHQQYLAKPGARPYCSAQPTGVPVPE
FT                   EFLKENGAKLSAGYWKKYGPRPGCTIQVSNEPVPVEEALNA"
FT   CDS_pept        495416..495733
FT                   /codon_start=1
FT                   /gene_family="HOG000244123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636378"
FT                   /orf_name="MICPUN_86171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66162.1"
FT                   /db_xref="HOGENOM:HBG557500"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniParc:UPI000199BE5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE31"
FT                   /transl_table=1
FT                   /translation="MLDNKYHWSAVAGFLVLFHACYSVIAYRNDLKIAGDEFEGVPFLV
FT                   LIECAIGFGACAWGSVGFAGELVPIKAEPVELPPVTMEKNDDFMTFRHRGRALNPPGKR
FT                   S"
FT   CDS_pept        join(complement(497495..497806),complement(495750..497405))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636379"
FT                   /orf_name="MICPUN_103061"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66467.1"
FT                   /db_xref="UniParc:UPI000199BE5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE32"
FT                   /transl_table=1
FT                   /translation="MADATRHNDIVARLRMFAAAVVLLARLRAAAAAAAESPAAQRCPF
FT                   AYPSYREAAHAHLAKVFDRAGFDTRRGSMWFAKGDDVPPDCQTCGRVNPAIGAYGCPML
FT                   PTKRDRERAWERAWERASSPKTSSVLETAILADGASTVGYIPSDAKRERAPRRDARADR
FT                   YIPDLSFATVSPADAEAVSLAPGEHLSCELDLGFRDAALVVGCTPPPSRYFGVTPHLYR
FT                   EYSVGGVSGGAETLMKPLGDSLSYGVGPPRAAQSPGGTSSSPAARYTRLATNARKVGTN
FT                   WYANDARAVVRDDASLECAGRTFAVLVGRSRHTMAAAMDALEAAGVVNDTAVNPYGLSS
FT                   PGGDEDGVERTHAVVLANAGPVGSQTEWDAYAKSPPFVVTRLTPRDPTWFDPFHAIDWT
FT                   DHGHHPGEFPEAGRIARARVDERGLASAVAAVAAKIASAFDAEGGYRTRVSESPGISGS
FT                   DMHADDAGDVTVVRGPSFHLPTDGSKDVYVVGVDRSQSGSATYSVTSLASASFNFDVQT
FT                   SLPLADDSTYEGTATRWGELAGVNVEDAAAMYVVKIAARCPEGAVDGDGVRCVEVKDEV
FT                   AKFGGATHEFVLEERAYAHPDTTTGPDRRNLAAPVVVEVTRASREVVGPGGSGFGLSWF
FT                   RRCDFETATLVCGEVRTNYN"
FT   CDS_pept        join(complement(500749..500883),complement(498071..500371))
FT                   /codon_start=1
FT                   /gene_family="HOG000228138" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636380"
FT                   /orf_name="MICPUN_62483"
FT                   /product="Heat shock protein 70"
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO66468.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG315155"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniParc:UPI000199BE60"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE33"
FT                   /transl_table=1
FT                   /translation="MSVVGLDFGSVNSVVALARRKGIDVVLNTESKRETPAMVNFGDKQ
FT                   RFIGCAAADKINMQPKNTIVQLKRLIGLRFSDPEVQALVPAFLFPISGGPNDEILITVD
FT                   YLGEKKTFTPERLVAMILSDLKVIAEADHGAKVTDSVISVPVFFTDAQRRAMLDAASIA
FT                   GLNVMRLMHETTATALAYGIFKTAEFGDDPHNVVFVDVGASSMQVCVVRFTKAQLKVLA
FT                   TGFDRNLGGSSFDQAMMDHFCEEFKATKKIDIKSNARASLRLRTAVEKMKKILSANPEA
FT                   PLSIECIMDDVDVNSKMTREKMEELSSALLDRMMEPVKKAMSEAGMIPADVKAVELVGN
FT                   ASRMPFISSQLEAFFGMPCSRTLNASECVARGCALQGAMLSPQFRVRDFEVVDSFPFPV
FT                   SFSWQADGGEVKDMELFERNNAVPSSKMMTFFRNETFTLQAKYTTPTLLPPNAMTQIGS
FT                   FDVGPIPSTNSDDGKTKLKVKVRLNLNGLVSVESAQAVEEIEEEVAPAPEVAPAAEAPM
FT                   DTDAPAENGENTAPEDPNGEKPMETEAAAPVPEKKKKVKKIDVPVSSTVGGLPAQVLEQ
FT                   FVNEEFEMALQDRVMEETKERKNAVEEYVYGMRTKVTGALSDFVAPEAAESFVALLNAT
FT                   EDWLYEDGEDETKGVYNAKLEELKAIGDPIELRASEESARPGACALLQTKASAVLAAAA
FT                   PDAAHEHIDAADLEKVRGEAQAALDWLAEKQGLQAAVGKTQDPVLLSADVDKKLAALER
FT                   FSTPIMSRPKPKPPAPEPAPEPAKPEAEANGDANGEAAPMEEDGEGAPEAAPKADDLD"
FT   CDS_pept        join(501117..501159,501293..501344,501757..503791)
FT                   /codon_start=1
FT                   /gene_family="HOG000218417" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636381"
FT                   /orf_name="MICPUN_62484"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="heme binding"
FT                   /function="sulfite reductase (ferredoxin) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66163.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0050311"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG626671"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011787"
FT                   /db_xref="UniParc:UPI000199BE61"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE34"
FT                   /transl_table=1
FT                   /translation="MEGPQAPAPGPMGSKEASARVSPVAFRPLESRPQNGVKRASRVRA
FT                   SVARRVANPIVAVATPSGKKSANEGEKNWSKVEYIKENSDFLRHPLIEQLATEDPFISE
FT                   DAAQLYKFHGGYQQDDREKRAFGAGKFYQFMMRTKQPAGTVPNKLYLTMDDLADSHGNG
FT                   TLRLTTRQTYQLHGILKTDLKSTFQAVIRNMGSTLGACGDINRNVMASPAPYAKNFKPE
FT                   YAIAQELAKDIGDLLAPQSGAYYDVWLDGEQVLTVEKPEVVACRNDNRFGTNFEGSPEP
FT                   IYGTQFLPRKFKIGVTVPGDNHIDFLTNDIGICVVMKNGEHVGYNVYAGGGMGRSHRNN
FT                   DTFPRLASALGFVGKDDILYAVKAIACAQRDYGRRDDRKQSRLKYLIHAWGVEKFKAVT
FT                   EQYMGKAFQPLADLPPFTMPTYHGWNEQGDGKLWYGVHVVNGRLRGDAKKALRAVIERY
FT                   ELPVRLTANQDLLLTDIDPAWKSDIVATLTAAGVKDASEIDALDQISIACPALPLCGLA
FT                   ITEAERGLPDINKRLRDVMNKVGLPADEQFLIRMTGCPNGCARPYQAELGFVGDGPGSY
FT                   QIWMGGTSNLLKLAEPYADKVKEGDFETFFEPIFYAFKTGKNADERFGDWANRVGFKAI
FT                   KDAQESYKGLPAAAKAAAAPAAVPAAAAAAAVPAGRLPRVMIEREAFEVLKAYAEANNT
FT                   TLTEAATAAILKLKK"
FT   CDS_pept        complement(<503957..>504586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636382"
FT                   /orf_name="MICPUN_76417"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66469.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG561995"
FT                   /db_xref="InterPro:IPR007005"
FT                   /db_xref="UniParc:UPI000199BE62"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE35"
FT                   /transl_table=1
FT                   /translation="DGSRFGKLGKNPAVKADFLPDRDRELEDAKEAIRLKEEYRAAMKA
FT                   KLESSFDLHFLYWQSRGMLGQDVRKIKCVMSVKYGDSVADLLNRFRDDNHREYPELAHL
FT                   TGEQCMFAKEGLIVPGHHTWFELINTGCVVQDKDVFKDLDSPKFVTDKDKANERKAGIE
FT                   VKESLKLYSYLDAGCVMDRKWFDRNSKTFPMCKWEVYNPRKDYRTAF"
FT   CDS_pept        505152..506003
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636383"
FT                   /orf_name="MICPUN_62486"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66164.1"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199BE63"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE36"
FT                   /transl_table=1
FT                   /translation="MHTFAARSVLPGASLGSLAPRAVRGSGRTRAPASIVAMAGRKKRK
FT                   EKSRRKENEGGSAPAPAAPAPAAPAQSPAAASAPAPAAPAGRARDNEIDWAEIERNNEQ
FT                   ARAAMGAPSTPAPAGDGLLERAFSADAQLLFAVDGCVPEVVNGRVAMFGFFTAALTEIF
FT                   TGKSFTTQLAYNLSHGVSFTIASLVIAGTLAPMIMADPKETPYEGTGFAKWRPEPRAKA
FT                   GRQYLCDPRSIDTTGLPGRDTPLGRLGFGATAETWNGRAAMVGLMLTFLIEGATHHGIF
FT                   RG"
FT   CDS_pept        506165..506752
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636384"
FT                   /orf_name="MICPUN_62487"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66165.1"
FT                   /db_xref="HOGENOM:HBG607609"
FT                   /db_xref="UniParc:UPI000199BE64"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE37"
FT                   /transl_table=1
FT                   /translation="MSASIVARLGAPALAPRRARLSERRARPTLAPPVRAVVTAEDVAA
FT                   KLSGEDLGKWESCRSILVGELGMDEDKADKTMIRAFGWGGQTYWRNEKVEEVPEVEDVE
FT                   ARIAYLLEIGIELPDLAEKVLGKVPEVLGCDVETRLKVNVAHIQKTCFMKPNTKNFRNY
FT                   INRVPQVLGNNLDCAAQGLNCAGECNRCWARC"
FT   CDS_pept        complement(506900..508267)
FT                   /codon_start=1
FT                   /gene_family="HOG000189057" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636385"
FT                   /orf_name="MICPUN_86679"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="ACO66470.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG324241"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI000199BE65"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE38"
FT                   /transl_table=1
FT                   /translation="MLREPNGVSDASLTLQRAVLDYSARDERFALDKKIYGQYFQLYFQ
FT                   RLMLLGPRLKQAVGAKWPGVPAVKVLDLKEGEECVVMGTLYKDMKLKPSILDEYVKEAG
FT                   AKASEVAAKKFVSDDDSLVLEDEGARVRLTGKGVAVDCFVTGVVLAVKGRVVANGEFEV
FT                   DEICYPAPAPQATRPSATDEASSAGRHVLLCSGLRVGDDAASSALNLELMCDYVTGNLG
FT                   GANEQGVAASIARVVICGGALPEVDVPAQSLDGRAQAAVARPLRQLDVLLTTLAASVPV
FT                   DLMPGDGDPTNQALPQQPLHPCLFPEAKRFSPHTFASCTNPHDFTIGGVDFLGTAGQNV
FT                   SNLAAYTNVVKGGAGGDDDAGEALDLMEATVRWQHVAPSAPDTLACYPYKDRDPFFIER
FT                   SPHVYFAGMQPAFGCRKVRVGDAETVCVSVPDFSKTSAVVLLDVDTLECHPVTFGR"
FT   CDS_pept        508763..510049
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636386"
FT                   /orf_name="MICPUN_86547"
FT                   /product="NURF complex component"
FT                   /protein_id="ACO66166.1"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000199BF07"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE39"
FT                   /transl_table=1
FT                   /translation="MGANDEEFPDEQDERMIAEEYKIWKKNTPFLYDLVVTHALEWPSL
FT                   TVQWLPKREEPAGKDYSIQQLILGTHTSENEQNYLMRAEVQLPLEDADVDARGGDDKGE
FT                   VGGFGASAGKVQVVQLINHDGEVNRARYCPQNEFVIATKTISADVYVFDYSKHPSKPPA
FT                   DGGCNPDIRLKGHKTEGYGLSWSPFEAGHLLSGSDDAQICLWDVQGPLGKGERTVDAKA
FT                   IYTGHLGVVEDVAWHCQLPHMFGSVGDDKSLKLWDTRKAPDAACLNSVEAHQAEVNCLA
FT                   FNPFNEYVLATGSADKTVALFDLRKLDNRLHTFASHTEEVFQIGWSPKHETILSSCGAD
FT                   RRLMVWDLSRIGDEQSPEDAEDGPPELLFIHGGHTSKISDFAYNPNDDWVVASVAEDNI
FT                   LQIWQMAENIYADESYLEEQDKKAEAKKA"
FT   CDS_pept        join(510150..510272,510397..512265)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636387"
FT                   /orf_name="MICPUN_62490"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66167.1"
FT                   /db_xref="UniParc:UPI000199BF08"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE40"
FT                   /transl_table=1
FT                   /translation="MAAAAHPQEPWNKAQFDKDNRIPAAQYELLNSLPGWGNLSTAIPL
FT                   DETPDASPSNSEQAPAAKGVARPSQQLASQGDWLQKQKGPALEDSGSDDDDDEDEDEEF
FT                   KVVYAGVKPDPQTRGLAAIATATPPAATDDDDERDAPARTRVVSPRRPADVKYSEQIRS
FT                   IHHQLRADVRELAAPRALAAGRPTPVVEDIAPTQLAPEDATDDDGRDGRQPPRGAAGAA
FT                   EALAAAGGVFSPRRTRSRWRKVQQAGRNGASDERVDGTAGDVPARAAAPGVGLVGRVLR
FT                   SISGAANAVMGATAGTPAATKANGSGDDDADVVRFPGFATAHRARHREALAQPRWDELG
FT                   VLAAEAAAQLEVVATTQPEEEATQATRLAATEPAAKRYLHDELPGAKQLRRRVRQATIN
FT                   EAVGQAASDALAAAVAAATEHGGAGVGSPLRRRASMFGAQDADRAEHDLTLEARERVEA
FT                   RRSAAAAPAVGATPPVEERREGAVGKSGEKFPGKVEARTPAPAPAFNPVIRGWLSADPR
FT                   FSGANGKRRRLESATAKSEAATTGRKKAKGPRGRAALVDEEDDGGARGKTGGGKTGGGG
FT                   GETPDPSVDFMRARLSPVVHRAVNEIERENVKAASPASPAKRTTVRKSTLAVLAGTRGV
FT                   ISPPRTGGGEGGATARRSLMSWIGLESQ"
FT   CDS_pept        complement(512340..513650)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636388"
FT                   /orf_name="MICPUN_62491"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66471.1"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="UniParc:UPI000199BF09"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE41"
FT                   /transl_table=1
FT                   /translation="MGAIGDSSALTTAQLTTVAEIMVAGAFFSTLGSLVIITVFLNSPE
FT                   LRKSFAFQLVFGLALAELGNSFWPYFFMPREGAACECQAVLLQFFSFASIAWSAVIAWT
FT                   LEMATNTERKPGGPSPSSLASSVLGIGDPTRVPDVRKFHVAVWSTSFVLVLVPWAAGVY
FT                   GPAGAWCWIDPRHGAEAHALRLVCFYLPLWCVVGFQIRTYRRVYLRLRRVASLAAATAA
FT                   VRADMRREARERDAARISNADEKTQTGLETNADSSVPDDATTPATPGGETAKDEDEIDV
FT                   EATLRRLLRRLGAYPAVLIVAWTFPTINRLNNYVQGAKTGQGDDYTLYVLMALGMSTQG
FT                   VGNAVVYGMSGAVRREAAVLLERWTGARFGGGPFGRWGRGSAAGGLARLAREGERGTEM
FT                   SARRAASPAVANAEEGGDAGPGDEGREVLLEVDESLK"
FT   CDS_pept        513851..514243
FT                   /codon_start=1
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636389"
FT                   /orf_name="MICPUN_109147"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="ACO66168.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG402579"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniParc:UPI000199BF0A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE42"
FT                   /transl_table=1
FT                   /translation="MATEGKGALISVIGDEDTVTGFLLAGVGEVDVRRRTNYLVVGDKT
FT                   TTKQIEEAFKEMTSREDVAVVLISQFAADSIRYLVNEYDKPIPAVLEIPSKDRPYDATK
FT                   DSVLQRVHHLMGAEDAAATTTATGAR"
FT   CDS_pept        join(complement(515613..515693),complement(514323..515522))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636390"
FT                   /orf_name="MICPUN_113340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66472.1"
FT                   /db_xref="UniParc:UPI000199BF0B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE43"
FT                   /transl_table=1
FT                   /translation="MGAAHIEHSFFPWEETNLHRLHWEGDKMFVMAEVATLLFEESPVM
FT                   FAKFLRANQYPRKHTVERSVVDKCAALGISGETSSGGSVGVTLLPATTVEACLFDRRRN
FT                   DLVKPFKLSLLNLASQEAERHIAAGHFELALPVALDVVRRGQDIYPPKPKAPPAVELFP
FT                   AYLLAAEANAGVGRANAAEDFLGLARWLALGNPELVGDEALARMHELFGDLRSSQRRMD
FT                   EAAAAFAEETYHRASAHGPEDVRTTFGYLRLARCFENTGDHGKCVAFCRTVCDVWLEAT
FT                   VASNLGAALGEGVKRTLATTPLNAPLPLRKKQTLEGVDELMWARNVLMRGDSRGDGSVG
FT                   DAVCAADASLAAGCALLGLVATGGSDAAATLARATTLVEEALGEYPAAETERVGLAERA
FT                   LAAAAAAMDGVVDGDGRSRRTSISNVR"
FT   CDS_pept        join(complement(516693..516708),complement(515847..516568))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636391"
FT                   /orf_name="MICPUN_109148"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO66473.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199BF0C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE44"
FT                   /transl_table=1
FT                   /translation="MSIYIGGLPPHVDEDRIVDPFKKFGPVTCRLCAGFAFIDYPEQHM
FT                   ADVAMDHIRPAVANDGNLGGYPGVTLSWGKRSIVLKYQEELAEKKRRDREREERRDRER
FT                   EERRERKAARRRRRSRSREGHGGRSRSRDKSRGGRSRSRGRNGGDRGRSGARSSSSESS
FT                   SESDSESDSESESRRRKKRRRRNKKRRRSRSASSSRGSGETRRRRKHRRHRKRRRRSRS
FT                   RSRSRSRSRPRSRSPERTRDDGD"
FT   CDS_pept        517005..517742
FT                   /codon_start=1
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636392"
FT                   /orf_name="MICPUN_86671"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66169.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000199BF0D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE45"
FT                   /transl_table=1
FT                   /translation="MFTSQADAKYSAKSRNILILFGPPGAGKGTHAPKIVDKLSIPQLS
FT                   TGDMLRAAVAAGTEVGKKAKAAMDSGALVTDEIVVGIIADRIKEKDCVDGFILDGFPRT
FT                   LAQSKMLDKELAKTGEAVSRVIELSVPDAVLTERICGRWVHKSSGRSYHVKFNPPKSLA
FT                   KLGGKDLNKEKDKTKWMKDDETGEALMQRSDDTAEALVSRLDAYHKQTVPVLKHYGKKK
FT                   CVAIDANRDMDSIWASIDKATDF"
FT   CDS_pept        join(complement(518278..519072),complement(517888..518175))
FT                   /codon_start=1
FT                   /gene_family="HOG000022459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636393"
FT                   /orf_name="MICPUN_98066"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO66474.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG689308"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="UniParc:UPI000199BF0E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE46"
FT                   /transl_table=1
FT                   /translation="MMTVGPWSPPAWADFPGAPTRRYNLARTPTPVHRWHLPGTPDGCE
FT                   VYIKRDDLTGMQLSGNKVRKLEFLLAEAMDEDADCVITIGGVQSNHCRATAVAARYLGL
FT                   DSHLILRAPQSIAETGDPGLVGNLLVERAVGANIHLVTKREYAAHGSVALAESLRRRLE
FT                   REGKRPYVVPVGGSNAIGTWGYVDAMAELAAQMGEDHPHPFTDIVLACGSGGTAAGVAL
FT                   GAALCPELRRPNVWAYGVCDTPKYFYEYVGGILRDMGAPVKDIAKGAGYAMATEEELAT
FT                   TAAIARATGVLLDPVYSGKAAHGLIREMARDPGAWQGRRVLFVHTGGALGVYDKLAQLQ
FT                   PIMEATAPSRRFDVADVETA"
FT   CDS_pept        join(<519496..519690,519862..>520168)
FT                   /codon_start=1
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636394"
FT                   /orf_name="MICPUN_72752"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO66170.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG657462"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199BF0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE47"
FT                   /transl_table=1
FT                   /translation="GLEKSRRDLTSRATGDVLELGVGTGLNLPGYDLRAGGAIRSLTAV
FT                   DISGGMLNEARTRADELGFRAAKPPPVRFVVADVENLPFPDSTFDCVVDTFSLCVFEHP
FT                   ETALAELRRVLKPGGVALLVEHSRSQIGPLGAYQDAVAAPVKALAKGCAWNQDVVGLVE
FT                   GAGL"
FT   CDS_pept        complement(520365..521663)
FT                   /codon_start=1
FT                   /gene_family="HOG000223045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636395"
FT                   /orf_name="MICPUN_95446"
FT                   /product="Aminotransferase"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO66475.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199BF10"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE48"
FT                   /transl_table=1
FT                   /translation="MDQDPARFLGDVARSQQANAGASQVWAEVTALSRLPGILDLGQGW
FT                   PDFGADMTAREAASRALLDESDPRSNQYSMIPGRPELIAAISRYYRATGSADAVHADGG
FT                   NVLVTSSGTEAVYATMQATLSPGDECVFLEPFFPWYISNCAIFGATPVAVRMRVSEATG
FT                   QYDVDYEALERALASPKCKVLIHNSPHNPTGKVFTREENERIAAMCVEHDVMCIADEVY
FT                   ERCTFGGFDGDGGHGDGDAFPRMMDSTRMADRTVTVGTASKLLALTGWRVGWITGPPAV
FT                   VAGVKTMKSYTTFCAPTPLQLGVAAALNKIADDAEANGVSAVTSDEAAAAMAENVRVLS
FT                   SALTDAGLRVIRPDGGYFLVTDVSDLGLTSVEYCKRLANEAKVASIPMVVFYDPGADGA
FT                   SAPDNFVRFAVCKKPETVRACAEAIRANPVRGE"
FT   CDS_pept        join(complement(522924..>523091),
FT                   complement(<522222..522782))
FT                   /codon_start=1
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636396"
FT                   /orf_name="MICPUN_70546"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66476.1"
FT                   /db_xref="HOGENOM:HBG609337"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniParc:UPI000199BF11"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE49"
FT                   /transl_table=1
FT                   /translation="LALPPDFVAYLLEDGLSLAADSQAMPARIRPDIAEQMESAFTLSD
FT                   EEDDAGVADARHFPELEDAMREAIESLGGAVTPKLTWSSPKDAVWMATTNDTRCQNPAE
FT                   VMLLLKASDAVAYDLQDAYAQCVDASESSSAALTTGVVLTLRKWAGLSPSMEFRCFVRR
FT                   GNLRGVCQRDVANFYPFLPEQVGQIEEAIAVFWQENVHGVFPVVDYVMDVYVTSRKKVK
FT                   IVDFNPYGGATLPLLFDWNEL"
FT   CDS_pept        join(523445..523530,523653..523908)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636397"
FT                   /orf_name="MICPUN_53374"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66171.1"
FT                   /db_xref="UniParc:UPI000199BF12"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE50"
FT                   /transl_table=1
FT                   /translation="MSQVLALNKVVAAPKVARRTIRRAKVVASANPVAKATKKETVAPV
FT                   ALTAGAAGLFAAMPAQAQDAMFQLAELGDDVDEETALYVLVGGSLVIATAVLSLVIGSD
FT                   LFIKNIVNK"
FT   CDS_pept        524281..525177
FT                   /codon_start=1
FT                   /gene_family="HOG000200326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636398"
FT                   /orf_name="MICPUN_53375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66172.1"
FT                   /db_xref="HOGENOM:HBG557508"
FT                   /db_xref="UniParc:UPI000199BF13"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE51"
FT                   /transl_table=1
FT                   /translation="MGASASREPPKAVVSETTADVLDVQVPAWLSDLRRERRPRYRTDA
FT                   YRFDELIRALVKQPAWPEGSPGDGPLEMIHDVGPTGALPATAPRFGKIMHAFRHAGWKM
FT                   PPEWRLAMRPGEERRSFKAFQTTPEWIAFMETYARFVREEVAPLCGDPAGVVYQCPPTL
FT                   RIAMPSVAPTIALHRDRDYPRHQPAEINFWVPVTAVAGNSALWVESDPELGDFHPVDME
FT                   PGEFLMFDGHNCRHVTKPNDTGRTRVSFDFRVVPQSLYVEVLGQGGKRKIGDYFVDSTG
FT                   PVELIGRGGGGEQTTPG"
FT   CDS_pept        complement(<525224..527417)
FT                   /codon_start=1
FT                   /gene_family="HOG000200841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636399"
FT                   /orf_name="MICPUN_53376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66477.1"
FT                   /db_xref="HOGENOM:HBG562256"
FT                   /db_xref="UniParc:UPI000199BF14"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE52"
FT                   /transl_table=1
FT                   /translation="MPGDKGRDGSPARDKWQRAISKVAASTAIAEETAAGERFARIVLE
FT                   RTFVDTVNNERAFLAAFGQRSLHNQLSSKSLKVDSGRDLETELEDAGTADGGAPSTPGV
FT                   DPNGVSPPDDKAERVARLVKVQKSLKGDGFAVCSAYSRNFEYDPNLTFKVSQFARTLFY
FT                   ECIPPGLNWFVCVGTEMLFFEHTFKEATCSASARGFILPIFIFLPIKPLFKRLCQFFGT
FT                   MEGQPGFFFFFFYFFGFWCFFPICAVALSAEVREYIEPLELVPMLVLQCGRMLCISCKY
FT                   ALLPESYVNDRFGKMYRPMKVTDMGRTLVAGGWNKAKDEEHFDMLKMELENACIQADVD
FT                   LSNTEINVGSAEAAAVIRFRSRGIGERSRASAGKAPEVVSGKELLAALTDVHMGAPMPP
FT                   YMEPGIMLFAVLFSLTSPIMRAWCGRPMFGATHLSKAASAFLMMYSWFIFANNMTFSAS
FT                   GAWHYKRQYNAMLALNNMVRFPGEPLINFLPDVPLGPKGKVSPDQEPAELRQLRQKVAQ
FT                   KPDLAFIVDLKDPASCLCWSLVRRSLRHIGSSWGRRMNAYSVIFLMMSFASAGMLLMLY
FT                   YGADQFDHRLATSGSFYVLSICISFLVCTTVIEASAINEMVPKLRSWLKRETVAIAAQM
FT                   AYLDVPKVRTDADCKEEEQLRSAHRLIESVEQYILVEEEQSEPVEVFFKVHATPAAVTF
FT                   VVSSLLSMLLIAMQRGFTMMDSEGWSYSGPQGQFTRD"
FT   CDS_pept        join(complement(528396..>528472),c
FT                   omplement(527597..528251))
FT                   /codon_start=1
FT                   /gene_family="HOG000237744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636400"
FT                   /orf_name="MICPUN_86170"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66478.1"
FT                   /db_xref="HOGENOM:HBG318785"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000199BF15"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE53"
FT                   /transl_table=1
FT                   /translation="FANDATLCRYLRARDWNLKRAMKMLKASLQWRKVARPEFITWDDV
FT                   KKEGEEGKQYLAGRDRHGRAVLIARPGRDGGREQASHVRFLIYTLEHATWSDTAEEDLP
FT                   LGAHAEHTGEKLVVLINFTGWTLATAPPMKTARETLAILQEHYPERLAVAVCYNPPWIF
FT                   AVFWKAISPFIDPNTYRKIRFVNPKREKEVRRMRQMFDMSCVDEDLGGDRSNAFDARAF
FT                   GDKMRVFDARKAAVLKAKAMR"
FT   CDS_pept        529773..532568
FT                   /codon_start=1
FT                   /gene_family="HOG000264911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636401"
FT                   /orf_name="MICPUN_62504"
FT                   /product="Hydrolase family 31 protein "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66173.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG559273"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199BFA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE54"
FT                   /transl_table=1
FT                   /translation="MEAVAVLGSIPGVLRAPAGVNRRRNRGRARGSAIVTRSAARRPSL
FT                   GRGVSPEPEARESRQHAAPLNGSVPGAPRAATPAPKSNLREGTKTNAVPLGFIVAAGGP
FT                   SSVATSAVEALAKAKKLAEDAARRGVPGPRVVASTVTTLPKPKTLESDPSLLNPARAPN
FT                   LSDTAGATRSVVLVDGASRLWITEDGRVQLRRWKKAKTPGGMPTEDLVSTAHVQLPKEC
FT                   VGVPGAFTRTVRDDDGNAIGAEVRWGVVARLRVESATSRCFGHSRVDDWSAKLAEGFVA
FT                   EFSVNAEACVEPEHAMAEFKVDVDVAGDWFGGGHLMKQHWPLNLGCWEVGPHYPFDNGP
FT                   NGINTLVATHWVTSRGLAVLADPDTPYLHVGLNAPKPKGAWDSLVSNRSFGVGIQNATR
FT                   LILPMKQGERQGDGVLRLQARAGFHKGRGAFSMDHPMIGWEAKSSAVVGSVDEGLDRDY
FT                   EDESQWLSMRVGLLALDNVKHATEACLQTLKKPSGAPPSEVIRAPIWTTWARYKQNVDQ
FT                   RKTLTFAREILENKLPRSVMEIDDKWQSGYGELDFDPYKFPDPKGMVDELHAMGFKVTL
FT                   WVMPFIEEDTDAYREGKPLGYFVESDHLHHPFDAIVNGLKPGFFKWWNAPPVVALDVTN
FT                   PAAVEWFVNRLESLRSRYGVDGYKFDAGEPCFLPRHFETHKPLTHPSEYTRCWVQNVAA
FT                   RFELAEVRTGHHTTGTSLLTRMGDRFSDWGTGNGLRSIIPTLLTSGITGYPFCLPDMIG
FT                   GNAYFGKFPDRELLVRWAQANALMPALQFSLAPWDVGSEAADLTRRSLEIREKVVEKLV
FT                   HLTEAAAHSLEPMCRPMWWLAPEDEETYRIQDQFAVGDDVIVAPIVEKGKTMRDVYLTE
FT                   GLWVEASDPTGKVFVGGQWTRDFLAPLEKLPCFMRVAIGEEEYCDVGDMWEDPPASNSE
FT                   Q"
FT   CDS_pept        join(complement(533672..533707),complement(533441..533513),
FT                   complement(532721..533286))
FT                   /codon_start=1
FT                   /gene_family="HOG000197425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636402"
FT                   /orf_name="MICPUN_62505"
FT                   /product="Nucleosome assembly factor "
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66479.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="HOGENOM:HBG611346"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR017282"
FT                   /db_xref="UniParc:UPI000199BFA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE55"
FT                   /transl_table=1
FT                   /translation="MSAINVTQVQVLNNPQMFMTPLQFEIQYECLQPLANDLEWKLTYV
FT                   GSAESDAHDQVLDTVLVGPVAVGSYKFVFQADPPDVSRIPQSDILGVTVLLLTCSYNDV
FT                   EFIRVGYYVNNDYHDQFEELRENPPATVQIDKVVRNILEEKPRVTRFPCEFDTPSIPTA
FT                   SGMEGEAGGAMMGEDMENVQPGYGYDADAAAKMGYDQQQGYADQQQGFGFAAGHGPTEV
FT                   QY"
FT   CDS_pept        complement(534213..535373)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636403"
FT                   /orf_name="MICPUN_62506"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO66480.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG557509"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI000199BFA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE56"
FT                   /transl_table=1
FT                   /translation="MMTATASIPLVPRVTPAHPARRVGPRAWGGSGGWRRPRIGIRMDR
FT                   RSAGDAPKPPADNSDLEPEQRDYTGTLKQYEEVPLVPKKLPAMLFPAEEVLLPGSAQVL
FT                   HLYEARFLALLDEVTNETGGLFAHVTFLPPAQGEADDGGLRVNQVATLVRVEEVQREEV
FT                   GAKVTIIGESRMTLRELEEKSQRGYLVGTFVPIPVMQDDGSATYKPSKTELDEVEALAD
FT                   FIDDAVNDCVALVDKLLDGDGDEKLWDLSEAANEVEWGHGEVGNLKRAMAWIEGPYVTL
FT                   DMLEMPCSMSERDWLRDAVEERVKHSELQLAERLSFACLQVAPASTEADYARLVSCRNV
FT                   AMSAQHGLMDRLRLGKILLEEQRSALRAKVALKSAFGGAAEKDDAN"
FT   CDS_pept        535519..537591
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636404"
FT                   /orf_name="MICPUN_62507"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO66174.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000199BFA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE57"
FT                   /transl_table=1
FT                   /translation="MAAPTAASVAPLVNTAPRLLARRGAIARPVARGHAVRASVVGAGG
FT                   ENASGQLESTTRRGTPLPLPSHFDLDTAVLLGGFAFESYSTPEGGVVDADVNGCSTAYL
FT                   SDFVREVYSGVLEVTMVRGENLPRGDKLGLSDPYCVVSVGGGGSSARTKTKRFTLDPKW
FT                   DDEAPMRLLVRRPSDKKAGLHSQTLTVRVLDEDAGKSDDLLGVARLPLADLIDGSLVKI
FT                   PLTGEIGLAREEEVTAELTSEGGGIGGGKIVARLRFVPFNPRADEVVGEGLRRAARIME
FT                   RKGERDGSDSMKLAAKAAGAVAGGLAFVTTELSRGEREGGLWAVRPDGEWATLATEKRL
FT                   RVRGKDASPHDFEKVCFVESVRTDTQAAVWRCVADRTVVVSFRGTEMSKPLDVLTDVNL
FT                   APAAFSPERVEVEGEDEPRVHGGFLAAYDSVKRRILGAVDDVVGAGSGSGKVDSADEGE
FT                   RALRSNGGNDDRWHVFVTGHSLGGALCTLLAADLGASVKSGSRNFTVTAINFGSPRVGN
FT                   RAFVAMYNDLVPDSVRVVNGDDLVPTLPALLGYRHVDHGVRIDTDGGLAGCSDTFLAAA
FT                   EDEDVQSRSVTGDLSETREDDGGGWAGRAALAAAMRGDVTAAAESVRLEIQTKGAGKIV
FT                   ELAELLGVGTFLGVDEETAADAANALATLVSASAVGDHFEDKYYAALRDAAGRRT"
FT   CDS_pept        complement(537713..538156)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636405"
FT                   /orf_name="MICPUN_62508"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66481.1"
FT                   /db_xref="UniParc:UPI000199BFA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE58"
FT                   /transl_table=1
FT                   /translation="MPSKILKLGEKNEDPGPWPTNILEIGTVGTRKKPCPLCGLWFAEE
FT                   NLTGMSSLKTVLTLKVKWGVKGAQEKLTDSNMTASRLYTGVNMCAFCAQLTMPDPDDED
FT                   DAEIFANSPQKTPKKAPKKQEVEVKASTFLQGFLSPEAKSKYK"
FT   CDS_pept        join(538574..538618,538747..540033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636406"
FT                   /orf_name="MICPUN_62509"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66175.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000199BFA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE59"
FT                   /transl_table=1
FT                   /translation="MSSTCACAQEGSREWIRLWFKDCINNPSAEVGFYLGLASIGCWLV
FT                   AQFPQLVRNFRRKSADGLSPWFLAEWLMGDTLNLLGCLMTGDQLPSQTYTAVYFIAVDM
FT                   AMIFQFVYYTLLSADAVSLITADMRDPDVAYSVRVDDTAGTHGRGDGGEGGVRGGTGRD
FT                   APSPQGGADRATSPPPTGPGEWYSRRTQASQGSSSSRGASMPTGGTGGIAGRRRRREAR
FT                   AAVGLAAATGVAAVVAVALAVALGLTTASRTGGVNLQPPAVSAEGIGIGGGTQAYSYSS
FT                   VRNNNNDDDDDNNHGRRPHKDGLPICGASANPEWEVVIGRAVGYASSVFYLGSRLSQIY
FT                   KNHSRRSCEGLAMSMFFTAACANIAYGLAILLRGGGNPTYLINSIPWLLGSLGTVALDT
FT                   TILAQSRYYTKRAQRMRRTVGATDGDGDVPEGEGELDRPLLRVD"
FT   CDS_pept        join(complement(540698..541069),complement(540338..540646))
FT                   /codon_start=1
FT                   /gene_family="HOG000027381" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636407"
FT                   /orf_name="MICPUN_86638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66482.1"
FT                   /db_xref="HOGENOM:HBG576400"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="UniParc:UPI000199BFA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE60"
FT                   /transl_table=1
FT                   /translation="MGATAAAETATSTRVHFEDVIVTNSRTTDMAHTLWRAVMRPGDTV
FT                   VDATMGNGWDTVALARILADLDASPAGDASKPGRVVAFDVQEDALTSTRARVREMLTPD
FT                   QASRVDLVLKSHERMEEHVRTDAVGVVCFNLGYLPGPTADKEVRTRRTTTVSAVASGVR
FT                   VLRPGGVLTVVGYTGHEGGWEEVEAVMELVSSLDPREFTATNHSVVNRDNCPQLIAVHR
FT                   KETK"
FT   CDS_pept        541671..542849
FT                   /codon_start=1
FT                   /gene_family="HOG000243414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636408"
FT                   /orf_name="MICPUN_62511"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO66176.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG609554"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199BFA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE61"
FT                   /transl_table=1
FT                   /translation="MMLSAARSFSALALRRARFPTQVTRYAPGQLAPLARRAVASPLCA
FT                   ASEAAAKGAATPAGGDQKAPYPPLKVTAPGRVVALGDVHGDIGQARRALTIAGVLGDGG
FT                   DAVNPEWTGGNTVVVQVGDVLDRGDDEIAILILLQKLHKQAEAQGGAVYILNGNHEVLN
FT                   VSGDFRYVTQGAFQESARFGEHLVNLFGSAFKEAFGGGEEDPRKRQVKARVGLFSPGGP
FT                   LAQQLAMNSTVLIVNDTVFAHGGLMPRHVEFGLERLNNAVADWMRGAEIVSEEDRTALG
FT                   MAIGSVKDSVVWNRTFGTENFVTDSDRDRACEVLGNTLDAISEKYGAAKRLVVGHTPQL
FT                   GGCNGECDGRIWRIDVGMSFGVVGADPEVIEIDGDEVRVLNSRVPAKQASKL"
FT   CDS_pept        complement(543007..544482)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636409"
FT                   /orf_name="MICPUN_62512"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="cell cycle"
FT                   /biological_process="replication fork protection "
FT                   /biological_process="response to DNA damage stimulus "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66483.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006974"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000199BFA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE62"
FT                   /transl_table=1
FT                   /translation="MPQSAPLRVQSFVNPSQTHNDTPRSDSRHASRMSSQPAAGTQANR
FT                   GNLPKGACYKCGKTGHWSRDCTAPREEWIPQQPRDASAGTAADGDANPEGAAGGSAAAG
FT                   GATGKKKSNRPPKFTVVDHLLGPNGLAYLHGVIPEKFNQIAKGPGHEFGDFQRLMGLYR
FT                   EWTRKMYPYKPHEWVMNRVKVLCKTREARACIRELNERERIELGGEGVDAPEDFTEEDV
FT                   FFPDQDQDQDQDDDDEGEDVVFPDDDEEEEWNEAKHGKKAQLGVGGGVGKSKGAPAAAD
FT                   SDDDEEAIQSQREKDADAFDDARKEVGAGYFDESSDDDDDGIAVVGATRRESSALGAER
FT                   QKGKARKKLKEVAAKRRRKKKEPTPEPEDEEEAAEEGPEPPAEAAEASSPKRKQLRRRA
FT                   RDSDDDEDDEEEEEEEAGASRRARRRVIKRGIDSDSDSDTPNLRDVLPNDVGGNVLGPS
FT                   PAKPLVPSFLYDSESDGEKKGSEKKGSEKKGDE"
FT   CDS_pept        join(544733..544846,545284..545409)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636410"
FT                   /orf_name="MICPUN_62513"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66177.1"
FT                   /db_xref="HOGENOM:HBG557515"
FT                   /db_xref="UniParc:UPI000199BFAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE63"
FT                   /transl_table=1
FT                   /translation="MSTLVGTPVVAPVKAVRAVRSTRVVAAGTKTVSKPKAKAGAKKSF
FT                   GEWLLDKACRDSSVIGAGYEDDLKSGKYKKGGKK"
FT   CDS_pept        join(complement(547183..547622),complement(545902..547051))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636411"
FT                   /orf_name="MICPUN_62515"
FT                   /product="Erf-like protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66484.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199BFAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE64"
FT                   /transl_table=1
FT                   /translation="MAPAAHDKTDPASKKSAVEPTSDVDDDDDDEDDVSARAIFPLIFA
FT                   RLPICEPIPASPRLLNPARFVRASRGAANSALLAAFIAVECSICYFVELRTQGNSTALR
FT                   PPRPPRSLTRAPSVHPSRQPKVSKTKKTCSSIYRGVRQRPWGSWAAEIRDPNRGARLWL
FT                   GTFDTAEEAARAYDAAARHIRGPNARTNFQLAPGEVPPPFVLPDPPAARGRGKGGEDGP
FT                   PPGGGGRGAGRGGPGRPPHATKKQARAVGEMPSIGGAGLNTGLPGYSLGGLGGPSGPQR
FT                   GSAGYHTNNSSLGSTAPNDLSALVNANLALAQQNLAMAGQATGGDGGYIRLGLNSHANP
FT                   SGMHPGEGMHPGEIPRLHNSKRERAPSNPFLGTSFGVAGSFGSVFGHDYLSSTPENGGV
FT                   FPMGSSPLLMGTSPDHAGGSGRGGVHGKMENSLGNGGGVFGSMKDHDFQVGSLGLGDDD
FT                   IHAVGSLELGSPLDNFGDLLNSLPKHSVGSGRGMGGRLPMRRETRGISPTSAFGVGGGS
FT                   GGIEEALAAGKR"
FT   CDS_pept        complement(<549539..>550339)
FT                   /codon_start=1
FT                   /gene_family="HOG000096858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636412"
FT                   /orf_name="MICPUN_70761"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66485.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748611"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199BFAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE65"
FT                   /transl_table=1
FT                   /translation="DRSRIVKLSEKPKAYLYRGFLRQAECDYIKERAKPKLEKSTVVDN
FT                   KTGQSVPSNIRTSDGMFFDRHEDDIIEDIERRIAEWTNVPWENGEGIQVLRYEVGQKYE
FT                   PHLDAFSDKFNTEESKGGQRMATVLMYLSDVEEGGETVFPRSVDKPHKGDPKWSECAQR
FT                   GVAVKARKGDALLFWSLDIDSNVDELSLHGGCPVIKGTKWSATKWMHLKSFDTANSFKF
FT                   PEGVCDDVNEQCEGWASTGECEKNPKYMIGNGKTDGYCVRACGKC"
FT   CDS_pept        join(550708..550769,550900..551860)
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636413"
FT                   /gene_name="RSP16"
FT                   /orf_name="MICPUN_62518"
FT                   /product="Radial spoke protein 16 "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66178.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199BFAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE66"
FT                   /transl_table=1
FT                   /translation="MDYYEELGINRAATDIDINKAYRKLALTYHPDKDDSEDAAMIFER
FT                   IAEAYDVLSNRKLKATFDLLGEIGLKDGVPDGRGGRKGGIYTFETSPMAIFKRFFGTDN
FT                   PYEALMVIQDAFEKMGGSGKPELGAQRTYDLPVTLEEIFHGAHKAVTHTRKVQRELNGS
FT                   IESEDRTLTVAVPPGCKNGRRFVFEREGNSKPGVEPGAVVFVLETARHASFTRSGDDLV
FT                   YVAKLSVVDALCGTTLKIQTLDKRTLAIPVVECVDANSQKIVGGEGMPRADGSGRGDLI
FT                   IIFEIVMPNKLTPAQKSLVRAGFFYPGKQPSPEQHAASVAFLNAANHGSKGWTIGFAGQ
FT                   "
FT   CDS_pept        join(complement(552727..552836),complement(551997..552606))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636414"
FT                   /orf_name="MICPUN_62519"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66486.1"
FT                   /db_xref="HOGENOM:HBG557517"
FT                   /db_xref="UniParc:UPI000199BFAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE67"
FT                   /transl_table=1
FT                   /translation="MATALQPPEDPAKHPCKKMRLGGRQNALPEEFCIASTKTGRPCSK
FT                   RKDPDCALPFCRGHREKGDGAFRKVPHPLAGLCLVANFDIPKGYKTVFWGTRKRWRDTE
FT                   NKEGGDYAMSFRTNGGVIDPTTHKEGSQMQFMNNPGPNERMNMRSTDRFFGATHEKDPT
FT                   DKTGKRGGLVGREFVVMDDVRKNHQLLIWYGSQWFNARGIPRIDVGLPRYPATLKRVAS
FT                   REKLSPLADTTNKKAKA"
FT   CDS_pept        552974..555157
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636415"
FT                   /orf_name="MICPUN_103082"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO66179.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniParc:UPI000199C056"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE68"
FT                   /transl_table=1
FT                   /translation="MWRARREAIALAARCAQLARERGVSSSSSSHARWSFGKKSGKHRR
FT                   GPPTTSAMGGGSRTALQFEEEAHRLASGDGVVFFKDKITQITQGAVDVSLPGRDDAYYN
FT                   APGDYAGVAIRSSLRWPMPMDDLAKLNPKLALAMGQSRQQVANANRGREALNPMGNPNT
FT                   KRLSADDAPPATDPRVMDGDELAIVKMLEEDRLEAMRKEAFALVEGRERRRRETERDNA
FT                   PKPERRERTVGAREKASQLAAERARVDRKLEALERKKKELRLAEEWESHKAAGEAHKIL
FT                   PKPGSAPGATPAVYEHLKRHMLDRSNEKLAATQTNAALTETALARLSMADLRRACQIVG
FT                   LPTVGQKKTLTQMLHAHFKQAEHHFARAFIEAQKELDKDVRRLKRQARSHARAAAAEER
FT                   AERAAVERATRARAPTAGAVRRRGRPPKPELEEERARKAAKAAAEAESLGLALGTLEYA
FT                   AADDDDEENEEEDEDEEGAEGAEELTDARDAPASSAGEPTTENEGDDDDARPNPSTGRM
FT                   NYVEAFDPEELVRILLKAKGADVVVIPVKEKCNWTDHFVVGTAKSPRHIRMLAGAVLHA
FT                   VKKRTRFIVGNKLQPAIEGADAGDGETPGDDHWMLVDCGSCVVHVFSPEARRRFDLEGL
FT                   WAPGVPLERRNAEGGALTIDTITADVDDDDDDDEDIEIDLDDMPGTLDDYEDAYLEPPS
FT                   WERSITDEEQERVRRRGASRRNSGFGAAGVNLD"
FT   CDS_pept        556178..558256
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636416"
FT                   /orf_name="MICPUN_103083"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO66180.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000199C057"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE69"
FT                   /transl_table=1
FT                   /translation="MNMQTSAVIQSGSGVVDAAGFDATTAKYAVPPGERESRGVHPVWR
FT                   AGIRGENVLVGVGDSGLDVGSCWLADPTNAPPGPRHRKIRRYNAVWGDEVDANGHGTHV
FT                   VSTILGEAVVGSPIGASEYDGMAPRAKVVFNDIGVGVGGSLFLPTSMAAYFDTAYADGA
FT                   RIHSDSWGNDAPLYDGLAREVDEYAWSHRDFLPVFAAGNFGLSAGAPSTVTSPATCKNG
FT                   VAVGASLGWSGPNVASAVVGDSATMNVRSLNVPGTVEAFTVYMAAVGADRFATGAQPVR
FT                   LVAASPPDACSNFTVRFPGAVVLVTRGGCYFSDKIIHAQDAGAVGVIVANDDVTGFFKI
FT                   GARDGDASARLVRVPAASVPASSHRKLLAAMPCVVTFHPARLSPKRVDHIASFSSFGAT
FT                   TDGRIKPDVVAPGEITSASAAAAGGGDSSERGAFPNCAVTTIAGTSMATPVAAGAAALI
FT                   RQYFTDGFYPTGARTKGNGFAPSAALIKAALINGAEPMRGFTELGLPLEPPPSVRQGHG
FT                   RVHVGRSLPLAPGPARMFAVDERRIAHGEVHSFCLELPPGRDAPESTTDADDELRVTLV
FT                   WTDPPASLPSAGRTLVNDLDLVVVNGDGVAWGGGDRSNNVERVTVPLTIDGTQGGDGAA
FT                   SFVARVVARDVRWVPGGESGQPYALVATAPGLTGGPCGARELSVAARAGDDIDFSGG"
FT   CDS_pept        561099..561506
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636417"
FT                   /orf_name="MICPUN_86624"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO66181.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199C058"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE70"
FT                   /transl_table=1
FT                   /translation="MDEYEQVLDDADGTDGLTVLMVGVTYCKPCKAFSKKYQDFADRFN
FT                   GARFIKVFGNENKDMTVLCRDELKVKSTPTFYFFRNKEQVHMHTGANAGKFEKFILANV
FT                   REGEPGYGSERQFEDPVEDPKKGEKSASPAR"
FT   CDS_pept        join(561954..562523,562626..562865,563052..563366)
FT                   /codon_start=1
FT                   /gene_family="HOG000217464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636418"
FT                   /gene_name="GOX2"
FT                   /orf_name="MICPUN_98069"
FT                   /product="Glycolate oxidase"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66182.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C059"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE71"
FT                   /transl_table=1
FT                   /translation="MVFDYLDAGADDEITIRRNKDAYSQLELHYRILAGLSPPLDMSTR
FT                   VMGRDVKIPFFVSPTAGSKMFHADGEVGVARAASAAGAMYSLSTMGTAAPAEVAPAVPA
FT                   HHPKLFQLYVWKDRSLVRDMLAQARENGFHALALTVDLTWYGNRERDHRNGFTVPPAYT
FT                   AKQTWEAMRRPAWTWDFLSSPEYAYAAVAFIRDAFDPSFSWDDAEWLCQEWNEGPVALK
FT                   GVVRPSDALKAVDRGFDAVWVSNHGGRQLETAPAPIDVLPSIRDAMGGIVVDGGVQRGT
FT                   DVLKGLAMGADAVAIGKPYLYGLCAGGEAGVRKAFDVLTDELERAMGLLGVGTVRELRA
FT                   RMAAGEELVRRRHPSPRDFPDRGALDRGYGGGVF"
FT   CDS_pept        563450..564265
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636419"
FT                   /orf_name="MICPUN_62523"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66183.1"
FT                   /db_xref="UniParc:UPI000199C05A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE72"
FT                   /transl_table=1
FT                   /translation="MWSAAAVRAPAVSAPWRRGRSNPARTSVVVRLGKWPKVIGGVRSW
FT                   RGIKFDEFSFEVKKCGDGQAAEELMREFLESDGLDHDFCQSAFDTVHLAYKQRRPPEEI
FT                   ALLQDMATMLMRAHRQKVQLPEEFLADALLMSFATKDPEAALSGDADAARRIAEIRAEL
FT                   RRIFVDGKPPEMTGTMGYASDPTVATANQVDLSKFLTHLEKCKARAREDAKWGRSMAAV
FT                   AIDAGEMAVQEFEDPMEEIAKSKRAFTETADRIEALQEIIKDELFGAKK"
FT   CDS_pept        join(complement(565120..565362),complement(564402..564761))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636420"
FT                   /orf_name="MICPUN_62524"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66487.1"
FT                   /db_xref="UniParc:UPI000199C05B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE73"
FT                   /transl_table=1
FT                   /translation="MALRIVTSRLARATAQAAPGFYAGAARHMSQETDIVKDVFVEQQK
FT                   KFRALLDATKDLEIPTSGDKAAIADYAQKRYDIMKKLGIPSTEERIEMILKSGKEPGMT
FT                   ARDYLAFVSEQRKAMGVSDESGLTRALETALGEIEGKSGKPVMVDDAAGMKTLYSKVEA
FT                   LVKEMGLEQGDAKKESMVLEAEYEIQKLQEEVAKNKA"
FT   CDS_pept        join(565665..565738,566062..567043)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636421"
FT                   /orf_name="MICPUN_103087"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66184.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199C05C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE74"
FT                   /transl_table=1
FT                   /translation="MPSKIPVPFHRNYTWDSIVFGDGGFYEGLISKYGQVDKLGTFVFA
FT                   DGDRYEGHFKRGAMHGYGVYRWDHTGDVYFGEWRNNAQHGCGIKFSGQDDGAEYGEWKD
FT                   DQYLGSYTGVCGEVESYDAMNMAINTAQSARMFKYKPESEATLQRRGFVMHQDPIFYEQ
FT                   GTEWTMPGWRGEMHDAPSKEDIEQQHPRLYAQMQRHNEIWERTWRYYNMDLKGAREYFV
FT                   QQEAERQRLAAEQAAEFVEGFNDDVVDDYDEYADLYDDDDDSSAKKKKSKKGKKGKGGR
FT                   NKTASLTLSLRNAGAAVERAFEGVRGAALRRPEIRAFAERRARAAEERARARGPAPPLA
FT                   SLSLSLPFGRK"
FT   CDS_pept        complement(567188..567847)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636422"
FT                   /orf_name="MICPUN_62526"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66488.1"
FT                   /db_xref="UniParc:UPI000199C05D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE75"
FT                   /transl_table=1
FT                   /translation="MALEARFWRYDSRVLMPDWHEDAVAAPHSDTKRRVTPPSGFQSDY
FT                   SRSSQAVGVPGQVSTGPRPRRRMVTTQNFTAQISQPRRTELKPTVGGFDATLSVGPAFE
FT                   EERTTTFQRFHEIAPAEARKGPAPPEKGDDDRAVGGYPASVNPVRPDAAVYSTSRAFFI
FT                   KNATDRDFLDTTRDVTSLGSGPGGRCGARGPLVRNAGEAGCRNAYSVWADDYGHGV"
FT   CDS_pept        567988..568464
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636423"
FT                   /orf_name="MICPUN_62527"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66185.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C05E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE76"
FT                   /transl_table=1
FT                   /translation="MASKKRSSGAAATPTTDAKKPRTRPATTPAAAPPGDESDDFAFEV
FT                   PPMSQARKSFGAEMAKLQMAGASGGVDDEHKFLRGIATLGKDLSCCLCLSTFERPVRTS
FT                   CKHYYCAECLNESLRRKQQCPLCKEKVTRRDVEDDDFVAAVVWKYRRIVTAANA"
FT   CDS_pept        join(complement(569868..570068),complement(568521..569750))
FT                   /codon_start=1
FT                   /gene_family="HOG000178028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636759"
FT                   /orf_name="MICPUN_86102"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66489.1"
FT                   /db_xref="HOGENOM:HBG738986"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniParc:UPI000199C05F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE77"
FT                   /transl_table=1
FT                   /translation="MPYKGTGKLPGNLKAKNAPLADQLANDKLAQGKGRTKKRERQPEE
FT                   DDFMTDAMSNKVMLAARQQLEEDDEDDPMGAGRDGFGVRAAGAFDDDGDGDDDRAGPKG
FT                   ADDDYYEDIEISPEDEKALSAFMAPKASKERTLADIILEKIKEKESGGRGAGGAGGGDD
FT                   DDLAPVPEGIDQKVVDVYRQVGDLLKRYTVGKIPKAFKIIPALSNWEEVLYLTNPEKWS
FT                   PHAMFQATRLFASNLNAKMAQRFYSLVLLPRVRDDIAEHKRLHFALYQALKKATFKPAA
FT                   FYKGILIPLCASRTCTLREAVVLSSVLTRGSIPMLHSAAALLKLAELPYAGTTSFFLRV
FT                   LLDKKYALPFRVVDALVDHFLRFRKESRQLPVVWHQSLLCFVQRYKQEIRAEDKALLRK
FT                   LVEAQHHYQIGPEVKRELNHGRSRGENDGEGAMDTDEPGAKKKAVFGGFAAGVKQVKAV
FT                   EESIRDMPEVRMMDDDNY"
FT   CDS_pept        complement(<570829..571461)
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636760"
FT                   /orf_name="MICPUN_86202"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO66490.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C060"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE78"
FT                   /transl_table=1
FT                   /translation="MARGGAPGGSGVHGARSGLGFSSSSGGSNDDAAKLYVGHLPSTMN
FT                   AERMLEMFKPFGRVLQIDVIPDRERQLSCKGFAFVLFSTPEEAIAAKALNGHVVEGKSI
FT                   DVRLKAEPRAPREPVNAPVAPVNDDAKLYVAYMPDHYRAEELKMLLQPYGLPSDVRVIT
FT                   DRETGRSRGFGFAQMMDEQQAMAAIQGLNGQMLDGKTLVVRIAGAKPP"
FT   CDS_pept        complement(<571662..>572052)
FT                   /codon_start=1
FT                   /gene_family="HOG000238548" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636761"
FT                   /orf_name="MICPUN_73699"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO66491.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG605582"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199C061"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE79"
FT                   /transl_table=1
FT                   /translation="PGFTPPPDFKPARKTRKILIPVAEYPGYNFFGLIIGPRGNTQKKM
FT                   QQETNTNIAIRGRGSMKPGGADPNKPYDPVDDEPMHVLITGDTQRQVDAAAKMIEELLV
FT                   PVDEDNNEHKKRQLKELAEINGTLRV"
FT   CDS_pept        572724..574712
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636762"
FT                   /orf_name="MICPUN_62530"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66186.1"
FT                   /db_xref="UniParc:UPI000199C062"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE80"
FT                   /transl_table=1
FT                   /translation="MTRGKSPRTHSMYGSAQVAGSRRERAQTSRSDPARDMARVTEAAM
FT                   AQSPHQAVQNLIRATPAKSAKKKRQSVAFATAVDGASGTDDPFSTSPKAIASTSAAADI
FT                   IAAQARRFAAERAAGLVEEPGDAISSAMWSSAKGATEAVAAAVANTSRENAAHLVSRAA
FT                   SAHAEHAADVAAAAAAHASAAAAAARDDPSPETEAEAQTAAAIAREAAEMATRAAAKAT
FT                   SAATRASADDVNRRIAAARDAMRGADGFDVAAETERLRRSQLAATQLAARDEGLLPPTP
FT                   PPRTRHTIMSEVYQSAASGLGGGAGGGGGGAQLSRATEPSSPSVGRLPATPAHAYTRSP
FT                   SRVDAVAVARERRVGSAAVKVKTPGKLGISGAAARVPARAMTREAAGAYDLAEARRKLS
FT                   KLSKEAPSPAMRFKARPAPSYTKPRRPDSASAARVASLRENAPAVKKRDPLSFDSMADS
FT                   ALDRRHSRFEANMVERERRIMNQMIHYNDDKSEAGTPKKDVKMHPWVGKSPEKKASESP
FT                   GAHAVGLLGVHMPRPTKKSIAIAEAARQRRIDREVAEAMAATEKQYGSPVERRGNPYLA
FT                   RSPGVALTKTAASAPGSARRLMADTSDARIRLEKSYAEGRLNAARALLAELETERKGTS
FT                   APDVADDDVWALDARSRGAVAALRGRL"
FT   CDS_pept        join(complement(579843..580037),complement(579562..579621),
FT                   complement(574784..579415))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636763"
FT                   /orf_name="MICPUN_62531"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66492.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001739"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003888"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199C0FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE81"
FT                   /transl_table=1
FT                   /translation="MSGEDASKPGKADPDFDPVLEEKNMTKEQHARAIRADRGGENPEQ
FT                   SLLDALEDYIILCGGEPLEDGWRVEMKMRLNGATEGQYDVYYFNPEDVRFRSRAEAVRY
FT                   YGLKPIAAPRGGSKGAKPGSKAFGTSFGKAKPWKPREPKLEPYVPVPDVIPRADAAKAA
FT                   TSAANPAREAPFTVTEGVMVVSLGKVDARPAFHDATHVFPVGYTTEWVNSDGTAKFRSE
FT                   ICDGTSVGDGKAFKDVPVFRVTRTLTPKAFEKDFPDDEAKREEEAEKANEDPLVCDGDS
FT                   SLAAWCKMAVESNSFHTMNGEELEPGARKVTGAGTADRFCLDDIDVVRTLEASTWVDDM
FT                   CPMYQYCEQRGSWAAEGLRRAKYTLAAARELLQVIKDASKAQEEAKAAREKMKRPPMTQ
FT                   EERDKHEVKRVVDKMISKLEGVHASRTRHDQRAAEKESERIERIAQKERERIERKAQLE
FT                   RDRAEREAAKEREKAEKEAAREAAKAQREKDKEAAAAAKEKAKKAAAEERERKKLADAK
FT                   KGEAAKKAEERASQWLHGITPRVADESPAEDGAAVAPGPVTPPPAPEGFAAAIAQKPRL
FT                   AGDVLEVWTFLDRFRDLLFAEPIQRDENGDPVDSPPRPGRKRKHVETRAPAEAAPPTPA
FT                   ALAAAVIDGDAVAASSLVGALLQPLLAAHASASEKSLLVDALALAPVTDASTAVPGGVW
FT                   EESLRRYLRGVAASMELPPEGATVRSAADAAEVVCKHMCGGCPTAVATPPETGTVTTPS
FT                   AAAALAASLEGHPRPPPAIAARADAEAMTACEIELYANFAVPGGAGESERRQRAVQAAM
FT                   GAATNPTAAAVRQSVRVLAHTDKFRPPELSRGAKREHGQAAAAVPYYASVAAGAGASIA
FT                   ARARFPRAIDYEVIDQRCAAGVYAVAALSAHPDDMVAVDSAECGELVSAAHAPQKDAAH
FT                   AVTQRVCKAARRGRPEGHCSDGLVHLEIGSLALFGGEEGALPKVAWDDGCQVCGGDVAA
FT                   GVVLICEECTGEYHCACLDPPLESVPEGEWFCPACERAQETRDSRSRELFALRGTKLDL
FT                   VTRGLPTPDGELGSTRCRADAARRLVKMVGALGRGWGECTPAERLELLRELTLQLLDSS
FT                   TVRNVLDDCERAQFEVHEALRKHIRDFTCYRKYGVSTAERDAIMLAARAAAEEKAEEAE
FT                   AEARAKAEVAKAARAEAEGAEGAEGAEGAEVKEDAEMEEGDDAKGSKKEVKSYAVRMAG
FT                   IAAANASVFEIPEQEGRLRWQAKWHELEQQARAADLRLSPVGTDRTGASYYMVAPWGQV
FT                   AVQPSGGGAVKRIKGSTAAAQVNKKRKKPKTEGAAENDEDEDDDNDASQPASQHQEGSQ
FT                   RDENATLPEEKPWGMYEGAERLLDDLASRLNKRGFREGTLWSELERRFGAAPVEVKEEP
FT                   VQPEVKPEGVEGADVEMHEPEADDDEDNAQKAMAPIKNVKAVPEPPADATGWKPPAPVG
FT                   SPVDTPEATIGAIKDELLALDAALPDGGGEGRAFCKVRGSKARKEAWRRMIENATDPLT
FT                   LAMACVLLEASLKREWLSPAWLPWSPPAIALRAASQPDANAAGASVLLRVHALRKAIVW
FT                   PQQRRIREEVAPEPQLSREERGARRAAAQAAAQIAAAIKASEMDIDDAY"
FT   CDS_pept        580184..583795
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636764"
FT                   /orf_name="MICPUN_103091"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66187.1"
FT                   /db_xref="UniParc:UPI000199C100"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE82"
FT                   /transl_table=1
FT                   /translation="MYAKAKAAAANAAAKAAKAYAEGKSQLAASTSQTIGSRTPDPGAG
FT                   GRNNSSLDPFADLGMAPPSYDAATGAQGGGGDAPAPTVNLDDLLSGAGAPAVNNDGGMT
FT                   TIPLGTDDDGSASRSPRVSAGSAQQQQQQQQQQQQQQQQQPSSPTKQTSGAKCQTCGKG
FT                   FSAFSAGVNVRRQCVACKGTFCREHVEYQCEGCREGPGGEELRRETAALAAKLASVTEE
FT                   KAMLEQWRQSANETQRAMVEEADGARRAAEDARRRLADAESRATAAEERAAAMEEAAAV
FT                   AEAKADSLVDQTHVTLDGSMMIDAGVAKEREEVAVAKSEEEVAIARSEAEAAKAAMNAA
FT                   EARAAAAEEAAAAASARAEEASARADDADARRAEVEEECAKMRALQKQREEAIARRNEA
FT                   TDAELAASEKRAEALERAFETEKAARLAAETAAEEVKAGDVSAAADEAARLGESVADLE
FT                   LRLAQARDAADDAVARETDLTSKVEALTAALTSAQEQAAAAAGVGDAASIACEDLQSRI
FT                   ASLEAELAAKADEAESAVRAAGTARAEAESARADAQASGGELAGKIGELEGRLRQSEEA
FT                   AAITAKRLENSNSAAKELSGKIDSLTAELTGAEEKAAAAQAEAESLKAAASSGAGELES
FT                   KIAALESQLAAKAEELEGVKSSGEQYTTELTARVEAAEAAAATAKADADSAASSASSAA
FT                   AELEAKVAKLQAENKELDGAVEAAREALSSLQAHVRENSEKAVAMLEKEQERVVEHLKS
FT                   TLEAKVKAAEEKSVAAERKAAAAAAEAASALGDADAARSAASSATAELESRVSALQREL
FT                   AAADDKISAAAAEVAAAMAEADAAKSTASSAAGESESKLAALEASLAAAEAAAAAKAEE
FT                   LEVIKTTGKQYTDDLSGRLQAAEAAAAAAQAEAESLKAAASSSAGELESKISTLESQLA
FT                   AKGEEVEAAKTAGQQSTDALTARAEAAEAAAAAAQAEAESLKAAASSSAGELESKIVAL
FT                   EASHAQTTGALKAEIEAAEERIAASENSRAADANDARSRIAAAESALEELRGAEAAAAA
FT                   AASRAEGELAELRVEMERKEVDAAAARESAAAATSAAETRAGELERALGEAEAEAAALR
FT                   AAAEASTSTEKREESEQSQQLKRLKDSLEAAKEIILSKEGELAAIEQIRQERDVLAEMV
FT                   RTLQEREASRPDPKQEIRDGLKRAGEKFKGLFAKPPN"
FT   CDS_pept        join(complement(584392..584583),complement(583936..584223))
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636765"
FT                   /orf_name="MICPUN_92004"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO66493.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199C101"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE83"
FT                   /transl_table=1
FT                   /translation="MATTLSLCAPNRVSCSRLGGKRAVGSTRALAATRAPARFASRRSV
FT                   TTRAVQEIAGSDWKKEVLESDVPVLVDFWATWCGPCKLISKVVEKAEESYPKDKLKIVK
FT                   IEVDPNPDLVEEYGVYGLPTIILFKDGKMVEGSKREGAINLPKLKEHLSAYGLDA"
FT   CDS_pept        585097..585291
FT                   /codon_start=1
FT                   /gene_family="HOG000159681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636766"
FT                   /orf_name="MICPUN_86098"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66188.1"
FT                   /db_xref="HOGENOM:HBG498094"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="UniParc:UPI000199C102"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE84"
FT                   /transl_table=1
FT                   /translation="MYLMYYLDEKGNRVYTLKKTAPDGSPTQSAHPARFSPDDKFSKQR
FT                   VACKKRFGLLPTQKPIPEL"
FT   CDS_pept        585393..>586070
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636767"
FT                   /orf_name="MICPUN_86636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66189.1"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniParc:UPI000199C103"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE85"
FT                   /transl_table=1
FT                   /translation="MTPPPPPLPDGVSFGTAPGGVRVINIRFDEDEWETRWAKVPHATL
FT                   RHPETRAAVTLIGTAHISKAAAEETRELIMRERPDVVVLELDPHRLNALVRDAHTAKPC
FT                   QAAADRFVSTSLFRSGPTQAIGLAYTLVGALLGTTPGAEFLAAIDAAKEVGAEVVLGDL
FT                   DVKITTSRAWKRQFRELGRIETYRGRPRVSEDEAVDEDLLPSEDLRIEIQNDEGEPIPV
FT                   KYRL"
FT   CDS_pept        complement(586977..588365)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636768"
FT                   /orf_name="MICPUN_109157"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66494.1"
FT                   /db_xref="UniParc:UPI000199C104"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE86"
FT                   /transl_table=1
FT                   /translation="MHAVIVLAALRFWPRLVGGGVPNRNVWQKFIATKETVIKARFWPD
FT                   KWRRFRVAILDDSKLLLAVMIWPPSMFVANATDKNGKFWWRSKTCPRKSFLSVNRVDAI
FT                   FPLPAVVAVQVFEAMLMLVIVGASISEYPHYHNYYLIAFLANMAWLAAAVGWMSAASLW
FT                   NPFLPEGPPLGLPTATLHPGRTPGRPAREEDEEECPGTAWRPHEGWGGDTPAPARGVKS
FT                   IGGALAAAAPSGGEGAVAASVDAGGIFSPPAKTPRGGPAVRASYAAGDGPQERWDDERE
FT                   GGAGAGILPIETMVDPEPVPESSPRALNFTSVPEDFKYDFAAERAKRLAAAKAQQEAAA
FT                   RAQLAAHRRTDSGGSAASEQAAEPRETASPAAQPKGGISFDRLRGGLEKKGGYVPGQTQ
FT                   PSGRVNTSTASTVSSLATPPFPGRHAAGGMSASSDTSMAVNATLTARDDESGDPWSDPW
FT                   GGRR"
FT   CDS_pept        join(591112..591207,591545..591628,591776..592381)
FT                   /codon_start=1
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636769"
FT                   /orf_name="MICPUN_95460"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66190.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG748739"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI000199C105"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE87"
FT                   /transl_table=1
FT                   /translation="MGRIIRGQRKGAGSIFTSHTDKRKGAAKHRQQDFAERHGYVKGVV
FT                   TDIIHDPGRGAPLAKVTFRNTKRFQHDKELFVAAEGTYTGQFLYCGKKAQLVVGNILPV
FT                   GSMPEGTIICNVEQKLGDRGVLAKASGEYCILISHNPDTGFSRIKLPSGSKKTIPSGCR
FT                   ATVGQIAGGGRCDKPMLKAGANYHKFKVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHA
FT                   STVRRNRPAGAKVGLIAARRTGRLRGVKGIMAAKAKEGN"
FT   CDS_pept        593193..>593819
FT                   /codon_start=1
FT                   /gene_family="HOG000241777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636770"
FT                   /orf_name="MICPUN_71212"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66191.1"
FT                   /db_xref="HOGENOM:HBG609305"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199C106"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE88"
FT                   /transl_table=1
FT                   /translation="MSYNLLADSHAWKYRNELYRGIHDSILSWRRRLRGIVQEVKALRP
FT                   DVLCLQECEDFHGIAAALAGCGYTGLHAPRAGGRTDGSSVFYRTSVFRCAAFEAVDFTD
FT                   FDLRENAAAVACLVPSHPNAKPVVVGCVHLLFNPRRGDRKLGQLRVFVERVEAMRDKYV
FT                   GAVGGDAAPHAMLVGDFNAEPDSPLYRFIVDGTLDVSRVDRRDMSG"
FT   CDS_pept        complement(594540..595574)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636771"
FT                   /orf_name="MICPUN_109159"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66495.1"
FT                   /db_xref="UniParc:UPI000199C107"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE89"
FT                   /transl_table=1
FT                   /translation="MSGMRNEGNGKLYREKIAHHLALFYGKTFEQGSYWYTHPNENEFF
FT                   RAVFAKAAGKENADDVDAAGIDNIFFKKENRQMGIDAKALGRYCSERQLKALFAACPAS
FT                   SEEGDVCIEVPPPASASLGAPVKSDEENEEEEEEEETPDSGSPVPAVHGVPAVHGEAGT
FT                   GEPAESDDEGTVAHEADVANLDDLPGDDDDVDVDDAVPAMPAGGDFDDGNFYSDEKKFK
FT                   EGDDFNLDVLPSLSQWDDAPGFDFDFAIFEPSQPTEPTEQQRDLMEHLVNVPRVNEWRI
FT                   RLSQLKVDAAEGKIITGWMQPAVERRARAMKCFEELERIMREQEQAYEGEINSSFPVAP
FT                   TTLG"
FT   CDS_pept        596385..598919
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636772"
FT                   /orf_name="MICPUN_103097"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66192.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199C108"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE90"
FT                   /transl_table=1
FT                   /translation="MPRELESVGMGPGRGGLPPRTPQDADEFLENVDEVNALIDGLRSG
FT                   KISAEYVDRKIKERDAESTQLEEERKKEAEEAERRKYENLSPEEQKKIKAKVDEMIAEK
FT                   ERRERARKAFHEYRAKMPEDKRRATDYDAWDLWTPSDDEDDPWMQYTPENPAFKAMEAD
FT                   IDRRHAAQVRARQTAHRRREEGNAAFRAGQFADALRCYELGLEADKRSLELHGNAAMAA
FT                   LKCEMFVQCIDHASKACELAEFLLERPDHPTAIKCLQRRAAARLKLSHYKDALNDLSLA
FT                   HERDPSNGEIESQMKEANATYEEARKEKEVERGMRRAAQGVDGEVDGTDFHTLRELEKL
FT                   CGEIGSGACDYARLEALVEGSEQCRVFLRSGRGSHLLGLSRELELDKKAAPTGPLRVLR
FT                   AACLNEANRETLARNGTLKLAVGFIARARRSTEKATDREAVSAALFLLHTCSATANPRA
FT                   SIIEALASDVEPDGAIAGLFAMLDTDLANDAGAKLAAAHALSLLGNCAVDAKARIALTR
FT                   AVGADAPGKIAPVLRCGTPVLAERAATLLGNMCADGRMRAEFAANERGISDLCALLPKN
FT                   EKNERARASSAASPAGMGAGLPGLGARGADKESDAPIDPSPVRDCELVLNVLAALANVS
FT                   VDAAAAATIGGAGAAPQLARLLSASDPLVAARAATVLSRIARDPSTARRMCGAGGSNGD
FT                   VGSNGDVVAATVAKFVVRRLASDARDGAIEPAVRTLAVLANGGDVASRLALAEHAAGAL
FT                   VECVRRWDVVGDGAAGNAALAIGDLARERDLLPRLAALQPVAPLLAVCHKRTGAAQKNA
FT                   AIACARLATHSGMLETLKANNGLELIYRYVQP"
FT   CDS_pept        join(complement(599426..600329),complement(599258..599364))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636773"
FT                   /orf_name="MICPUN_62541"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66496.1"
FT                   /db_xref="UniParc:UPI000199C109"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE91"
FT                   /transl_table=1
FT                   /translation="MYQYADTVEFDLMVVFLVVCVMPLAVFLMQSKTKVGRAMSLALMV
FT                   LAILYVGGFEHYRMHRPEVTEGGLKAAVFPVAFLDLIESETFTLTYLPIGADPDTIAKA
FT                   SAGIDRRNATTAARVAASAPRRAAPGKRSGLKSVDPAGEPLMVHLSHKGAGDRMFRDAL
FT                   RVIEKNTCGGASNETTDFAERSQSSSPACMRWCSGTVDDFRHDVHSFSFDRSTPRDMGL
FT                   LGRAYRAVFVVRDPRDLVAESYLEHLDTSEAWARLPRDDLGGESFQSKLRSMSTEAGVD
FT                   VEIDRFTASLSVKLGIARAIGSGISRGVCGRLLERATPTWYLSSTRSFSAPRRTV"
FT   CDS_pept        600787..601446
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636774"
FT                   /orf_name="MICPUN_62542"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66193.1"
FT                   /db_xref="UniParc:UPI000199C10A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE92"
FT                   /transl_table=1
FT                   /translation="MCHPIFRFIAVASLACAATLAHASTCEELYTPERLELARRMVECS
FT                   LDNYPSDCVAPVDETDFVYSQNFERYEVKGKAQWDTWLENFFALNPDVRVRVVKGKGEF
FT                   CTPLRYASEWTMNMTFQPSGDKLVDVEGASVITFKGPNDNTMVRMKDYSPDMEIYGLLP
FT                   RIGPPLVTVKRGIDECLRTEGGCESEEAMMKIASLLLGTTEEVPSLETKPSAKKKK"
FT   CDS_pept        complement(601553..602479)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636775"
FT                   /orf_name="MICPUN_109161"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66497.1"
FT                   /db_xref="UniParc:UPI000199C19F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE93"
FT                   /transl_table=1
FT                   /translation="MVAGHILDAVDVLHSRVRGKKRSGNREMSHNFVMHDKLKPWVKWA
FT                   FWFTNVPYWIICGLALYQSLPAKALQHPVAECLRPYCGSNLFHAICVGLVALASSAFHG
FT                   AQLNLDRACACALHDWNILVGRAEQLTGVTLTPLHEVGSMTVATPRGLRRRSGRLNDKR
FT                   MSGSPRAFDDGVPNGLNDHPSDDEEELCQFVGEDAPIWEAPMAGAIAGVTGASPERRRL
FT                   VSNLLFCDVLCANVYVMFLLSCIGAKRGHLTEVVEASALPVVCMFIAAACKRRGMYHGY
FT                   VFFHSIWHFTSALLMYEMLYERFGDSW"
FT   CDS_pept        join(602660..602662,602805..603932)
FT                   /codon_start=1
FT                   /gene_family="HOG000231498" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636776"
FT                   /orf_name="MICPUN_62544"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO66194.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG318833"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000199C1A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE94"
FT                   /transl_table=1
FT                   /translation="MGNGSTKLDKALLADTDGERYYGLENFGNTCYANSVLQALYFCKP
FT                   FRHAILEYHESLPKDHDESLLTALGDLFASISNQKKRTGVLAPKKFIERLKKDNVIFNS
FT                   YMHQDAHEFFNFVVNECCEVLVKQHRREHPTPDGEETKPVKTWIHDIFEGGLTNQTQCL
FT                   WCENVTSRHEAFMDLSLDIEQNASVSACLKQFSSNELLASQDKFQCDACGGLQEAHKRM
FT                   LVKSSPKVLALHLKRFKYLESLGRHAKLMHRVVFPSELKIPNMTEDADGQDAAYQLFAV
FT                   VVHVGSGPNHGHYVCLVKSHGQWLTYDDDTVELMDDDAMNNFFGSTQEHSGGNTEHGYI
FT                   LFYERVDGAEWSGSGGGEGSRGARGGLSEALATAQQ"
FT   CDS_pept        604749..605198
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636777"
FT                   /orf_name="MICPUN_109163"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66195.1"
FT                   /db_xref="UniParc:UPI000199C1A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE95"
FT                   /transl_table=1
FT                   /translation="MRAERDDRDPFATTFPVDDSLVPKPTLGDFAKVAPPTVSPIPPPP
FT                   LPPPPVRTAVRAADDETSDAAASTATTSPFAGTTTTPPARPADDYADFDAHSPLNLSSL
FT                   GLDDGYGAARSPDARSPDGASMEPARGRTYRDDLADRIWEDSRYR"
FT   CDS_pept        join(605335..605613,605753..608065)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636778"
FT                   /orf_name="MICPUN_62546"
FT                   /product="Predicted protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO66196.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000199C1A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE96"
FT                   /transl_table=1
FT                   /translation="MASIAAAGAAAAAIGMWYSQRRQPTVSEFTEPPTNWGEAMLRLHE
FT                   VVRISWKEALSKLGVWRLDHLLAIRHLSNRDMSAEIAADAARCGTLVEDGDEWIEKLDA
FT                   IALAAGYNRTLRGARNLEQIVAKLDPSRADILMSQLRPAILQPAYILVRDRVEKKLFFV
FT                   IRGTHSVRDTVTSLTANSRPHHAIGEDGAPVLGHAHAGFLSTARWLVKTCKNDLAAAKS
FT                   ANPGYTLTVVGHSLGAGTAVLLTQILREQDGGNAPGNPFANVECIAFACPSCLSRELSE
FT                   SCRSFVTTLVSNADIVPYVSFSKVSELQSQIVSAAWEQQVLKKWRETTRALSCVAPRAS
FT                   RSNLGPADTAAARRGAVDRGPHFLCQVPGSLTCGFGGPPRVRTSSHSEGHSSEGVVLDS
FT                   QAFDVAHLPGAAAGGNFRPRRWLGAQLRSLTRGFENGGKGGKLKQLAGLGGALIAGCVA
FT                   PRKPATRIPDAYTLEDSRASTGRVNREEERESPRTQTMATARGAWPAESPSASSAAARE
FT                   AAAGAARPVDRSEKSETEKSGGHPETSTGWDPDRAPRADDDPLPQWTAELASARDLVLE
FT                   LDEDEELLARAQGEAAQEVLRLQEELSVIHAAEIRSASRAASTAGGDSDSDEEDRSPLA
FT                   APKASWSSMASLLGPGAPADVVAAADEVEAAIQGPDEIRPGSYEPRGAGVKGLSGLSGE
FT                   DDDADDVRGQQLLAQHVLAERIATGRGGSDWRAVQLERRASRGSLVGSDNEGANSEDTA
FT                   FTVKLYPAGRILHMVRADATPVDANGGVGVGDESSRGEEPVAAAPGSAEWRARFRMYAD
FT                   VSVDMYDSIKLSRTMLSDHFLPKYLEALEDVLWSMKKKKEDEAVARATERT"
FT   CDS_pept        join(complement(609755..610506),complement(608107..609622))
FT                   /codon_start=1
FT                   /gene_family="HOG000006166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636779"
FT                   /orf_name="MICPUN_86270"
FT                   /product="Predicted protein"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="ACO66498.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG318039"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniParc:UPI000199C1A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE97"
FT                   /transl_table=1
FT                   /translation="MVPEVLLALLGVPGEVITLVPATSDGGQERFRVSPDLPFLEPPER
FT                   ASLDRLVSLGYAFRCLERFVAREDEAGTTMATLPSGPDASFAFNAPASGGSLYRRALAA
FT                   GVSEVLATYESAILRLEQDILRGVTPALPAALESALSGFALVLPALHVTLRPVIERPDL
FT                   KGAPLLHHLHAAALAAGAPQLEAALRSLRARCYRAMYQQLLAWTVHGVLVDPHGEFWVR
FT                   PVEGAGGDGGVYLGDFDESGAAKATGALGGNAPGDDGGEREWHRGFQVSLEALPPGVEL
FT                   PAAEAVLFAGRAVRVLTRPRGEFAGGSLLPDAVASRATEALRGLARVEGEGNDGEFDRL
FT                   AFESTVEGIRAPVAARLGELVVRDAKLAKHLEALRSYHLLGRGDFFQSFFEEAASLLAV
FT                   PPRANTAEADVAAPFAAAASKSSASDDPLLPRFRLRFVSPNQGVDDTGAGAGGSNVQKR
FT                   GPNVRVPSYDGWDGLELEYATPWPLGLLLTRSVQRRYNHLFQYLFRLRRAALALDDAWF
FT                   ALRRKSASGTLRWTTTPGSFTSGHGVKGFGGDGAFQLCQRVRHDMAFVVNNWFTYLQVD
FT                   VVEAQYRAMIERVEASEGDFSECQRAHRAFLAALTAQSFLDLPSVSDVIETIMRLAGNL
FT                   LAVVKSLPSDGLGEGVGEETADEIEAIGAEFSRQSAALYTVLRSNRLANDPKAPFLRTL
FT                   LLRLNFNGYFFDNAAKTSSGHDAGGSDAPSVRSSASSMKSFRSGWGEAIPPMPSLSLKR
FT                   GI"
FT   CDS_pept        610622..612136
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636780"
FT                   /orf_name="MICPUN_62548"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66197.1"
FT                   /db_xref="UniParc:UPI000199C1A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE98"
FT                   /transl_table=1
FT                   /translation="MRSVDEEVEDVIGRLKAAVGVSLFDASAARGGPSLFDRAYDADVP
FT                   RGTVDDDWDPVPSPRRRDENDESGDEGVDDDANATANYLHRSATDDEVRGILANLYRVA
FT                   TTGGPIPEDLKEPSWDDRELPRWDPATRAKWDPRATKPYVMEGVMPPWHAKSYYKVVAA
FT                   VPEGAVRASTSERAAEVIRRGAGDKSRGDVATTAGVEYVSVYDGVTRYRPGVTVCHPAK
FT                   ETHKGGLYVAETIEGCLRRDAEMFPTASAMLTAPRAIARVRCWNPDRLEEPVRYGGKLA
FT                   FTCCHVEEILPYPTTWGAGIKGAGTSTWSAALHGGPTPSGTRTEWDENDENAPAVRLDA
FT                   DSSPLKSSSSGFRYSVFSPSRPRRAARQGYDDVALDEAAGGMFRGMTRASTGTPGGLRG
FT                   VARRSTEARRSTEARRSTEANRSGLGELVDDEAAAIVAELEARAVAGVQAGGRRREAER
FT                   VGAGGKVAEAETKGAERLLRAQAKTVALEEEVRAMERRLDRARYGA"
FT   CDS_pept        join(complement(614822..615145),complement(612308..614683))
FT                   /codon_start=1
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636781"
FT                   /gene_name="PHO1"
FT                   /orf_name="MICPUN_104969"
FT                   /product="Glycosyltransferase family 35 protein "
FT                   /function="phosphorylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66499.1"
FT                   /db_xref="GO:0004645"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG444050"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniParc:UPI000199C1A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EE99"
FT                   /transl_table=1
FT                   /translation="MEGDLTADTFYVTGDNGAKVDDVYDLANIKQVIKVVLNAHYLKSN
FT                   QGARPKDSTSFLETNPRQKDLLYSLMDSYAKNDVLSVQKSIVDHVEYTLARSRYRFDDF
FT                   EAYQATSMSVRDRLIESWNDTQQYFREQDPKRVYYLSMEFLMGRSLTNSLFNLELNGTY
FT                   REALKQLGYEMENLVEKERDAALGNGGLGRLAACFLDSMASENLPAWGYGIRYQYGMFR
FT                   QEVIEGFQHENPDYWLNFGNPWEIERPNIAYPIKFYGNVEILESEGRQAFIWNSGEEVT
FT                   AVAYDTPIPGWNTPNTINMRLWSAKPSREFDLESFNTGDYVQAILAKQRAETISAVLYP
FT                   DDRTYQGKELRLKQQFFMVSATLQDIIRRYLVTHEDNFDDFPDKVALQLNDTHPTIGVP
FT                   ELMRLLMDEHGLGWTKSWDITTRVFSFTNHTVLPEALEKWPVDLVENVLPRHMQIIYDI
FT                   NWRFTQELRGIMGDDYDTIGRMSIIEEGDGHKNVRMAHLALIASHTVNGVAAIHSELIK
FT                   TTIFKDFYQIMPEKFQNKTNGVTQRRWLAFCNPKLSALITETLGTSAWIKELDLLSDLR
FT                   LHCDDPAFQAKWAAVKRENKLRLAELVKAKTGVDVNPNALFDIQVKRIHEYKRQLLNVM
FT                   YIIHRYNALKAMTPAEREKQVDRVCIIGGKAAPGYDMAKRIIKLVSAVGDVVNKDPDIG
FT                   DKLKLVFLSDYNVSSAEIIVPGSELSQHISTAGTEASGTSNMKFAMNGCLIIGTMDGAN
FT                   VEIAEEIGQENMFIFGARADVVPSLRREREFFNVPEEFYKIVDQIRSGYFGWSDFFAPV
FT                   CDAVCGAQDYYLLANDFNDYIRAQEAVDENYRNQALWTKKSILSVAGSGKFSSDRTIRE
FT                   YAEDIWDVKPTKRPMPTNPKPYGPSHKM"
FT   CDS_pept        615936..616997
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636782"
FT                   /orf_name="MICPUN_62550"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66198.1"
FT                   /db_xref="HOGENOM:HBG609313"
FT                   /db_xref="UniParc:UPI000199C1A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA0"
FT                   /transl_table=1
FT                   /translation="MPKRPDRAQVRIDAFLSPRGGIASTSGGSFGSGVGTAPRGGGHRA
FT                   NRDRAFDGSSFVNCPVCDARVALRLMNDHMDGPTCGIGVGTRDETPRASVPDQEEPAAT
FT                   GEKVSDQTTTKTGELDDDDDDDTKPSALAELMRASATAPTRLPGHHLIPDFITPDEESR
FT                   LIEYLDRDESDTNPWRPSNFNGKHRGKKWGVEVDLKRRTVAPERRPLPALVRAVADRMP
FT                   AAHPALRGFVPNEANAIDYDRRGGAELLPHVDDRQMSTDLIVNLSLAGDCVMTYVEDAG
FT                   RDGRRGGWEGVPAGARRVDVFLPRRSLQVQSGPCRFNFAHSIRNENLRAPRRVSITFRR
FT                   SQMPRTRTRVRGE"
FT   CDS_pept        complement(617055..618584)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636783"
FT                   /orf_name="MICPUN_103103"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66500.1"
FT                   /db_xref="UniParc:UPI000199C1A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA1"
FT                   /transl_table=1
FT                   /translation="MERDGGAGGVDRKVFSGGDASIFSSADGLQRLAKTRSGSRQSSRA
FT                   GSEKSGRGSRGDPPRPDHSAQVNFYGAQARISGGGAHSVSEGSGSHRGGDRRSQGAGSN
FT                   RAPSTGRGESTGRHGQGAWVRVEDVADHAAPTDPRRARVPSRAASDRSDDRGTQTDGPA
FT                   GADDPTRAPANPNPNAQLRLQAALQTELRECQEELARVQMEAAALRNDKARLVQELERE
FT                   RERTAGEREQREQRGGGDRKDSGDRMRRAESGGGLSGAGRESSGGAPTITEEEMDDTVN
FT                   SLLEMIATEREAKSALEHHLRTATAALEEERRRRVSAEDDLAETREAADDDADAAERKL
FT                   REATDIIGELRQALLDVMRVKDGSVNGSDGGRRLSSSQQPKSPETSRPQQGRDPNKSRW
FT                   LEGGGGGGGGGGGGGGGGGGGGGAGVSDPNVASRTGGDAGVDLYADIGGRATAILRAIA
FT                   AKVAAHPAFELAWPLMCIVLLLRFQLGPDVFTWRSLTWSAREPPTVAAPDL"
FT   CDS_pept        618720..621971
FT                   /codon_start=1
FT                   /gene_family="HOG000007676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636784"
FT                   /orf_name="MICPUN_62552"
FT                   /product="Glycoside hydrolase"
FT                   /function="alpha-mannosidase activity"
FT                   /function="carbohydrate binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mannose metabolic process "
FT                   /protein_id="ACO66199.1"
FT                   /db_xref="GO:0004559"
FT                   /db_xref="GO:0006013"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG718615"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="UniParc:UPI000199C1A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA2"
FT                   /transl_table=1
FT                   /translation="MRRSDDDVDASLRVLLRTGDEEGSVDDEEATRGGRGRASSLLNGL
FT                   LLAIVVVFSVLLLLLLLAQAPVEAGCDRVPGYEGPPVPPPGDRRVPGKLNVHIVPHTHD
FT                   DVGWLKTVDQYFTGSNASIQQADVRRIISSVVDELSKDPARTFVYAEMAFFSRWWKEQG
FT                   AAERSRVRLLVKEGRLSFVNGGWCMHDEAAAHFADMIHQTSMGHEFIRANFGASALPRV
FT                   GWQLDPFGHSAIQATHLGSGVGLEAVFFGRADVDDVARRIADGAMEFTWRGSRSLGPSN
FT                   DVKGFVLSKYGNYGPPPGMCFDVVCGDDSRWQDDPDLEDYNVPAMVKTFVNAVEEQAGW
FT                   FLGANGSTPYGGDVMLTMGTDFTYGAAPYWYDQLDRLIRHVNAAEGTKLNVFYSTPSAY
FT                   LDAKTGNPHMRWPLKTGDFFPYRWNPHQYWTGYFTSRPTLKAFIRRGGEFLRAAQSLAA
FT                   VVSLRGVVHAPGAETSTPWDLFRPLAEAVAVAQHHDAVSGTAKQHVTNDYAVRIQRGVD
FT                   GVEGHFSRTLNAALLTRGSPSAPAPPSPDPDAVATRCPLLNVSACPVTESMTPGDVVAV
FT                   LAYNPLAWERMEHVRIPMNAAAARRAVVVDASSGEFVPSATLPAPPPAPLAGRTTTQLV
FT                   FSVALPPLSVSTFFVRSLSENEVLPETALAEAAEETGASESDANDGGAVSVSVDPNDGG
FT                   LLVDFVVDATFNLTAKITAAFYASHDGSDGFVPSGAYVFRPDSSQEATPLRTPSFDAAA
FT                   FRAFRSGVLAETRVAFGDWASVAVRTWSKERVPHAEVEWTVGPIPVEADGVGKEVIVRY
FT                   STGLATGGTWATDSNGRDMQPRRRDHRDDWTFRNASEEPVSSNYYPFGSIATLTGDERA
FT                   GFHLLTDRSQGVGSIRDGELEAMVHRRNLNDDWLGVGEAMNETQCGCRECDCPGLVARG
FT                   THLIAATTPATGPRTYRELQTRSQNPTQLAFAKVNGWFEESIRGGSRSAVSVFAGEAPR
FT                   NVHVVSIERLPGEDCSRGSACARIVLAHLFESEGCVGYDEELSAPAKVNLADFFPGRSI
FT                   VAVDELTLSGTPIRPGDAVVTLEPMQIRAAKVEFA"
FT   CDS_pept        complement(622181..623386)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636785"
FT                   /orf_name="MICPUN_62553"
FT                   /product="Predicted protein"
FT                   /function="signal transducer activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO66501.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI000199C1A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA3"
FT                   /transl_table=1
FT                   /translation="MAPEQLVRRHLAVRRRLLAAETERDDLSANLRRLAGVHEKLEGEL
FT                   REAGGVGDEDAKDAQRELDDHALATIDVDKESLIERHLLAISKLTATEAECASLAATAE
FT                   GVEEKNCELRAEIRRRKYARLGGDSARIDVGRVAQDTGHDDDDDARLRVDATRNASPPA
FT                   RPSSPPLIIRAAEESGMPFTLADAMAPCDEARVVVDEDGGTVIHVNAAWEQLCGYSAEE
FT                   CVGVDLKELIECPDSEEALFKALVTAVKQQGACAEARLTGYRKDGSEFIARLRVSPLYC
FT                   ERTNKRSFVGVMTLSRSTHNSDDDLPAAAEKNSNSPPPRTASLSPPLPVRQENGKVYVG
FT                   GDPNCLAPPLKRKLSPPTPENEEIDGVAKTRSNGHADGVTNGLAINERLTRSTRNRSGG
FT                   TR"
FT   CDS_pept        join(624355..624453,624563..624654,624756..625785)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636786"
FT                   /gene_name="FOLR"
FT                   /orf_name="MICPUN_106264"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66200.1"
FT                   /db_xref="InterPro:IPR004269"
FT                   /db_xref="InterPro:IPR018143"
FT                   /db_xref="UniParc:UPI000199C24D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA4"
FT                   /transl_table=1
FT                   /translation="MNALRLTVLAATIAYASAQQGTCEVCHLHYYHKDVSHAEIWGSDV
FT                   SICKEYEHEACCTKDTVKKIDVNSKLYGDYDLDACGLSSSCKKFFIEESCFYECDRNVG
FT                   KWRKHVDCDDAGEDNGWEIKGMPVKASYWDAWYEACKDQYFAWGPGGSYWDIPKFTTDS
FT                   YRGTGHRGQRTAYTSCSKFSDTYKNGTMVAEVMWGGAFTYEKDESKAYVMTFPDGTANP
FT                   NNALFTDKEYPRECAGHEVNLTHPGVDIITGNRVSYSEVACPSDWHKAANSGISERSSR
FT                   GTLICDSDLNTAKTELVSGTKCKASGTTCPATCKALLDEVEVECFGMEFTYTPVGGTET
FT                   YGKWNTDKLAWYDIADAERVKANKTDACDAIIDQYILAATPSPAGIIRAPLMAIMGFVV
FT                   AALLVIA"
FT   CDS_pept        complement(626117..627514)
FT                   /codon_start=1
FT                   /gene_family="HOG000202586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636787"
FT                   /gene_name="DUS"
FT                   /orf_name="MICPUN_103106"
FT                   /product="Dihydrouridine synthase "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO66502.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557545"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000199C24E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA5"
FT                   /transl_table=1
FT                   /translation="MSALTACALSPRASAAGHASSSSPPPRRDYAALFERGRNGGAPPL
FT                   FLAPMEGLGDRRLRRALAFSTGGFDEACREFTRVPGVLSQGANPEKLLRGIALTGYDAD
FT                   ELTDWERFAWHHDDVRGDAPPPTSRAPNLLAAQLMGSNEDLLERCARFLAHQGGAPRVD
FT                   LNCGCPANVVTGKGAGSSLLRDPRDVEAMTRAVARGVAGTGCAVTVKLRSGFDDRGLLR
FT                   ENLLAAQAGGASFVTLHPRTRAQGYSGHAAWEDIGFAVDLLSVPVVGNGDVTSAALASK
FT                   MLRDTGCAGVMIGRGAVQDPLVFRRCRAALSDENFRRGTSGDASVGYAWEMTAEEEADE
FT                   IRGFLRRFADEVFGEAERQEAEGKRRRRRGRSPAEDSERFKVGKLKQVCKYLFAGNDAL
FT                   LPHVAGVLGTEVDLDAGIDAAKLLRDVEELVAERWRGEPREVLVDAFSLRTAYQGSADA
FT                   SKDAVRT"
FT   CDS_pept        join(627601..629073,629130..629138)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636788"
FT                   /orf_name="MICPUN_62556"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO66201.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199C24F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA6"
FT                   /transl_table=1
FT                   /translation="MATAVTASGGWSTPWRRYPHTSTRASISSRARVSRVDHGQPDPKG
FT                   EALASWLRTHEGFDELGVRVRFVGEARGFAGVAVDGVKEGDLLVRVPRSAMLTAEDARS
FT                   CPIVGDVASRVSDTAALALKLLAERDAADGSAWSAWIATLPTWEAVRETHPLAWSRERR
FT                   ERALRGSPTLTRLEAMVASSVEEYESIAAACANAGGTPAPRVEDVTWARAMISSRAFYL
FT                   DDGDDDVEGEGWWHDDDDDTAGDDEWWPDPAESGDGLDDDPTQPNDDEFEAFGGVDAAP
FT                   FDDGYRRHDPTGAFVALVPWADALNHSPDADERSLLSLTRDGGTGAVVAELRASAAYAP
FT                   GDEVHDSYGVGVSRADSFLRYGFVDVSELKCEDSVDVSGEIFLRGLLGGDEPAEPLFAR
FT                   LDAVGLGPGETCVTVTAHGVGESALAWCEMAASAASGEDFDGDFDGDFEDECVAALSRV
FT                   CEAMAAAYPEQHAAAVGSERGEERACGEDAAALKG"
FT   CDS_pept        complement(629203..630330)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636789"
FT                   /orf_name="MICPUN_86329"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66503.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199C250"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA7"
FT                   /transl_table=1
FT                   /translation="MSYASNRTPGVARAAVASTGARQRDVRASSVAPSSAAASGETSVR
FT                   LSSSAAQPMVGLGTWQAPKGQVRDAVKAALEGGYVHLDCAAAYANEEEVGEALADAFAR
FT                   GVARRDDLFITSKLWNDRRRPADVRAGLLQTLKDLRLEYLDLYLIHWPVCWRRGTLLQD
FT                   DADASILECWRELERCVDEGLIRSIGVSNFSEARLEELIRDARIKPAVNQIESHPLLPN
FT                   TELVRWCQSNGVAVTAYSPLAQGGKVFADETVVSIAAKHGVTPAQVLLRWNVERGVVVI
FT                   PKSVTPARIAQNADVFGFGLDADDMRRMESLDADATTTPSPWSDIGPAARRNKILRPLL
FT                   SAVLRPFFWIVRVDVQRMGRKGFISWAWSRDENLD"
FT   CDS_pept        630552..631019
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636790"
FT                   /orf_name="MICPUN_109164"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66202.1"
FT                   /db_xref="HOGENOM:HBG609901"
FT                   /db_xref="UniParc:UPI000199C251"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA8"
FT                   /transl_table=1
FT                   /translation="MSASSIIAPLAKVPAKLRRSACAPARRTPVVAAPVARHQAGASKK
FT                   ADELARTFTVGFASMLLATQPMAAEAKKPYEGPMAVFNNPAVLGGTCVAVCWGIPQTVG
FT                   MSVLKEKEDKGRAQLSKWGVDTSDIEQGSWGRIRQMLKREAEARGEEMPKF"
FT   CDS_pept        631192..631380
FT                   /codon_start=1
FT                   /gene_family="HOG000197071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636791"
FT                   /orf_name="MICPUN_62559"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66203.1"
FT                   /db_xref="InterPro:IPR015157"
FT                   /db_xref="UniParc:UPI000199C252"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEA9"
FT                   /transl_table=1
FT                   /translation="MPGKEGGKAKPLKKAKSNKGELDDDDIAFKEKQKADAAKLKALKE
FT                   QAAGKGFGAGMKKSGKK"
FT   CDS_pept        join(631813..632277,632370..633485)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636792"
FT                   /orf_name="MICPUN_62560"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66204.1"
FT                   /db_xref="HOGENOM:HBG557549"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199C253"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB0"
FT                   /transl_table=1
FT                   /translation="MKISSPRASLRLPSALPGSGRLRRTEEPKRHRKTFLVFSPNEWPE
FT                   RPRHVSRHSAGSRGRGHMSLAASAARSARRAAFALAPRCASAGPTARDALFLERASSSS
FT                   HAWSTTRGVATRVVSCGNGDFGRLGHGGDGRGRAGLGMSAETFQRMTGIPQGLDVVSAS
FT                   AGGSHTAVVTADGAVYTCGLNEHGQLGHSHDAGYVPILRPVSGLPQHDRVVAVSAGHHH
FT                   TVCVTEGGELWAWGRNDASQCGLGSGAPSVVPLPAWISSASPGAPGNHGAVMSVAAGPR
FT                   HNLAVTDRGAVYTWGDGKEGVLGHGADESWRWGFWGRDTTEPAPRLVRSLADDGIEVAS
FT                   AAAGLCHSVCVDRTGHVHAWGQGRFNQLGVGAKNAPAFTTEPTRVPALGRVRDLAAGGN
FT                   FNVAVGADGSMISWGANGNGELGLGNSNDKRGDVPRLVHNPNAASFASASAGWRHAAAT
FT                   SSDGRLWTWGWSGSVGQHGVDADSTGGQLGLRNGQSDFWEPTLVVGLPGKAKAVSCGFN
FT                   HTVAVLEEP"
FT   CDS_pept        complement(633537..635516)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636793"
FT                   /orf_name="MICPUN_106265"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO66504.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199C254"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB1"
FT                   /transl_table=1
FT                   /translation="MVPTGDLPPPPPGWRKYWAVLVTYVSCASFHASREAFVAVKGDFQ
FT                   RRLHFPTELLGYLDTTFLVCYGFGLLFSGSIGARYGNKTMAIVGLAGTALVIATMALLS
FT                   MGWITDLPTDKSEAWTQGLLLYVPLWAVNGFIQSLGFPNLVAVTSGWVNPEKRGLVLGM
FT                   WSTTGAAGDIIGLSVATHVLERSGGVGSHAQKPGETTEQWTNVFWAIAVYLAAVSLLLA
FT                   FGVEDRAWIGLNKSTNGGDKAPGTDENAPLLPDAKEGAKGMKTRPPANITGVFSGLKEA
FT                   WSVPGVLDWSMSYFFIKTVTYTILFWMPYYLTLTLSSQAAADNLTVLFDVAMIVGCTLL
FT                   GYVTDAFGGTRSPGFFVSYIFGALPLLFLPALQRSIPHYAVAFGIIGVFTGGPAHMYGT
FT                   AVSVDLGVAAAELGKPGLVSSLSGLIDGIGTLGAAVGQTLVAKVASAGESKTVKKIKKV
FT                   LDDAVKGNETTVEDLVEAHSRPRLTGNITEDMASGATDYVLREWSDDEDGTLGVETSAA
FT                   MAGGRKKGLAHGVNGLIRDLARGSDAEIELDREERTNAMAFGTMPSLGDESDLGRYVSE
FT                   ATFAPAIFEAAKVAVADEGRREKAHEVLANVTRMVASSDLVDDDFQERWSRVFLMLFFF
FT                   NVLAAVCLLRVAHRELTRAGVIPK"
FT   CDS_pept        complement(635901..636764)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636794"
FT                   /orf_name="MICPUN_53406"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO66505.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C255"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB2"
FT                   /transl_table=1
FT                   /translation="MPFCPYCARISLLLIESGVEFEVFLIDAGDKPDWFINAYDKAETP
FT                   AMMGSPGGLDDGQWVGESKDIIARACEQNEKFKELCEREGPITVEQIEKYANAVAFGMI
FT                   LGYIAPTEEEAGKGLAMGLHKQAGLEPIEGETGAALRERCNAHFRAGLAEFEKMIGGLT
FT                   TPFIGGDTPSKADVFAATTLFFSHNIAESGLCGDPVAMDKGASLADLGAPSVVPYLRRW
FT                   MERPSWNKAYKTTCMYSTAVVACLAGWMMMAKDMFDDGRKLNLILDNLRRRDTDYNPDF
FT                   VPPTVG"
FT   CDS_pept        638631..639767
FT                   /codon_start=1
FT                   /gene_family="HOG000201452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636795"
FT                   /orf_name="MICPUN_86144"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO66205.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG603845"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000199C256"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB3"
FT                   /transl_table=1
FT                   /translation="MASATGDTPAGKPRVVIAGAGVIGASTAYHLAANHGMRCTLYDQK
FT                   GAGCAASGKAGGFLALDWCDGSPVGELARVSFAMHEELAKTLSLDSYRRLTCEAVAVDE
FT                   RAVVAAGGVAKPGNKKLESIEWADIGAVASRPMGTEETIAQVHPKRLTEAFLDAANAKA
FT                   GTEVVLGKVEGVVTHEVTGEVTGVVVDGETVPADVVVVAMGPWTHRASTWAPGMPKVIL
FT                   GQKYHAVLMRPERVLTQAVFFQGLGDPEFYPRGDGDVYVCAYPDSPNVVDEEPGEVEVR
FT                   PDAVQRLVDVARAVSSEMKNAEVNGSGQSCHLPITQDGMPVMGAVPGTNGLYVATGHSC
FT                   WGILNSPASGAAMAELIATGSVTCVKNFDAFSPKRFAR"
FT   CDS_pept        complement(639835..641271)
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636796"
FT                   /orf_name="MICPUN_53407"
FT                   /product="Elongation factor tu"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="ACO66506.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199C257"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB4"
FT                   /transl_table=1
FT                   /translation="MVAELKVEDKPAPPPAPVEEEDGDTPVADDNADDANFDPREHLNL
FT                   VFIGHVDAGKSTIGGQILFQAGMVDDRTIQKYEAEAKDKNRESWYMAYIMDTNEEERAK
FT                   GKTVEVGRAHFETEKKRYTVLDAPGHKNYVPNMIAGAAQADVGVLVIAARKGEFETGFE
FT                   RGGQTREHAQLAKTLGVTKLIVLVNKMDDPTVKWDKERWDEINTKLSPFLKTCGYQPKD
FT                   VQYVPISGLYGTNMKTTVGKDVCPWYEGKSFFETLDNLEPLERNPDAPFRMPVLDKHKD
FT                   MGTIVMGKTEAGTVRRGDKLIVMPNNIKVKVATVYRDDVEVSKVLPGENVRLRLSGIEE
FT                   EQLMSGFVLCAPSAPVHVTQEIECQLAILELLEHKSLFTAGYKAVIHIHAVTEECEVIK
FT                   IVHQIDGKTRKPMEKKKGQALFLKSGSLAVVRIRTQGIICCEKFADVPQLGRFTLRDEG
FT                   KTVAIGKVLKLKPYSNLNDQ"
FT   CDS_pept        join(642288..642325,642494..643238)
FT                   /codon_start=1
FT                   /gene_family="HOG000234606" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636797"
FT                   /orf_name="MICPUN_62565"
FT                   /product="Ribosomal protein S8E"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66206.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG396800"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI000199C258"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB5"
FT                   /transl_table=1
FT                   /translation="MPQNEHIELFQKRYGRRLDYYEKKRKKEAREPHKRSAVAKKLIGL
FT                   KAKLYAKKRHSEKITMKKTIQQHSERTNKHKVEEEAAPGAIPAYLLDREQTSRAKVLSN
FT                   TIKQKRKEKAGKWEVPLPKVRPIAEDEMFRVMRSGKRQKKSWKRMITKATFVGPGFTRK
FT                   PPKYERFIRPSGLRFTKAHITHPELKCTFQLDILGVKKNPNGPMYSSLGVLTKGTVIEV
FT                   NVSELGLVTPGGKVVWGKYAQITNNPENDGCVNGVLLV"
FT   CDS_pept        join(complement(644963..644983),complement(643270..644817))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636798"
FT                   /orf_name="MICPUN_103113"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66507.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C259"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB6"
FT                   /transl_table=1
FT                   /translation="MVELVATRAECTASTALRCEVSALQWSPTNGALACGGFDGRAHLL
FT                   KPSGELLGVIPQAPEDVAEANGAINALAFSKGSRYLATGGADAEVVIWDLKRKSKLKTL
FT                   SGHVDEVNAVVYSPGDQHVASGGASGAVLLHSPVSGLAVGEMRVVSDVPDADGGITSLH
FT                   YSPHRRQMLASSSMDGRVQLWDTGIRRLGQNLQAAAGASPCWQASFSPTASGLVAAACG
FT                   DGRVTLLDVNAPGASKGVGSIALGAEARCLSWRSDGGVIAAGAADGRVVWIDPRMLSSS
FT                   LGAGYGGAGSAVLYTTAAHVGAARRGGVRAVRWQHAADGGAAAQLAAAGEATTPTPMRA
FT                   TRPAPFASTPASSDLGRDLAFPSPAVALPTGKENVVDPGRMEAMKEDSRRRVERLMSAR
FT                   AAGGTPESVAAAARPSLGDDVAASPLALTPLQARVGGGSAHHEPLGSMASLREMLREMA
FT                   AEQLEEQRRMIHAEVRNVHVELIKQFHTLQEEQIAMFEELRGAQRELAKEVAALKKSQG
FT                   EFVRR"
FT   CDS_pept        645145..646461
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636799"
FT                   /orf_name="MICPUN_62567"
FT                   /product="Zinc finger domain-containing protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66207.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199C25A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB7"
FT                   /transl_table=1
FT                   /translation="MSEFLRELRAARAAREARIELRASARVTTALEAAVDAASTLESAE
FT                   TIAGRADGRNPGVGPGVEHVEPDLLPSSARRRRRGGDLLSDEALRRIVDRIHAQHVEES
FT                   DANARLRAAIRGLEPNEFASLPDDTWPGLDREDGAARSDECAVCYVGFEDGDALKVLPC
FT                   GHSQFHLGCIRTWLQRSPTCPLCRCACRPPRVHLLKPTREISSATNREEDPTSDTPLDL
FT                   EYPEQTSTATTTAELRLTLDRLRREHEEESAWLDSLEAQPRFVPLGGAVVGGAVGGADG
FT                   GDEGAEGEEDADATRRAGVRERARRYFDPLDTEYMRRNYGELYRLREEERTILARLDAL
FT                   SVHEDALRVRLADARDARERQRARVGAEEASSVGGGVRRRWLRNGEVDAATRGTSADAT
FT                   ALPRGAPAAALEQVAAERTRASVVNAMDAIARWRRNGDE"
FT   CDS_pept        646723..653367
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636800"
FT                   /orf_name="MICPUN_62568"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66208.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR005445"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="UniParc:UPI000199C2FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB8"
FT                   /transl_table=1
FT                   /translation="MPVVKNPAKKKGPSLEERMRMVAAAEAKARKEKMKKRDRRGPITR
FT                   FIEWLPKWWTRVNENNTSLYLFHEKSRVRRNAWRLIRWKWFDRTVMAAIVVNCAFLAMY
FT                   DPTQPDDSSGNQMLNLVEMAFTVIFTVEFVIQIVARNFLIGPGAYLKNPWFFLDFIIVV
FT                   AGWVALIFTIVGMAGGGNVSGIRTLRALKPLRTISGVPGLRVLVTTIIDSMPFVGNACL
FT                   ILVWLFFVFGVVGIDMFAGELTHRCFTHGGEVLIREEANLPCDPGAAGRLCGVGEFCLD
FT                   SGLAPNRGYTSFDNILWASLVVFQTITMRGWSDVSDKLEAATGNPDLVKVFFVAAVFIG
FT                   GFFAMTLITSVLIAEFHKTSVLERKTGTAQDGKAARRMKRRLNRKPWFIRAKRFLKSEW
FT                   FYQKPLKALVTNRWFDRFVTLLIVANTVTLASEYHGMDQNLFDLLQQINVFLTLAFALE
FT                   MVLKVLGLGVLAYCSDRMNLFDAAIVIVSIVEMLSSQSSMSVLRAFRLVRVLRSVKFLR
FT                   QYKRMRQLMENISRGLRGMLDFLLLTLLFVFIFSVLGMQIFGGGDGFAGQRKNFDSFGN
FT                   SFLLVFEMLTGSDWYNAMWNGMDSEGKWAALFFVAWMLLGHFIILDLLLANMVFNFSLE
FT                   TEDERLEREEKERLQKQILYGDKRDLTRTGGAEVITERMTTRKSRLFAKEAAAMRVWLR
FT                   ETGQSYGDDDDWSSDEEEDTKKKKRAPTLYSTTDGGETDGETDGEGEPREDESSEDDAE
FT                   DGAPEDEFTTQQVDPQEELKKTLAVGVAVPVNQEQVEEAERKTVQLHGARRPLDKFRAA
FT                   ANKAITGIRMAGDRWQDPNYDGRSTASSPESGSMSSRSHYTDLTGLEGEELEDAILQQD
FT                   TERKKARRRALMTTVSKLVNRKSRRQLMEEEEAAAAASVSGFDTSTLLTSTSGRRSSSR
FT                   TGTYSNISGSVDGTGSVLDDIFADTLQRAEAQGQNLSREEVARRMGWDPSALSAVGTKT
FT                   DTVLSGSSGEEDDGTELSYDGGYGDYASRAHELGFGSLAAHGRVGRAPSMKSGMSFAEK
FT                   TARLARERSSGNVGRYQGEGVDPEVAAKLRALGIESGEPTTTSSTALPSPDSSRSPSTL
FT                   RRRSASMSSDRRGGTREDVSHENTPPLRESGREWKSPEAAKMAAKTVGARVAAQPRARA
FT                   FGRAPAFPGATEARPGGGGAREALRMVPPGVEDRTDATSALEGMSSSGGGGGGGGGATD
FT                   RGTPPPKAPFTLDPEPAAGSARKKPAPFGAQVRQRREGGLLDRLYRMVAQGAPPEGTAA
FT                   LAPVEGSESRVTMGRRAAAAGAKGGMNRMGIPAPTLAEQLAALGARDEGKTSSGPGPVT
FT                   EAYEGDGDGDGDGEPSLMARMHAARQRGLVSRQHREGFTPEQTRGRAFAQLISAGAGLM
FT                   GSNENLAGMANQRPASAGGRTRFANVPPLNLDPLRDGKENTSAPATPSKKPPSRTSSVG
FT                   AGLSMGVSLAATRVKTQELAKDMMQRMEARRLEMAKIQPITNNDVLLEPMTEDLCLPHI
FT                   GVVVRGGAADGKRRMDGVPDRDVIVNLPAKLRERPKHAQKKVGEDNILTGGEAPPVYMK
FT                   HRSLFAFSPQSPFRRVVFMIAFDKKFEYVVLLLIFASSIALIVDDPSVKPGSTTDEVLR
FT                   GLDLSFTTVFFMEMCTKIISMGLVLHPGAYLRDAWNCLDGLIVVTSVLSLVLNSSSLTI
FT                   VRSFRILRALRPLRMVRRLRGMQMVMATLARSLPQIGNVLIFGVFQFVVFGILGVQVFG
FT                   GMFWRCTDPSVTHVDQCQGMFQGPDGNSQLRQWVNPVLNFDHIGNSMLSLFVVTTMDKW
FT                   FEIAHRGMDVTEVNYQPVANASSINVLFFIAFVLLSSLFWVYLLVGALIDTYRRIAAAT
FT                   GEMVFTTPGQQKWAEALKMKQRQNAALYVDNREPVFFIRKWIYRLVQWKWFEMFIMGCI
FT                   GFNVFMMILTHEGQPSGLTSAQDSLGGFFTWIFVIECALKMFGLGAKRYFKDPWNRFDF
FT                   IVVLGSLPEIFGQDMGPGATLLRTFRLGRLFRLLKDAARLRSLFAALVDSVVAMGNVGS
FT                   LLFLLMFIYSVLGMNLFGKMEHGQFINEGANFENFGNGLLVLFRVFTGDGWSRLMVDTM
FT                   DCDLVEGFMQGDYYTKCYGSNFAAPLFFVTFISFATFILLNLFIAIMLDKFVDAAQGEG
FT                   LLSTASFFDLLQRKMLLDGFVERLKQRLEENRIRLGIKKKSGKSR"
FT   CDS_pept        join(complement(655494..655628),complement(653667..655274))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636801"
FT                   /orf_name="MICPUN_62569"
FT                   /product="Dof-like transcription factor "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ACO66508.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR003851"
FT                   /db_xref="UniParc:UPI000199C300"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEB9"
FT                   /transl_table=1
FT                   /translation="MAPASKAEGSARGRTAAKAEAGANTNTQYPIVRKDAGKNDANLGL
FT                   DAILAAAAEELRSSSGSADGSEDEKKKGSDKGKKGDKGSNGKDGKGKDASARKSGRDAG
FT                   KGDKAGKPGSGKDSDAKAKVKAKDAKTEEEEEKEVELEANGKPKLPRPEGTVSCPRCAS
FT                   EETKFCYYNNYNVKQPRYFCRGCQRYWTAGGMLRNVPVGAGRRKNKNGVNGSGDNSQAA
FT                   GAAAFAALAASAAANGRGRVGALGGLTEAAMHAAAAALGKRERRDGSSDGSATEAEGDD
FT                   SAYRLAAAGSGAWPMPFGAVPSSSGGGRGGSPGEGSGAGEGSGAGAAPDYGAMFAAMSG
FT                   GMPGYNPFAAMQAAAAMQAASSGSAAGGWDAAAMQQAVAAQMTAFMQGATAQQPSAEQQ
FT                   QQQAAAAAQQAFAAAMAARYGGMNPFANPYSNPGSPRASMADSGSAPAPAAASAGSVPA
FT                   YPRATEQPPATSVTNGAQPASSAAPTTSSAPPGFFPPAAAAGAPNWASMMAMMGPAMAA
FT                   MQAQHAPNSFGGMDPAQMQQIAAAISAGYNPYAAPPAAEGKGAAADAPDAKRFKVEDRA
FT                   GHAG"
FT   CDS_pept        <657649..>658011
FT                   /codon_start=1
FT                   /gene_family="HOG000030485" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636802"
FT                   /orf_name="MICPUN_72338"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66209.1"
FT                   /db_xref="HOGENOM:HBG706795"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="UniParc:UPI000199C301"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC0"
FT                   /transl_table=1
FT                   /translation="RRTHKRLTIVAGTLSRRKLLSPSGLDTRPMMGMVRGATFDMIMSL
FT                   IGIRSNTAFPPDSRWLDLFAGTGAIGIEAISRGCAESHFVEMDPWVVNNVTRKNLQSLG
FT                   VVSKTTVHTASVEAFLA"
FT   CDS_pept        complement(658510..658719)
FT                   /codon_start=1
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636803"
FT                   /orf_name="MICPUN_62571"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /protein_id="ACO66509.1"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG744819"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniParc:UPI000199C302"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC1"
FT                   /transl_table=1
FT                   /translation="MTNTVILKVAMMCTGCSGAVERVLSKMEGVQSFDVNLETQKVTVV
FT                   GTVTHEEVVTKIAKTGKAVEPWSD"
FT   CDS_pept        659046..665072
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636804"
FT                   /orf_name="MICPUN_62572"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66210.1"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniParc:UPI000199C303"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC2"
FT                   /transl_table=1
FT                   /translation="MLKETYSWALRRVFRFALRRALGRALKNDLDVNQLDVALGAGTLE
FT                   LRDLVLDCEYLTRQLGHESLRVDEGRVGWVRATIPWNALGTKSCVVEVGDVDLVLAPRE
FT                   DPIAPRPGARRKRRGRTGRRGADATGDATGSNGGSSPRTGIIDDGVQLISKALENVLKG
FT                   LRARAVDVTVRVDARSARGRAAEPGAPSPSILARFRELDFSDDGADGEGAATTREKVVS
FT                   VEGLEVDVVEDAVRGEGTKWRRCVGGGGGAGVDCVAAAKWSWRSEDAAASFAAPDAIAA
FT                   SLTLSRAWVEASPARLEAVARVAAAFQPPGVEEDEPVANDVDDDDEFVSPESSFLADIC
FT                   DDADSSEEEGIDQVRQGMRVRMSQYLDRRATERDGRDSDEDDDEVSTELTLTIACPGVT
FT                   ATAVYDDDDVDDDSEERETFPTTEHTCVDLIGIDATVSSGSEGVSFGLRVDELDAREYL
FT                   RRPTVAASALGWLPNGVHDPFEPSRRGGLHRAPLISLSPTHACHDGDGIGAATFAYKSP
FT                   GRGGGSEPRFLSAALAPALIWIDAGLFERTAALGQALDRAHDERSGRQRRRGGDGSSSD
FT                   DDDDDDDDDDGSAVGGGWRIAVNAALARVVACAPSFDGDGSHRHRCVALDIVHDSAPDA
FT                   APAFVALVPSPDDDAADGTTFEFADVVRAAFYAPPATERDRTDADDGPPVRPLLELESP
FT                   SHEARREGDSDSDADTRRVAVAIRVKGGGGGLALGESRGLDAGTTCLDVYRAVKARADL
FT                   AVSNPDSDSDPNPRTHPREDGIESDDVVRVVEQVAAELLRAILDQIEIDVTSPRIGLAA
FT                   SPESIARASEAFNAFAALPRGHPLSCAPPAPGTPIIPVAFRASAGEVVAEVWTDGDPCW
FT                   EAGTRRGDGAAAMETSMHGTMHGAASAMFQSAMSFLRESTRGGERESMDVQWGESMDVQ
FT                   WESTDGSVPPARVAVDDRRRRDIRGATVSLANARVFSATAMCGDPGANLLTVNAEGFDL
FT                   TRGVPSDPRVGPVLTARDHDALEGEPGLTVVHAAAPGVGGAAYASVSGAVAKIARGRGV
FT                   DSGLEGVLEDLRVAAADVVAAAASKDDPGDEETLPYHASLDVRESAVVLVGVVGGDGED
FT                   ATLDGGGATLDPKPKPLTLNHGVVRLDVLRVAVIPGESTGVEGVGSESPSHPASRGSHL
FT                   KHRALVEGIAVHVARPRAIASSPEGYADDADLNLVGLPGFPCTSDALVAANVVRVARET
FT                   SVLAEGRTGGGCAAIVALNATNLRCDFHGDSLNATLDLFDAMTSAGPTVEPPREDDDEE
FT                   REPSSFDASPRRREFDNAPAAAAALSQPSVRVAAGRAVLDAVDEDAFVIERGDGCSGRA
FT                   KSPRLGGVIEDYASISKGADGKVRERAAAQRLRSSRHTPSKSPPPPLTIAESPSSPTPA
FT                   FAKSYAEAVCKSIRYVSPETAATEAMRAMRLSQSQSTLAMGRSGTMMGSYMASSHLAHA
FT                   GSVGLPPRPPRSPKPTGAPKATSRLRSNGTESSSTEPLNATRPPPRGGSAEHRAVWFDG
FT                   GAGVAVIDDHVSIPSTCPSREVPGSTPFLPQLPRDGSTPTSSITALVSSVEVNARSGSR
FT                   WSPAHSAVSDVECAGARFVAKGAALRCDELAAGPVAWRAAASIADAACVDLTPPPRCRW
FT                   PKILAHDANVPRETDSAMFRLDVSAVRMDPAGAGSGATELRLKVALLPVHLRLDQHALR
FT                   FFQSFASRGERVKDADDDSDDEAIVDADPVTDATAAFFQLAEIRVPSVRLDYVPRDVDV
FT                   AALRAGNLGEALNLVPFGGVVVRLQPVTARGVCGWSKLSELAVRSWLEHVASTQAHKFA
FT                   SGLAPIRSVCNVGTATKALVTTPLEFRRAGRRGGAWRGAAHGAAEFVKAVSREALGLGV
FT                   TVAAATNAVIGGVEDAVIPRRAPREEMPEPNNLREGVRQAAATLGRGLKKAAAAVKDGP
FT                   VRVRRLGGDGTAVMASAVRSAPTAAVAPVAAAAEAVHRTLLGARNQFESSVDGTRRVTF
FT                   DFSGERDGDLLDGEEF"
FT   CDS_pept        complement(665150..665809)
FT                   /codon_start=1
FT                   /gene_family="HOG000100126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636805"
FT                   /orf_name="MICPUN_62573"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66510.1"
FT                   /db_xref="HOGENOM:HBG557557"
FT                   /db_xref="UniParc:UPI000199C304"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC3"
FT                   /transl_table=1
FT                   /translation="MSATSFAHTMSVALAPARGRGASKHRRASRLASSTRDDALRAILR
FT                   LDDAAREQLETSVEGRRVIADIPLDVLAARVRVFSRSLPPACAGFVFDIITERPGLLCD
FT                   DEFASTSVATAASVLGGDEKLGELCEECAPACAHVIWEIGCLGKSREGLARSLREWVGR
FT                   EEGWHRVFVSRVASQWGYLRTMQRTETTTMAGKGEVYRNVRTGESVTFREQTKHSV"
FT   CDS_pept        665974..667284
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636806"
FT                   /orf_name="MICPUN_103118"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66211.1"
FT                   /db_xref="UniParc:UPI000199C305"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC4"
FT                   /transl_table=1
FT                   /translation="MTEVASPSAAAPPPPPMEPRAIPADDEALIRSLVEDVNQTASKIA
FT                   RRARGEPPQRFGGPFSVAATPQATLSGLPRFAFTPNLSARSANPGPPPRFDAATRAELD
FT                   DKHREIDNLTRTVEAMERELSRRDVETKTLRRELATAHAEVEERDAQIAEVCAEWERNL
FT                   TAAQKSRDADVASLETRMRHLSDVELAALKAQVEDAEARAAKATARAEAAEARAAAAEQ
FT                   ETRRQVAERDRKFALSAEDFRRVIQERDARAAELSQRYAARVAVDERAHKRTLETLRAA
FT                   WDDEREEMRVEMQTVTAGAAAFVRREVLTRHGLSSSRPDGAIFDEDAVRRMLRNPTGGA
FT                   DDVGGGDSAIPVVIPVGAGGAGSNSLAFQAPPPAPTADAQPEVPDARGVLEARASAPAR
FT                   TTSAPADVASARPKKEKSGSFFSMFKSSKKSGMKLEK"
FT   CDS_pept        667356..668015
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636807"
FT                   /orf_name="MICPUN_62575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66212.1"
FT                   /db_xref="UniParc:UPI000199C306"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC5"
FT                   /transl_table=1
FT                   /translation="MSQARVLAFWSISVSASMLAALASSVNVPMHAGEANNDTASSATF
FT                   AREDRTTTPAPLCTFEAEIPSQCECVAALRLSDAVGSVGAGAMIGAVVFVARSGLNAFF
FT                   CDEQINFNDEEKESAAAVPLERLSLCLECPPAPTCTLTPGCIHLVHAAEKIREIRAEDD
FT                   ENARPAIDLGRLTVKTPEPFNFGAAVRGAANNAVKAAASVACILAYAKLQRTRPYK"
FT   CDS_pept        join(complement(668670..>670249),
FT                   complement(<668306..668627))
FT                   /codon_start=1
FT                   /gene_family="HOG000216640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636808"
FT                   /orf_name="MICPUN_75213"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66511.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG512104"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="UniParc:UPI000199C307"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC6"
FT                   /transl_table=1
FT                   /translation="RGLSDKLYEKRKTAALEVENVARAILRAGDRAKLDALVSTLVNDF
FT                   VAMPMPNHRKGGLIGLAAVTVALAGTADSKLDDIVPPVLKCFTDTDQRVRYYACEALYN
FT                   IAKAARVAFVGHFPEVFDALCKLSADNDPNVQNAAHLLDRLVKDIVTESVEAFDVAKFA
FT                   PMLRERIGVLNPYVRQFLVGWITALDSVPEIDMLTHLPDILDGLLNMLSDPNREIRQQA
FT                   DGALGDFLAEIRGEGGRAHRGADLGALAAILVGRCGGSGDEFTRVTCINWLREFVSLAG
FT                   DSPRLVPHFASIIGAVLPCMSRTEAKVRETAARASEELLASTTAAAKACARGIGEIESA
FT                   DGLDLPGVLAALKKHAGEGAKGPTRLEALRWYAALCDGSPETVRRLSLDASGVGALDEL
FT                   LASLGHDSDEVVTRAMRVLGSLGAGEETDFDVVVRRVVTVFASDGGDLLERRGSAVVRT
FT                   LCAELGAERTYCKIASIVREGGLVSGDEGRELDFAAAMVEAMNLILLTAPECAGMRASL
FT                   SGLTLSKASTLFLALYPCWCHSAVSTVALCLLSRAYAHAAHVARSMGDAESEVTVRALV
FT                   QIDQLVHLIESPVFANLRLRLLEPNAHPDLMRGLYALLMLLPQSDAFRTLHARLGAVP"
FT   CDS_pept        join(670632..670682,670789..671130)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636809"
FT                   /orf_name="MICPUN_53411"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66213.1"
FT                   /db_xref="UniParc:UPI000199B952"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC7"
FT                   /transl_table=1
FT                   /translation="MADMKRPSSVTVSDEPTDGPTTPESKAPPKPSKEWAEPDHPGPLF
FT                   IAKPRTPNGSFASDTVGVYQRVHYPNELPYVEKATPAAEGPDYPWLTSFQRKQMGIEDH
FT                   EGIEIKGRRNPSGGFFSTSDVASKVK"
FT   CDS_pept        complement(672239..673813)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636810"
FT                   /orf_name="MICPUN_109168"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66512.1"
FT                   /db_xref="HOGENOM:HBG609333"
FT                   /db_xref="UniParc:UPI000199B953"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC8"
FT                   /transl_table=1
FT                   /translation="MIIVAILGARATEATLPAAGAASDAEKTRSEFSRRLQMAREGEPA
FT                   REVDDYHYVFSADCKPYMEWQSVALYYSWVSAGAPGRFTRLLSCDDPNYPYVNSVPTHV
FT                   TPLYTNIDPKDPYSAYNLPGSMMHWTQHNRTDRKWIIKLDADMIVRKPLSVTDGLEAEE
FT                   GLVAAGIYGYLHGVDNEMAPMFVPADVVPRLAKVGGWEIFWASDLVKAAPLWFEYTKRV
FT                   RQDPRAWWPFKGTGDVYITKESPRPWISEMYGYVFGTAMAGLRHNVEPSAQLYAGMAPW
FT                   DQDSFDPFLIHYGLRIDIGDWNWDKHFELQGTAHRDKLNCELPYYPFPMVPKKHWPGSH
FT                   HGTLFQPGQEEARRVEIVMELMLALNKGIRAWRHVHCGEPWPEGLSSKGLEHIVGEVTD
FT                   DHAEHRAKGDGHEFERRRQHPREKSEAEMAHLEHVQAATKAKAGEDSASKESKPAPVVG
FT                   GRRAGGGFKGRNVKDGMANMWLYFSFGWGLVLTVMARYLFCPPSAGKARRKGRSRRHEI
FT                   PNRYYTS"
FT   CDS_pept        complement(674102..674938)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636811"
FT                   /gene_name="LHL"
FT                   /orf_name="MICPUN_104970"
FT                   /product="Light harvesting like protein "
FT                   /protein_id="ACO66513.1"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199B954"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEC9"
FT                   /transl_table=1
FT                   /translation="MATIATSSLTSRVRVAPGARALSPSAAAPFAAPRPRGSLVIRADG
FT                   GSGINLGGFPYIIARKAGFDTSEGIAGFTPFAELFIGRTAMGGFATGIAQELITGDGIL
FT                   AQLGVRDLPNEQIFDFFVATLALSTVAGVWVTFRQLVAGEMSPKQFKRYQKFLGLTAKD
FT                   EAARLNATREAQEKEIDGEYLATEFKAVAAAAIDGPGPSMSVDEELQLTPKQQADGSMA
FT                   YLKSVELNNARWAMVGFAAAVVIEAKTGLSVFDQLVMWAKMTGADVSVLDSFRQLY"
FT   CDS_pept        675242..676057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636812"
FT                   /orf_name="MICPUN_109170"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66214.1"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000199B955"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED0"
FT                   /transl_table=1
FT                   /translation="MAQPTLTPVYHASGWYTDVCVCCNCCSKNGDDFVECDLCCAAVFC
FT                   PCAVLNSNVKMLQTRTYHKPCDFECTKPCGIMACLTVTSGIIQTIGRATGVFLDLVNLG
FT                   PLYSFQWRSALREKYGIAGDPCSDCICHFCCNPCVLCQEHIELRKRNGGTGGLPPHAVV
FT                   MAQPYAGAWTQTYAPGGQVMPATAYGGPPGAGGPVPMYTATVAPQGPPTVFQQPGGGVA
FT                   MATLSADQSEQPARPSADPYGQDPYGQQEPRRAGAYYPEYPSSGKAQGG"
FT   CDS_pept        join(complement(678086..678562),c
FT                   omplement(<677027..678028))
FT                   /codon_start=1
FT                   /gene_family="HOG000155510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636813"
FT                   /orf_name="MICPUN_86278"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66514.1"
FT                   /db_xref="HOGENOM:HBG609308"
FT                   /db_xref="UniParc:UPI000199B956"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED1"
FT                   /transl_table=1
FT                   /translation="MSFHLLPHLLAGPIVDETASHGIVGTDAAALKIRHGLNDDQADAV
FT                   ARALIAVDEAGKAFATPSLTVSPVRLIHGPFGSGKTSTLAAFIVSAAERLGESKSNARI
FT                   LVSAHTNVAVDRVLNALKLRGFTDFIRVGALRRIDHSILPHSLHLADRKRSGDADLMEM
FT                   LKEAKTEAERRLLAAELAATKAGAADKRARALSKVRVVGTTTASCGNAALEGMTFDVVV
FT                   LDECSQMTEPSSMLAMSRFGCRALVAVGDPKQLPPVLDSKDSVDDGSLNPLAKGIFVRL
FT                   RDAGHSATLLRTQYRLHPTLSQTPNNCFYDGKLMDGCTPADRRALVTVGYDGPPLSPLV
FT                   WIDSGSRDVTQERGSKYSPGEARFAALIAARIVELGVPAGEVGVITLYKAQERAIVNNL
FT                   AGIMSREAVREVIEDDDRAGEDDGVIKVSTVDAFQGQEKDVVVLSLCGVNGGSVFVTPE
FT                   RVNVALTRARRHLIVLGDSKAPGVSKHPAWGSCLK"
FT   CDS_pept        complement(<680746..>682304)
FT                   /codon_start=1
FT                   /gene_family="HOG000176635" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636814"
FT                   /orf_name="MICPUN_66518"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO66515.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG512879"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199B957"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED2"
FT                   /transl_table=1
FT                   /translation="KRQLVGVTPDRFEELVTQLKWRTFAEGDGEALYELGVGDDGEAHG
FT                   LDDSAFTESIETLRKMASAIDCDCSVAHERRTRDGKRCATCLIRAKTSARQHKEIRITT
FT                   LGNVDSGKSTMLGVLTRGGLDNGRGLARGGVFRHKHELESGRTSAISQQIIGFAPDGSV
FT                   VNYHNPEVRETHQLTWTQIVSASSKVIHFSDLAGHERYLRTTMHGIAGVQPDFGMMCVD
FT                   ANRGGIVGMTKEHLSIMLGLKVPFFVVVTKIDMAAAENRNATIDALKKLLKKNKTPLLV
FT                   KDERDVMTSVQNVAGGVITPIFQVSCVTGEGLDLVRTFLNHLPSRRSFAPLAGNEALVH
FT                   LDDSFAVPGIGTVVAGLVVSGTIETKDELLLGPNGNGEFIPVAIKSSMNKRVPVDRVTC
FT                   GSSGSWALKARKAGQHVHKDDVRKGMILCAPSLNPRACWQFQAEVVILSHPTTLKLGYA
FT                   PILHCLTVRQCARIVKMEGKDVLRMGDRALVTFEWNHRPEFVKVGTRVIFREGRTKGVG
FT                   VV"
FT   CDS_pept        <682626..>683034
FT                   /codon_start=1
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636815"
FT                   /orf_name="MICPUN_76821"
FT                   /product="Predicted protein"
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /biological_process="positive regulation of translational
FT                   elongation"
FT                   /biological_process="positive regulation of translational
FT                   termination"
FT                   /biological_process="translational frameshifting "
FT                   /protein_id="ACO66215.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006452"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045901"
FT                   /db_xref="GO:0045905"
FT                   /db_xref="HOGENOM:HBG526951"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniParc:UPI000199B958"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED3"
FT                   /transl_table=1
FT                   /translation="AVKKGGYCMIRGMPCKLEICEVLPKATANGNKRLHIRGPNVFTGK
FT                   PYEDTLNLTAGFHGIDVPVTIKAQYSLMDVDSDTGFLSLLTDSGDCKEDVGLVKNEDGS
FT                   FDELGQEVISKFEAGEALKLTVLSILGKDVVI"
FT   CDS_pept        join(complement(685732..685873),complement(685271..685644),
FT                   complement(683158..684933))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636816"
FT                   /orf_name="MICPUN_62583"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66516.1"
FT                   /db_xref="UniParc:UPI000199B959"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED4"
FT                   /transl_table=1
FT                   /translation="MGIPANFGILFTIFPRARYGQGDSLGARIKNRRSEKPTIHVDPPR
FT                   QSPPETQHTRADRARESDEALTERRNEVTTDSEPFIQKTMTSAEAAAEAPRVSDRAQTA
FT                   GIEKSKDAPEFADADRDARTTPTSAHATGVKAREGQVESSDSDSNQDGERNGVKHGDEG
FT                   RRHGEGAKKRDKGHESDGSGASGSLHPSDMRREGSSDDEDPPCPDEGEVKLSLEPDDLA
FT                   GAKPSLRLDRDELAVIANTKEWSEEAKACLEEYRKKVDSGFNPFDDAFPLWRKEQFMAA
FT                   TTSPDPTRKETYAAINAAIMEEARKERERQTKANGASDVNDADANANVAVVTKPDADED
FT                   EACTLEEKLPGRLTGAHKGPDAAPVVAPASDDPFLAAAASAAAAHKGKRNSRSLMLGRR
FT                   WYDSSLYPTPGGAAKPADSNKTDTTAANEPAPIADDGSKPPKNNGDGSQFRRPPKLILF
FT                   PDGSMREVGEDGAAQQPAAAAAEDDGLTRINSGPRATPRDSANSENMQYTLPASHRGGP
FT                   NQVRIAPQPAALTQHQQQHHQQQHHQQQMMNWYQRQPAQQYQPPVQYGWPAGAPHPYPP
FT                   AQNPQQVQHAWQSYQSMASQHAMMSWMNAMWMNAMAATNAQQAQAEGEQPGSKKGKAVT
FT                   FAKPSGSDGSDGGSGGSGGSGGSGGSGPSGGSGGSGGTRGSGSSGKDSTHKLDGAGDKA
FT                   DFRLPSVSSDDTRVGSAGGKAVPTKGPRSKRPNPNDKKAGGGSPVKRRRTGKVMSDAAD
FT                   CLQLLSEGAR"
FT   CDS_pept        686117..687970
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636817"
FT                   /orf_name="MICPUN_103124"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66216.1"
FT                   /db_xref="UniParc:UPI000199B95A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED5"
FT                   /transl_table=1
FT                   /translation="MDDDPPDPFSPDAPGPSQRLPGDVVTPRTASARRALREHELALRA
FT                   HESGTAEYRRMLSDAEQGMEKLLTMNAALRRELELERRASTGVGRADGTRDALLAATLE
FT                   DSRSRLRETEVQLERVTDAFEALKRERAEATAVLQSNAAVRKALDAERVQLEGAREDLT
FT                   SRSAEVATRAHKVRSEAAQHRAALDLKIVSRMTREDDAAIAAAAFAALSGLEEKLLELE
FT                   RFASRPAPEPPDNGGANRPGIAHAVAAERAITTEGEVRRVQELNVELRDRIRTLEVDLQ
FT                   MSRAREASAVEGARLARDFARAEDEVREATARPEVEALRAELEKANEAVRRSEAHALVA
FT                   AKRSHEADRLEILLAERETEIRRLRREVSERATGEESLARPVEALPSPSPRKSRPGTAD
FT                   GATRLRGGRAPAWAVNDETIIEDATESRDFRDSGDDSGDDSGDDDDPEYVPAHDLDPVA
FT                   ALEELKAHRRARRAVRKLRRWEAARDIVPVAPDREPDGTSVSVYRPPAPARGGRSRTNL
FT                   NGEEPVRRQVQGSAGPGFRRQVPFRPAGVAGLELSRGLSTAIGQARLALADAERELTEA
FT                   HERRMSARRQRESVARLYRGGHARTSVARKEPAPPWAQRRP"
FT   CDS_pept        688462..692997
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636818"
FT                   /orf_name="MICPUN_62585"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66217.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199B95B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED6"
FT                   /transl_table=1
FT                   /translation="MGYGDEALYGKELRDALGSFPGGYVANGGDAGLAADHGKSNLANF
FT                   QIRGVAQLDASADVYLDGNATDDAGDSENDDTGPGVDAHMFDDLPVDTSQWSDVMRRRA
FT                   NGAPGDFAFNPQPVNPNAAQHIFARRFSGAGASTPSTEDLRITTVTPPPIDGEDDPPFA
FT                   PHHQARTPSSREVLERVRARTPASTEPWAMATAAAAAAVQKAIERQEIAIQARIRGVEL
FT                   AHDADEALDRAKEAAHLSAAIRRGETKPVPKNAVPASVMKRLAAERREREKKRKGSPEG
FT                   SDALDSPASANGKLGSGKKGKQVKAARAPPRPALDIKNDPKAAEVAKMWRKAAELDACA
FT                   VCGEPDPDHWDAKDEIIFCDGCDLQVHLSCYGMRRVPEGEWMCVGCTDGLDVGKARLGQ
FT                   FGVCALCPQPAGALAKLDPPSAWDVAWESPGTHAHIACAECLPEVFIIRDKKNKPPLID
FT                   MSFVKGARMNLRCSLCDQEGACTQCAMKKCYASFHPLCARASGFAVERHVSDGRPMVFC
FT                   KTHSGERWLEQRRVTAGKPAKDLFAKTEGATAQAAEAAEEAAVNAEVIEEDAVGVGVGK
FT                   SKFLSLNGTVDAVKPEPEREESGDGYAAAAAATATRLWEGFAPFIADKRERSRFGKVAR
FT                   KMMTDSGMDQKECGRLAALDASAGEAEASRAVCRAERAVAASLPPETPPTLAPGVPAEV
FT                   AANAAAAQSMPWRVLRAHQRAGVDWLSARHLAGVGSIVCDRVGAGKRLTVLSHLMHLRD
FT                   SMGVKGSHLLVCQPEAIAAWTSELNRWCPRLRAVTLSCPADERNPAKAAILRAGADLII
FT                   VPTNVLVEAKDAAAKAAEAAEAAEAKAAEAAEAAEAKAAEAPVETDEARAAARAAEDEE
FT                   AAAAAAEAAEASSLKKSKKKKKKKSTGGGGGHARKPEEDGVLPSSLTKLTFHTVIVDAV
FT                   GDAAEDALPELARSEPHARVKFSRAIVVARDTINARGGVLRAALSIMFPAVFDAIAAIA
FT                   REGDDSDDEYVDAEVLEQEWSVTAGALRRMTTLRRVADCDVGADRRRVDETVIVARSQS
FT                   SLFQERYSEVLGGCGGGDDAESRARTLKELGALCATDLDGSGKLRALDSIVPRLRVERR
FT                   AALVVSSSSAALDAAAALFEQRRVTHFRLDAPDVALGTRLHAVGRFPWSFKAGGGVRAL
FT                   LCSVAAAPDLTKEVVGKVDSLIVLDGADDAGVERVVHRLTGVGAAVSPESFDALTHPRP
FT                   TRELSVVRLAADGTGETRAFASVAEAKESFDAARAKASTNKSLDSADWAVARRGTSGAR
FT                   VVTLKEGLPVPLDGLFIAPTTGWFGAGEVDPVEAENDLEEDERAWATATARRKSRAHAA
FT                   SAEAALAAKEHDLTKYQWHERRCLNCRGEPERCVHIPPAFVGPDVAAKRLECRLCPRVM
FT                   SFGCAALTQTPRGGWVCPQHLCHGCGAVGADHPVRTDGSRRNPPPAAAVLLRCVSCQKA
FT                   FCDQCSGGAEFEAVETTPSGEWERNSFFLPARSYEYVTCQLCATKPMSTA"
FT   CDS_pept        join(complement(694213..694377),complement(693877..693936),
FT                   complement(693180..693746))
FT                   /codon_start=1
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636819"
FT                   /orf_name="MICPUN_95475"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66517.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG402643"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI000199B95C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED7"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRISKGKKGGKKKAVDPFLKKEWYDIKAPSMFTVKQVGK
FT                   TLVTRSAGTKIASDGLKGRIFECSLADLQQDEDQAFRKMLLKCEDVQGTNVLTQFAGMD
FT                   FTTDKLRSLVRKWFSLIETFVDVKTTDQYTLRVFCIGFTKRRMDQTKRTCYAQSGQIRQ
FT                   IRKKMNEIINREISSCDLKESVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKILKRPK
FT                   FDVTKLMEVHGDYAGEDAGAKVDRPKDLIEKVEKRDEVVGA"
FT   CDS_pept        join(694768..694867,694996..695060,695189..695261,
FT                   695400..696724)
FT                   /codon_start=1
FT                   /gene_family="HOG000165752" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636820"
FT                   /orf_name="MICPUN_107152"
FT                   /product="Predicted protein"
FT                   /function="IMP dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66218.1"
FT                   /db_xref="GO:0003938"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG298985"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="InterPro:IPR018529"
FT                   /db_xref="UniParc:UPI000199B95D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED8"
FT                   /transl_table=1
FT                   /translation="MTGLSNGHVGKRKAGDITFDEVDGFSAAQLFGQGVCYTYDDVIFH
FT                   PGHIDFPATDVDLTTKLTRNISIRTPIVSSPMDTVTESDMAIAMASVGGAGFLHYNMTQ
FT                   DEQVAHLKAVKAHRLGYVTRPEVRGPDATLAECDALATSRGFTSVVVTDTGIIGGKLLG
FT                   LVSSRDGDLVMDRSTKLKDVMTKAADLVTGKASDAIEKLEDALLASKKGKLPVVNDKGE
FT                   LVGLMTRASVKTKKLLPPPGAPSLDKKGRLLCGAAIGTRPADKDRAKALVAEGLDMVIL
FT                   DSSQGDSVYQIEMIKWLKDNLPELDVIGGNVVTQVQAKRLLEAGADGLRVGMGSGSICT
FT                   TQEVCAVGRGQATAVYKCANLASQFGVPIIADGGIQNSGHITKALTLGASVAMCGSMFA
FT                   GTTEAPGEYFYDNGVRVKKYRGMGSLDAMAKGSDTRYLSESGHLKVAQGVSGTVKDKGP
FT                   VMKMVPYLTHGVKQGFQDMGAKSMEHATELRNEGSMRMETRTGAAQKEGGVHDMHSYKK
FT                   VAW"
FT   CDS_pept        complement(696827..698110)
FT                   /codon_start=1
FT                   /gene_family="HOG000240746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636821"
FT                   /orf_name="MICPUN_86659"
FT                   /product="SWI/SNF and RSC chromatin remodeling complex
FT                   protein"
FT                   /protein_id="ACO66518.1"
FT                   /db_xref="HOGENOM:HBG557568"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI000199B9E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EED9"
FT                   /transl_table=1
FT                   /translation="MSTKFAEVAPRAGRGRGRGRGRRNYQEQQQKLFQEKVVASIPASA
FT                   VFTQLQEFERRVDATLARKKAEVNEALKSAPRDPRTVRIYVYNTWKEANPAEGEDASWT
FT                   LHVQGRVLAPHECADGTAGGDYDPETEPKFSEFVRSVEIRLDPAAPPPPAADGAAPAKE
FT                   SDEPIRWDSDKAPADAKPVDGFEVKRVGNTDRKAKILIAVKHEPERYKPKPELSRLLGL
FT                   DLETRPRLIAALWQYCRLNDLLDKEDATLVSLDDRLRSLFRKGSNGEKESAKFVDLCEM
FT                   MCAGCLDPAPPVELDYVVRTRGRKNPTHPDCYDLLVDVPGGDKAPHNFVEGIGRDAEIA
FT                   ALDAKIQAGIKKIERHLQRRSYFLGFSHSPVDFINTVVAQQARDIAIVRNDGRKRRLAE
FT                   RRTEFYNKPWVDEAVMQYVTRQSKAGKI"
FT   CDS_pept        join(698289..698307,698489..700686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636822"
FT                   /orf_name="MICPUN_62589"
FT                   /product="COMPASS/Set1C complex protein "
FT                   /protein_id="ACO66219.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199B9EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE0"
FT                   /transl_table=1
FT                   /translation="MNRAMEEVVPGSDMLEIIEEALQHGKATCVAFNRRGTLLAAGTSG
FT                   GSIAIFDFITRSVARELVPEAITNEDGTVEELPAVFSVAWSSDGRKLLSTAADGSVVVW
FT                   DVAESDLSFRATFDSQLHSAQFCPTNDSLALVCPSDDGPMTLALGRGRKRTPMPQMPGF
FT                   WSEDRACRIPSGGLDSAASQTPGCAAYSKSGRYAFVANNRGTLTVVEMGTMDIVQACRI
FT                   PGSEEGGTMYVKRLELSRDGARLLAVTTAKEIASYDVSDEVLNVNDNGTRILTPSPSLH
FT                   NPVSRSQWGAACFSHDGEYVLAASGGSPHELHAWRRETGTLVRILQGGAEAKGIAQLLS
FT                   HPNKALAIAVGANGQLYVWARRYAENWSAFDPTYVELEENVKLADDDDDEFDAIARNTT
FT                   DAFRRSLEEPEAVALDKAVEAAAAVTAAETREKNQSDFDDRSHAFEQWAAVREGTTAPE
FT                   RPTWRDPIMMDDFKRRSEGFDAWAREKEGVSLPGLPARNEALTLTLDELLGSGRSDAAE
FT                   DAAQRAHAASLKRSTAIKAAEEARRARVETAKLAAEKEAEEIRAEIIDVDAPCGGYYTD
FT                   EGEDCMHYLPLEQLEPQEDAVNVVQVRLERWKRKKMRLTASAEKRPRIEGEPDGEEQMG
FT                   DAVDVKEDVDEEEEEDDEENDDDEGDGDDDEMEEEDEEEEEEEEEDEEDEEEDDDEEEE
FT                   DDEDDAEDEEEEDEDDDEEEEDDEDDEEEEEVEDEDGVEDMDAS"
FT   CDS_pept        join(complement(701594..701770),complement(700757..701563))
FT                   /codon_start=1
FT                   /gene_family="HOG000009104" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636823"
FT                   /orf_name="MICPUN_98082"
FT                   /product="Predicted protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="ACO66519.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG732667"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI000199B9EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE1"
FT                   /transl_table=1
FT                   /translation="MRQAVTSEVPALATAAEYFFKVGAEGKRMRPTVLLLMASALTDLS
FT                   SGGADALSRARAASVPDDTRRRQQRLAEITELIHVASLLHDDVLDSAATRRGLRALNLE
FT                   VGNKLAILAGDFLLARASVTLASLRNTEVIELLSRVLEHLVTGEVMQMTAKPERLMSFD
FT                   HYFQKTYFKTASLIANSAKAIVLLGGHDTETASHAYDYGRHLGLAFQFQDDVLDFVGSG
FT                   SVLGKPTLGDLKEGIATAPVLFAAEEHPQLSALIERRFKHVGDVELAHDLVKRSDGIER
FT                   TKELAREHSALAVKAVEALPSIDCPHALRCRKGLKELAHMAVNRIK"
FT   CDS_pept        complement(702413..705949)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636824"
FT                   /orf_name="MICPUN_62591"
FT                   /product="Glycoside hydrolase family 38 protein "
FT                   /function="alpha-mannosidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66520.1"
FT                   /db_xref="GO:0004559"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="UniParc:UPI000199B9EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE2"
FT                   /transl_table=1
FT                   /translation="MRAAWLRLVAILAVLAAGHVLAAGGDDGRFGVAECTPSSPCVHLV
FT                   AHSHMDPGWRNTFDQYVIGSGNGIHRSAVLACARDPARRFTFGDAAFLVRWLESEGGEA
FT                   PPEDCVYSPTPSRGRDPCGTTWLELFRSLVRDGRVDVVGGGWVSHDEAVTPVHLAAAQF
FT                   DAGAAALRAVVGDDDWRPTVAWQIDPFGHAASTPAVLAHLGYKHVVVNRVPRGARREAV
FT                   RQRGREFVWIRAGSSRGQVVAHMLRRHYNVPRALDFTGERTDVDWASAAVALEAEAVAS
FT                   FEGLARGAGRAMMLVGDDFRFKDAERTFAAWETLLARVGSGDRGGDRDGGGRRAGPKGP
FT                   GKRSAFRFAWSTPAEYFAATASNPVELPRRVGSFLPYADNWPVSENAWVGSFVHRRELK
FT                   RAVVASSTAALNAGSLAALCPNGAKDVERIETSRAERAAYLGLHHDAITGTCPKSVADD
FT                   FTSWARKGEALAEDVTARAAARALRCDVGAEHSWRTEPDVGAAARLREPGDAVAVHNPT
FT                   GWVLPYAEVRLLVGRRVKIVDARTGRAVPTQERRTDGVRFLNGLLRSPSLADGEEDDDI
FT                   DGLSETVVALTDLPPLGIVRLAAVAVGDDEMKTTGDVGGYAKAPRRDPAVTFESDGTAA
FT                   VGGVKMSVASVASPADERFGDGPYVSRSGLWHVLPVVCGALVCFVNVTFAAWVAARALG
FT                   KRRAAPRRQRRRGLLDGASPVKSSKPRRSRVRGIGVYGFLATFAARARRFNRYSLAERS
FT                   TRSKPLATRVARRFAAPAFVGVVLVLAAHSTAFVSDASHGSIVRGGYRSGAWIGGVAGV
FT                   VNAARSRGKGTMGGAAASGCVAALAAFVTLARVPSLSYRGMVGHGLIAPRCFAGEVYTE
FT                   CIARFGAVANPSLPSAVLTVRERAGRALETERGSPSREPPPIEVEWAALAPEDVEIVAR
FT                   VVPSNGAASRGLLVDDGIGVTHHAWSSRRGWSVPANEVPSGAFVALSSDASDADVLGLV
FT                   LSPGSAATSVAHVNGGAWLGVHRQAVNDDGHGLGAARRTLVDESPGALSFLVARGSVAS
FT                   LRRLAAESSRPPTAAALGGDVACELAEWSPVAEPLPRHVEVLAVTERAPLGWRIGGDEG
FT                   GGRGGGFCPLWFRVRDAREASAAAGRDGAEGATTAAALERSLGSMGRIVMQPSSLLPGE
FT                   IGYVLVRRECER"
FT   CDS_pept        complement(706093..707034)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636825"
FT                   /orf_name="MICPUN_62592"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66521.1"
FT                   /db_xref="HOGENOM:HBG557571"
FT                   /db_xref="UniParc:UPI000199B9ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE3"
FT                   /transl_table=1
FT                   /translation="MTPEEREEQAMDMVIRLATTINAYEEVAFTSKSTNMGTYVYEKLD
FT                   AIPEEFRPRLMDELSDVGLVNCWYIAGLLYKVKFQEREAGGALDISSDLEDYQERLDAT
FT                   VEQAAVSGADFSLDESVDDDDYADDEEGRAAKARRAAALVASAAGVQVFEGRAANVPGG
FT                   PFVNRFQKVFYPSPKDVGVWFGRVVLKKPGFVEKYLPLYFRTNDTVERFVKVPATAEDA
FT                   DLLLDYQNPPYLEADMPPAMRYPSRRTPGAGAEGTWWPEPKLAIPPFDTLVDYLRPLGP
FT                   GVYAGRGWRDGGRGDEFLTFILFRRYDAPPVE"
FT   CDS_pept        707632..710679
FT                   /codon_start=1
FT                   /gene_family="HOG000218168" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636826"
FT                   /gene_name="SECA"
FT                   /orf_name="MICPUN_103130"
FT                   /product="Type II secretory pathway family "
FT                   /function="ATP binding"
FT                   /biological_process="intracellular protein transmembrane
FT                   transport"
FT                   /biological_process="protein import"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66220.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017038"
FT                   /db_xref="GO:0065002"
FT                   /db_xref="HOGENOM:HBG284200"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="UniParc:UPI000199B9EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE4"
FT                   /transl_table=1
FT                   /translation="MAQAAAAAPAIAARRAVRGTALRGKSASVRPTRSGRGASLECNAF
FT                   LDQLKKAADGVLKGDPGAKTRARYQDRVDAINAMGPAMSKLSDDELRAKTKELQAKVKN
FT                   GANLDSLLVESFALVREASDRVLGLRPFDVQLIGGMILHEGQIAEMRTGEGKTLVSALP
FT                   AFLNALGGKGVHVVTVNDYLARRDCEWIGQIHKFLGLKCGLIQAGMAEAERRENYLCDV
FT                   TYVTNSELGFDYLRDNLAQTPAELVLRDFNFCVIDEVDSILIDEARTPLIISGMADKPS
FT                   ERYIQSAKIADALERDYHYKVDEKQKSILFTEEGYEACEELLQVTDLYDPRTQWALYII
FT                   NALKAKELQLKDVNYIVKGGEVVIVDEFTGRTMVGRRWSDGLHQAVEAKEGLTIQNETV
FT                   TIASVTYQAFFRAFPKLGGMTGTAETELTEFNNIYDLSVAVVPTNREVKRDDAEDVVFR
FT                   SESGKWNAVRTEIARMHKKGRPVLVGTTSVERSEQIGELLDEDGIPYELLNAKPENVER
FT                   EAEIVAQAGRRGAVTIATNMAGRGTDILLGGNAEFMARLRIREALMPRIVMPEEGDIAF
FT                   EKKNIGGANADRWKVKDGLYPCDLSAEAEKLVQEAVDAAVASWGARSVEKLEAEERLSF
FT                   ACEKAPTEDEAALKIRAAFNKVEAEFEAVTKTEKVEVVGLGGLHVVGTERHESRRVDNQ
FT                   LRGRAGRQGDPGSTRYFLSLEDNLFRIFGGERIQALMSAFRIEDMPIESGMLTQSLDQA
FT                   QKKVETYFYDIRKQLFDYDAVLNSQREKLYFERRRALAATPAQLEQLMLEYAEQTVDDI
FT                   VQANLDTSVDPAEWPLEGLAGKMAQYCYFMADIDEADLRDKANKGGYDGVRNYLAKRGT
FT                   DAYRTKREEVEAIQPGLMGEAERFFVLSQTDNLWKEHLQAIKFVQQAVGLRGYAQKDPL
FT                   IEYKLEGYNLFVEMMAQIRRNVIYSVYQFQPKRVKENPPEAQPKAEAGAAESEFPEMGD
FT                   GQPVEEDKELATAKAGGSRKKGKGKK"
FT   CDS_pept        join(710904..711178,711240..711969)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636827"
FT                   /orf_name="MICPUN_62594"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66221.1"
FT                   /db_xref="UniParc:UPI000199B9EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE5"
FT                   /transl_table=1
FT                   /translation="MGRLSRPSSWVVFVPLLFALLSSSDVAAQAPGTLSDTVAELQQAL
FT                   SELPNGLGPEIQALMAELGMTQSETHYRPFFDLTTGEKINGSIALIRYPTEMNDFELDF
FT                   LKLTHSLDPTKSHAMMVCGHARPDQCRETVPHLGADDAHPCGASDASDPAAALASGFFC
FT                   ELLNATTTTTHGEVLVYGKEKIEFLEQTHAEDLAAGLTPQLPVLHLEIVEIEDLLEGLD
FT                   LDYEDYDFGIGPSAAPETSGPVGSPSPALAPEGSRRRVARRLLRIGGIGRGGFRGGVGG
FT                   VGRFGGMRVGMGRRGRRGVGNNLATQQVLRSSYYGNPGTSGQIAYYGTSTVGK"
FT   CDS_pept        complement(712284..714461)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636828"
FT                   /orf_name="MICPUN_62595"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66522.1"
FT                   /db_xref="UniParc:UPI000199B9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE6"
FT                   /transl_table=1
FT                   /translation="MDEEAGKDAAIEAEKQRLQMAAVLYRALRSAEDDLVNARPPTRAQ
FT                   LAEACHSKLQYDFPIVNAAELDALTEEMAAEIAEGTAPGSFTYPITSALVNAAVEGACK
FT                   PAPGAGSAPGISGKSREADSDRDLEDAGADGAGTEPAVDGGAVRIAYQRLCATTLVHFT
FT                   SRVLAMPDDEAEVALRWFDGFDTEETAPDAGDGAPTYDEADARAPGEDDGREPPGSHAA
FT                   ANPPNDASDSDSDWEPMETDPTEDERRARDPAQPAVPVPRLGAKLSVDAKLSHVLRRLS
FT                   RACVDGDDVWRHSPHAALPQLAPALVSLTETLARSEGRPERRAARVAPLRVLREQWAAN
FT                   GPPPRSDGSIGRLLAALGFESSRHGGGNIGAVMERLGLDEDARGGDEDVGLALEFLAYL
FT                   CVRLGGEALGDFASAAQSSAGKRAGFGVGAAGHLWGHVDAHIGVVAEKFDALAHVKATG
FT                   DNSWQQRVGMCSLIVAFHAAKAPGNANPGDVLAKTGALRALCAAFTAPDNATAPHSEAL
FT                   RRAVLLVAAAAPKTVEFIAAVPGVRSEVESGFRVESRDEFRGTEGSLAAHGAMWELLLP
FT                   APGTSREDAERSCAARLAPLLDPTRGGVGGGSSIALGLLRAAQTAARGATPLWRRGGAI
FT                   DGVLRDALTHLAATVSAGARARGGVVGSSRPRKTTGSDDEGDDEGRRGGDDSAAASDPE
FT                   MEKSREMASAALRVLKEILGAADGGGGRKCD"
FT   CDS_pept        join(714558..714691,714818..714869,714990..715454)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636829"
FT                   /orf_name="MICPUN_62596"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66222.1"
FT                   /db_xref="InterPro:IPR010441"
FT                   /db_xref="UniParc:UPI000199B9F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE7"
FT                   /transl_table=1
FT                   /translation="MQATTSEYTEGGFVVRAPPDRTLRREVLKWIQGLDLSHSLRNVRR
FT                   DCANGYIIAEICSRYFPTEVSMHSYANGTSTKVKENNWDLISRFFVRTMPKIALDPGAI
FT                   EGVMRGSPGYAVDMLEMLYTKFTLKKLPSMVPLMDDSSYGGPLDLSVQRNREVSVKGEL
FT                   SPGHRKPQTLTRRGDGAAAVKFQGIKTLPQETAAAARKRLALGVMLDADEDAY"
FT   CDS_pept        717811..720420
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636830"
FT                   /orf_name="MICPUN_53423"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66223.1"
FT                   /db_xref="UniParc:UPI000199B9F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE8"
FT                   /transl_table=1
FT                   /translation="MDTTVAVLQVAEQQLFESTAKLDDDALCALTKALAWASSAELGRL
FT                   GGGGGKAPVNGSKERLFMLERLVDVALINSGRIHKVWSDVEAHLLSCIEKEPSAELCRI
FT                   ATASLARLCVSALELPRTPEMDSLASEGETDFETAVLRPVSTLMARAVSPDARLAALDV
FT                   LVSVVNGGDGIGRAWFSVLRALRGVAERGGEGIALAFSGVKVIVEDHMEDLPDDVSGEV
FT                   IAAVSAFVAQRAQVNISITAVSLAWTLSDYFSRKVTETKVGKEALAERGMIPLLSVMRD
FT                   ASMDPRPEVRNGACRTITSTLVSNGDKLPARIWRGAVFDICFGLVDDIRAATAGASQEE
FT                   QVAPDIGELDGRKIQMLVHHSRNSARKQWDETETLALSGVGRLLRAHFDAVAKFDGFDK
FT                   RFEWYLQWVTQSVAQGSPEVSCSAVKSLQTVLEAGGSTGMTRARWKKATKVLMTSAKGM
FT                   NAAGSKISGKTRYEFIDVFGKVWASKRAVFDKEDVQSLIGVIDMLARAPDEWLEKSAPP
FT                   ARAGRYSTLRVQRRCLELLSDLPPLDPAAVDSGAYPQAICQLLAYVAEALGGEVAEAVA
FT                   KADFAYPGTETQHGSMSLGFAQEACEALAKIYQSEHVPKDDRAMTFAAATRVISAAMTH
FT                   AEEGTAVAEASKELRGAAAKTFRAVVTGGLAAVTRSSAFEFRAASVADAWDALSTAFES
FT                   TLAGERRDQNLDRDMIACMAEAVSPHCGFADEHSRRRLIAAVAADSSVSRIWALSALHF
FT                   GGGQMGRIALQSLVPTCEGILRACDEPEKVACVLDVASSLARDPSRRAESEPAPQSSSL
FT                   LGWIKKTVAGEERNDLNHLRAILGALGPCESSSDDVIRMKAEKVRRELTDAVEIRKE"
FT   CDS_pept        complement(720443..721876)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636831"
FT                   /orf_name="MICPUN_109173"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sigma factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="ACO66523.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016987"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniParc:UPI000199BA80"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEE9"
FT                   /transl_table=1
FT                   /translation="MTTQLAEESIAAELRDEKGAGDPFSVDFGKKKKKRGPTSGASSLA
FT                   VTPGIGRDTSSPTFRRELARAMGFTSPAQLKERVDAGQEARRVLVTRNVGLARTVAADI
FT                   HAKLNDADRGLLSVSDLMQEGCAGLATAADKFDPQRGYRFSTYAFFWIKKAVIDCVGNS
FT                   GRTIRLPIHVNENIQKMKKATRELKEIKVRDPTEDELADRLGWSVVKLRQMKVWAFRTP
FT                   VSMDATTAKKGDPWEDADDAVAEAASLNAAMQSSDFGTGLNAPSDTAEADVDADLLRMA
FT                   LEEVFSTLLPREAFILRHRFGLAAASTAMEGGDWLKASRAEVLSALRDDEGMGTRGGAN
FT                   FKTLGNLLGVSSESVRTYERRALAKLKQPDRIALLLPHLNMEKDNIKLNDTEEFVEALN
FT                   VAIKEADDKTGGKVRASLCMIPRVGVEGAKEEGKKKRPKRRGPRKVKQIQSESAQAAAA
FT                   AEEEIETENAAAKESIIVS"
FT   CDS_pept        join(722851..722906,723012..723414)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636832"
FT                   /orf_name="MICPUN_62599"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66224.1"
FT                   /db_xref="UniParc:UPI000199BA81"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF0"
FT                   /transl_table=1
FT                   /translation="MPAVVATNVRVTLAGVKSRRGPLSIARAVVNPRVKRRATRVISRA
FT                   TEEGEEKAEEAEVEGSPEERVSNAMQEFAEAGFPSDEDDAKDPVSRTKAMNSAVDDLYS
FT                   LMDSEVQVLSEAFDLLEQLGVKGLEKPPKSLRRDDKKETIELEKDEDQ"
FT   CDS_pept        complement(723515..724555)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636833"
FT                   /orf_name="MICPUN_62600"
FT                   /product="Predicted protein"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66524.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="UniParc:UPI000199BA82"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF1"
FT                   /transl_table=1
FT                   /translation="MAKTMAQLSAATNRMVHRVQAYRAKAAARKQGGKLLLQQLQDESG
FT                   AKDPSLVPGIMITPPPDPRYSTPTLSQTLKYKIFGAPGPIDPATGRVEIPDPVAAKASM
FT                   WYKVKGSRRRTSQQMAVKLGKAQKHHDEDFELLWAGVQRQELLLNKIKTDGKRLAAAIQ
FT                   EQADAAKSMASHIASLAETSIELGEGPEADARRAVVERARQLMEVMDVMDQDVRPACLE
FT                   QLGNSVNKPVGQLCEEFPAYQQCVDKRTHYMLDMDAYERKLQKARQFAKDPAKVPHREE
FT                   QFTKAQRRYTYFSDKLVEDLTLLDANRYELAGFLIEGFVEMQEFQSQRQKDVLAGLAQG
FT                   KLPPKQ"
FT   CDS_pept        complement(724644..725084)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636834"
FT                   /orf_name="MICPUN_62601"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66525.1"
FT                   /db_xref="UniParc:UPI000199BA83"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF2"
FT                   /transl_table=1
FT                   /translation="MATATAGEPTATSQPSPLAPGSRSPASWAAFPIFRAVGYFFFRQR
FT                   PKFLLALTFTLTCHSQSPHPRLAPRLGAGRVARREQSRRPGQLRLLPCRGPARRARQEL
FT                   GQPAAEPFLEGALRGPAVPGASRGHLGRLERQRPDPSHLPWR"
FT   CDS_pept        join(727115..727816,727883..729223)
FT                   /codon_start=1
FT                   /gene_family="HOG000030333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636835"
FT                   /orf_name="MICPUN_86310"
FT                   /product="Guanylate binding protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO66225.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG557581"
FT                   /db_xref="InterPro:IPR003191"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="UniParc:UPI000199BA84"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF3"
FT                   /transl_table=1
FT                   /translation="MKRTVSVLAVLTLLVASVGAVPHADDADARGPRSLLQRLRSGGTV
FT                   PRRYGGHEVNTDGRAARSGRRPFPIVLPSETERTKLTLQREGLDVLRGIKGPIAPVVVI
FT                   GPYRSGKSFLLNQMLGVSCGEGFGVGHTRKTETKGVWVWGEPMMVDGDEVNVVFVDTEG
FT                   FEATGMSDAYDDRIFALSSIMSSVLVYNLPETVKEGDIEKLSFAVELAQEFYTRASAKG
FT                   GGDGGGDGAFHALASFLPRSLVWLIQRDFLEGSTVNQMVKEALRSVPNPSRDTHVDELN
FT                   RIRESLRALAGNSTAFGLRQPHLERTKLCELRDDELEPAYVAQRDQLKGIIASSAKAKA
FT                   HVDVPGSAPSLGNSGLMTGPSLAALIERSVTALNEGDFPSAGNVVDSFNRDALERHMAS
FT                   YASAMDGVRLPVDEEALTSTHRLAAAKAVKDFRRDRFGRGAVTTAALRRKLGEMLEQRK
FT                   EKNAFLSGKECETLATTCEEELVSLQTMRLPSLRKFDTSSKACEDRWSKRCVGPSRETY
FT                   GARIKRSMARERSSFLQNYNARLLNGLLMLSIGGIVTFRFLYTSALGELVAWCLFISLE
FT                   VGPKLYLGGDGMFESRWWTTAVQFWEVAVYNQLIDMDKVGPVLLCVALAALVYVRVRRC
FT                   VQWLNGCCPCIVRNCCCTSLLGIPNARPKGKRKTDVSGRTRDLDV"
FT   CDS_pept        complement(729310..729720)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636836"
FT                   /orf_name="MICPUN_62604"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66526.1"
FT                   /db_xref="UniParc:UPI000199BA85"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF4"
FT                   /transl_table=1
FT                   /translation="MTSTQGSSYDWILGEDADEDLEPWQRVLKENAKNAKVERFLELLR
FT                   GILGPDELLNLAGLVRDMDVQHVQKLYMKQWQEHQMAASGGVPPMMDPAAMMMGHPPPM
FT                   MPPGFVPGYLPHYAGFPPPGAGVPPPRPPPPQ"
FT   CDS_pept        729865..731772
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636837"
FT                   /orf_name="MICPUN_62605"
FT                   /product="ChlRe radial spoke protein 7-like protein "
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO66226.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BA86"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF5"
FT                   /transl_table=1
FT                   /translation="MTVDPVLADPIPVDHFLAEGRRKLAEKYLDTKMVAFRFEGEMDPD
FT                   PIQAPLTSHHPMRDVVSAMEQEVYAFRPELIFPFMRDALARFPARLPPEAAYQGPLNDD
FT                   EYDEKVQTCVARLVECVTLERPEEPFEWLDAWLEEEARLEEEEAERSAPTLEQSVEELD
FT                   MASMTTDQLASFAMDVFLRFDADKNGVLDVWEFKEVLKSTALNFSKEEIREIMAESDAD
FT                   GNGIIDYKEFLPMFVELVTSLKSAQEIKHLRDEEREETREEVETLFIKGMTQEELERKM
FT                   QRLFAMFDEDGNGTLDPEEFQRALNSADLGLSRKEINMLLGEADVNHDGCIEYEEFVPV
FT                   AFRVLVDRARNKQLENEALASEDGITVLLIDAFSKVDPDGSGVLHVQDVKKCLKRLAER
FT                   EEIQLSRSQIVSIIADCDVNPDDGTVHYLRFAPVASGVIHGMIDFSAQKLRAEAVASLA
FT                   SEDTNVGLMRGMSNEEVERIMLRAFQAADVDHNGGLDREEMLVVLKSVGAEELGLELHQ
FT                   ITALMVSADEDGDGLVDYRELARFIYDTLHQLAREDMVRDRAFRHAAGAIKSREEILDV
FT                   VDDSIVISELSGGVAQAPGESRTPQWQGPDGVYAVGGRDGISARRRQTDDRHMVDRTHS
FT                   "
FT   CDS_pept        join(complement(732235..732308),complement(731834..732107))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636838"
FT                   /orf_name="MICPUN_62606"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66527.1"
FT                   /db_xref="HOGENOM:HBG744640"
FT                   /db_xref="UniParc:UPI000199BA87"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF6"
FT                   /transl_table=1
FT                   /translation="MSFAVASTATLVTATAARPERASTRGIAARNRVAASIAPRSVKVS
FT                   ARASRGFRVVAMAEKKPKILRENEKEAWLSEMEREGANPFKDPMAIVGILGITFPFVIL
FT                   AVAGAAGYIGQ"
FT   CDS_pept        732599..734692
FT                   /codon_start=1
FT                   /gene_family="HOG000184070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636839"
FT                   /orf_name="MICPUN_62607"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66227.1"
FT                   /db_xref="HOGENOM:HBG618072"
FT                   /db_xref="InterPro:IPR018816"
FT                   /db_xref="InterPro:IPR019134"
FT                   /db_xref="UniParc:UPI000199BA88"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF7"
FT                   /transl_table=1
FT                   /translation="MGSKKKSKKEKKEKKSKSKSKKKRSRREPSSSSSSSSDSSDSDSE
FT                   NSEEQRRHRAAKMAKKLAARLKQGEIAGYTDNVNPFGDANLTERFVWHKKIEKSLVNGV
FT                   DPKELGLKAEKRRHEERLKEIEKVKMQREQRDRERMEKEEEREIMQREEALIEAVELEK
FT                   KEEEFHLQQAKVRSEIRVREGRARAIDLVSRNLHSEDGDEFDESVHPLAIFDGLTLSEM
FT                   DELLNDVKTYLDLDHKDERHKAFWANMLVVANAELDEARRRDEYERARSRGEEAFGAMM
FT                   PNQGVHESVEGDVREMLEGKTRVELEELEGDVERQLATGEESEYWIAVLQRVKVHKART
FT                   WVDDVDAGLRSKRAALAPRDVPPPPFKDGRAATNQPPTTADDSDDEDLLGADFGKAAAD
FT                   AGNASDYENEDGGFSPRAVSPEPMSPAGGTPREGTPTRSFSPEAIRAREDEPDYLDVVD
FT                   EDEDRRELERLRALQRAKKLGRFKEAAGPGATAGATERATFDAFKEGAQEAAAMSGAVI
FT                   QNLTADAGEAVEAARAKEEANARASRALAERMMGDGAGEVAFAGEAPLESQVYWWHDKY
FT                   RPRKPKYFNRVHTGYEWNKYNQTHYDHDNPPPKTVQGYKFNIFYPDLIDKSTAPTYTIM
FT                   PDGSKHGETCILRIHAGPPYEDIAFKIVNKEWEYASKKGFRCSFERGIFHLYINFKRAR
FT                   YRR"
FT   CDS_pept        complement(734898..735224)
FT                   /codon_start=1
FT                   /gene_family="HOG000243213" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636840"
FT                   /orf_name="MICPUN_109176"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66528.1"
FT                   /db_xref="UniParc:UPI000199BA89"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF8"
FT                   /transl_table=1
FT                   /translation="MQSGLRGFAARAVRGVQRQQQRRMGAGPPGGYFAEGVQGEGHVNG
FT                   RLFNETPPPPGQSRKWEDWEAPWYATMAAVGAILVFGLSAKPETSGSEWAREEAKRRLA
FT                   ASGK"
FT   CDS_pept        join(735506..735644,735783..737716)
FT                   /codon_start=1
FT                   /gene_family="HOG000265767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636841"
FT                   /orf_name="MICPUN_86194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66228.1"
FT                   /db_xref="HOGENOM:HBG314474"
FT                   /db_xref="InterPro:IPR010490"
FT                   /db_xref="UniParc:UPI000199BA8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEF9"
FT                   /transl_table=1
FT                   /translation="MATQLAPGLARKVKKVLETRADTPETIACLKGLSEFYGENTPAAR
FT                   RGLRSSIERRGLDINREFLEASGQAQEALAVVDAQLEGLLSGCRRIANVLDKSRERTGN
FT                   LLDETARFNNNLAKIEERKKMLETFLVDYQLTDEEISALRTDDQITEKFFSALARVQEI
FT                   HGNCRQLLRTHHQRAGLELMDVMASYQENAHERLARWVQGECKTLAEEDGPDVPDLLTR
FT                   AMTALKSRPVLHRYCIEEVSRTRHNALFRRFISALTKGGPGGVPRPIEVHATDPRRYAG
FT                   DMLGWLHQAAAGEKELVAALLATEGDDGDEEKNGDEEKDGDKEKNGGEEHKEGAGVDEE
FT                   EEAADPEAVLDRILEGVCRPFKVRLEQALNASPTALVAYQLANLLDFYRETLGAIVGKD
FT                   ASLVATVEECRASAARTFEDQISRRAAKLREKPTRPPDTLAPPPFVAETVSLVRELLQA
FT                   RSDAVSGGDLDETYDAVGAVLDPAVEACERGAGAIAEALRPEESGGAGPTPATTNAAGT
FT                   VPPAYTARWAKEAYLLNCLNAMAAALGDFPGASAARDSLNSRVASLADTIADDEAGRIL
FT                   RSSGVAEVRELIALYQGQRTERGAMSRDPALELGVVGSALDKLVDEVSASPEPVPAFDE
FT                   VLNPRTRVDLRGTYVGKIIEAYTLVYMAVLDPNNGYRDAKSAIRHGPDALGVLLN"
FT   CDS_pept        complement(737765..738412)
FT                   /codon_start=1
FT                   /gene_family="HOG000190181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636842"
FT                   /orf_name="MICPUN_62610"
FT                   /product="YEATS domain-containing protein "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66529.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG748014"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="UniParc:UPI000199BA8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG0"
FT                   /transl_table=1
FT                   /translation="MAEDKPAEDAKTPDDSNLKRKKDTELVVPICYGTCAYWLGKKADE
FT                   YHSHKWTVYLRGPENEDLSHVISKVVFNLHPSFKEAQRTLEKPPYEVTETGWGEFEIGI
FT                   TVHFSDDSGEKSVDLSAPLKLYEESADGKQEKKEQKKPVIKEKYEEMVFHEPDESFLKR
FT                   VKSHKTKQAPTTEITPVLGKRDDTDELLRIATARKVVAERVSVLKAQLDALT"
FT   CDS_pept        join(complement(740144..740218),complement(738583..739971))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636843"
FT                   /gene_name="RSP7"
FT                   /orf_name="MICPUN_86323"
FT                   /product="Radial spoke protein 7"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="signal transduction"
FT                   /protein_id="ACO66530.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BA8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG1"
FT                   /transl_table=1
FT                   /translation="MSARYQKTFTIPEGFPQLLKAFTREILRNQPDNIYEFGAKYFEDL
FT                   IEENKRAAERESSPEVAADEGGGVEAGWWNMGDEELQDFIMDRFMEYDDDQDGYLDRHE
FT                   FKTLLMSTDLGLSPKDVRRIMSEADENEDGVLEYREFVPIMVELIHSIKAKEDAKAAAE
FT                   EDEDEAREAVEMHLLHGIPREQLEQMMFSVFNAADTDGSGALDRKEFARCLKSAELGLT
FT                   RKEINLLLSEVDADGDGMVTYDEFVPLCFNILVERFKDDVLAEQALNSYDDLTQTLLEE
FT                   FQTVDEDDNAGAATGRLKFRRIRHVLDAMSEEMLGLSRLQIASIMSEAKVDEETEEVEY
FT                   ATFAATAARMIYSMIDLSAQAVRVDAVAKVAETEGAEFLNILDEETIKDVLAEAFEEAD
FT                   KDGNGVLDVNEVQHVLKSLGVGQLALKPGEINAMIAAIDADEDGTVNYTELVDFLFDVL
FT                   NHLERERWIKANAFSDWYDVSDDGVGEED"
FT   CDS_pept        740564..741478
FT                   /codon_start=1
FT                   /gene_family="HOG000232930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636844"
FT                   /orf_name="MICPUN_62612"
FT                   /product="Predicted protein"
FT                   /function="tumor necrosis factor receptor binding "
FT                   /biological_process="immune response"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66229.1"
FT                   /db_xref="GO:0005164"
FT                   /db_xref="GO:0006955"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG557587"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="UniParc:UPI000199BA8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG2"
FT                   /transl_table=1
FT                   /translation="MSVCLPARANPGSLPAQRVAIRRGPTVRATRCSAASTSATSTSVE
FT                   ALSPEQLKRNILRLGALTDRGQLLFPQKAYAPLDMYNAKHKEEIIAAVEALAKTKEGKP
FT                   LDPALLNGEWECVLATKQIFRSSPFFMAIQDAFGDATFGDSKSSEVFFRLHDLQVMSWG
FT                   ASTVGRVAQRINLENETLESDFDTILFRSTVIPILGWFKLLPTFGGRVVSFAERVKLDP
FT                   ESGRIDLELMKTRVERKEGIPEPPLFLPWFLDRDYPVNAVWRLLPWNKGRAPTATTYVK
FT                   YVDEDFRVMVDRDGQYFVYCKVA"
FT   CDS_pept        join(complement(741679..742662),complement(741533..741628))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636845"
FT                   /orf_name="MICPUN_62613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66531.1"
FT                   /db_xref="UniParc:UPI000199BA8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG3"
FT                   /transl_table=1
FT                   /translation="MHSDKSPFNSAKSKRRRAWKVTPQLAMVRRQDLSGFDDAERYNLR
FT                   LQMRNRSRLRLFAGSCAIVSLVLVTYVTTEAWFVADWSGKGEGLSELDEVSHMAGSSLK
FT                   GLNTARDLISLKKHGREREELLAQVDRIEAIAQDGTPRASGKRPRKVGPKVETKSVQFS
FT                   VHIVVEHAAGLDMLMVRGSDGGEWGPVLGTAVTTRVTNSDVAGDGDGNPWNAKKAAAMD
FT                   DPAVRKAAADALLAQAGLDQPPEIEFMQLLPPRVGSSSDGRASYVALAREAQVSTGGLR
FT                   GDGSRSARKRIPLDAALKGQTGNAKIDAEKKKAVARSQDTMGSTSRIHRGEGPEGGVQG
FT                   STRCRRTRRGRREGGCAPV"
FT   CDS_pept        742736..743392
FT                   /codon_start=1
FT                   /gene_family="HOG000100127" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636846"
FT                   /orf_name="MICPUN_62614"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66230.1"
FT                   /db_xref="HOGENOM:HBG557589"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="UniParc:UPI000199BA8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG4"
FT                   /transl_table=1
FT                   /translation="MATACTNSLGHVGASRAAERLSSSRSSYVSTAPVSVISRRRVAKK
FT                   VETAITARLRPGRQGVQRIYRMATEKSQISVYEYLESIGVPRVNALQVQSRASEWFEFE
FT                   NAKAGGDKDAPFGVEQMAAVVDFLKQKGVGESDVGSLVCAHPPVLAYSVERRIAPLFAY
FT                   LDELGMDAERAVAALRKRPNLLGLDPDNNMRRMVDYLQSTGKTQEEALDLLLTSL"
FT   CDS_pept        join(complement(746008..746068),complement(743482..745820))
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636847"
FT                   /orf_name="MICPUN_62615"
FT                   /product="ABC transporter"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO66532.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199BB35"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG5"
FT                   /transl_table=1
FT                   /translation="MGKKDETPEERAARKEKEKKERKGDKKDKKDKKDETPEERAARKA
FT                   KQAAKKAAEEKAAAKPKPRGPPPGRPPPVLKGGRGGGGGGYMDDMDLPSSGSEDETEAI
FT                   VREEKEIVLGVKTEKEERKARQKELEAARKEAIAKELAMQEDDDAFTIRCANLSDEAKE
FT                   LMANSKDIKIDGFSVAARGKELLNNTSMTIVHGRKYGLVGPNGMGKTTIMKLLARRKLP
FT                   VPDFIDILLVEQEVVGDDRTALESVVAADVELMNLRKRKLELEAAMERVAKAEDKGGED
FT                   GHKEREAALADALAACQLSDDAETQGGRLGALAVKAAREEAAELTADNFDLADELNKTY
FT                   EKLDEKNDATAEARASKILHGLGFTVAKKDGTQTGPERFSMFNTTKSFSGGWRMRISLA
FT                   RALFIEPTCLLLDEPTNHLDLRAVIWLEEYLTRWKNTLLVVSHDRDFLSSVTTDIIHLH
FT                   DQKLDQYRGSFDNFEEMYEQRRREANKAYEKYEKQIKQAKAAKGGQAKNKQQEVKNQAA
FT                   KKLEKKNQKKGDKGMMQDDDNDGRGDSSAPTKWNDYNVEFHFPTPTELPPPLIGLTDCH
FT                   FKYPKLEGFALENLNLGIDMGTRVGIIGPNGAGKSTLMNLLAGDLEPTAGDSRRSHKLR
FT                   IGRYSQHFVDVLSMDENPVQYLLRSYLKPEGGSYKPEEIRAKLGKFGLPGHNHLTPIVK
FT                   LSGGQKARVVFTAIHLSNPHILLMDEPTNHLDMQSIDALGDALDEFEGGVVLITHDAHI
FT                   CSKVLDNEKSEIWVVDEGRVDKFAGDFEDYRNQLVKEISAELDDDY"
FT   CDS_pept        746243..747364
FT                   /codon_start=1
FT                   /gene_family="HOG000046974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636848"
FT                   /orf_name="MICPUN_86447"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO66231.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000199BB36"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG6"
FT                   /transl_table=1
FT                   /translation="MVLSWDKGPSEGKRQKVAKKPKEPKSETESYASLKLIQDAAKRIA
FT                   PFAKLTPVHTCTSIDDMMSDETDKIEGATVELFFKCETFQKGGAFKFRGAMNSILQLSK
FT                   ADLQKGVVTHSSGNHAGALALAAKTKGIPSYIVVPEGAPQCKLDAIETYGGEITKCEAT
FT                   VPAREAAAARIQETTGATLIPPYNYGPVICGQGTIGLEFMEQVPDLDVVIVPISGGGMI
FT                   SGIATAVKGIKKDCVVIAAEPVGAGAYAADTFESKKRKELVDDLPVPDTIADGLKAKMG
FT                   SLTWPVVRDKVDAVITVTEDEIVAAMKIIYERLKLVVEPSGAVGLAAAMSTQFKEFNRK
FT                   NPPWGKISKHKKVGVVLCGGNVDLALLAKLFAP"
FT   CDS_pept        complement(747382..748506)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636849"
FT                   /orf_name="MICPUN_53429"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66533.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199BB37"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG7"
FT                   /transl_table=1
FT                   /translation="MSERWANVDASCGPMDASYQELWGPAALARAQRNDLETPLENELG
FT                   LLRAMRKRCGPFASVGKMVTHLRSARGKLHWSVNGYFRETVLDAGGSVDFAPRPSARED
FT                   AGRGATDGEEEDVEHGEKGHEETPSLPSLVWEMLLSRVTLPDVCRLARVSRLTRDIARS
FT                   NAVWRAQFVARWGEPAACRVAAARFAKRRGREPRIFHGGEGFDGSGGGRPGFAAGDDVD
FT                   DDGVVPSSARNDPVADWKDEYRQRHEKERKMTCPECHAARVTPIVYGFPSPQLVTALKK
FT                   QKVLLGGDYLVEGDPSWACRACQSRWRAWPFAWPAVGPEQERLGIAPHPGLSGKSGCGP
FT                   GLGTDLDDAQPLPEWELEKPPFIRTYTDSEDGSQ"
FT   CDS_pept        748719..749798
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636850"
FT                   /orf_name="MICPUN_53430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66232.1"
FT                   /db_xref="UniParc:UPI000199BB38"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG8"
FT                   /transl_table=1
FT                   /translation="MASSCAPAATARLAATLPARRRTFARGLATRNDRRGGARPNRPGA
FT                   ARVPLVFATSTDPKAAAESVDGDIIANNAASLDGKLRTLVVGVADERGDELLAHRNRDP
FT                   GVLFRHQRWVDAYKLPGQYITITDVDSGKQITKPISVSPYHARSTAPNSDVSVIEILLD
FT                   SGSDDGDENFFAAAQPPARLKVSPVRGGGFENPLFPEYNLKRAIEHGHSIVCIAGGTRG
FT                   VGPLRSVMNWPDISSHAGTHPVTLFYLHAGDMETAGQSAAYVQEWDNWREAGAKVVPCY
FT                   GEFFDDGVFQMQAAIAGSANGGGKFETVLGKDPSKVTVLMAGVSGEESKAVLNIFSTLQ
FT                   KVPKEQILIVSEFALKKGK"
FT   CDS_pept        complement(749932..750345)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636851"
FT                   /orf_name="MICPUN_62619"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66534.1"
FT                   /db_xref="UniParc:UPI000199BB39"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEG9"
FT                   /transl_table=1
FT                   /translation="MKRSGSRKNDESDDRGAPWDDNIPTHAGPDGDPRSTMSAKERAAH
FT                   DRGTRRARITLVALVVFCCILKLTRPLYGPYIDRFGVNNDQSMMERFGSHLEERARRNN
FT                   LDLNPRPWGHKPDKDEDEAKKRRRFEGNRGTQT"
FT   CDS_pept        join(750601..751036,751130..751869)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636852"
FT                   /orf_name="MICPUN_62620"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66233.1"
FT                   /db_xref="UniParc:UPI000199BB3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH0"
FT                   /transl_table=1
FT                   /translation="MSNTSRPLGKTAPFLGVFLTTLIFLASGASAATCPTDGSAYDYSE
FT                   TVTGDTRTITYTACPNHAWKAINPNTAQYDGTQTIRVPAYPKIQNDGVTGVSTTSKRTM
FT                   DLTAKGGVVGIFFSAAALYSPYGGGKYGQVKGFDNSATNAEDLTVCLGIDSNQRGCHSS
FT                   QGSNSYHCHSAPTCLLQQLGQAANAHSPQIGWASDGFPLYGPYGKGGVAMKTCTVTGGK
FT                   FGTDVCTNDDGGYYGELAGVDSYKFRYYIQGPVCSDSCANPIKDLPGADYHPHSPTGFY
FT                   GCCPSGVTCSLAVAACTGTPADGYVSGFTPVAKTKLSTFCNACYSSGQGGSSVTTGSGC
FT                   SAKSAGFTLATCPADGTGVNADSPSVKSAAAPFTGAAIILNIAMAVFVTMM"
FT   CDS_pept        join(complement(755336..756162),complement(752948..755092),
FT                   complement(752656..752863),complement(<752010..752580))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636853"
FT                   /orf_name="MICPUN_75054"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66535.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199BB3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH1"
FT                   /transl_table=1
FT                   /translation="MVPMLKLFRFYEPADRAMLGVGILFCMIGGVAFPCINIAFGELLD
FT                   STASMSNIEETTKNAVMFMVGVALVLGVSLAAGFGLVGWAAARGASNVRRAYLKSMMAQ
FT                   DVAFFDAAKAGELSAATSEKVQILQNGTAKKMGELVQSTFTGVGGLAVGFYFSWELSLV
FT                   IMAGVPMLAGALYFLVKATTKLTAANPEYEKAGAIATESLTACRVTSALNAQGRVAERY
FT                   ESHLGDAERVATKNLWNISFANGGLFGVMFIMYAAGLWFGAYLISDSTNGAMSNSPCMT
FT                   GGTVIMVFFAVLIGGFSFGMAGSSIEAVIKARTAAHQLYEVIDRKPKGGDGADARTPTG
FT                   LALKTPVSGDIMFNAVYFSYTTRPVFRGIDLHIPAGMTVALVGESGCGKSTVTRLLERF
FT                   YDPSAGTITLDGVDITKLRINELRSAIGVVSQEPLLFNASIRMNIAVGRAGVKHATDVP
FT                   IAEIESAARAASAHDFIATFPDGYDTVVGGKNSKLSGGQKQRVAIARAALRNPPILILD
FT                   EATSALDTENERLVQAALDELVAGAHGRRTTIVIAHRLTTVRGADKIVVLGSRDAAGGL
FT                   AGGGAAEGSVVLEEGTHDKLMEIPGGRYRGLVGIGGSRGTPSASSVSLAGMDRSASQVD
FT                   LKAKEEEEEEEDKVKDSKDAKGAQKKGPKVKAARIWAYSEPEYPVLAFGGFIALANGCV
FT                   FPSIAFVFAEMLALFYSHDTDYIMDTAYMLGGIFFAIAVISWCLTGIQGGVFAVIGEKL
FT                   TTRLRVHLFRAILRQDVAFFDDPDNSVGALTSNLRTDTSTVRAATGQGLGSALQTFGSL
FT                   CFGLAVAMEASWKYGLVLLAAVPILSIGEMINMQNIATGEAVVSESLSRTAGHISETAT
FT                   MIREVKAFGMEGRMYDIYDSMLKAPHKEERNKALTVALAFGLAQSLTMLFYAFAFWWGA
FT                   ELIAKGELDFYDFMKSLWALGFCAAGAGQAAAFAGDATAAGSAAARIFSLIDRVPPIDT
FT                   RPGQGLIIPPEQFKGRIEFKGVKFSYPQREAAVLGGLDLVAAPGETIALIGQSGSGKST
FT                   AVQLIERFYDPCAGSITLDGVDIRDLDPMWLRQQIGIVEQEPTLFSGTVHDNIAAGKCG
FT                   EPATRDEVIEAAKISNAHEFVSKMPNGYDSEVGVGGGLVSGGQKQRIAIARAIIGRPRI
FT                   LLLDEATSALDNESERLVQASVDNLLNEENADKRTTFVIAHRLSTIRNATRICILENAD
FT                   GEGAKLVEQGTHDELMKIGGRYTAL"
FT   CDS_pept        756504..760964
FT                   /codon_start=1
FT                   /gene_family="HOG000265535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636854"
FT                   /orf_name="MICPUN_62622"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO66234.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG557596"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BB3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH2"
FT                   /transl_table=1
FT                   /translation="MAELEGFEIGDPVAELYERNLTSSSAESKHVTAVLEAVADILRQE
FT                   GIKPSPTAVFAASLSSLERANTEASPETSAAMLTVLGVALEHAPTGPVLSRLPHAMQVL
FT                   LATGRAAQEKPVALRGVVRCIGQLVAALRDAQDPGTNEWPHCAKAFGAISNLCVDSRPK
FT                   VRKQAAASVAEALRAVRGTSAAGPASRAFANVAVSIARAPVKAARELTSMHGASGAKAA
FT                   EQRAQAAAQESLHLLVALKLILGELDGSAAGEVAGAVTGLLDLAEPLLTQHACDALVAL
FT                   FQPTGASATAAAAAAAAAAAGNTGFGVPKAPRAAESVSSQAAATAAAAIGPLSTAAQNE
FT                   STRRPTLAVSLIRAHAAAVRRLHELDPAEAGARALPLACHELVKMLNAVHEGVAMEAGT
FT                   CLASLVTKCVDTNMVREGIKAMAAARAAGKSAPARPPPVIGVASALKASLGFRYRAAWP
FT                   VSLPVVAAAFERLGAAAGAILGGCLEALGEMGAHAEGLACRAQLTQCLAAAVKALGPEQ
FT                   VLAVLPLRLEEGIDAEIAAKSEDGRDVDEGMGDDDMDIGAGAELNEDGGNVAGSAGARL
FT                   WLVPLLRQALKGARISYFSEEILPVARRLGARAAQAKAAGRAFEAQRCAAGEAALWSLL
FT                   PSFCRWPQDASESFPGLAPSLGSALSARADLRGPLTEALRRLIQQARAVVNADKHDADS
FT                   DADEDVDEDEDDEDKAKAAAATAALLEDRPDWFTAQIAEGQAATVAKYARNFLPILFNL
FT                   FVAAPPERRGELSATVGCFAQITETAALGGFFRTVLRKLVKVTSDAEDAPDGLKEGGDT
FT                   RSARRCTFMDLSLAMVPGLDNAARDLVFKAARPAALEKDAAVQKRAYKLLAALMKPNVG
FT                   PGANLGGDWLSANRDAAEESLVEGSGMCAPAARRYRLRCVAAILPSLMEREAEKDSAEE
FT                   GVAMGAQGSSFAVLLGELIVATKETNARTRQQAFSLLVDIPRSMERKAGRAGGSGKIGG
FT                   GAGGGGGMLGAWLAEGSDEDEDEDAPNAANSDDDFEGMDDVNGEEMGVGVRKFFMTVLA
FT                   GVVGATPTMQSATIMALARLLYEFSAALVSTVPELLPAVFALMETGNREVIKAAIGFIK
FT                   VAAVRLPQTDLAAQLPTLVPALLHCCDDEDGFNRFRSKVRVVMERMVKRCGWDAVEAVT
FT                   PELHSALVQHMRREEVRTERRRKASVAGSEFGGGAKSLAGKSARTARKSAWNDEEVFSD
FT                   DDGQTMRTGRGGRSTVGGGGGRGAYSMAPTSRRDAGGGGPRSAAAAHALRAVGGARLPG
FT                   AASGTEPLNLLDESAMRRHMLNQRRGGEHDDDDLGGYKRDEGGRLVIVEEREGRKRGRD
FT                   GDDEDDFDDGRSVGGKSLGGVSRRTAKTMGGFTMRSGRSVRTNKTSRTTKSGQTVKTVK
FT                   SKKGEGKHSADRYRAKKGATGDRKNGALEPYAYWPLDPKMLNRRPSKRAKAGAGLAKVV
FT                   RNTTQLGIMTGQKAKDAKRIKSSKY"
FT   CDS_pept        761119..761523
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636855"
FT                   /orf_name="MICPUN_62623"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO66235.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000199BB3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH3"
FT                   /transl_table=1
FT                   /translation="MIDDDELDDLVLQGHGGAIADPDRHVDDPNEKKKEKLNARLKCEV
FT                   VKIAEEASREHGVRISPKFAQCLTELTSTYVHTLADDLAAFAQHRKGKVITHDDVLLAV
FT                   RKMPSVLEGVHAVLPPDLVAKKSRQPKLTL"
FT   CDS_pept        complement(761677..762447)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636856"
FT                   /orf_name="MICPUN_62624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66536.1"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniParc:UPI000199BB3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH4"
FT                   /transl_table=1
FT                   /translation="MDQYARAVAEYLKEHVGVQDVKYVQGKPATMSDIQAWEDANSPFK
FT                   LPEDLKAFLLSSDGFKMTWDVLFKQEVHHLGNMHINSLAEIKKMPMMLVPHDDADDDDL
FT                   LVVPPGSVWDPRREDDGARGPDGWKPPFPSAAFDLDSSVRHGRVALVFVPSFEASSSGP
FT                   NVGDELTPMRSVPHKAQVWFQDISTRWHIMADSFSEYYRLMTAHLGLPRWHYKLMDVGM
FT                   DRPTTQWFNFFRPELLAMDLDKGKLRRQERKRRN"
FT   CDS_pept        complement(762723..767099)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636857"
FT                   /orf_name="MICPUN_62625"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66537.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199BBDE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH5"
FT                   /transl_table=1
FT                   /translation="MGTSSSENNNSATERAGRTGSSSVTERKNRLAALAYGGAKVSLIG
FT                   KEKRRRRRSVDVPSTRAESTKDPPGVTDATAEGPSHRPRPPSTRSSGDHGDKISLRQAA
FT                   YRAISTRARAVEKVREGLRERGRLHSSPTPRRDASAVETPSSSPLPPAPIVTVEELPAG
FT                   SQESSARYDPIYVDSSDEDAPQKYSDDEDFEVEEVEDEEIEVEEEEEPPPVLNYRAPPR
FT                   ESPLKPVTPVTPTVEPVASNETKEEAPRNAHRWGVLSGTTSSTPIRSAMAARQDDTLPA
FT                   TSRFVSLPSLKPRQPQPRSSSRHDGSNESSPPSKQLVNEKLPPLSGRGTPTSVLKNQLA
FT                   AVAYGAMASRSLAPTPPSVKLPAPPTAPREPGSQQGVRAARVQQSTMIANDIYEDFKKG
FT                   FVPLRELVARKKAAEKKALPQRKPSSLGRNLWMVALSAVKWKSWVRRSRSDGVASPRRI
FT                   KSPVRLLSPVRSKMRKDEWARSLDRERKRMSLTTHRSESNTSREFAVVRPGAFGSEPEP
FT                   VSLGTAAADNRAAAAYSKTQIKILTKRDINRAGKDKDAKIETPRSSAKVVATPPQWIKN
FT                   PLAHSAAAARRRRFLTEMAAADADPELSRPSSRAPTRPSSPKLGKRNETPLDRLRGAVK
FT                   RLMEHNRNMKRKSLQSPQKRTPDRVRDAQQRAEWAQRMHTEDQAAARAAEHLRRKADMQ
FT                   SSAYVRPGAFGSEASPVQMGVAAANQRATSAYSMLTKKPTPRKLTLSPIAETKKPADSP
FT                   PPPKEPIASPLTQKLVERARRREAQLRRQRRKSKPKRKGFKSTSDSSVQGDEAAFSAGD
FT                   MRDIEAQYRSQARERPGQGRAGVKRGVKSEWAMSLEREMRMQNEARLREEAQKREASPE
FT                   HVPRVPGVFDATLTPVELGTKAAAKRAAAAYTTKRRRKKPEKDDDDAYSLNFDSDELSE
FT                   DFDSDWDDDEVYLSAELDAHFDNVSPIIRQPSVSPEPSLHNAFVRDIATDVLRDACEAA
FT                   ALDLAGEVLREARLSAALADILGEVSAAAVDVAELDSAFAHDIIYSALDLCDIEETVLQ
FT                   TVYDCADDAADAVEIDAVVFGQMERAVQACELDDFILDVVYDIVDTIPTTSERWKEDMA
FT                   FEAAAAERMAFVTKLKDKAASEKEKDRPTSRSTSRASTEMEELQQKLDALREQHKQAHE
FT                   NIHEKRRWGRYLEHTPNHMLRDRKFTLEQSESIWDEEPAVALRYRKNPLYDPILETNDD
FT                   ILEWEPNEPVAFVPPESVADPDESVDDLEEVTPDPRRQRAMARDELAARAYRQKQQLVS
FT                   SPRATPTKRTKLKDGLPTGLAIKRAERAERIAAKTRIAHEKALLAQGKRPPSPQPWEDD
FT                   ELEADLHEMFEEERRIREAELAEQVAEQHAAARKIQAMHRGRMARKHVQAKRAEAVARA
FT                   QAPEDSPGSSPGQENHSPGGKKKRKPKTTSRTKVTSPLESVYSASGIRRKVGRSLA"
FT   CDS_pept        complement(767414..767875)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636858"
FT                   /orf_name="MICPUN_62626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66538.1"
FT                   /db_xref="UniParc:UPI000199BBDF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH6"
FT                   /transl_table=1
FT                   /translation="MSWFYVAMQREPVVMWSCFIGFTGENPPNPFPRPSRLTPFRDVAH
FT                   TEGFFSSLHPIQLWGCSSRADDAARVTAAARRPDCPNTQTVTRLSSSSKPSHRPSSFSQ
FT                   TDDDFSTFASPSTGMMLPVVVPPIRDAFSGTKPKAPPSPHLVAKALTGK"
FT   CDS_pept        join(768215..768241,768356..768416,768541..768749,
FT                   769006..769032)
FT                   /codon_start=1
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636859"
FT                   /orf_name="MICPUN_106274"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66236.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG744999"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI000199BBE0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH7"
FT                   /transl_table=1
FT                   /translation="MKYVAAYLLAQMGGKESPSEADVKAVLASVSAEVDDAKLKSFFAA
FT                   IDGKDVAELIKEGQAKLASVPSGGGGGGGGGGGGGGGAAAAAPEPEPEEEEEEEAMDFD
FT                   LFD"
FT   CDS_pept        join(769397..769488,769591..771013)
FT                   /codon_start=1
FT                   /gene_family="HOG000029999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636860"
FT                   /orf_name="MICPUN_106275"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66237.1"
FT                   /db_xref="HOGENOM:HBG557602"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI000199BBE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH8"
FT                   /transl_table=1
FT                   /translation="MADGDQGMPLTFQNFLEKMRHPSASELVKSMQAFISSFGDAQMPA
FT                   NAQRDSDEDGRRIQAFLRDTEAAFRGHPAWRGASEEELEASGEGLEKYLTTKLYPNIFA
FT                   VVNEERTLDDVLGRRIAALRTFIRPEHLDIPECFRVEASLALARNELVKVNNFKAPRDK
FT                   LVCVLNTCRVINNLLNVSAGNRPAGADDFLPVLIYVVMLANPPRLESNLRYIARFRLES
FT                   RLVSEAAYFYTNLVSATHFLTTCDHSAFTNLDEDVFEAHMAAEGFAVGPDAAGSFDGER
FT                   GGDGATGGGAGEGRGGDTGARGSLAEKMLREGAPGATPPPAPRDVPGLPPRSPNGTASV
FT                   ALEKDRARLERELADAKRELAGANARARHPLRWSTVEDVEAEGAASLATENGAGTLRLP
FT                   YKFLYARADDLQVGDVPALLNAYKTIALQYEALSRGVGAVLADVTPNSAIRSGADVDGL
FT                   SMFANIGASSPAAEDVFAGMTITEGERHAGIEPEDPFARLEALTQR"
FT   CDS_pept        join(complement(772665..772725),complement(771061..772562))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636861"
FT                   /orf_name="MICPUN_62629"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66539.1"
FT                   /db_xref="UniParc:UPI000199BBE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEH9"
FT                   /transl_table=1
FT                   /translation="MDAAIRELCERVRLRLDRLKGRTWNGRDAELDAELSSVEYDINGA
FT                   EFLLKEIRAKLATSSTRNLPPVAAYRASLESSRRVLADIRRGEPRAHGGARGVRATRSV
FT                   GGSTRSMGGSTRSMPAGPLGRLWKGTVSFVKDLLEDPFLDPLLPPALLAAEAEKRRRGE
FT                   VPESEAMRDYRAAGERSVDYHVAAGYYGSRGPRAGAPSREEGGGREETGFDKQRRRRRR
FT                   NGKRTGNHTEGRDVSPVPEEGSPPSPDEGRAPVRVTPSPTDAAGESRDEYAESAWDEDE
FT                   QLMRQTRENARDEQAWIRALQGAGGGNKVGASYAAASAAAAAAPTVWGPTGRDVDDLVD
FT                   RYSNMAARDDPMMLSDASPGSTPRYSEAPPVFGRVEEANNQQKEVDTEASIRRELFMNS
FT                   SGADSRARARVAALGPTDGYPRSPFSGDAPPEGWVEEELMRGVERLERGREMLTDAQRV
FT                   AADANETGDAILGTLREQRDALIRSRAGMEGIKEDMKHNERLVNNMTSWTRLGVKSRRT
FT                   PWG"
FT   CDS_pept        join(773348..773434,773521..774225)
FT                   /codon_start=1
FT                   /gene_family="HOG000264429" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636862"
FT                   /orf_name="MICPUN_109180"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66238.1"
FT                   /db_xref="HOGENOM:HBG557604"
FT                   /db_xref="UniParc:UPI000199BBE3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI0"
FT                   /transl_table=1
FT                   /translation="MSDSLDAIRKAQEDRFFKLEQEKHLQAYVKKLKASGRFDQIPASA
FT                   PRTFSASALPQVLAHELRLSTPVEEVLERRQLDRSFMTRQIIKGVCTGDPYLINSVTLG
FT                   SRVSMGKNKWSAGTNTGIENTTIFSVHKAQDLMAETPKHLNGIESRAAKHMVDNSFVEI
FT                   GGKRIKLMPDPTPGRAMAWGGTLAIWGTAALAVGTCKVLGIKTMDDMKRVMNAQLSPLG
FT                   DAIRDRMTPFKSYITEAPLDGSPKVNTKDSRFAKGVKDIFA"
FT   CDS_pept        complement(774305..775213)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636863"
FT                   /orf_name="MICPUN_62631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66540.1"
FT                   /db_xref="UniParc:UPI000199BBE4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI1"
FT                   /transl_table=1
FT                   /translation="MAPTMVRHAVISLFMFAVAGAAAEPGVARARASEPTLVGVRSSHE
FT                   EYSHEETSTSLASSRVTTAQPLGLVPCDKPPAPPGCFILRTPFPPKYTKYPKGVRGAEA
FT                   CELRSPGLTVTLSGGSSSDPVDIPILYSHFDGVDVMFDVDIRAALVAEGVRAGDSRTLR
FT                   ASASLACPTDTFEDAAEELPANQVLRTGSGTGRLVFPFNFFLLEEMTILADSIETLVEA
FT                   VDNLEITVEGTDGSEEFLYGEGTDGSSGPHLYELDPSDEDTGGAGDMFGMFSDPEPAQR
FT                   PEFDLPEFDPPTFPWGEGLTA"
FT   CDS_pept        775417..781242
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636864"
FT                   /orf_name="MICPUN_103153"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66239.1"
FT                   /db_xref="UniParc:UPI000199BBE5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI2"
FT                   /transl_table=1
FT                   /translation="MRKGRSGSPMVGESTRTGRGGIPRSVSPAEAVAKARAKGKSGTPE
FT                   PTTRGVASRSRTPLSRTKSPGSSDANDPTSPKPTPRTPLTILASSPNVAHTPSSNPNTS
FT                   FGSDRTLSPGWGLFQGGDDTPGLSDSVVSEQADFLVEQIARGGIADDDLREELRSALKA
FT                   RRENTALRDHIERIKNEEVGMGLEASKRMAELSAEYMSQVDELKKEKEAARERAEAAEE
FT                   EAKMLAEMMRANGFATPPGAGLLERAMAGANASTATTSTPIAGPAALAFASPVMYDQPL
FT                   DCLMTPTGDFVFPGSGDSGGVSGLDLAEGAAAAIKSVGETPDAPPASSSFSAKTPSSDA
FT                   AQGAAMVAMASMDHPTLVKEASQLVAANVRLERERRALVERLESVTREAAAAASSNDAF
FT                   GITATPAKTDRPVDGVLPGTPGSIVLTPGGSAVDVAALVAFVDAFEVDGAAGSPPPGAP
FT                   ASWEMQGTSLAVDQLTEAIEKVKRAANEAVSLLDPDGDVDTSAASTPGGSTLNRALHRM
FT                   KQKAGVDPVHLEKRNKAHGLVLEVTQAAALAVMQRDHLAEVLASEREQAKIDAQESLAS
FT                   LRQALKQQRLISSNIVTTPNSTMKSVTIGDAIITPLAAVDTSQELTSAPAGDASELISK
FT                   LQREIADMRRKIASDAAKAEHERTELQYMSAEHERNASRLTAELEAATKAAEVAQDMAV
FT                   RRQKQAASLEAKHTRLSMELSATLQKLHEMEREALAEERKLSLSFRLNEHRGGVISDSP
FT                   LVGTPDSQEQTHMTLVGTPLDLPLIKTATKASPDSASSERSRSRADSPLVFSSLVRKVS
FT                   ATRSAVEAALAVAEEKDAEPAVDTDETAALVEELRTQLEAARAEVSDVHARLIAAEEKA
FT                   DVATMAAAAAEARVKASMKSPSPSPISAIENSPVVQDDVEEGVDEVSDNLGLDGDTYFK
FT                   DQDDDVSPESQRRNLSDAREAVTAAEAALTWARRGEAAAQAEADAERKLAAAARAEAAA
FT                   SASSLENVRSELVVARATATTAANKLAVAVADAENIRAQLAAAQAAEELLAEKVDKLQE
FT                   QLVEATAARDETERLVLEECESLRAQLEEKETELCELKTVTAPSDVTMEAEEALRTMAA
FT                   GPDDQEPAADADLARIKAELDATRAQLADARAETERVNKSMRQWKDQQTAAVARWREEA
FT                   SARTAAAEAAAAAANAKAAAAQAEAATAKAEAETASVIKHGDAHDPSSIASLLAENREL
FT                   IAEAERHASQYEMLEVETQELRARCEAAEESAADAPQLRAENYDLAVKHRAGLQRLHDE
FT                   LSARRQLEDRVEDYERATARLEATVGELEIALKEAQTMCAAARSASISAASDRAASEAA
FT                   AALMTPAKGVNGQSFNAESSGGSSSSPAYEGQATVAALAAAEAAKNTLSKAVEAAERAA
FT                   CEAREEAAQARAEAASAKQEAEALRVTAEQRRADLAVLRDECQSLRMKVLDMEEDARLS
FT                   PSPRKGGMRLMNGDSPFSSMKAYSRLVEDDAKQANDPDATALSISADTPMRSPAMIPAE
FT                   GGSMQALALTPPASDNVEEEKKAAASVKKLAVSLRSKAETLLAASSGASVAIEGSSSVA
FT                   GLNQHDHLTHSVSELVQTEAWLDQVIATTDRIRHENQTLKEALTEARKMAEDAFEAAQA
FT                   VCADAEGANDRCIAAEARATAAESRADELESATVESESALAEARTQLMQVKDDFTKMSA
FT                   AQFEELRKKNAELAEAQEARRVAEAASVKMASEVAASSPLSLTIRKPASTALAVSPSTA
FT                   QFGEALRTHTVRLKDDVLRAQAEVAAHKEHAKRMQREIALLQSDVPSARARVLEQQQLR
FT                   LGSSSDQNKLSVSPAAGTNIPPTPPPVDVEATTAANTAANTQASSRAVYYKSIAKKCYT
FT                   RMKQQKDAYELQISGLRKQLEFVSNGSVNMTNLSFASTVAGGPSPARGKHGVKFSPDVD
FT                   DATLLHDL"
FT   CDS_pept        join(complement(781954..782032),complement(781341..781888))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636865"
FT                   /gene_name="CBR/ELIP5"
FT                   /orf_name="MICPUN_62633"
FT                   /product="Early light induced protein-like 3, chloroplast "
FT                   /protein_id="ACO66541.1"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199BBE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI3"
FT                   /transl_table=1
FT                   /translation="MSAFTVARNPVAFRSLTTNVSRGRSSVAAKAGPNEIVGETAFWTS
FT                   KSGQAMRGTAAEYEAAKEAGDTYLASTATGVLPEWAAAAGADSTLKYSLAEAFAFKTPE
FT                   GANFLASGPELMNGRAAMMGFVAAAGAEIATGQTISQQFAEAPFGVLLTFSMIIAGSLF
FT                   SYTANMEAPAAGPFTKEKELLNGRAAMVGMGIMLAYETVKGSALL"
FT   CDS_pept        782509..783249
FT                   /codon_start=1
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636866"
FT                   /orf_name="MICPUN_109182"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO66240.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG657462"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199BBE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI4"
FT                   /transl_table=1
FT                   /translation="MAPIVDLDPGLVSKYDLPRSDKQDYLFAKGMAQGMTGYEMAVKLR
FT                   KQRLFAEVFARLPKGVEATVVEVGLGTFPNASYYFDGEVKSGPSSLDLVGVDPNDAMES
FT                   YATANLAKARTSGSKLDANLRIVHGVAEALPLPSKSADAVICTLTLCSVVDPERAVAEV
FT                   RRVLKPGAPFMFIEHVLSEDDPDLAQLQLRFNAMQIAMADGCHLDRKTLDVIEKAGFSS
FT                   VSAERFSLPGFGLISSQVAGIAVA"
FT   CDS_pept        join(784760..785404,785520..785591)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636867"
FT                   /orf_name="MICPUN_103155"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66241.1"
FT                   /db_xref="UniParc:UPI000199BBE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI5"
FT                   /transl_table=1
FT                   /translation="MAIEDMVDIALETGAVDNRDDPPQSGARVEGDGPTHTGDSTPLVS
FT                   SMQTVGGGMVAFEFSSEGVIGDDMVLDDDRWRWRHTVSYWVCVCYILGSMLFVAGSAFW
FT                   YKHYVHESRERALVVYPFLLGSILFTLGGYLGMFQAINLGRRGTSKLWEWSPEKDGFLG
FT                   YWFYFVGALVFNVSCIEPLELFADWPDWLKREMAWGAAEVGSLCFIAGAFVERRRLADG
FT                   IRRRRAGCTPPTSSGR"
FT   CDS_pept        complement(<786246..>787085)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636868"
FT                   /orf_name="MICPUN_70979"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO66542.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199BBE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI6"
FT                   /transl_table=1
FT                   /translation="VAGQIAGMVGLMVVHPIDTVKIRMQARVSAPPVSAVSTVSSLMQR
FT                   EGPMALYRGIGAPMVAYGLINAVAFTTHTEVVRLLRGELGGSGGSPLLKDPYLIGLAGG
FT                   AAAGFTSSFVRGPAERVKTVQQVAESSCGTGKVPEKYRGTIRTAATLAKEHGLLKGWFT
FT                   GTGATVAREIPQCAVYFLTYDSIRHACEKAAGPGYETAGIVLAGGSAGVVQWVATYPLD
FT                   VIKSRMQAFPPGTYNGFLDCAMKSLRAEGPGVFVRGLEMALLRAFPLHASIFLTCETI"
FT   CDS_pept        787344..788780
FT                   /codon_start=1
FT                   /gene_family="HOG000100128" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636869"
FT                   /orf_name="MICPUN_62638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66242.1"
FT                   /db_xref="HOGENOM:HBG557609"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniParc:UPI000199BC80"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI7"
FT                   /transl_table=1
FT                   /translation="MPSLARLAPARVVARPTLCVKSRRGVTGVSIDDARGGTRPAICFP
FT                   TGPIPVGPRARSPIAPNRAVGPEAVTAAVTTVDAFGVSAEQWELIEGNLFGASLLPYLV
FT                   FLYYLGMPESKMPPRALFGFKFLLVFVFGTIPCAIYAKLVYNDILANVDWLHGPAESLL
FT                   TITNLLIVIGLREGLRDLKGGDGGKRSKVSSVSGALLGWSAAATTATLAAVAAGAGGGV
FT                   GNVAEAAESAASIAPAVGDVAASFFRHAEPANALSLPTWVIHVSSLIEWLVAMGLIWEY
FT                   ADATGNQKYKGLTWGMVPCHASGIAACTFHLFYNSPALNSVVATQAGLTVLGNTTIAIA
FT                   AYRIAIEGGAKNTLPWEEGFVAPWKKNDPIGATTDAKVDEAGAEDFAANIEEGATAKEG
FT                   GLAGWEDLGKVWAGDSDLVLILKLALVSTVVSAAVKWGSLEVDFPFEPSVWLAFTLIFG
FT                   PTALNMIKWQQISAEERAAR"
FT   CDS_pept        complement(788842..790041)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636870"
FT                   /orf_name="MICPUN_62639"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66543.1"
FT                   /db_xref="UniParc:UPI000199BC81"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI8"
FT                   /transl_table=1
FT                   /translation="MRSDESSRARDGAPVYEYEDEPSALDDDDDEQQPWVQPELYITTR
FT                   PFRKDRSFIGRLPPSAKDALYTGGVCHYLALYRSERGELWQFDFGPFGGDVASRFLNDT
FT                   GMATGQKEEGSGGATPGHVREKLIDEMPQGGGTYLVGTTDLTLDEIREFNTGRNTMYSV
FT                   NKNDCRHYVNDLCEYGTGVDNVCSKYIRGEVWGKKILSPVDDSGENALDQERRRRATEL
FT                   AVLLPILAVTDLDNVPIWDRVGQASTAAIIFGVGVRCIPPALMAAAASVAARMGGATAS
FT                   SAASTGATIGMAAAKAGAATEAGTILMRVASAAQPLVAPLSRRLITTGAGVVGGCKDDI
FT                   AANIRRGHERAKQALASFRGSLLKREGDVTVTKGRSASVIPTVGWAGGKLASSASNQKR
FT                   "
FT   CDS_pept        complement(790367..790855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636871"
FT                   /orf_name="MICPUN_62640"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66544.1"
FT                   /db_xref="HOGENOM:HBG608954"
FT                   /db_xref="UniParc:UPI000199BC82"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEI9"
FT                   /transl_table=1
FT                   /translation="MGKKKAAARGGVSKRTPSKGLSETGLEAVADDAYEQMEEAEAAAA
FT                   IAGGGARTVNPELQKRLDLLAELSRRGDIRGFVRVFVPHDLTQDDTDYFAGELEGDETR
FT                   WQQLAQEVQLIADGSKVLKIVGDQTTRAEFRYLMPNQALAIQREVVFYCENGDWRAEG"
FT   CDS_pept        <791106..>791810
FT                   /codon_start=1
FT                   /gene_family="HOG000182512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636872"
FT                   /orf_name="MICPUN_72406"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66243.1"
FT                   /db_xref="HOGENOM:HBG716164"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniParc:UPI000199BC83"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ0"
FT                   /transl_table=1
FT                   /translation="ISREEWAARMQAADVPKELLKNLVMDYFVKRGFTKAAKAFQRESF
FT                   TEPVKYGPEDEDKPIPVDLAELEPKSKVNQALQDGEILKAIEVVNQLDPKILRDRPALN
FT                   FKLHRERLLELVLADKVEEAINFAKDVLVPLGDGNHELLHTMEEVMALLLFTDRKQAEE
FT                   SVWGKSLGLDDEGQRRDNIAHEINSAIMNHQEGLEPDDFDPRVTEPKLHMKMKELLIKQ
FT                   RKLSEKGVKFPKV"
FT   CDS_pept        complement(792004..792993)
FT                   /codon_start=1
FT                   /gene_family="HOG000264632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636873"
FT                   /orf_name="MICPUN_103160"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66545.1"
FT                   /db_xref="HOGENOM:HBG557612"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199BC84"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ1"
FT                   /transl_table=1
FT                   /translation="MSPRSSFKYVYIPADDTCPMEELSMEIPEGREMECLLDVLKDHFR
FT                   NSKTVGTANEQKAIFKKQLEEHSGKTIDDNLMDIAAKMQMVQPVALLPGGKATNWEHIN
FT                   CYVDDRGISKGLPRNIRACGIANECGASSDIVGDAFIARIIDDEERFERHDFTLSEVSS
FT                   SAPWVKRAFELNLAKHQNSGDMKEQLRAMTNMNTAADALDLQDDLPEPGPPPGAIEEGV
FT                   THPYQWTQDGEDLVVTVPNLPAETGKGDVRCDIKMKHLHLECDKAPDGERVIIDGALEL
FT                   CFEVIPDESSWSILANKDGTKRIEVTMTKGKDMRWPCLTRTKSAPETK"
FT   CDS_pept        join(793488..793831,793975..795058)
FT                   /codon_start=1
FT                   /gene_family="HOG000231249" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636874"
FT                   /gene_name="SEC61a"
FT                   /orf_name="MICPUN_95488"
FT                   /product="Type II secretory pathway family "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66244.1"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG589438"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI000199BC85"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ2"
FT                   /transl_table=1
FT                   /translation="MSSGFRVLHLVRPFLSVLPEVKAADRRVPFRERALYTVVALFVFL
FT                   VCSQLPLYGIHTASGADPFYWARVIMASNRGTCMELGISPIVTSGLVMQLLAGSRIIEV
FT                   DDAVKEDRALLNGAQKLLGVLITIGEAVAYVVSGIYGDVRDLGAGNAILIIIQLFMAGI
FT                   IVICLDELLTKGYGLGSGISLFIATNQCESIIWKAFSPTTVNTGKGAEFEGAVIALFHL
FT                   LITRADKMRALKEAFYRTNLPNITNLLSTILIFLVVIYFQGFRVDLPVASKRGRGMKQT
FT                   YPIKLFYTSNMPIILQSALVSNLYFISQLLYKRYGGNFLIQLFGRWQESESTGQFIPVG
FT                   GLAYYISPPTSLRDIAANPLHAVFYLTFMLSACALFSKTWIEVSGSSARDVAKQLKQQQ
FT                   MFMVGHRESSLQKELNRYIPTAAAFGGMCIGMLTVVADFMGAIGSGTGILLAVTIIYQY
FT                   FETFEKERAQELGGVLF"
FT   CDS_pept        join(complement(795934..796005),complement(795727..795768),
FT                   complement(795325..795597))
FT                   /codon_start=1
FT                   /gene_family="HOG000186306" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636875"
FT                   /orf_name="MICPUN_92037"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66546.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316677"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniParc:UPI000199BC86"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ3"
FT                   /transl_table=1
FT                   /translation="MSNTSCTLRTRKFMTNRLLSRRQFILDVLHPGRANVPKAELREKL
FT                   AKMYDVSDNACVSLFGFRTQFGGGKSTGFGLIYDNIDAMKKFEPKHRVIRAGLKEKVTQ
FT                   SRKQIKEKKNRVKKLRGSAKNKVM"
FT   CDS_pept        join(796309..796504,796649..796731)
FT                   /codon_start=1
FT                   /gene_family="HOG000201916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636876"
FT                   /orf_name="MICPUN_86475"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66245.1"
FT                   /db_xref="HOGENOM:HBG464594"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR016464"
FT                   /db_xref="UniParc:UPI000199BC87"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ4"
FT                   /transl_table=1
FT                   /translation="MSKAAFAGLKAVQEIRFHLCQTSKGSEGVRNFLLKSYKNMKAASP
FT                   ATPILIREASGVEGGIVVRQDFGVEKRASLEGMDEKAVEKEVTSLLK"
FT   CDS_pept        join(complement(797351..797524),complement(796994..797251))
FT                   /codon_start=1
FT                   /gene_family="HOG000242567" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636877"
FT                   /orf_name="MICPUN_62647"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66547.1"
FT                   /db_xref="HOGENOM:HBG601404"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="UniParc:UPI000199BC88"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ5"
FT                   /transl_table=1
FT                   /translation="MADIVTQLQDSVNELNGMFYNCVGVLQRDAKPAGTTADGELSDEL
FT                   PDDGREASEKQIKEMAAAVVQQSRKIDELASLLPEVDLDEHAQLGRIAKLQAENDELDR
FT                   ELARELEASEKILAKATAAFEAATDKVLLSEDQPSTTGR"
FT   CDS_pept        797648..797971
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636878"
FT                   /orf_name="MICPUN_62648"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66246.1"
FT                   /db_xref="UniParc:UPI000199BC89"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ6"
FT                   /transl_table=1
FT                   /translation="MSDRGTCFRGDGNRKYNRQACAGPARFQNAGDVAFFARHFLGAGS
FT                   ITLVAGGRRDRLTTRIANTGGSSRRVSTRRNAARKTLLRGSQEWVSSQGLERIGVETSS
FT                   RSL"
FT   CDS_pept        798412..802719
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636879"
FT                   /orf_name="MICPUN_62649"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66247.1"
FT                   /db_xref="UniParc:UPI000199BC8A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ7"
FT                   /transl_table=1
FT                   /translation="MASSASERQLGDDTMDSSFELDVVEEHTPPRASLKSISERDFNAP
FT                   EVVTAANAEQDAEHSWLRRRRDSDPETLNNAGNSVVLSTIPPSADEAMIHRRVAELRLA
FT                   LRTADGALDKARARFEEAEVARNEAESEAAALRARVWTLEGAEALSGTRLHDGSLDLLR
FT                   GELLNEATAELEEAARATAEAEERAREAAAALRQAEDTAAAIAAAASGEVETLSMEAAQ
FT                   ARLRAQAEARDAADARSARERAESLAAEAEAEVAKWRDIGKRETELRSAADKAAKIASD
FT                   EAEQAKESAAVAAARESEAAQHNNWLQERVRELEDAEGSDAGARYGAELRRLREQLTAD
FT                   AAKAADELAAERATRRKLEALLLEARGDAPIPAVPAATENDEASEKVLILEAKLNEERE
FT                   YSARLEKQLETAVVAKPARGSLHDSQDSWADALGLQEGDAVSDGEKDEKVAMLTESGMP
FT                   PSSPKKENNKEEPVPPAEDDRVLQLQGMLEEAEREIQDLQAMMLEERMRAAATLASATS
FT                   TAAASTAAAVEAAVSRNTESWASKLKEAERVADEATETAERAARRVAMLQEECDAAQKD
FT                   LAELRARRGELTEREAKLQATLKAMKEENASAQVTKLELAESDKTKEDQHIEARKVAAE
FT                   AASKLAEAERAAAEASEYAQRAAAEADAKLSKAEEMVAEANETAERVKSDADATLAEAQ
FT                   QIAVEAKKSAALAIAEAKQAAADAVAEAHAKLTAFAEAEKEREQDEFETETEWEEKLTE
FT                   ARHAAAEAQAKQAKAEAMAAEAKLAASRAIIRAEEEREGDVAEAEKEWEEKLAETKQRA
FT                   ESAESKLSMFEKTASESKEAAAEAMRRVEMLERAASESKDAAAQAMRRVAVLEKECAAA
FT                   QREIAMMREREATAELAAEAEAAFAALEAGEEAKMEAAEALAQARAEAATARGELDALR
FT                   ESIRLSSERKEPSTPLITSTMRSGGVTVVQLTSEDEVDTDFHAAVDTDLDDQRDTPLER
FT                   ALRRDREAGSGVIVKGRPLLDETPSKTRKLVSTQRDRLAAAAAEAAAEVEALQDSGRNE
FT                   FLPSMSERETELDISEPEPAVDHPTGEGQWVWHGQGTPVKAPTPREEPTPIAAPVTATV
FT                   VPVAPTVDIGKPKTSTVAHRLDIDHDAAHVMVHRPARRLSDGGNLSSSRARSTGGRISR
FT                   VATHPGHSERMAGAMDISSSDEDDLCRISSDDESSAPSAPASTKGRSRHAHSRRDVGEP
FT                   HMTPPRSAPTQSMTSPTRSRNSPVEMSEEFEGSPIRASDAFVAVAASAHAAASVARGDW
FT                   SVDGTPKPSPAKLAAAALAASLSSPFKSPRRPSQADGETRRSIQEGEAALEAMRASRAS
FT                   LAARTGGSPPAKEVSTPAKRQVSTSSTRSSPMPTKSTSRGRAAMETPGRPTGTWGRPSS
FT                   ASGTRSTTIGSHDRSTSSRAGKVRPEAYNNRYS"
FT   CDS_pept        complement(802493..802666)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636880"
FT                   /orf_name="MICPUN_109185"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66548.1"
FT                   /db_xref="UniParc:UPI000199BC8B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ8"
FT                   /transl_table=1
FT                   /translation="MSICRGSRLLLIGYQKQSLDVPRCPWDDQGFPSQHDLGRWTWWAW
FT                   DWNESSWWTPVA"
FT   CDS_pept        complement(802786..803526)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636881"
FT                   /orf_name="MICPUN_62650"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66549.1"
FT                   /db_xref="UniParc:UPI000199BC8C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEJ9"
FT                   /transl_table=1
FT                   /translation="MSSSSDFSGPGRELRQPRQTRHFPISRVVVAAPQLVWMMTIVLGM
FT                   GMHRGSASSDTSSYLPLAWYDGIFIHVGPLLPLIPLGTRAMASFLSGASNMAKDVSASR
FT                   AGLVYAFAAIIRLSVYFAAGLFGDHAMSDHIFLGSCVFSSAHAEAVAGLAMLARMCVIK
FT                   STVFATVSAALVVLQSFCLMGLQCGDSWFTAIYFHTPAETMIALVLGLLACQAITIGMV
FT                   IIPAASALELAVIALRESRDSRLG"
FT   CDS_pept        complement(803869..804882)
FT                   /codon_start=1
FT                   /gene_family="HOG000265194" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636882"
FT                   /orf_name="MICPUN_103165"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66550.1"
FT                   /db_xref="HOGENOM:HBG557618"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199BC8D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK0"
FT                   /transl_table=1
FT                   /translation="MASSTHDARVVTYNVLSSSLCEPDYFAHCDPNDLHPPNRLAKLLA
FT                   KLEPEMAKGAVIGLQEVSQKWAGELHVFFAKRGYHMICSLYGKPFNGYMGIALAVPLAK
FT                   YDVSKVDISRCSDTKKLPREPKPGLLQKVINYPINLYRKVSGERAPQSDWQLAKGRFNT
FT                   IMYASLQCKKSGAKFGVANYHMPCMFRNPKVMTIHSQLAAMYAQQQSGNLPVILMGDFN
FT                   LKPGDGGYDLITTGTLASDHEAAPVPPAGEEWSTSLKYPMRSAYKVANGAEPDFTNFAQ
FT                   IKDDPQFIDTLDYIFISPKIEVAEVLQLPHRSEVKGPFPAPDEPSDHILLAATLRV"
FT   CDS_pept        complement(805381..806460)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636883"
FT                   /orf_name="MICPUN_103166"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66551.1"
FT                   /db_xref="UniParc:UPI000199BC8E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK1"
FT                   /transl_table=1
FT                   /translation="MACVSNLPVVGAPRGTSASGSRRRNARIMNRIHHSRLVSTGSKFV
FT                   CGGVGVVDRDAMTAEATAASEYVAATWPETKSSMRHCVVDTRGEHFLYQFSEDKPDGLR
FT                   IATFKAAGVCVYMSRLAKNLEVAAVPEKEEVIVTTETVPEPIESVVEPVANVAPSIPPT
FT                   PVPEPETPSARDITSKPPTASFGENAGKSGAAVFERGGGIASWHGWTEGYELDLVLEVD
FT                   VPAEKSTDPIAAGVSSVSRGRQALKSGAAVFGDGVGTITFSEAQLQTAVFEPEPAAPPK
FT                   PMLTVGEARSVSSGGVAFEGGAGVGGARWRSPNAPEKVSESTAGAADASTQRKVDVQTV
FT                   VVWGLCAAIFAYKIFFARV"
FT   CDS_pept        806870..808852
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636884"
FT                   /orf_name="MICPUN_62653"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66248.1"
FT                   /db_xref="HOGENOM:HBG607888"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BC8F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK2"
FT                   /transl_table=1
FT                   /translation="MSHTWFVRLPPQLDDHSRIDDAALLAGLRGGVVAEKPITVVAEQR
FT                   LDCARPDPNDHNHACAVERRGVFRSMRVGGRDGSGIERFQLHTESDDGELKPVSRSWRQ
FT                   FEFIPRQEGAFIFTQTGSPNLLFSTIPTKGSKTGSMVFLFGSCSAAVNSFAIDANGSVV
FT                   VAGAQDGSLAVWKISDGKKVGAISGAHEGGVRAVTFLSPTCVVSAGADGTVRIWHVSGD
FT                   PRLRMLHRMAAGDSPLTAIAAWAQEGVAHQFLAAGADDGTVYAWKAKAPVNVDGEMRWE
FT                   PTTVSHHLQGKEVVELSFRGDGAALIAGACDERQLGAGEVRLFETEHWTLVASQPYSSH
FT                   VVACMYSRSKLIVDLVLVCSAAGSPRLFEGRLVPAVSAPLRDRGLGSDMPPQPLGHGLP
FT                   GPLTNRDGDGIRIVRSTDSDDENDPRDHPPPIPAKKMMDPTPEAPKPVLRPAFRRSGKY
FT                   HVEPRATPSERATRLVAQMAADAMANAPVISDDDHDDDDDVENQGDPYDGLVGVEGAET
FT                   ILAKPTLMSSRPILHRSALIPFAVFDRDTELQHHMAPLGISGREEAAKVADTHVRAMAA
FT                   ANMNLAFPRNGRRFEGLAQIPKASVPTKAKRMVGKQLDPRWLAVRDIKPRMEDMWVAAR
FT                   REPQVCSTEGCSSSLLMPPSKGVEY"
FT   CDS_pept        join(complement(815428..815493),complement(815239..815307),
FT                   complement(808923..815117))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636885"
FT                   /orf_name="MICPUN_62654"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66552.1"
FT                   /db_xref="UniParc:UPI000199BD1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK3"
FT                   /transl_table=1
FT                   /translation="MSHDVDQSDTAPGAAAALMRERVDMFAEELKSAREYSDAINRLLQ
FT                   TQLSTLGDDDGETQNKNKSRSRTKKPALERKTKRKALGSVRGASRTALSDVKLNESQRR
FT                   SHLAEDPSASSSAFKSAKDVSARETKAMALEAGIRRLQKDVERHRATEASLRAALDAET
FT                   EVWKFDCSVSDEEELHEKLAASLDMQAQMQEELARELTLRITAEEASEQAKKDLDSLQR
FT                   DFDSLKDDVAQRASASKERDDLLEELRRETEARRTAEVAYEEVQSRVQTLENTLEKQRS
FT                   ELRSRASENSQEITSSLETAKAEATQARARVEETLAALTRAKQAERGARKSELATANAA
FT                   RAELKEMKRRLAKESEKRQKAEAEAQTIQMKLEEHINGDRRDDSSKIAEAIQSKEMAEA
FT                   QASMLRSCLEDTEEMLEESRATARTLEAKLKETQVMQKSDPSVDEKMQTLLSRAEEAEQ
FT                   SVSAARLIAKHAEEGLATARHDAEDMAQYLKKLVAEHEAAISRLHAESKEKDESIEALR
FT                   RAHDETLNKSKVLDEMLIRAEQTKRQLNERLSKANAEVKTLTETCVQHDDSAFHERLAS
FT                   MQQKLNSVEDAKSGAEASLQQMQEEMKHLQSKLAEKEAKDAGATVSVPIEVTPTVDMVV
FT                   QTDPPPQLIDICTQMDASIDVRVKLSADIEEKSKALEEVQLRFIAAEVKHNADLAAMQQ
FT                   LCDELKSKADASAHSANELESKLVWATQRSSDLESELATLREEAKLSLDVKVKEVVAAT
FT                   QAARDALVGKSAAETEIQQLKHMLSKYEEAASSNHEMEIDVVELREALSNAAVTIRNQE
FT                   ASLSELTAQLEAAEAASADGEAQNALLRDELAAKLEKAEESLKTARAENAKHEWTISEL
FT                   KSRLDMSELNGHGMQDEIQKLKSSLMESTAETSRLGSAASKQAAESQAKVSELQHSLND
FT                   AFREIEGLRLLVKRFTADLKDSEDRFTQLQGDSEASVRTASELKHRCDAAEKQASEIDA
FT                   AFSAFKSEAKARLELQGNQLMEAQRALTDAATKAKADEEEVQRLKLVAQQMEATPSIDE
FT                   ALKVEVLELREALHLAQEAHEVQETSLSELTARLEAAEAASTDGEAQNALLRDELAAKL
FT                   EKAEESLKTARAENAKHEWKVSVLTSDLDMQKSWTAAKEREVLELNEALVMVRAEVQSA
FT                   TSEATAKLSSTTNELSEARQTIDKCRRELDEARQLSDRLASELDVSKQQLLTATVDAAK
FT                   FKKDFEAKCVEAEIQANEAAAALSAFKQDANTTLKQKTDELVALSGVATDTKAAKDSAE
FT                   TELRRLRQAIAQHEANVSMDEALRVEVIELREALTDALEAHKNQRTSLSELTVRLEAAE
FT                   AASADGEAQNALLRDELAAKLEKAEESLKTARAENAKHEWTISELKSQVQVGEVKLKDA
FT                   TSKVTSTSAKLAESEDSLAVSIRELKESRRRITQIAADLERVQHKHEKSIEASYQTEMK
FT                   LAAVEQRAAWAEAALVAFKQERLHDLEVKSQQVKSVATSHADNTLEEFKKIANVSLERR
FT                   TTEMLLATRVASEATAAKEAAEAEIQRMKQTLEDVQAKTAADVHLQSDVRDLQAILVQS
FT                   TKMLHQRFEAVDEAVATKEAGNKLVSQLASIESLAAQEAARTEVNRLTCLVADAEKENG
FT                   ASKEKIHQLEAEVHVLQSALAEARKAHDSQLGLQDELRSQLIALQLSYDAREKDHEEAA
FT                   AKLRHQFDEKLEASMRELIETTDRAAKAMASKELADAEVTRLVALCSELEKHDEAAIED
FT                   AVKAKTAELTKRITGLQKDHDEALSLCDSLRLQLDTVAAAAEKANELNDRCIQEAEVYA
FT                   SAASIVMHEMSDQLAQLNSEVTAAKANITSLSAVRESLEDELLSMEVEIKVALEERTQA
FT                   MQEVSELKKSISGLGKVRDDLVVAHSEMRKLKEAEEREVELQLRAESAEQRERELHTKI
FT                   ISTQSALRELRLENGSMETRLACGAAELSSAKEEAIQLREEVKKIQLAALDASASDTNV
FT                   KSKINAVKEALKDSEAALEIERLARSAAEARVSALEQRLGLLNSTAGEFTQQLDEGSNE
FT                   EIAQLLDVAQEEVERARAECQMAKKELRGAKSRVRQLEEEVIRLQTHEHALHALIGSA"
FT   CDS_pept        817910..819031
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636886"
FT                   /orf_name="MICPUN_62655"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66249.1"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199BD1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK4"
FT                   /transl_table=1
FT                   /translation="MKLHVLDLKSGATELNDVDDTDTIGALKQKLFEASLIDVEPSKQR
FT                   LIHAGRELSDEKKQLREERVGDGDVVAVMKSRVTKSGNSRGRARQAISEPAANLHLINK
FT                   LMARAGSVVAQQTSNGDPLDLQGLKLSDGAESTQVGGVQQSVTQATGRGLGITLPEPDA
FT                   RAVEQLVEMGFPEARARKALLLHLNHSPAAMEWLLEVGDSPEADAELTDAQIRHIMSAS
FT                   TVHPLLRMRQEASSATQGPDETVIQRLVEMGFAREEVLSALAATNNDYDAACAWLLGER
FT                   GNSGAYQAQTGQMNDGSGAQGNPESMQALLGNILTHPAIQAGMQSERVLQAFQAMIEDP
FT                   SSAHDYLNDPEVGPILLRVHSILSRVADQRGQP"
FT   CDS_pept        join(complement(819404..819448),complement(819131..819304))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636887"
FT                   /orf_name="MICPUN_62656"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66553.1"
FT                   /db_xref="InterPro:IPR013174"
FT                   /db_xref="UniParc:UPI000199BD1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK5"
FT                   /transl_table=1
FT                   /translation="MQSGLGEAELQAVQLLPLWALVSFGLYSIAVIGWSLAHFPTCSKD
FT                   AEILQGEMKEAQSELCARGVLSAEEIE"
FT   CDS_pept        <820018..>820545
FT                   /codon_start=1
FT                   /gene_family="HOG000265558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636888"
FT                   /orf_name="MICPUN_72498"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66250.1"
FT                   /db_xref="HOGENOM:HBG692249"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BD20"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK6"
FT                   /transl_table=1
FT                   /translation="QTPLMAACLAGKSEVVDELLRLGADPSIPEKDGYTPSHGVAFQGR
FT                   EQAARVLVKHGVDVDEKHADGYHPLHRTLWGRSPRHLATARVLVKEGGANVDALDGGGS
FT                   PPSHKALASSWHEMLELLLELGADVNLQAGNGETLLHLAVQNRDERAVTAIVKAGGDPA
FT                   VKNSDGMSPLDMA"
FT   CDS_pept        join(complement(821261..821315),complement(820692..820981))
FT                   /codon_start=1
FT                   /gene_family="HOG000231490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636889"
FT                   /gene_name="DIP"
FT                   /orf_name="MICPUN_96664"
FT                   /product="Deflagellation-inducible protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO66554.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG522014"
FT                   /db_xref="UniParc:UPI000199BD21"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK7"
FT                   /transl_table=1
FT                   /translation="MDGAKGGALADQNSQLITCIDELRNKRTAIDEQIDQEEAEKAKVQ
FT                   SDLQVLSKRLATLNESIARKLAARNDYDKTIQETEAAYLKILESSQTLLTVLKRESMGL
FT                   ERKSTGPGAV"
FT   CDS_pept        821517..822044
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636890"
FT                   /orf_name="MICPUN_62659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66251.1"
FT                   /db_xref="UniParc:UPI000199BD22"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK8"
FT                   /transl_table=1
FT                   /translation="MLGLDYSSSDEDDDDATNVQAPTVAAEADKRGVEAGETPLQKMEG
FT                   ARGASNPGRTGAGVSSASDHRPSTILPSAFDLLEATGPGGVGSMTQHYSRPGPPGGGAQ
FT                   HSGTAVTGVKRPANGQFPLPSVPQKSGRGGQQRNVSGKPVNTLLPPQLRGRANNATQDL
FT                   EALGFKRKPKPL"
FT   CDS_pept        join(complement(822945..823151),complement(822702..822755),
FT                   complement(822137..822538))
FT                   /codon_start=1
FT                   /gene_family="HOG000039903" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636891"
FT                   /orf_name="MICPUN_92039"
FT                   /product="Predicted protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66555.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG606796"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI000199BD23"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEK9"
FT                   /transl_table=1
FT                   /translation="MAAYMVSSSLSARQGYAPSARLAARAGASPVAVRAPLAVVAKQSR
FT                   IGKQPVPVPKGVTYTLKDNHLSVKGPKGELQMQFPETMVLTEGDNEIAFARADDSRRAR
FT                   EGHGLYRTLANNMMVGVSTGFEKKLKLVGVGYKAAMEGSKAINLSLGYAHQVIVEIPEG
FT                   LQVKCDSNTEITVSGYDKVEVGNFAAILRSKRKPEPYKGKGVRYADEVVIIKEGKRK"
FT   CDS_pept        823637..824815
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636892"
FT                   /orf_name="MICPUN_103168"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66252.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG557624"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199BD24"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL0"
FT                   /transl_table=1
FT                   /translation="MGKEGKKSKEKDREKISKKKAADGDKEHGKKAKREKDGHKRVTGS
FT                   LDGENRPNNAVRPPKKQKNGKEVVTVHEGANGIVAAERKAKNEAWNPKIEGQKFGEWSK
FT                   DEKEELDARIKEWAMAHGKIDDYNNKKFDFLMQRRQKQGGRGAKLPDSERKAFLEIATG
FT                   FPTRNPKQIYGYVSRHYDSDNYKGKWSDEEKKKLTDLVAEYGEKWKEVGKNLGRPGHAC
FT                   RDKWRMMRNNPKSGDWSPAEVAHLRELVNEYFAQNNAAPGRGAGEGNEHLPLRDNINWK
FT                   AISSKIGTRSENMCMQKWYRIAPSPEETGQWAKGDDKTMLEGILKSDADDEHKVAWEGL
FT                   VPGRTLGQIKNRFRAAKKDIPDHSNMSFDVLLAKMIEKYAPEISNAGALPAP"
FT   CDS_pept        825866..826669
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636893"
FT                   /orf_name="MICPUN_103169"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66253.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199BD25"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL1"
FT                   /transl_table=1
FT                   /translation="MVYRNTDPPCCSFCLRFLEKDPPEFRCDGCKLECYCSTACKDEAR
FT                   RLYHSSDGECAAFEAGIEAEAIDFEFGDVPERFLLRVLSQAGGWRTPGGPMVVGAGVDR
FT                   VRMLQAHVPAPDTEERGRLAGISRNTLRLMDESVEDGVRVVDPSGDEPATTSRYGEAEL
FT                   TQLLCSVNCNAHTLYANDRSSLVPVGIAVYLQGSAFNHSCVPSAEFCNVGTSLTVRSLR
FT                   RVQAGEEITVSYVPTTMNLKERRRCLEGQYKFVCACARCVAEDVS"
FT   CDS_pept        join(827169..827309,827635..827870,827931..828303,
FT                   828355..829580,829650..830133)
FT                   /codon_start=1
FT                   /gene_family="HOG000231303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636894"
FT                   /orf_name="MICPUN_86265"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66254.1"
FT                   /db_xref="HOGENOM:HBG590303"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="UniParc:UPI000199BD26"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL2"
FT                   /transl_table=1
FT                   /translation="MAAVEPQPLGGEAADYTNLQRVKVYRLNESGHWDDKGTGHVSCEY
FT                   MEQSDSVGLVVVSEEDQQPLLVHRISREDIYQRQGGDTIITWTDPDIHTDIALSFQEAM
FT                   GCNYIWEQISSVQHTYKKSDMAAPDDGFYQDSGRAGPSELPPAELGSLAELVKVVTECS
FT                   PFAREKIANLALKKGYLRQLLDLFKTCEDLDDMESLHMMYTLVRGLVLLNDANLFDELL
FT                   RDENVFDVVGALEYDPEYSEAEETGGDGHRAFLRDSVVFKEVVPIQDPAIRAKIHQTYR
FT                   IGYLKDVILPRVLDDATFGTLTSIMLFNNVEVVLALQQDPAFLKELFNRLKSTPRADPG
FT                   WDDLVGFLQELCSLAKHLQVQQRGSLFASLIQHGLFYVLTDVLKAESETSQLKGADVLM
FT                   STLHNDPSALRAFLVKQEDHALFDRIVELFVQGEEGLQAQLFELLKLMLDPETMDQPVE
FT                   KSGFLELFYDHYVDKLVASVGAGATKEEDAGTEPTQSGLRPLDSFVPAWNLVKTIELLC
FT                   FCVQHHSFRIKYYVLRNNVVEKVLNLTKRREKYLVVAAIRFLRSCVGLKDEFYNRYIIK
FT                   NNLFGPVMKAFGENGARYNLLNSSVLELVDFVRRENIKGLIEYLVVTYDELFSGVEYVD
FT                   TFRLLKLRYQQAQQPKTAAGAPGGRETAAAAQAMEAHRRRRDGSMDQSEEDYFNTDDDD
FT                   EEEEAVGPAPAVDDEPLVGPSPPSLSAQFIPMAAEYEAGLVGSKRPLVDEEYAGDDDTG
FT                   KRIKQDDGVEEEGLTAAQRNALTGLNAEPNVEVATDPNSEGGEVEHKPTSKPTSNWVSV
FT                   GQEEQNQ"
FT   CDS_pept        complement(<830254..>830946)
FT                   /codon_start=1
FT                   /gene_family="HOG000093311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636895"
FT                   /orf_name="MICPUN_72179"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66556.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG736819"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="UniParc:UPI000199BD27"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL3"
FT                   /transl_table=1
FT                   /translation="DDETLLKEFFADVSDASRDAEVERILACFKLNPYEHLNVRFDAGE
FT                   DTIKRAFRKVSLLVHPDKCKHPSAKAAFDAIGQAQTLLGKEEVKRELDFNLTRAKESVI
FT                   KAWRKETRNDVVLRVRYNGDRDAQLADFLESDEFHERWKLEGRKNIVDLEWRRRKLTLR
FT                   IAAEEERVEKEEKEEAAERKKQSKAQKNWDEEKAREGRVGGWRDFTSKKKAKRQKVAGE
FT                   FKAPTLKKE"
FT   CDS_pept        831890..835027
FT                   /codon_start=1
FT                   /gene_family="HOG000264303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636896"
FT                   /orf_name="MICPUN_86357"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66255.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="HOGENOM:HBG413866"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR002311"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniParc:UPI000199BD28"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL4"
FT                   /transl_table=1
FT                   /translation="MQASNVGVLRIASARRVVRVARAISTDAPASAHAASAAKGSGASA
FT                   TVPTFQEAILRLQQYWADRGCALWLPHNTEVGAGTMNPATFLRSLGPEPWSVCYPEPSI
FT                   RPDDSRYGDNPNRVQRHTQFQVILKPDPGNAQELYLGSLEALGIDTKAHDLRFVEDNWE
FT                   SPVLGAWGLGWEVWLDGMEVTQFTYFQQCGSLKVAPTAVEITYGLERIMMSLQGVKHFK
FT                   DIRYNDTMTYGEMLLQNEYEMSVFNMDEADVPAHQLRFELADKEANRMLDARLPLPAFD
FT                   QLLKASHAFNILDARGAVGVTERQKLFASMRKLARESAVLWVARREELGFPLGVWEPEP
FT                   VPDPVRTKGAAPTEAADFLLEVGTEELPPADVASGSEQLSKAIEACLDAAGLTHGGVVV
FT                   GATPRRMVVKVKDLAAAQESKQERNRGPPLSRAFEEDGVTPTKAAMGFAKKNGVDPADL
FT                   EKDGEYVWANVQTVGRAAHEVIADALPGIVGGINFPKTMRWNGDAAFSRPLRWLLAMHG
FT                   EYHLPFVALGVASGSTTRLLRNSPTPTAEVTSAAHHAQLLEGDTIEISFDARRAAIWSA
FT                   AEKLAAGVNGVVPPTAGESGGLIDEVVNLIESPTPIIGGFDPAFLELPKEVLVMVMRKH
FT                   QRYFPVEDVATGDLLPHFITVANGSVNPDVVRAGNESVLKARYEDAKFFYEADTRRKLA
FT                   DFKPDLAGITFQTELGTMLEKTERVEKLAPKLATSLGFSESDAKVATEAAALARADLAT
FT                   QLVQEFTSLAGVMGKHYAAREGLDAPLCEAIFEAALPRSSGDILPSSPAGIAVAVADRL
FT                   DTLAGLFAVVGAPKATADPFGLRRAAYGAVQALVASNSRCDLRAALAEAAALQPVECGD
FT                   DVVDECLEYMTRRLEQYLVDSGCGVEAVRAVLAERGGDPAVAAVTARALDAAIVGGSEE
FT                   LKAAMTVLARPTRLVRGKELPADLEVKKESLVDAEEVALYEAYVAAREKVGVHSEATVG
FT                   DLLSAAASLSEASEAFFDKVYVMAEEPELRRNRMALMNAIASLSEGIVDFTELPGF"
FT   CDS_pept        complement(835138..836124)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636897"
FT                   /orf_name="MICPUN_62665"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66557.1"
FT                   /db_xref="UniParc:UPI000199BDBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL5"
FT                   /transl_table=1
FT                   /translation="MADDAYGYVGSPGKPQPRTGGSRPGPRGLALSSAAAQTATLGRSR
FT                   ATPPGSPGGGGGGEHTNGYYEVYPRGGGRKPALLVQLESLLAEQLRLSEKLASVKGGIH
FT                   GADYRDESGALALEAHRAVFDAFINAFTTYRPLLTKVKEHYDRALDRALRSEHENVQMR
FT                   SELKAMELRKGREVETARAEAIATAATFRGDVQQRLAKQTARAEEAEKERDEARAEIAR
FT                   LVEELEETRAKCAEAVEERRVLKEAALKESSWAQDPAMESMMALSVGPVPKNFPRADAT
FT                   LVDGEGGLSAPTEDAEGGEEEGEKAEAAVEDAEAAPEGEAETETKDE"
FT   CDS_pept        join(<837347..838091,838743..838987)
FT                   /codon_start=1
FT                   /gene_family="HOG000200842" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636898"
FT                   /orf_name="MICPUN_86481"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66256.1"
FT                   /db_xref="HOGENOM:HBG607820"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000199BDBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL6"
FT                   /transl_table=1
FT                   /translation="LRVMTYNVLADAYSHTWKELYPYLSDEAADAEYRLLLAMEDVRVA
FT                   KPDVVALQEVDKKWYDAFWVPQMRAAGYVPAGGLTEKTGLTREGCATFCRGDEWRPVRT
FT                   EETGLNTPGPMPEERDTSDWVSSQPHLADALSKVNTVAQLAVLESAAGDGRAVVVANTH
FT                   LFFHPGAVHLRVMQARWLLRHADGLRRRWVEADNEAGRGGGKEVGLVVCGDFNGEPFDG
FT                   VIRFVRESVLGAGDGDWALGSVFRWGAAMHLRHPLALVSACGYPEFTNYVGGFAGSLDY
FT                   VWFDSSALESVASMPMPPLDAVTAETALPNSEFPSDHLPMVADLRFTR"
FT   CDS_pept        complement(<839195..839737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636899"
FT                   /orf_name="MICPUN_62667"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66558.1"
FT                   /db_xref="UniParc:UPI000199BDBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL7"
FT                   /transl_table=1
FT                   /translation="MAIENAGGTERTEESRRDVLKGKTVSELWAMENNNKGEDTRDDDE
FT                   DEAGVTGYEYCCGGAKDVAERDEAGKEADTAEEDELIEVVDPERQARQLQKVIKQIEIS
FT                   SRYERVRAVTKPLPEFRAEDVEEPEYYSHAAGDERFWDEDEFSVEADPAGSEFGDEDEE
FT                   RYAVLGDFESAHDLATPW"
FT   CDS_pept        join(839892..840230,840338..840856)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636900"
FT                   /orf_name="MICPUN_62668"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO66257.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG557628"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199BDBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL8"
FT                   /transl_table=1
FT                   /translation="MAASGSALAWSVAFNHDFARVPCVRRSVGCRRVAPTSPRHRERES
FT                   TSTRAQLGSLKPIEESGDEGPTQWRVRQVYGDGKELLDQLREVADLLAEGFNKSGSTSR
FT                   DLLNGLVQKVRWSGGNFLCLVADNGEDGSALVGACDLTLLPAGGPKRSREALVADVPAL
FT                   LNLPPDGHFLYLTGMVVPSTFRRRGIGQALLRRSEAMARKIQPAPECVALHVDVANVAA
FT                   RRLYANAGYQYVGWSEGGSEDKGEDEKEDKEGLPWRLPFGLPKKPKTEVLMVKWTPGPG
FT                   ASGE"
FT   CDS_pept        join(complement(842047..842858),complement(841651..841848),
FT                   complement(840933..841320))
FT                   /codon_start=1
FT                   /gene_family="HOG000238755" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636901"
FT                   /gene_name="BAM2"
FT                   /orf_name="MICPUN_96665"
FT                   /product="Glycoside hydrolase family 14 protein "
FT                   /function="beta-amylase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="ACO66559.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0016161"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG747772"
FT                   /db_xref="InterPro:IPR001554"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199BDBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEL9"
FT                   /transl_table=1
FT                   /translation="MGSPRSSGGVPVYVMLPLDTVSRDGQLQRPDELAERMSRLKRAGV
FT                   EGVMVDVWWGIVERDGPLLYDWAAYLDLAGLANRIGLRLHAVLSFHSCGANRDDDYHVP
FT                   LPRWVTDAVARDPDGLLFADRAGTKSDEYLSLWADEAPMMIMDGTAEAARMEHAPPRTP
FT                   LECYRDFMVSFKGAFAEILGSVVTEVLVGCGPCGELRYPAYAASRGWEFPGVGEFQCYD
FT                   RRALESLRAAAVNAGRPEWGAAGPHDAGTYNSHPDDTGFFSNGKGRIRSPNGRWDSDYG
FT                   RFFLGWYSQELVAHGDRVMGAAADVFNGTGARLALKCAGIHWWYRTRSHAAELTTGGGN
FT                   GVPGYDGIMAMCRRRGVGVTFTCAEMSDGEHPPEMRCGPEGLLRQVVAAADRHGVEISA
FT                   ENALYRCDSGAYKQMVRNSMGLSGDGGGGMHSFTFLRLCDSLMEPDNFAQFETFVRDMS
FT                   GDSAGGR"
FT   CDS_pept        join(843451..843753,843962..844489)
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636902"
FT                   /gene_name="RPL3"
FT                   /orf_name="MICPUN_62670"
FT                   /product="Ribosomal protein L3, chloroplast "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66258.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI000199BDC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM0"
FT                   /transl_table=1
FT                   /translation="MAAIASFQLAAVAPACAKRSVGAKGLKASASSGFMGTSLATPVRA
FT                   GVARAAGASALKVEARLDAGVGVFGNKAGMTQIFTDEGLCIPVSVIAVQKGNVVTQVKT
FT                   VDTDGYNAVQVAYDEVADYKITKPEVGHCAKAGVAPMRHLEEFRLAQAPAHELGQQLKP
FT                   SEMFTAGDLVDVRGASIGKGWQGAVKKYGFSRGLMTHGSKSHRQHGSVGAGTTPGRIYP
FT                   GKKMHSQMGNETVTARKLKVVKVEDDCIIVKGSVPGKRGNLLRIAPAKIVGKNV"
FT   CDS_pept        845163..847049
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636903"
FT                   /orf_name="MICPUN_109189"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO66259.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000199BDC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM1"
FT                   /transl_table=1
FT                   /translation="MGTVVNIGMFSGHASFSSIVQRPKGVRRGGRAVARRAARASIAGD
FT                   PRTSIRGASSAPVKSAPAARVDDEDAWLGILRDAVAREGGTLRCSPNARPDHTRGVRAF
FT                   AQYWRRGDASSHDEDDALCSTNQPFIAEKTKTKTAAAKDGKGPWSNALEFIRGSVDIED
FT                   DVDPAGGHPVLEALLARKRSGSVPGERTDGMRIGLAVEGGGMKGVISAGACGEILRAGF
FT                   ADCFDAVYGSSAGAMNLTYYLANQPEGIRAYEEDLVDGGFLDLRRLPALKGPRRNKGRK
FT                   GKKNEGLGADEDDGAEEKVQPAMDVSYLVDGVMDGTTNRALRWDLLMNSRVPLKVVATS
FT                   LDTLTPVVLEGPWRGVEDLKQCLKASAAVPTLAGPEPVTWRGQRLVDAAVMEPVPVHAA
FT                   IADGCTHVLVLCTRSLPPLGEKRTESVSSEVSSVPPSSITADSLVPAAAGNGPSRPNGG
FT                   MFFSRVGMFFDRRRRRGPAPSAAGGEGNVAVGDGTENTTERRKRKNFIVRALGGMLYHV
FT                   VRGALLTPPHMKDAWATYDLHRRLHDESEGGEMKSLDDALILARDNPDAALQARTFPGG
FT                   AHVFPIAPPVAPKGVSSLCQESEILAAASEAGRQAAEAVFAPLLNRNIASWS"
FT   CDS_pept        join(complement(848998..849264),complement(847156..848868))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637192"
FT                   /orf_name="MICPUN_106284"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66560.1"
FT                   /db_xref="UniParc:UPI000199BDC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM2"
FT                   /transl_table=1
FT                   /translation="MEESKGTFKHSEKYKAMQAKYGAGGARDRERTSRRESPSATPQAG
FT                   RSSRAAGTATAHAPGEKSRLLEKRDRRGSRGAKGGSRGGFNFCKFLIYAVIFAALLAGG
FT                   WLLYVKVQESGTPQWKAPDVHAPDWKWPNWKAPDWKAPDWKAPNIHMPSWSWPSLPSWG
FT                   GKTPGPSPAPEPSPAPAPSPHKPEHHKPEHHAKEHHAKEHHEEEHHKPEHHKKEHHHEM
FT                   TKEEKEEFWFDSHSEEWKANYLAAHNATGDNSTAVLDNSTAVNGTGVNGTVVVNGTVVV
FT                   NGTAVNGTDVDETETNATVPPPPATSPPPSKSPPPSKSPAEPDAPPPPAEPDAPPKPAA
FT                   TPPPESATPPPPGAPPPASHSASRASSKASSANADLAHKDHHTHHHHHDDDDDEEEVRV
FT                   TKTKDGKMKVTVDGFEEKEDEPEVKLETTSHHTSHHHSSHTRDASTEKSTNKDVEEILV
FT                   DASVVEEGLKSELPVVEESHHSSSSSLHSSHHHHHTGEDGEKVVEVEPVHHHHDIASLG
FT                   EAEESSLGLNFIGLSKPDADYADTFEAAAMALREGTAPKTQYDVKMQSIASAIVALEDE
FT                   LKVSSYQPLLRAFSAGSGSAGGLEVSRLGKSQSKTPLLDEWVETARRKPDRDAELRKLH
FT                   AAFGTGPKARRAMRIMVHDIHRAR"
FT   CDS_pept        849641..850834
FT                   /codon_start=1
FT                   /gene_family="HOG000241277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637193"
FT                   /orf_name="MICPUN_86735"
FT                   /product="Predicted protein"
FT                   /function="mannose-6-phosphate isomerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO66260.1"
FT                   /db_xref="GO:0004476"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG590632"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniParc:UPI000199BDC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM3"
FT                   /transl_table=1
FT                   /translation="MVLSLTCAVQNYDWGIKGGCEVSSLGELNTGAPSDPSKPYAELWM
FT                   GTHPSGPSVVSATGEGLKETIAADPTAHLGAKTVERFGDDLPFLTKVLSVAKALSIQAH
FT                   PDKTLAEQLHADRPNVYKDANHKPEMTLAVTEFEALCGFVAGDVLAANLISVPELRAVV
FT                   GQAAADAFAASPGGKDELRAVFTALMTADGDVVAAQVDALAARLHAKPDKTPVDALACR
FT                   LNEQYPKDVGVLCAYVLNYLALKPGQCIYLAANEPHAYLAGECIECMATSDNVVRAGLT
FT                   PKLRDTAILCDMLTYRAGAPVVLDGERVDESTTRYVPPFDEFMLETVTVAPGATYELTK
FT                   SQGPCVYLVHRGSCVVGGENARRGSVLFAAAGDETVVAAGEEGATLYRAMINSRVYA"
FT   CDS_pept        join(<851884..852065,852144..852623,852768..>853056)
FT                   /codon_start=1
FT                   /gene_family="HOG000265549" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637194"
FT                   /orf_name="MICPUN_69295"
FT                   /product="Predicted protein"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="ACO66261.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG607881"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI000199BDC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM4"
FT                   /transl_table=1
FT                   /translation="SLMGTLKMGQDISRFELPATFLTPFSAIQATEDILTIISGTERDI
FT                   DAWRSMSDTGVGTVQSSFPLPSMKKPINSVLGETHRVRVGEIELLAEQVSHHPPITCWE
FT                   LEHDGAGVRMTGNLAPKPVFHGTSVQIALRGTLMIEFEATGEVYSASVPDLHIRFFGLG
FT                   GSYNETVGKVRFERVDPGTTGDDRKLWADLHFKPRGSAGWKSKANRMEGCVYEGSSPSI
FT                   VMTLKGHWNDTLYADGDPSKPFWHAARRRRQMPIAQTVPLDLETESHIVWGDLIRAIVN
FT                   KDWKKANAAKKRLEVAQRRLMKEIKEGRKEWHPRLF"
FT   CDS_pept        853391..854104
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637195"
FT                   /orf_name="MICPUN_109192"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66262.1"
FT                   /db_xref="UniParc:UPI000199BDC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM5"
FT                   /transl_table=1
FT                   /translation="MARRGGREVAKLAISQFRSQTRIGRRKALLGETEKILRSGHVEVP
FT                   KWFEALKAVPPTAQMSAMRPERIVYAEDKLIRAYYNRNPRERFQPIDLASHEPHYVRNF
FT                   ARRQLKVMNRNRVPEDVALKIVEEMAAEEDRVASEREAQGLPSTRHLTPKHTLQTNILE
FT                   TIQQEEEIAWQLAKKFKMTRLADKREAEMAAKMERKRELEEKQALEAEKQAEETQVKQE
FT                   DAPAEPERKGKSNET"
FT   CDS_pept        856760..857887
FT                   /codon_start=1
FT                   /gene_family="HOG000217991" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637196"
FT                   /orf_name="MICPUN_86756"
FT                   /product="Predicted protein"
FT                   /function="RNA methyltransferase activity"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO66263.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG335345"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199BDC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM6"
FT                   /transl_table=1
FT                   /translation="MKNIERLLSGDGTRKPGVDPSYNLLGMTLPELKTFAEEAGLPKFR
FT                   GKQLRDHLYGVKPAKNIDDLVTLPKAARRQLLDAGVSVGRSVVHHVAGSPDGTTKLLLR
FT                   LHDDRVVETVGIPAHEAGHRRLTACVSSQVGCPMRCTFCATGKGGFARNLATHEIVDQV
FT                   VSLEEHFGERVTHIVFMGMGEPLLNVPNVLRAHEALNKEVGIGSRHITISTVGVRGAIE
FT                   RLARAKLQSTLAISLHAPNQELRERLIPSAKAYPMQELLNDAQQYFIATGRRVTFEYTL
FT                   LAGVNDSIQQAEELGRLLYKNKLASHVNIIPYNPVDDAPDFKRPGRASILNFRNTLEQM
FT                   NVPASIRQSRGLEAAAACGQLRNAYQKNALQAEEA"
FT   CDS_pept        858082..858327
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637197"
FT                   /orf_name="MICPUN_62678"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66264.1"
FT                   /db_xref="UniParc:UPI000199BDC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM7"
FT                   /transl_table=1
FT                   /translation="MDQYKKIHAAHDDLRAKVPRRPAHLYKSPFEKVVDKYVGEGTAPT
FT                   LVRVFMVLVFLYCASLVVRAMISMRSRGKNKQGPLD"
FT   CDS_pept        complement(<858665..>858844)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637198"
FT                   /orf_name="MICPUN_72894"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO66561.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199BDC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM8"
FT                   /transl_table=1
FT                   /translation="LCDAAARFEADVLVVGSKGTTGLRRAVYPSVSTHCVENASCPVLV
FT                   YRERVDPADASPRSP"
FT   CDS_pept        860219..860608
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637199"
FT                   /orf_name="MICPUN_62680"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66265.1"
FT                   /db_xref="UniParc:UPI000199BDC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEM9"
FT                   /transl_table=1
FT                   /translation="MAFPVHAIRLMAMQYRPVPRLRASKRASTSDDEARIVREERESYD
FT                   DDLFVDKLVVDRITRTLKAKGREHEVNRRRLRDLKMEAAAAEKAIASHASEAAEIEPGE
FT                   KKGEGNTKGFRRKKKNIMGKKHKKK"
FT   CDS_pept        complement(860772..861626)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637200"
FT                   /orf_name="MICPUN_62681"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66562.1"
FT                   /db_xref="UniParc:UPI000199BDCA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN0"
FT                   /transl_table=1
FT                   /translation="MSATLALLSIAPRTSSRGLPRRSGVGAPRRRRGDLGRNDAKSSPS
FT                   ESSLNNKEEKVRRRQEEADAVEAAWREGGGLLDGADEESVVRTVRGTVQVARHYEQLIE
FT                   QQVFNLAKYGEGEVLPDTHKDPVWVAQRLCMLQKLTNVPPQYVPDMVGQSGAGVLSLTP
FT                   ASVLRSMLAVKDLVPNGDASHMVRVEPDLLLTDTTHLAYSGGDVMRTLREMPMPEPCVR
FT                   LLVTEEPGLLLGKGGLVRMEQVRDQVEEHRENLRAICEGVPDDGWLDVRAQRWFTNFFC
FT                   GYY"
FT   CDS_pept        861785..865090
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637201"
FT                   /orf_name="MICPUN_103185"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO66266.1"
FT                   /db_xref="UniParc:UPI000199BE66"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN1"
FT                   /transl_table=1
FT                   /translation="MGSKAMGPRVGRRATTLPVLVAFLALAVTSAGSAWADGWPLDGGR
FT                   HGAIDPAPVRLRGTLEAQDEPPLPPEGTKYIVLTSESNLGDPDALLPLVLSFRKHHDDA
FT                   TGKVVLLSTASRAKDRTKWTQWADTHGVIVGFVKPPHKQIVIGRFFAYHAYVKRLSTQR
FT                   PEVTAVAMMDATDVLFQSELMSRVPSDYVAYVLEPSHTAIGQCPVHKRWIEGCPKYGRK
FT                   VWHRVSQKPRVCAGTVLGGTAPVEKFLAAFTAEMTRTDFCNDQGVLNVMVHTGALGESP
FT                   TLWSHEDGPVLSLNTAKEKDDAHRARTAPVLHFGHSSAWASRYLGRAGDTLASEWRREG
FT                   EQKQEVGDDDVVVVETTPAANDGDANNREGVGKIINLSVAFYVEAKPNDPRVAVDALKS
FT                   IRRHHPTAPVLLVGPPGDDYTVLCRYYVCYAEVWERGKERERGAGALGRGGRLGGGGVG
FT                   ELESPAGSLGGSGSPPRGAGTAVKGATSSISGDGGEWGEERQGSGFTDGGGPPEICGSG
FT                   RASEFVGTIRSIARWAEGKGAEWLVMIDPATRIDAAVTRPPISDANGAEDEHWTKPLAS
FT                   KLLAKAKEITGIDPAYRHSGLCGGSALRVKALTRGRLPKLSSLKGLDDRVDWWHDVALA
FT                   TYFFMNGYAIAPWGDLRENGHPGPAHGPTAFERVANGDGGTAGLVPLEGADRFLFRRVE
FT                   PRVHAGHVPAGSDVFDPSAASRVTESDALAGLDPRTSATGTSSLFQDLAAIDLFAEALP
FT                   WDSGDDESAADGSAVHGGVAAELGLEPFRVRLADVDENGRSTAPTVAPTELHRPPPATD
FT                   PNGADGGYFFVALGPEYVEEAARLVKTLRTAGRDARPAAVLVRRTDESYASSTGVFHRV
FT                   VTYDPARFEDDGLDALAGTNHERGNILPRLRAIDLSPYDEFAFVDTDVLCSAPVDAAWA
FT                   ALRAANQAVAAPGLARDCNWHFGRVCEISEALGLKPQLPHVHAGVFYVNRLKDPAALRR
FT                   FMGFAVEAFERYDELGFARLFREESRVLEICLSYAHHKLGYQPVDFYRSPVINFNVPRE
FT                   EKLPTSWQRLGDGYKDRRSKGGEPYPLTHYFVKAGHKDDYDAQYKALTADRLD"
FT   CDS_pept        complement(865204..865779)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637202"
FT                   /orf_name="MICPUN_62683"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66563.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199BE67"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN2"
FT                   /transl_table=1
FT                   /translation="MPSIWRPNVRVTLDEDGEVEDAERGGEELTKKGTKRKRAPCTKGP
FT                   CEHGVKYRSNCTVCRACPHGRRRSRCKECGGASICEHGRQRSICKECGGSGICEHGRRR
FT                   STCKECGGASICEHGRVRSQCKECGGSQICEHGRRRSTCKECGGGSICEHGRERSRCKE
FT                   CGGSQICEHGRRRYQCKECGGPRISTPP"
FT   CDS_pept        865904..867337
FT                   /codon_start=1
FT                   /gene_family="HOG000100129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637203"
FT                   /orf_name="MICPUN_62684"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO66267.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG557636"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI000199BE68"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN3"
FT                   /transl_table=1
FT                   /translation="MPARASTSAASIAPRVGASRTRQGRCAHSSTRVPRSSAVASAGGG
FT                   AVVVLGTDEADMRVTAQAVRDAMPSCLLLCVLHDDRDGLTRGGVEHALELGPWEGCYRL
FT                   VGASGEDAAVVATDPTEGLARSLGLVPVLCVVGVARETCLGEDANGARTTRAARRAAVA
FT                   GVPTIAVSVPTRSPDAPAAPAASALARLLRAVARVVRTDAPANCPRSHFPFPTRGRWSA
FT                   VGTDQLPLDAALAAQLFARDVGDFAAEDCWSLGGPLHAAAHAQTPNANGGEVGNAPTRL
FT                   TPAEAREVLRDAFREGDVFLSVSVPPRWDVEAGGRFAAARPGVLWRQQTARAAYPNEHD
FT                   GGDGIDGIDGGSSTSRDLWGRTLPVQSLGDARAGEAGARFVRQLATEAAVNGRSEAAST
FT                   STSERRRRSPPRGFRIGPGTVVADDSAGGDVDVVMGNKAAVCAAQTWPHGHAFSLLDHV
FT                   AAEALREDPGTGLPLWLCE"
FT   CDS_pept        join(complement(868054..868140),complement(867522..867776))
FT                   /codon_start=1
FT                   /gene_family="HOG000240133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637204"
FT                   /gene_name="ELF4"
FT                   /orf_name="MICPUN_95499"
FT                   /product="Putative uncharacterized protein ELF4 "
FT                   /protein_id="ACO66564.1"
FT                   /db_xref="HOGENOM:HBG588468"
FT                   /db_xref="InterPro:IPR009741"
FT                   /db_xref="UniParc:UPI000199BE69"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN4"
FT                   /transl_table=1
FT                   /translation="MPDTGSPPGPPEPAGTQPWPGFDKFSAVQGILDRNHALIAEIDQN
FT                   HASRYPEGLQRNVVLIRELNENLTKVGDLYEELSGAFMQRVSSAQSVNPENRNNGDGTG
FT                   WETAEREAA"
FT   CDS_pept        868483..869001
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637205"
FT                   /orf_name="MICPUN_103187"
FT                   /product="Glutaredoxin-like protein "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO66268.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BE6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN5"
FT                   /transl_table=1
FT                   /translation="MRRAATLGLRVALRSSTAAPAAHCSTAYAAPVASFARARHHPSPW
FT                   TDVSRGFAAESDDDFKPKVHATGGDEVQAAIAQDVKENRVLLYMKGTPSAPRCGFSNMA
FT                   VQILNFHNADFASRDVLASEELRNGIKEFTSWPTIPQVFIDGEFVGGCDILRQMHSDGE
FT                   LEKLLKKAA"
FT   CDS_pept        complement(869173..869406)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637206"
FT                   /orf_name="MICPUN_109194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66565.1"
FT                   /db_xref="HOGENOM:HBG607882"
FT                   /db_xref="UniParc:UPI000199BE6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN6"
FT                   /transl_table=1
FT                   /translation="MGCCGSKGQYAVEEPGAYEARREKMLEAADRRNAQSAMRGIQNPR
FT                   SAARLREEQSKPARTSEFQARKDEQMVRDWGS"
FT   CDS_pept        869853..871031
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637207"
FT                   /orf_name="MICPUN_109195"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66269.1"
FT                   /db_xref="UniParc:UPI000199BE6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN7"
FT                   /transl_table=1
FT                   /translation="MARPRLLFLASVAATLVSFVAAGGGESMGEGDCGEKQTWKLKPGE
FT                   EKRCCTSFLMNDVDRFEYKATPVVSGSWGPGSISFWVEEYDHWQDLTQPTKVLKARCNL
FT                   NGSAQTCTGEACVTPGSSGKCKADVDISAKGHEDICVVAKCDIGVKCEDHEVEIKFHHN
FT                   ETEGEDWYDDDGDNNDWYGTGGEDFGDFESLMQCFAVCPTEGDSTFYEGDCGPLADRNK
FT                   DRWCSVDGKAFCCANSSDDCCVDDEAAIAGITIAVVLAISACCVACCWCAKCCCFQYRR
FT                   NIPAQVMYVQGPPGVQMTQMGYPQGTYPNQGYAPGQSQFGAPSYQYTSQAPIAAAPSEG
FT                   NPYPTATIYTATIDPPGASAPVYPTAQAQPQIQYADGSQYTPQQGAGAMPKV"
FT   CDS_pept        join(complement(872422..872676),complement(871489..872244))
FT                   /codon_start=1
FT                   /gene_family="HOG000244083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637208"
FT                   /orf_name="MICPUN_86321"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO66566.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG557639"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BE6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN8"
FT                   /transl_table=1
FT                   /translation="MDARFGSVEECVGQVGVLARDQHGCRFLQRKFDEEGEEAVNLCFE
FT                   EIIAEVVDLMMDPFGNYLVQKLLECCTDEQRMGVLRAVAKDGDGVPELVSVALNTHGTR
FT                   AVQKLVETLRTPEQVALATEALKPGVVTLIKDLNGNHVIQRCLQRLGAEDNQFVYDAAR
FT                   KCCVEIATHRHGCCVLQRCIDHAADGQRRALVQEIAAQALVLSQDPFGNYVVQYILDLS
FT                   LPWANAEVMMRLAGNYAELSMQKFSSNVVEKCLKLADASLEEHRNVVVREIMTSPLLDR
FT                   LLMDPYGNYVVQSTLSVTKGALHSELVDRIRPHLPLIKNSPFGKRILRLLLENKK"
FT   CDS_pept        875307..877070
FT                   /codon_start=1
FT                   /gene_family="HOG000265550" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637209"
FT                   /orf_name="MICPUN_53459"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66270.1"
FT                   /db_xref="HOGENOM:HBG557640"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI000199BE6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEN9"
FT                   /transl_table=1
FT                   /translation="MAVARERVFDIIWHIPLEFERLNFYGGMLCMDATLGVVTSLPVRV
FT                   VCQTARLIMSPALGVVSAVGTLVSPSPSTKTKGGTIGSPGSRRRFNNGDSGRTTSRKRR
FT                   TWGFHPYAREHLSDSLWLFMLLAAFAAAKLVDVSVVYHYIRGQEVIKLYLACSVLECFD
FT                   KLCCAFNCHVLDALQNSVYILVNTAQEDCSTAELINATFQLAFDAALTLAATCAHAMIM
FT                   LTHAVTLSVAINSHTNAMLLVLISNNFGEIKSHIFKKMDAAKLFSVARLDIVERVHLSI
FT                   CLVFVAAQRVTAAGSVAGGLTRKMLKDSLMVLSSEIVVDVFKHAFMSKFNNIRPRVYRG
FT                   FLRQLCREHVKLAQSYRLHRVVGFVPLAPAAVLMKVLPDLYRTLFPSNSSGDFDSGFMD
FT                   EATPAAAGGGGGWFGNMRLEAGILGLVPDPSSFAAYVLFFALLVAFKLAFGVALHWLGA
FT                   HMLETLHGGENERSTSRVGSPKKGAATAVPGGGGGVLGGGGGGDRRSERGHAFVQRSLF
FT                   EPNASSGPANGDGRASADGVGKEDGVGVGGDWGRSGDWGGAAPESPTRRKERRPPTPKS
FT                   PQYPLWSAGGF"
FT   CDS_pept        complement(877179..879611)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637210"
FT                   /orf_name="MICPUN_62692"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ACO66567.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG607883"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI000199BE6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP0"
FT                   /transl_table=1
FT                   /translation="MNGDDPFGRGSGDDDGSFGGARLMDSHGENPFANEGDDDDGEVSV
FT                   TPSASPAAPHDPHVAPAMRPDAIDSRRPERPGQYPRDSRRDLEAPDSADKCSISPPAPP
FT                   PPQFTDHPLSSPPPVPDDLARSVQNVSVADDPLGAPSAATPAMDLGPLGTPAAPDPPRS
FT                   EPAPVAAAPAPAAPSPTPPRPPAAPVATHSASAMGVSYGDLLAPPPSYADSVMYADPVG
FT                   YRPGASSEMHPRVPGDGGFGGTAGAAMSRTTHGGIAHTTGDVRASFAPPPVPGAGVAAA
FT                   PTGEPRQMNSAPATNTNEPPLNLNLAGTPPTPSYVPPTAGRNSPGIYQSSMRGVLETSV
FT                   SDPQASANATGAFGKKIVLYRVAARCDFPEYVLQEHVTWRRFRDFVGLADRLADSHRGY
FT                   FVPPRPDKTLTSSSDEDFVTRRMQQLDAYLRRLASHPVLRHSKELRVFLTAQNLEADET
FT                   WYRMKNKVPVPMPVPMPPPGQAHVMPMPGQENQFGGVNPQQTPPGMTAPYQPPAAPVTS
FT                   PTRSRGAGKFFKEMKQTIVQSTAVGMMGGAFGLETHKPKIVEEDTAFITEKDRVLRMEQ
FT                   ELAIASQKAERVLAAEQKHSDALGELGLECLKLSKMEEEEAGRMGSYTAAGAACQDMAS
FT                   QARKMGNATIRISRLSRSANNASAKSLDPLHDYLGMMPAVRKAVADRAETLLTLQTHLA
FT                   DVDSKKARLAKLEMDFSKMHKAEMLRRELAADEAAAEAARTEYSHIQGRHQEEFRRLEE
FT                   SRSREFKAMWLAFARTQVRHTEKVLQVWRAVAEDMGADPSEWADMSLAYKPTPENTP"
FT   CDS_pept        880164..881483
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637211"
FT                   /orf_name="MICPUN_62693"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66271.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG607884"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="UniParc:UPI000199BE70"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP1"
FT                   /transl_table=1
FT                   /translation="MVARHGAEVIHSMDSTSMPLRGQNVGLSAPTPRHSVSHQQWTNGS
FT                   PTHQPMDDEEDKYAKHAKVPSPRTPPEMPNGSRWGTRRATNGWIGSRSPSRGVATLSGK
FT                   GAGRGRRKKRYPTLALLAALMVLWVFAPAIHHVVTGVHKVFIRGYLFSIERPHHCLPST
FT                   PAPQDLADDDPIANLPPADLADLPGEIPANRKPKVGIVSLCDHNVDAICAASVANKQAY
FT                   ADRHGYDVIVDSEIIDESRPTSWSKLLAMRKYLPYYDYLFYVDVDTIIANVDVKLEDIV
FT                   DYGYDQILAADRNGLNCGVWLIRNTPWSLWFLDEMWAQEQLVAPSTRVLFHYEQRAMHY
FT                   LYQSRVWRRAVKGEPYKGANTIRARTKVVNSCVFNSLPAWYVKGDFVVHLAGLKGIAKC
FT                   LAFRHYYGTARREMTEKYGALTDEANVEPPTLTTCLFGRI"
FT   CDS_pept        881651..882322
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637212"
FT                   /orf_name="MICPUN_62694"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66272.1"
FT                   /db_xref="UniParc:UPI000199BE71"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP2"
FT                   /transl_table=1
FT                   /translation="MSTAASIATPRVSLRIRSGARALRAAPVAPRGAHRGASVPVRAIG
FT                   GKKGASASADGKKAAAKSVGKEKKSSGKTGTAIGESPLSNLPVPLPVAGGGVLVIGVVL
FT                   AKILGGRRGGSVASLEERGALDENRYVDDDKFFSGMMKTVRTVEMPALTEAQIRAARER
FT                   RRQSRDIDASPSTLENVELPANHPFATDAKVSEAERKKLAERVREMNKPRSRGRGRVRD
FT                   E"
FT   CDS_pept        complement(882390..883496)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637213"
FT                   /orf_name="MICPUN_62695"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66568.1"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniParc:UPI000199BE72"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP3"
FT                   /transl_table=1
FT                   /translation="MASLPPDAAEQVRVMKALERDVLAAIDRVVVGGGGGAPSTSGSQR
FT                   RQGRDRWGDDPAHAARTGMARLRRELGELEAIVEEQARPADRSACLEALAERRESHDSI
FT                   RQILRDATLRAADAEANAATSALSEGDERDELLGDAANGRGGGPDKPTDEAGVVGLADD
FT                   ATAGLRRARAMMAEELDKGRRTLAAMAESRATMKSTGDEYAGDQAAALGVGGKLLKQLE
FT                   IQAVRERLVLWGGFAAFVLAALHVVLKRTPLLVRFHPLWWIRKKAATKLKEAKEAAKRA
FT                   ARDAKAAKRSGQTGNAYGEAAATLAAGMAAGMAAGMAGDDATAAGMADVGAAEEYLGTA
FT                   DGEYVSADGIPDVEVGEYTKRDVRGEEL"
FT   CDS_pept        <885950..>886693
FT                   /codon_start=1
FT                   /gene_family="HOG000200843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637214"
FT                   /orf_name="MICPUN_71678"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66273.1"
FT                   /db_xref="UniParc:UPI000199BE73"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP4"
FT                   /transl_table=1
FT                   /translation="KALPGALATAMTGTVVPKFEAATREMFEQVKGAFEKGMDDIAQEL
FT                   YTQKENAIAAEATPLISSLRLASSEVRGAAEALLTMESIPNGGGSKTGPGAKTVQATSL
FT                   EELEATMDPTIELGRLVDEGNYEEAFQKALGMASVETVTWTCGRCEPVRDDIFGAVPVP
FT                   LSQTVLLSLMQQLSSDLDDEPSLKLQWIQAACLAMDPSDQSLAQALPVILGAVFDSLTE
FT                   TAQAPDTPAGVRGDLRLVLHVVNSLL"
FT   CDS_pept        join(complement(887129..887219),complement(886908..887032))
FT                   /codon_start=1
FT                   /gene_family="HOG000220858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637215"
FT                   /orf_name="MICPUN_109197"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66569.1"
FT                   /db_xref="HOGENOM:HBG320504"
FT                   /db_xref="InterPro:IPR008401"
FT                   /db_xref="UniParc:UPI000199BE74"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP5"
FT                   /transl_table=1
FT                   /translation="MSGSDATVTVAGPLLDIVDDEWRADTLPFDEIPLPPGVAPPTDDV
FT                   DDNQENIGKPQPEKWNELALASLANA"
FT   CDS_pept        887478..887849
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637216"
FT                   /orf_name="MICPUN_62698"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66274.1"
FT                   /db_xref="UniParc:UPI000199BE75"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP6"
FT                   /transl_table=1
FT                   /translation="MPQKQLKGAGKKINKIGKKAPAANKHGKGSITKKGKFNFKPKLAG
FT                   AGSSKLLEKIRASKEVSRSINDKNELEAARRATATGGKMAVVRPPPDARVEVRGPKPKK
FT                   INNKGPVVKTPAKTTLNPW"
FT   CDS_pept        <890753..>891505
FT                   /codon_start=1
FT                   /gene_family="HOG000200844" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637217"
FT                   /orf_name="MICPUN_70425"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO66275.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199BF16"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP7"
FT                   /transl_table=1
FT                   /translation="ALGGSLGVGGDHSPGGDSPGDDPLDAVGGLDDVKAALDEALSLPS
FT                   RHPAVFADAPLRLRTGALLYGPPGCGKTMVIRAAIKAAGVRSVAIKGPELLNKYIGQSE
FT                   AGVRDAFRRAAAAAPCALFFDEFDSIAPRRGHDSTGVTDRVVNQFLTELDGVEGLRGVV
FT                   VLAATSRPDLVDPALLRPGRLDRLLRCDFPDVAARLEILEKAARDVGLVDDQRALNEDV
FT                   LGLHAVANDTEGFSGADLRAIVTDARMHA"
FT   CDS_pept        891837..892340
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637218"
FT                   /orf_name="MICPUN_62700"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66276.1"
FT                   /db_xref="UniParc:UPI000199BF17"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP8"
FT                   /transl_table=1
FT                   /translation="MGRGDDDRDRRSSRRKRSFSRSRSRSPDGRGEARGELRSVLNKNA
FT                   ELKSKIAALESMLERRGGGGKGGNARVQALESKLEEVHKDCAGMDAWLSKVVKYASRAE
FT                   ESKKDLKRAEEKLASYLDDERDEDEGDHANGDDKGGKGDATDGGDKVHEERGRWESAGF
FT                   VGDP"
FT   CDS_pept        join(complement(895975..896022),complement(895768..895857),
FT                   complement(892687..895608))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637219"
FT                   /orf_name="MICPUN_103195"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66570.1"
FT                   /db_xref="UniParc:UPI000199BF18"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEP9"
FT                   /transl_table=1
FT                   /translation="MTGTDSKSALGAPRNKMALLNEVAAAPSATHAAGQYGEGGNILTQ
FT                   QALTQPGAHAAFRAPFVATPHPGVPPMFAPYGVYGGGAGSLGPGAEWPRWPPAHRVQPP
FT                   AQLVQLAGAGAGAGGLVAPPAPPPLAVDAKRPWGPRLANEPPQPDPTHGAAGSGSSGGN
FT                   VLSGGAGGGGGSLGGSLGGAGGGGGSLGGSLGGGSGASETTFDSYGRAAPPGMALYVHA
FT                   AAYPGGYPVTGRPAAPWTRQAPVGYPNVPGVSYAPHATIQPPKPPSGFLVEASAAQGSA
FT                   EEKKEPSGGTAPNGARTNGGGDATTNGAPTRGAEDAAVEPRGSNLAHGSNLVHVQSSAA
FT                   AVPASAHNPLATRTKSLLGERTFAEVQTMLLRQQGTYERQLLDLHRVVRVQSDIICSIT
FT                   KQDGVDFKSEQDAACRRKKSKSPDSDQSKELKLNKSEQGSGAGSGDGSGQGSGGGSEGG
FT                   SGDDGSGQGSKGSGPEPGDGSGHGSGGGGGSGQGSGSGGSDVSDGDKGPRRPILKGRRS
FT                   PRGGGGDANKNKNKRATISPEVDKIERDSSRKDSREEEEERAKKDSRGDGARRARSARA
FT                   AAAPEAAPRDEAEEGGAQAAPRCAADANVSDPNSANDGKAGPGAADGGPFAAIFSAMAH
FT                   QTVIKQAARKAFDEQSLQQQRAYALATRPWREEGGGDHRPGDNAAPPSHHQQQHQAAAA
FT                   VHHAQVQAAYHASRQRSLQSLHHQQQQHEHRYYHDQWVAWYSQQYAHAAAAAATQGACA
FT                   PGSMGPPQPKPPPGGVAGLGWTNWPHVPVDWFHAGHQQPPRGEEVTQVIGGPSHAHHGA
FT                   APGPHGAMAARHHYHFPVPQPPGAMFPHPAYPGSGSQGPNPPALNLGPGGGGGGKSPAA
FT                   EVNAGVNAGRSTRGGDDDGKSGARDDKKGNNANNNVNNNAKGKRGKGTKRGAGGGRKSA
FT                   DGKTEDIDDAGSDSMMTGQPGQSDGGEVDGHHHGGRGGGGNGGARGNGTNKKGSLIPGA
FT                   PLTKKPRSGQPKQGPKDQSAADILISIMKA"
FT   CDS_pept        896847..901574
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637220"
FT                   /orf_name="MICPUN_103196"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66277.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BF19"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ0"
FT                   /transl_table=1
FT                   /translation="MYDPGRQSSGGSKMHPGAQLSRRERAAMERMLALEHGGAPPIAMP
FT                   PPELLPRRPPSFVDPTPREPPAVVPTVTRRDPASNPGHALRSAAMPRHHRDDDDDELND
FT                   AVALALRGADAEAELRWLRTERDALRAQVAHWRDASERHERALAERDTHTRQRLRKLGL
FT                   WRLMGRLGLDAQTNPRSRLALAQWLHACRERLRRTGRGGLEVSAPSPAALGVHRRVTGA
FT                   SPGRKLGGRPEDDARAPRPIDDFPDSDSDDGEPGPHRWRDPGPEHTKRRIEARYNGRRN
FT                   GRSADANSLWSESDSELNEGGSVGGDDSESVLSYSTLASTVRTGANPFDDDDDDEGGDA
FT                   DAVHGGVATQLAAAAAAGANSSKKKLGYRTVATAARGLRAADLARLANQRAPPGASTAA
FT                   VLEWRSKAAAAAEELRALQQRAKKDADARRELEDELRTTRDATRSERTKGREQEETLQR
FT                   EIDALRARVRDKEREWSHRLGTESAARAQAEGELRAAQASARTNSATESAAVAVAVAES
FT                   KAREAALAAEVEALRAAVDVHQREWREKVERQERLAAEANRARDVAEFELRAMQESARA
FT                   EARARESAGDAAAAATRREMQLADDISKLRAESDALANSLRDKLAAEKEARDTLESSFR
FT                   ELQASARADAADRDASHAARIEEMRAHADALTADLARARSDAAAAELLFREAQNTVRAE
FT                   ASDALEAARRREQTLETQVQALRDLAADAEADATDRVRRERARVEAEAEARTRAELERL
FT                   RSQANAAEAELRELRDTVRTSDAALDAERRERREALDAEIKRVVSLAQAKERELEARAA
FT                   QLAQTAQLAQTARDAAESELRESQATARAEREAREAAQSAASAKAEEDRARAEEASRDA
FT                   IGALRARAADVEEELRRRLAEAEGARDRAEGEIRSLQASVRDHADALKSLRDAGEEETA
FT                   RAAAKAARIEREANERREAHLTAEIDRLRRDAEEKEREWAAKADAARAAADDAEARLRD
FT                   VQTTARAQAAQTAARGAEELEKVAASARIAASTAADAIAAKERELAEAVAAADAARAAA
FT                   ASRDEDVRRYQRITREAEEAEAGANARLREEAQKLREEADRRERELDAALKAEADARAQ
FT                   AEGALREAQASARGDRAELEAALRQAQASSRRESAARDAALKALEDKERELVDLRALKE
FT                   AVAEERAALEASLRDSQATTRREKEAWEATVESLRRKEQELALERTNATSELERERRER
FT                   ERAESELRKMSDTQREASDELTRFQRELMDKERALEELRRLKEEANEAKEAWSSRLADE
FT                   ARLREGAETQLRELQISAREERNAWEAQAAAEAADRRRALEEERANVSALEEKLAVLAA
FT                   TRAKNSDSGGGDEALLARLEEKERALARAEARMARMAKDLAEAEEELEERDAAADRERR
FT                   AAGGGRPPLALPARSSAEPGAIAADQPRLPPPPTAVAHHRPPSRAGGGSDDGRGVHPVF
FT                   SRVRNNRHGEVEDMLASGAVDPDIRDNHGNTILAVATQNNRKRIVKAAVRAGVPLDAQN
FT                   GQGQSAMHFAYAYGYHELAEYLIRKGANPMVTNVHGLRPDEGLSPDRLVGGNANH"
FT   CDS_pept        join(<901852..901875,902299..>902673)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637221"
FT                   /orf_name="MICPUN_106287"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66278.1"
FT                   /db_xref="UniParc:UPI000199BF1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ1"
FT                   /transl_table=1
FT                   /translation="SKQQLRRKTKTKDVRHVPVPRSDPRRRQGARRQGSGSPRRRRVGV
FT                   PRGGPPRRPRRPHRRRDGHRALRVRHHHPLPGVRHGHRPRERQAPALVQRVHGGVHPGG
FT                   GHQEDGPLAQGEVRYPRGGARAGGGRGGE"
FT   CDS_pept        complement(<906504..>907395)
FT                   /codon_start=1
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637222"
FT                   /orf_name="MICPUN_75663"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO66571.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG705868"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="UniParc:UPI000199BF1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ2"
FT                   /transl_table=1
FT                   /translation="VIDCEGMSVMPGMIDSHVHVTASSADLRKPAFMTPSLLYARSVPI
FT                   LEGMLMRGFTTVRDCGGADHGLAAATEEGTLRGPRIIYCGKALSQTGGHGDFRAAAENQ
FT                   LPFGSCRCCNFTIGRVCDGVTACREAVRDEVRKGCSHIKIMASGGVASPTDRLENLQFS
FT                   EEELRAIVEEANNAKIYCAAHAYTDEAIERAVRCGVRSIEHGNFAKGKTLQMMHDKDVF
FT                   LVPTLITYDRLTKEGVAGGMPQELVDKVGNLVEEGQRTVKQAIDHNVRVCYGSDLLGDM
FT                   HKWQAHGIDLHLRAGV"
FT   CDS_pept        907903..911598
FT                   /codon_start=1
FT                   /gene_family="HOG000265564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637223"
FT                   /orf_name="MICPUN_103198"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="ACO66279.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG557648"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199BF1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ3"
FT                   /transl_table=1
FT                   /translation="MTAVEQAAQGLALPSLRANAEATLLEFRRSPHALPACRHILEHSQ
FT                   VTEAQFQAASTLRDAALRDWTALPPQERSGLRQFCLGALLHRTPPPAPVVASQLMSTLA
FT                   VILKRAWLDDGVDRGAMLSEAEAAVTQASTAAARRIGLQLFAAVISEFSPTTASAMQLP
FT                   WEFHERCRASLETEFLAGLFAHGSQIARSVAESGAALNATDDNVCVASLRLMSAALAWD
FT                   FTRDGAAGGPFGFIQPEGHLRPAGNDRDGEAADAVRITPGVGWRETLLAPGAMDWLFRL
FT                   NTAAHASCARADGASSHGASGSGGNPKVDALAGAARGVVASLCALSGDVFPSAREEPGG
FT                   ETRRRHFAACVRALRAVLLPANAAVALAAAGSATGEENLEDGARALCSLAEVHPVEDFV
FT                   TPLGAMPGGSTNDAADPGSNDQNALGMLGELTLALIAAGALRGEHEGGAMEESLRMLLD
FT                   AWGSLIGRVGQFGCPPELANGAAAVFQAYLHGGLAAVAESAYDDDDGQEEEGKAGAAAL
FT                   DERLSLIAPIARAAPDATLPLLRQALDAKKRALAATTANGADPTTALEELWWLARLVPH
FT                   VLADAFDGEIPLPPDSLAECRARATHEERECPVDALAGEYVQLTCLCLDENARRALSPR
FT                   LLETLTWGSARWTDTYLMSEDTGGSLHAAIFAHNALGGGGEGRVYRGANKAKPAAFSEA
FT                   GGGANVLDALLRAAFVCLTAWPGETGVQKAAASTLLPALTRRRALCRTCVNLPAWKQVM
FT                   DAESVALAHSAAVAGAVPGHQTLHFPPEIHLGLSEALGRAAEGLNDEAQSQEYIARVLT
FT                   PVGQVLSAVAAAPGDMKHPAGESRAIAVIQALRGSVRATIARSQASVFSFFSQSFEALL
FT                   AVQRAGAHSAQVSKLILKLTEELVANQACFLGPAHAGVLCRHCLRVVEEYRASGRGKIG
FT                   ATEGGSRSLRAERVKECYKEVKAMLRMLTHVTNSDNDVEDEETARGDSHRGSVLAAAAA
FT                   GAAASEGRVRGGAGVATSGEALAKVDVAQVVFIGLNTVIPLITDELLTFPKLCHQYFAL
FT                   LAHMLEAYPAKVAALPPDMFNSLMGTLEFGLKHADVEVARESLAAAGAMGSFQHHASVD
FT                   GRAGLGDHNFLSASSGQGTILARLMRTTLSRMIFEDAGMDLVDAAADALLPLMLVERAA
FT                   FEGVAGELLAKLEGDAGAQARVVGALRELTTGNGLTDRVDRANKRRFRRNMSTFLTETR
FT                   SFVRHN"
FT   CDS_pept        complement(912122..912460)
FT                   /codon_start=1
FT                   /gene_family="HOG000231339" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637224"
FT                   /orf_name="MICPUN_109199"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO66572.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG750455"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniParc:UPI000199BF1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ4"
FT                   /transl_table=1
FT                   /translation="MSAALTFSAGVVGTRVAAKAPVARRQVVAATPAHAAQELLGTVVS
FT                   TTPKTATVLVSRKVPHPRYHKLINKSKKFAVHDEENTAKVGDVVYIKQCRPMSKSKKFT
FT                   LGEVVTAK"
FT   CDS_pept        join(complement(915336..915482),complement(914455..915096),
FT                   complement(912711..914126))
FT                   /codon_start=1
FT                   /gene_family="HOG000198161" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637225"
FT                   /orf_name="MICPUN_62707"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="adenylate cyclase activity"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="ACO66573.1"
FT                   /db_xref="GO:0004016"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR008172"
FT                   /db_xref="UniParc:UPI000199BF1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ5"
FT                   /transl_table=1
FT                   /translation="MTIEVSTPSPAGTPPKPPQRESSSSSKKLIKDQLALVDVKTADGG
FT                   TRKEIARFEDDLTFDKGFFLTIRAIQLLKSNSQGRPILVGVAGPSGAGKSVFCQKIQEF
FT                   MPGVCVLTMDMYNDASMLVEGNFDDPRLTDYETLNRNLEDLKAGKTVEVPIYDFKQSKR
FT                   VGYRTQECPPSNVIIIEGIYALSDKLRPLQDLRVSISGGVHFDLVKRVMRDIDRSGQEP
FT                   EDIIHQISETVYPMYKAFIEPDLRSAHLRVVNSFNPFAGFQDPTYILKSTKVVQEDDVR
FT                   AVLSDDYTSVAEQETTDIYLLPPNEDPETCTSWLRMRNRNGRYTLMFEETVCDGDVMIS
FT                   PRIKFEVGVRILGGLMALGYEVGAIMKRRSRSYSDEMLEVKIDWIEGLDRSFTQIQGKV
FT                   RAAVEEAGTKLGLDGTYVPHSYIEQVQLEEMTEELRNLTEEMKDKFVMAANRSSMDIPH
FT                   LERSNSGFGLGSIRSRQERAAKQESVTRLQDAVRKRRSERGNGNGNGDQWGSQDQVFAD
FT                   AAAVLNSPRPPSSQGRRRPPVATPKTQARLSSGALGANGTERLPFNNGGERAPFNGDSA
FT                   ANGRDGGDDSNEHSGGSDQDASGGYGFAAMARATSPSPYRPEAVVGGVGVFEPLHVAAL
FT                   ESRVHMLSQRVDDIAQAHLRSVSAMGSPSMGDQGAAQLQAQAATINSLMQSQMMLTAKI
FT                   DALANSVKMNESEGRMRMYLAAAGGAAAAMLALRLFDSQR"
FT   CDS_pept        join(916182..916340,916487..916627,916770..916874)
FT                   /codon_start=1
FT                   /gene_family="HOG000264605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637226"
FT                   /orf_name="MICPUN_109200"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66280.1"
FT                   /db_xref="HOGENOM:HBG557650"
FT                   /db_xref="UniParc:UPI000199BF1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ6"
FT                   /transl_table=1
FT                   /translation="MSAVDVIAHESLPQDSTFHLDAGIEDPEEYMVVHELLGRGQLLNA
FT                   YEAKMTHQHGVEFGHGILNKGKAQKREKRPPTQIEILAAQEREKQEKKAARKAAKEAKK
FT                   EERLAREEFALTGGNKKMTKKERKRLELDE"
FT   CDS_pept        join(917721..917858,918063..918080,918265..918405,
FT                   918540..918650)
FT                   /codon_start=1
FT                   /gene_family="HOG000264605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637227"
FT                   /orf_name="MICPUN_62709"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66281.1"
FT                   /db_xref="HOGENOM:HBG557650"
FT                   /db_xref="UniParc:UPI000199BF20"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ7"
FT                   /transl_table=1
FT                   /translation="MSTDVAAQEILPKDSTFHLDAGIEDPEEFLAVHELMNRGQLLNAY
FT                   EAKLTHQHGVEFGHGILNRGKAQKREKRPPTQIEIMAAIEREKQEKKAARKAAKEAKKE
FT                   ERIAREEFALTGGNKKLTKKERKRLEQGEFE"
FT   CDS_pept        complement(918998..920683)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637228"
FT                   /orf_name="MICPUN_62710"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO66574.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199BFAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ8"
FT                   /transl_table=1
FT                   /translation="MVSTRDYYPLLVVSPPHFMLRAVPVLAIGGAGRDRPAETDDALPR
FT                   SRPPGSTRRSRAERSKAFVILPASTDADESVWTESERGAVLVGTRKARRARQRSHDRWR
FT                   RVMSVSGVTGTSPEDVQARIVEALAAIEHERGRLDTALRHIERGCKSDVAVDEVKRLKK
FT                   LKLRCKDDAARLRKAASMAAEARTLGEGSFGRVFLGRDVDTGEDVAVKVEDSAAVDEEL
FT                   VCESLSWDEELPRSTVHDETHDDEHGDRTRDVTCAPKTPLTREHDALRRVTGVGFPRVR
FT                   FFGTQRRGLLGSDAPCRVLVMDLLGPSLEDMSWRCAAGGPLSRTTCLMVCDQALTLIHK
FT                   THKAGYVHGDVKPDNLLLGAVGVKGGARTVHLVDFGLAVPGPKEGELDDDEVLDGDTAG
FT                   GEAPGAGDSPPGDSLTGDSLTIASSPPLAPGSGFTQGTPTYSSVRADAGGAATYADDLE
FT                   SLAWTCAYLRAGTSCWTPAIDRSRVEAVLACKATATEADVATDPIDAAWIWALIAHARS
FT                   LRFGQRFDLGYCRDVIDKAFAAETGGAPMAETPFDWEEAGVVVG"
FT   CDS_pept        920864..922414
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637229"
FT                   /orf_name="MICPUN_62711"
FT                   /product="Predicted protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66282.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BFB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EEQ9"
FT                   /transl_table=1
FT                   /translation="MFTSDLETTLMRGSPPLHRAARWGDVARVRQLLLRDEEESSPRSR
FT                   PLVDERDVNGSTPLMWASQFGHDDVVKVLLDDFGADPNLINAFGWTAAEYASTSSAAGD
FT                   VLPLILAAGAPRDATRVVPSAMLGGGHGRLLCDFTPNRIPAPVGPKGPARWANLLTGLR
FT                   RRFARSASQSARDAWRAPAVVKVGGVAVAGCTFKPLGLYAGQRYEIVRLFLRDGVTGEE
FT                   VDVEQVSSHTSSPLGFEPGTSHAPTDSTSWELCATVRNPTWTPWGVSEVGVEVAELRSV
FT                   RDELAWASRVAAGAGAFWLSVAFMCSNDLVSLTSIPSESMAPGVRRGDLMLVDRRRPPV
FT                   SRAESSDGTSINRGTVGGFGVGDVVLFEPPPALREIATRNGTPLRSGEYFVKRIVAVGG
FT                   DEVEVVDGVLFRNGRREASYPTGTPVGVGRNGPTSDETHDGGTCDACKFGRYDLSLRRV
FT                   PAGSFLVLGDNRGGSNDGHVWGYLPEKNVLGKISFRVAPLNRAGFLREAPVGEERDGE"
FT   CDS_pept        complement(922516..925155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637230"
FT                   /orf_name="MICPUN_62712"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66575.1"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="UniParc:UPI000199BFB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER0"
FT                   /transl_table=1
FT                   /translation="MADLRGVACVACGSETFEETDAGFYVCARCGTQSQDVRKDVDDED
FT                   AALSMGLVGRGARSRRVRDPTRARLGADGRVIQRGGDAPKTADDVARERRAEADAIAAR
FT                   VRAYEEGLRRIADAVCQTLVRVHGADPAIRATAANVWRGYVAACGILGKDFGDPATYTN
FT                   PARRFGKRDGRGPTWINGERIATGIATATAVSSTTAKGAADDDDDDDDDDDDANEDSDR
FT                   PESSSSSSEDDDDDEEKKDDHKNANDADGSRSRDVEPTPGKPLTLRRLVSRHLPRRLPL
FT                   AVAYLACVLRREPLHPADFTRWALEGDLPFMAHAADVAKDLRRAGADPSPWPNALTTPR
FT                   ATPLPDKIASCAHDVACTLNIELPPCNALGLCARFASELGLNEDVADACVRLLAAHESD
FT                   GLRAHGRTRTRGCSARLRGVARSRLVSAPPHVHAMAYVVAAINLLHGLDGRAKGGDVDA
FT                   DDAPGWRGRRTEARRAGRNATPVTRRGRRSVPANGSLPANGPAAVERKLTIDPPRGGWI
FT                   AWAERTMREGASAPRLPVRVAEAASRTPAADDDDGASGASGASGASGASGASGASGASH
FT                   RESVDAFLEYCKSHALRGLEDGLPEAHRRTVDALWRIHDARGGADVTSDDGRPLVPPQP
FT                   TAELAPGGDSPGGDSPGAAGRVDLDASSRRIGPIAAHLARRVSTRPSTRAARASAAKLL
FT                   TLVPAAGTGFDPATSDPEFNQPTNKQTEAYVAVVRACAGHAWADPRALHECARDVDAGF
FT                   VAYLQRRGHAGKGKGLGKEGTETWRKGTGSDEDKDAGGVDEYACDVEGLERRFLRAVEV
FT                   PEFPEPAEGGVKEDVPDEKTKTKRRRSSAAAIMPPPPPRLPAAAIAPTTTARKRAAKKK
FT                   RPARVDGF"
FT   CDS_pept        join(925265..925591,925657..926868)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637231"
FT                   /orf_name="MICPUN_62713"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO66283.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG585120"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI000199BFB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER1"
FT                   /transl_table=1
FT                   /translation="MAAPRCSFTAAFVLLCAVAGVGGAASNDTCAYAEWALEDALLEDG
FT                   LCAHVFASGLDKPRGIWPVHGSGCVLVLERGRGRIVALHDDDGDGRADATSVIATQPGV
FT                   NHGLAVHGGYVYASSDTTVWRWPYRAGQRTTSPDSVKEVVVRDMNADGRGGAPGGHTTR
FT                   TLAFDANGKLYVSVGSYSNVDADSHRSRIRRFALTTNTDNAVPVGGFDFQNDGELFADG
FT                   LRNEVGLAFDKRGVLWGVENGADNLHRADLGGDIHDEHPAEELNAFREDDVGKHWGYPY
FT                   CWTQFGTDLAGPGVGAAKGTVWAWPSFVNDGVHTDAWCRANTVPPRVAMQAHSAPLGLA
FT                   FYSHESALTRCPSGQNNKTALPANMDGDAFVGYHGSWNRSPPTGHKVVRVPMTSAGDVE
FT                   GGNVADVTPIDVMKNGKGEGARWANGLRPVDVRFDACGRLLVSDDGPGGYVVMITGAGG
FT                   NGTDGGRARVGGKGATDPTPGLATSGAPRRLRFRALAFVVALALVSNDVRRVLA"
FT   CDS_pept        complement(<927043..>927831)
FT                   /codon_start=1
FT                   /gene_family="HOG000230189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637232"
FT                   /orf_name="MICPUN_69613"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO66576.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG292583"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniParc:UPI000199BFB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER2"
FT                   /transl_table=1
FT                   /translation="VAAWVGAAVAFGLGVGAVMGAEKAEEFFAGYLLEQSLSVDNLFVF
FT                   VLVFDYFKVPLASQPRVLNYGIWGAMVMRAAMIIAGYEAVTNFKPILLVFAGVLIFSSY
FT                   KLIAEGEEEEEEDMSENAIVKFCSNLLPVSKDYDGENFFTTENGAKIATPLLLCLCVIE
FT                   LSDVVFAVDSIPAVFGITEDPFIVYSSNIFAIMGLRSLFAFVATMVAELEYLQTAVAAV
FT                   LGFVGCKMVVEFGGVEIPTEASLAVVVGMLGAGVALSLAKK"
FT   CDS_pept        complement(928649..930190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637233"
FT                   /orf_name="MICPUN_62715"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO66577.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG714057"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniParc:UPI000199BFB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER3"
FT                   /transl_table=1
FT                   /translation="MATAVATRMATAALNRALRRRGIGGGAATATRDATRLSPASRVHP
FT                   RVGSARGFATRRSGVAMRGWRMGEGSSGVADETDGGDGDGARPASGWANAGARARGRNA
FT                   NNRSGGSRERRAPPSRRYADDERGDYGSFDDDGFDDDGFDRGRGARGGRGGRGSNRGRG
FT                   NRGGNRGAPRGRESYARPEYDDASSFDGTPDGTRTRWQTRHDEKKAARHARGDLTLAER
FT                   VRGEAVFGRNPVLAMLAARRREEISAVWIQEGSDASRDRALLKAVQARGITPEYASKHD
FT                   LNMLVGGDGRRPHNGVVADASPLTPTPIDSLPLPAEWATDRAGDGSGSSVDDNQSRPSD
FT                   PPVWLALDEIVDPQNLGAMLRSAHFLGVAGVVVCAKNSAPLSPVVSKASSGALERMDVR
FT                   SVGVMPRFLQRCVEEGWDVFGADNAPDAEDVTAVSVARPSVVVVGNEGAGLRTNVRRAC
FT                   NRVVRIEGGGGAERGVGEAGVGEGSEGGDTVDSLNVSVATGILLHSMLTSSRARR"
FT   CDS_pept        join(930479..930495,930701..932363)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637234"
FT                   /orf_name="MICPUN_103207"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO66284.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG607905"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199BFB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER4"
FT                   /transl_table=1
FT                   /translation="MDPRSRARDRGGGSGYDDPRNRGYRDARDDAPPPSMHGPGPAGAD
FT                   RFHPYGAGGGGHGGGRNLGPLPPPPGVGGGARGGYGNDGGYGDGGGYGGGDPRMTRGGG
FT                   GGPPPPPAAVGLPPNLDLQGILNSVQAATQGGQGGGPPPAPPAQGGYGGYDGRGQGGHD
FT                   PRYGPAMTGGHPPPPPVGYGGGYGGSYHDQGAPRGGPPPPPGGYASAGGALPRGGGGGP
FT                   AGVTHDQPLPGSAREEVMCPASCAGKIIGHGGDTIMSIQKKSGAHVKIQPAHEVPAGAP
FT                   RRIDISGAAGPVADALQMVNDILRESAIGGSGGGSGGGGGSRGGGGSGGGASVELDVPV
FT                   PAEMLGRVIGRGGETIRRLQEESGARIQVERDANRVVIRGSADNAQRAKELVLDIVNTP
FT                   PGQASASGIKNDFVRHVMPAGGCEGKIIGKGGDSIRELCARTGAKIQIDKDAATVTIQG
FT                   KQEQVDAAIALVQAIIDEGPQIYMRPGGNPGEESRPYVPRSQMGGGYGQDTAAGDGTAV
FT                   GDAGVPKPLWETHKSPEGYTYYYNTTTGETTWDQPEDYDGVS"
FT   CDS_pept        join(932575..932593,932732..934617)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637235"
FT                   /orf_name="MICPUN_62717"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66285.1"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI000199BFB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER5"
FT                   /transl_table=1
FT                   /translation="MAVNGAGPMIALRREPFDFGILPASFLLPRAESVAALVPIQRRLL
FT                   QCAHPSRHDPTKLVVSVADAAQCMGIAPQHAEHVIDTMHAVAPAEPTPHPAEDDGLPNE
FT                   PEVRVQHLLQFLFVQTFARPHAQSSLRENGSGLELTGFHAEAGGGGGPDETGNGISGTL
FT                   GTHGYPSPPRGGANSSPHGSPAKRSRSANGAHVERDRREDQLREAFAVHHFNALAGLLV
FT                   EDESRANNADGGGGGGGSFVGHGGHGGGVVQLTASEVDALDFMFREVRPRGAGSIDDDD
FT                   DATDATDGRRAGRLSASTGLFADGLVPSTAIRDWIARSLAPVERSSDPGSPLGSPRRVA
FT                   GVLSGTGTHAPASGDPGSTTIEVGGLHRGTRVVREGDAQLCTGSSSSVVVRNCVDSVVY
FT                   LLAPFQYATVANCVDCVVVVGACARALRAEQCERLTLIAASKRFVSKMCHECSFHLGVE
FT                   RAPAFLGENRGCHVAPYNTFYEQLERHLESAGLEAGRCARWDCPVVLGGGGEDSTDRLG
FT                   GGVDKLPAEKFSPFIVPFRGQNPNASSSSSSSSGGQGQGTRPPTQANPFAVPPEYVRAL
FT                   DAKVKAVASLRSALRDAGLDERSRRELQATIQAFFKEWLMTSGSMRQVYDLARIERGE"
FT   CDS_pept        complement(934700..935179)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637236"
FT                   /orf_name="MICPUN_86534"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO66578.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199BFB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER6"
FT                   /transl_table=1
FT                   /translation="MSVTLHTNLGDLKVELFCEDAPRTCENFLALCASEYYDNTSFHRN
FT                   IKGFMIQGGDPTGTGRGGQSIWGGKFPDEIRDNLKHTNRGVMSMANSGPNTNASQFFFT
FT                   YVKCPHLNGKNTVFGKVIDGFTVLDMMEKTPGDEADRPLAEIRINRVTIHANPLA"
FT   CDS_pept        complement(935322..936371)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637237"
FT                   /orf_name="MICPUN_62719"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66579.1"
FT                   /db_xref="UniParc:UPI000199BFB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER7"
FT                   /transl_table=1
FT                   /translation="MVQPPPIVGAVRAVADPVPPVAALRPEGCHRSTPGCDDDFARESL
FT                   AIAPTVVDARAACAQPPPRHHRGDAIEQGAGPVTESAVVPEPPVQHAVQLSPGVYYVSP
FT                   SPSPANTSWRRDRRARLAGTFEGFAPPPFGRPFDPAFRYVRVGVRGLGAIEREVPGMPE
FT                   GTRRVWISFTFPAAEAFPEAFLAAAGPNVRSRNVPSSFLLPKLPTGGGAGSPGGTNGTN
FT                   DDDRDVIFVTAVDLRRFIASREASRVSIIGALCGAMCCLAPVATNDYGIGYPPGWPHRL
FT                   NGLGDHRHLGDHGAFGVVDRPCDEDPNVPSTGIGDVAACIGAADLAGEGGDGGGCGGGG
FT                   CGGGGCGGE"
FT   CDS_pept        936566..937885
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637238"
FT                   /orf_name="MICPUN_62720"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="ACO66286.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI000199BFB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER8"
FT                   /transl_table=1
FT                   /translation="MGSEANIPDATAVLGTWLHVGSQESVAEERKERLVAAGVTHVLSV
FT                   MKRPPPWLSSSGPGPMKLPFAHMHVKVEDTRAADISAHFDETGAFIRACEASGGRCVVH
FT                   CAFGQSRSVTVAAAYMVTHRDMSLGAALEAIRSVRPCACPNPSFMTQLVRHEMATTGAP
FT                   PSDLRDFPSLPKPWRFVAWRDPLRQNQRFVSCHGRLMKVKQVSRHPRLAVIHNFISKEE
FT                   AAAIVDVAAPELHPSLVVRHQTAKRGDTAGGDTAVHGEATAGRTSHNCRVSSSHPIVRA
FT                   AIQRAAYLCGLEPSHAEPAQVVRYLPSQEYKPHHDWFDRAHPESFRAKTEGRGGQRAVT
FT                   CLAYLVEPERGGRTYFPKLRAGFEPKVGDALLWWNVDENGAEDFKTLHAGEPVEAGAKW
FT                   ALNLWLREKPRRGEEGNAGTCEKEKDAVDELADGIAKFRM"
FT   CDS_pept        join(complement(939253..939372),complement(937981..939093))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637239"
FT                   /gene_name="EB1"
FT                   /orf_name="MICPUN_62721"
FT                   /product="Microtubule end binding protein "
FT                   /function="microtubule binding"
FT                   /protein_id="ACO66580.1"
FT                   /db_xref="GO:0008017"
FT                   /db_xref="HOGENOM:HBG622485"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="UniParc:UPI000199BFBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EER9"
FT                   /transl_table=1
FT                   /translation="MAAANASSIGLQHPAFFVGRAELLDWVNGLLNLRLTKVEQVASGA
FT                   VHCQILDACHPGVVNMSKVNVNAKSEYEMVANYKVLQSVFDKLKITRNIEVNKLIKARP
FT                   LDNLEFLQWMKYYYDCATGGMGPPDANYDGEERRAHAKGAGSAAPAKKPASSSKQQPST
FT                   SASAAAKKPTATARGVPTASSSNAKVATLQKEIESLKLAVERAEQEREFYFEKLQDVEF
FT                   LCQRPEFVGQHLTCVVERILYHTEGKPDVEAIIAECATGADGAGDAAVVSPEEAGVAPV
FT                   AAPPQAVEPTDVETPPAYVEETAAVEDEPAVKEEEEEEETIGKPDVEEDAVTEEIDGGT
FT                   GAAPDLDVTVEADERAAADEDDDEEFNSEDAPGDVTMNDVAPSPAPECAPRPDAAAATR
FT                   EPLGPVQNVNA"
FT   CDS_pept        join(939818..940077,940376..941900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637240"
FT                   /orf_name="MICPUN_62722"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66287.1"
FT                   /db_xref="UniParc:UPI000199C063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES0"
FT                   /transl_table=1
FT                   /translation="MAVSREIPPFEPTTRNTQTTRKSDVIRDPEPLLRAASDTARACDP
FT                   SRSQIRSTREPKKAIPASRDVNLREPAPWPSSRDCEIPGQFSKQKGKTMLEKLVPIPPE
FT                   FYDDHKDEDLITGKGTIFPFAVFLYFMQWAAFLGFCLFYWYHPSSQVTQSKLENNWDYG
FT                   RHAGWNCTPMLNDPFYRARYNHDTCKELMLKPTEVKTLKINVDPACTPIENSTGTFPCE
FT                   NATAFRFIPFKGMEGLGGKRGVVQPGSLIDNTYDSTDTNGIQAELEKIFAPLKELNTCG
FT                   SIGFHWKNKGGWGKSKVDKMASFDIFVDQMKKKDPSPPPPPVASPPPPPAASGSGGHGT
FT                   PAPSGGGGGTPAPSGSGGTACCSTGNVGATAKCTGTCQFGAMGPCLASASEIDCEDNSN
FT                   CGNSACSADPCGAGCPSGRRRLNFAMDAMMGGMGDMGDQQEVDAGGAGCGPIPTLPDGS
FT                   CDYSGSTAPAGQFFIPGGGTINLSDLANYGFDTSDGSTYEPCSITKAEALLMFEKYMTT
FT                   HDPCEWAKHNAPYMCTKQGPPAPSAVFSLAYANALLAYSIFSAVCVQVFFASSKKKKKD
FT                   VEETPAAGDGKETPATAV"
FT   CDS_pept        complement(<942409..>943053)
FT                   /codon_start=1
FT                   /gene_family="HOG000200845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637241"
FT                   /orf_name="MICPUN_71386"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66581.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748611"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199C064"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES1"
FT                   /transl_table=1
FT                   /translation="WIEQISWEPRAFVYHNFLTPEECAHLVNLAKATDGGLKRATVADA
FT                   RTGGTFPGSGAFLLRNHDPIVTRIEERISAFAMIPADHGEGMRILRYGRGEKYDPHHDY
FT                   FDDGDKNLRFYGQRVATVLMYLSDVESGGETVFPKHGAWIEPDEMDVRGRSSSKDSSKC
FT                   AKGALHVKPRRGDALLFHNCHLNGREDPTSLHAGCPVLRGEKWTATKWMRAG"
FT   CDS_pept        join(943638..943712,943826..945043)
FT                   /codon_start=1
FT                   /gene_family="HOG000264571" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637242"
FT                   /orf_name="MICPUN_106290"
FT                   /product="Predicted protein"
FT                   /function="glycerol-3-phosphate O-acyltransferase activity "
FT                   /protein_id="ACO66288.1"
FT                   /db_xref="GO:0004366"
FT                   /db_xref="HOGENOM:HBG320011"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016222"
FT                   /db_xref="UniParc:UPI000199C065"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES2"
FT                   /transl_table=1
FT                   /translation="MAALASASAVSLGALPRASALSRQQRRAVPARGRRVVTRAAVETA
FT                   EKDPLEDLKVGAAKLVISLLPNEGGLRWVGGLLPSKFKSTFDGLVTSYKKQMLLALKGD
FT                   EERAGRALTSIFKDMLTAYSGQIIGTPFEFPSHHLAIREPFDYYQMANAYIGSLIEFDR
FT                   SILRYPERWTKVQEQLAAGDNVIMLGNHQSEGDAAFIPLLTEVSHPGLGEQVTYVAGDR
FT                   VVTDLLCKPFSMGKNLLCVHSKKHMDDDPSLKSAKMKQNLNTVKEMQRLLKKGGLLIWI
FT                   APAGGRDRRAPDGTITPDNWDPAAVEMMRKLGTKKGAAKTHYYPLAMATYDIMPPPATK
FT                   EKSIGEERVVNFTGAGLSLGEEIDVDPATGEWAKGLGEDADKAEALTKYVLAKVVDEYR
FT                   AIEACNVPGGGPVALPEGAVRPTRPPSVPVF"
FT   CDS_pept        complement(945225..945731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637243"
FT                   /orf_name="MICPUN_62725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66582.1"
FT                   /db_xref="UniParc:UPI000199C066"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES3"
FT                   /transl_table=1
FT                   /translation="MTMCGKRARERSMDASEPPTNASSPLMDLMLHAPDVFHEGITSRL
FT                   EYGDLFSLAAVGAACRDEVRSLDDVDLVRSVRSVCPQYLWGSWARWLERGCVKDCCRGK
FT                   PRGFFASVFDEAIRDRDAPKTPPRLRRSVTECDESLARHKIQRHSTRIPEGQGRASFAF
FT                   PVAWL"
FT   CDS_pept        945817..947061
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637244"
FT                   /orf_name="MICPUN_62726"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66289.1"
FT                   /db_xref="UniParc:UPI000199C067"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES4"
FT                   /transl_table=1
FT                   /translation="MRFGQRSRGRPISSARATLARAMGCLASRPRVDDPADTSRASPSD
FT                   PNARASPSASVRPGTAPAATTHRRRGARDNLRVRVPGDDDDGESSGGDDPDAVRAIVMV
FT                   QSPDIVSNAAASTMRASRGRSSLYESTSRAVACPREETRASTRRGSSSSSSSSAAARSL
FT                   PGSVGSRCGGGEGSTTPDAIELERATREVREACAAVAATCAATATKSSSSSSSYSSRSS
FT                   ASSLAGSSYSTGSSIRDDPRAPYRRDLAAVELDVIAAVARLRDGAGSAEERAPAEVSLS
FT                   RNRSKNSHVTLSVGVEDPSPSDAIGVGGYENAQKKAHPPCRPPRSIARVGTLPTSARRA
FT                   AAAELVRKAMRRYEASGRRGGSAQPAGGDERVGGGPSKFDERGGAPPSKFDEKGGGGVV
FT                   RARPGAPRRVTPIQF"
FT   CDS_pept        complement(947244..950777)
FT                   /codon_start=1
FT                   /gene_family="HOG000265560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637245"
FT                   /orf_name="MICPUN_103214"
FT                   /product="Predicted protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO66583.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG557663"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C068"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES5"
FT                   /transl_table=1
FT                   /translation="MSNRLGPGDLVVIAGGGISGLALAAALQSRPADRRPEVVVLERDP
FT                   SFEARRQGYGVTLSETNAALAGLGILRDLRERNTRSSAHWTFRSDGRVLGYYGAAFLPE
FT                   AMRKPSPWTNLRVPRNEVREVLASRLLPGTVRFGRRAVGYVEVDGDGNGGGRVDVAVET
FT                   VGRFGSEKRVGGGAGRPEWTENADGDGDGDGDGVGTGAESGVPTTESLRASLLVACDGV
FT                   RSAVQRERLRGRTDQNLNYLGVVLVTGFTTLSHPLLDGQGFYTLDGERARIFTMPFKSD
FT                   DDARGRGAGWERFSRESDETVPMDHPAGQSDEIGMDRHPSAAGKDAAKEAAGSHRARSR
FT                   RPPPLTMWQISVRVTEEEARRIASAPRSGPGGAKEFVQSVVSGWHDPVPAMFAHAIWEE
FT                   SWAGPLYDRDRPPPPPTGKDARSRVVAIGDAAHPMSPFKGMGANSALFDAWSLASWLEK
FT                   APVPRAIANFEREMIARAWAKVDASREAVDLFHGPAAVAGETPEFAGVAPELAKTFLKT
FT                   LGEKGVGAGCGGSLEGRVREAMAELGVPLDESASAKPYAYLRSEAGGGKGSETGSGSAA
FT                   AARSSSSSEAADADDSFEALTNVVDGAVRAGLAAAGADPVRDGFESFAARRLVPAKKYS
FT                   ARGRPAHDWVSRAALKIVHARRGGGGAGEGEDPGAARIAGSIESSEAGAGDSPPGESPP
FT                   GDSQPVSSAARKAARRERLDAANRCVAAEIARVARKICDELRRARHVIADARVDDDGQI
FT                   AITTAARHAALRAKGLVACAGCGQYYAMHGGGLRQHWAMGGINDACAAAAEGARSPYMT
FT                   DEEALVAAGRANGINSGINSPETHLEGVAGSAQTHPGTSAENHSWRGSGKGRPGPWRER
FT                   KSGKEPHDAGLRAAAAGDVAAMEKLQSEGAFDPTSAADAYGSGALHWAAGGGHLAACDW
FT                   LVNVANVPVDGSRRKDGRTALHWAARNGHLDVIKWLVEKGGADPNRKTYDGDGAFSLAV
FT                   WQGHLPVARYLGSLDAVDPGATNRWGCNALLWACIQHDPTGGGGGGVGTMRGFRTEKGT
FT                   SDGGSVGDEPSPKGDEPSPKGDEPPPKSPMATVRWLVEELGVPVDVVNVNGHSALHKCA
FT                   IYGHGDVIAWLLSETKCNRAEHMGPDDRGSPPSALAAANGYDTLAAELRHVEDRTMRLP
FT                   VVYHERVGDGA"
FT   CDS_pept        952681..953742
FT                   /codon_start=1
FT                   /gene_family="HOG000017552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637246"
FT                   /orf_name="MICPUN_62728"
FT                   /product="Predicted protein"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66290.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG745683"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniParc:UPI000199C069"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES6"
FT                   /transl_table=1
FT                   /translation="MTEDAGRLRVASALEATGAYDGPVDLDLGNLAASDPAPVDPDVFG
FT                   RAPSDSATAAAISRGRDVLQRLVADLFTLPSEADVNGRYVELPAGATQFPRTKPLPPTE
FT                   KPMTKWEKFAKEKGIKKRKRSKLVYDEQTDEWKRRHGYDRVKDADRIIIADAKMSDVPG
FT                   KTEDPFTREERERRERVEKNQGKQLKNLQNAVATHGKHVLPPTLQMSAAPKKGVKALPL
FT                   NGMKKQQIRDLTAQVAKSTASMAKYNAPIPGDEKIKTRGRRRQFDSVTDTGTERERAQG
FT                   FIDKLVRREKDFTVDVNVAARKIQRAKEAENRSAKKAKLLEKDSGAGGKGGKHGKSAAG
FT                   LKVKGMKGKKGKK"
FT   CDS_pept        join(complement(954634..955356),complement(954040..954534))
FT                   /codon_start=1
FT                   /gene_family="HOG000223049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637247"
FT                   /gene_name="ASP3"
FT                   /orf_name="MICPUN_96669"
FT                   /product="Aspartate aminotransferase "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="ACO66584.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C06A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES7"
FT                   /transl_table=1
FT                   /translation="MVANEALAASLRASQVPPFKVMEVMIAAHARELAGLPVLHMEVGQ
FT                   PSDGAPAHVCEASKRALDACAAGRTTLGYTISDGIDPLRAAIARDYETQYGVAVDPADV
FT                   MVTTGSSAAFVLGFTAAFDHGDRVAIATPGYPAYRNILEALGVEVVSIPVDASTNFQPT
FT                   VGLLDAALDGKPIKGLIVASPSNPTGTVLTRAELFELIDWCKSKKVWFVSDEIYHKIEY
FT                   GEERATTALEAPGGAETCLVINSFSKYHCMTGWRVGWAVVPPALQPAMRALQQNLFINA
FT                   PNIAQIAAAAALDPECDAVLRGHVAKYARNREILMAGLPEAGFTKLSSAGGAYYIYADV
FT                   SDLSTDSIALCKRILDVTGVACVSGVDFDRERGHHFVRFSFCGSTETCEEAVRILREKR
FT                   EEWQKH"
FT   CDS_pept        955681..956796
FT                   /codon_start=1
FT                   /gene_family="HOG000221564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637248"
FT                   /orf_name="MICPUN_62730"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66291.1"
FT                   /db_xref="HOGENOM:HBG300839"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniParc:UPI000199C06B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES8"
FT                   /transl_table=1
FT                   /translation="MSAPFARPSASIATPRIHRTRRERLRLDVAPSSKSAVPTTTTTRL
FT                   PAPTVHRASVPTRAHARGGATSSAATSSGASSPVSASSPLGVHALVWTGGWSEADAHDA
FT                   CARTAAAGYDIIEIPLLNPSSVDVAMTKNALAAHGLRVATSLGLSFDADVSSDDLSIVA
FT                   KGNELLDAALDVSVGIGATHMCGILYSALGKYPNGCTATGRANAVAAIKRLAKKAADTS
FT                   DVVLGLEVVNRYETNLLNTAEQAMAFLNDVDEPNVKIHLDTYHMNIEERSLEAAVVLCG
FT                   DRLGYVHVGESDRGALGMGNVDFDSLFRGLRRVDYDGPITFESFSSDVVSPDLSDVLCI
FT                   WRNPWGFEQRDELAVDARSFVLGMMDKHGLR"
FT   CDS_pept        complement(956896..958293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637249"
FT                   /orf_name="MICPUN_103218"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO66585.1"
FT                   /db_xref="UniParc:UPI000199C06C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EES9"
FT                   /transl_table=1
FT                   /translation="MTDAASEDPRRGVSTAGVHPAAEMIAREERREPPGGAGATKEHGD
FT                   SNEDVRTATHSEEDERSDGRSGGSLGDDEDDDVDDNGDDDGSNSPDFEFPAASAAAAVA
FT                   PVAEGIPPATSVPNPNPNPPEESAPSESAPRTDHPGTLARLQRLAAVATGELANLRDEL
FT                   AHERARVREYAAKLTELRRSTRTMGETAQAKALAATNAINAAVNARDVAEAALRTMGAE
FT                   VEAAKLANELVRAAEERAKMAEDRAIAAESRAATAEARAVRAEADAERAACEVRVARRE
FT                   VSSMPKLDTDEVRALVRAAEERAADAEERAARAEASTASARSALLESNDAVARLEARLA
FT                   KCRADAVQRAGREGRRDFNRGPGADRGDGCGRSPGDEKTFASSGVDEEKRGRAERRDAL
FT                   VRALDATRGRLRELQLRDAGGDGGALSRFKMSRFRDVSTPTPTKKKAPDPTDRFRPSPQ
FT                   KVRPGTD"
FT   CDS_pept        complement(958520..959110)
FT                   /codon_start=1
FT                   /gene_family="HOG000100130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637250"
FT                   /orf_name="MICPUN_109205"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO66586.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG714389"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniParc:UPI000199C06D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EET0"
FT                   /transl_table=1
FT                   /translation="MGACFSSPTGGGSTDAEVLFFPDAAGMPCRQHLAGKECRRANCTY
FT                   AHADTSLVKLLRRIDAASKTLDVCVFTITCNEIADAVVRAHERGVKVRVISDDEQAHST
FT                   GSDLRAIADAGIPVRTDAASTHMHHKFAIVDGATLINGSFNWTRQAVLGNQENVVIARD
FT                   AKLAGVFAKEFDSMWGKFRGNEYGGRGGGGNRA"
FT   CDS_pept        959316..960443
FT                   /codon_start=1
FT                   /gene_family="HOG000021658" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637251"
FT                   /orf_name="MICPUN_109206"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO66292.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG745472"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI000199C06E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EET1"
FT                   /transl_table=1
FT                   /translation="MLALVNPARGIARRGKPPPPPPSSSSPSHSSAPRLANAVARSAPP
FT                   ARRRARLAALARPFPVGEDAASKSASDASGATSTPNPPPPPPASPPAARRRVRARDFRH
FT                   PLDQQNTQLLQAVPGLSQITKSLVTPVAEQMLVLEQISTSVLVGPAQLPHVHKLVLDAS
FT                   AVLDIDPPQLYIRQSSQPNAYTLAISGREPVIVVHTALVELMTAAELQAVIAHEMGHLK
FT                   CDHGVWLTVANLLTLGAEIAPLMPAFVADNFRDGLMRWVRAAELSCDRAALLVAGDPRV
FT                   VVSVLMKLSGGCPKLSGQLNVDAFLDQARRYDDESSSPLGWYLRNAQTRQLTHPLPVAR
FT                   AREIDEWARSEEFARLGIEPAPTPEELELWSPEAA"
FT   CDS_pept        join(961565..962709,962828..962897)
FT                   /codon_start=1
FT                   /gene_family="HOG000204376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637252"
FT                   /orf_name="MICPUN_98102"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="polynucleotide adenylyltransferase activity "
FT                   /biological_process="RNA polyadenylation"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO66293.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004652"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0043631"
FT                   /db_xref="HOGENOM:HBG594063"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="UniParc:UPI000199C06F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EET2"
FT                   /transl_table=1
FT                   /translation="MDLKLSADLEARLHLENVFEAPEECTRREEVLGEINEALQQWCRA
FT                   RSASKGIEEDLDPRCNLYTFGSYRLGVHGPAADIDTLCIGPRHLTRAEDFFGSEWTGYE
FT                   GSFYLEMKNHPGTDQVVAVPDAVVPELKLVFRGFEIDIAYVCMGSYVSVPEDLDVCQTT
FT                   ILQNLDDASVKSLNGCRVADQLLRLVPNHDAFRIALRALRVWAKERGVYSNVLGYFGGV
FT                   NLALLVARVCQLYPNAAPSMLVYSFFQLWDAWQWSTPVMLTPIVD