(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_9

ID   MICSR_9; SV 1; linear; genomic DNA; GRV; PLN; 832468 BP.
XX
AC   CP001332_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 14, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001332.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..832468
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 14"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        726..3101
FT                   /codon_start=1
FT                   /gene_family="HOG000218327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631355"
FT                   /orf_name="MICPUN_88427"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="polyribonucleotide nucleotidyltransferase
FT                   activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="mRNA catabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO67126.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004654"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006402"
FT                   /db_xref="HOGENOM:HBG382411"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199C134"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGG8"
FT                   /transl_table=1
FT                   /translation="MSAFGRSALRGFAATSDDAKPDGGGCEPTFKGAYCESVAVELGTE
FT                   RTPVRVGFETGRVARLTDGAIVASMGDSRVICAAVCSRDENPDAGFFPLQVDYRERHSA
FT                   FGKIPPTFTRREGAPKDREVLAMRVVDRAIRPLFPKSFSRDTSVQAIVLATDQSQDPAV
FT                   LAVNGASAALSVSSIPWNGPVGAVRVSVLGDGNEIILNPSDKDVEASKLTLFYAGNENR
FT                   TLMIEAQAGTADEGGVPESVVASALRAAHEAAKVLIEPQRRLQRAIGKEKLDPVQQTPE
FT                   QAKLRHDVFDRSSEKLRALYKEEIQCKHTRGKRMAELKDEIVNSMTEEGMSFTNNDVEQ
FT                   AFFWVSSRVMRDMIFEDKKRVDGRGIRELRQLGAESNVLPVVHGSSIFERGNTQALATV
FT                   TIGKLIDAQKLDAPVGPDNRRMMLHYSFPSFSINETPRRGGLSRREIGHGALAEKSLAG
FT                   IIPAAKEWPFAVRINAETMESNGSSSMAAVCSGSLALMDAGVPIKEHVGAISVGLVMDE
FT                   DEQTGKVTRYELLSDIMGLEDVLGDMDFKIAGTRGGITGIQLDCKPAGIPLDILIEAMD
FT                   VASIARSAVIDEMDRAISKPRSRDDSEDGAQFTTVRMDRSLIGRLIGPKGDTIRELERT
FT                   TGAKVSIHEEDDAGVDDQCTLGIFAGTRPGLDAALEKIQLIAWVPKEGDVVKAKVVNQL
FT                   AYGWFLRLPNEQDGLLHASEYLHTRKVDPMKDNIFQIGEEVLVKIKDVSDGRVGLSVKA
FT                   LSPAPEGTEVGRRGSRAGAGFERNEDGSLKRPLRRLKD"
FT   CDS_pept        join(complement(4607..4657),complement(3419..4472),
FT                   complement(3343..3383))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631356"
FT                   /orf_name="MICPUN_63867"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67322.1"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI000199C135"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGG9"
FT                   /transl_table=1
FT                   /translation="MATHSDAVDEYYYEDLEQNVQGPYPWSNLDEWSMKGWFKDDVKVK
FT                   RGSNGKWITLKEARLERMGAKTADAAAKAMPPPPAKPSAPAAGNGSNLDLYPNFKPSAC
FT                   YTEDIDDRIRRMIREGKFDAQIKALRAGLDEDKLVGDVSMAALRGVADDSSKDAAATEK
FT                   QGGGKRGRDEGKAGEDGDQGKKARTAGKFPVKEPKVPVEIPTEKQDVVDPRVRSEPPKS
FT                   KGGKKKKNTDDEKPTLDLPLPIFAEEKEAGEAAPEGKTGKTKDDGYQSDDSWDKKPGIL
FT                   EDPEEIEREKREKELERARREEEARAAEERAAQLARAEAEARARKKEEEELLAKIDPED
FT                   LKIAKLARDPQGGDWSLPNPNDGWRWTKAWWWKDDGGSEGG"
FT   CDS_pept        join(4800..5481,5554..6137)
FT                   /codon_start=1
FT                   /gene_family="HOG000005746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631357"
FT                   /orf_name="MICPUN_98290"
FT                   /product="Glycosyltransferase family 76 protein "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67127.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG558457"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniParc:UPI000199C136"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH0"
FT                   /transl_table=1
FT                   /translation="MVLSVWRAATLARGCTLAFMIAFDLIVDDYDTSGSLSPGPGPRDP
FT                   SSSALCRRAEGLVTWDSVYFARVATNGYEYEQTHAFFPLLPWLMRALSPLFGGGSCGVA
FT                   VSGLAVSNAAHVASAVALERLGTSILDDEVLARAAAMLYAFNPAAVFHSAIYTEPLFAF
FT                   LSFTGCLLLARTRKNAACVAFALASLARSNGVLNLIHLAFDFWRSALAPALRQMRRLWG
FT                   EEEEGGLATASFVFLARCVSVLAPTLWFQWMGYRTFCLGGGDPNGYYAANPRPWCASWR
FT                   PFPNVYAFVQDHYWNVGLFRYYSPKQLPNFLLALPALGASVHAARAYVKGADEDATWTR
FT                   KEPLRPFMFQWCVMALAAAAVMHVQVATRFLSVSPAVYWYLAKVGANEGAGTRKIRRIV
FT                   STYCVVFGLVGTLMFPTFYPWT"
FT   CDS_pept        join(complement(6820..6939),complement(6649..6703),
FT                   complement(6201..6553))
FT                   /codon_start=1
FT                   /gene_family="HOG000241102" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631358"
FT                   /orf_name="MICPUN_109426"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="ACO67323.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG396607"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniParc:UPI000199C137"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH1"
FT                   /transl_table=1
FT                   /translation="MPYPPPPSFYKLYDPAREEPPPGPPPPAVGQYTAFGATHTTEKVE
FT                   DVLHSAKLYTTDGDIREELKRLNKDLLTRFTVLAANMVQAPSQYQRRVEEISLLMNNIH
FT                   HLLNAVRPCQARSTLEHALTEQAKQKRERLNDLREWTKKAEEAMGGAPAGLKEAVEEAV
FT                   AAAESRDDAMVE"
FT   CDS_pept        complement(7247..7606)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631359"
FT                   /orf_name="MICPUN_63870"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67324.1"
FT                   /db_xref="UniParc:UPI000199C138"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH2"
FT                   /transl_table=1
FT                   /translation="MDVDVATFEARAEEAERRIAALELKISEGATVPAAPAGDAAAGDE
FT                   FKKKFYDQLVALRVELGKSRVERAAMIRQAEEDKAKIEMLEEENTKMSYRIKHLVRAVR
FT                   EEMAKKYPEAKNVDR"
FT   CDS_pept        7788..9371
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631360"
FT                   /orf_name="MICPUN_63871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67128.1"
FT                   /db_xref="HOGENOM:HBG558538"
FT                   /db_xref="UniParc:UPI000199C139"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH3"
FT                   /transl_table=1
FT                   /translation="MRVSLLSVIAVLAAAVLPDRGATALRVAFVADTGIGNDNPGVWTD
FT                   WQGNKQGYYKLNGVDCLDFAGEPCALYSRARDVLTAAKDNGAELIVHAGDMDYESAPRM
FT                   WRYFVDETIRNQGMDFLAVKGNHDADGWDGVQNLWSGNPEGYAAQLRGTVPARANCRGS
FT                   YGEDMVCDYGPVAFVLSSVGVEEAGEGSDTNRRHYEFLERALSGSDARWKVCVWHMNME
FT                   DMQVSYKGDSTGWGAYEICRKHGAFIVTGHAHTYSRTKQMARFGTKQWSHTKKYLRVSG
FT                   NDDSRIHLHPGEEDGTSAVAVVGFGGYKNEAMLRGGKHWAKVYSTSCLDGDPVCEQASD
FT                   DEKFGALLCDFPDDPGSSETECWTVTTVRPGASNRQKRRSYRNPKDRFWLIAGEDPDAG
FT                   EGRTANTYSTMSSGNQRSFDGSLDRSECFDVQPQDHECILQKRWGKCDDWWLKNGGYCA
FT                   KTCGRCVELLEVKEYEDYIEEKDDDDETNEAQVPASKGVAAETPDESDYMNMDEVDFYA
FT                   IAEDVLEGRG"
FT   CDS_pept        join(complement(11138..11235),complement(9605..10856))
FT                   /codon_start=1
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631361"
FT                   /gene_name="TUA1"
FT                   /gene_synonym="TUA2"
FT                   /orf_name="MICPUN_94939"
FT                   /product="Alpha tubulin 1"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ACO67325.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI000199C13A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH4"
FT                   /transl_table=1
FT                   /translation="MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGG
FT                   DDAFNTFFSETGAGKHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFA
FT                   RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGK
FT                   KSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERP
FT                   TYTNLNRLVGQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKA
FT                   YHEQLSVAEITNSAYEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT
FT                   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMY
FT                   AKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESAEGDGEDEEY"
FT   CDS_pept        complement(14404..15945)
FT                   /codon_start=1
FT                   /gene_family="HOG000265585" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631362"
FT                   /orf_name="MICPUN_63874"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO67326.1"
FT                   /db_xref="HOGENOM:HBG558551"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199C13B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH5"
FT                   /transl_table=1
FT                   /translation="MRAMLASLARRCGVAHRAFWREDGRSFARTLSSSASDQESALQNA
FT                   MLSSFQRWFEAYGGTTSGISMVQTPSIGWGLTASRDVDVGERLILLPRVLQMTYSLQDR
FT                   ESTSSSDQATAELDREPDTPLYLKELIAQIPDELWSVRLGLALLHERALGGKSPFFQYI
FT                   SLLPAMHRGLPLFFGPEAVDALQYLPLVVQVKRRSRFLIDYSSGPLKNVTAGKNGETES
FT                   VPFNGYSVGADALGWAFACASSRAFRVAGEGKPAAMLPLIDVANHSFEASAEVRAAMGE
FT                   GPGAIEMVASRPLRAGDEVTLNYGNLSNDHFLLDYGFVPQGINKHDTASLRWDVSYLEA
FT                   AREVAGLAQVPFAAGTEPWQSAMLSELGLDDDPEVLVTRDERQPVDARLLAGIRVLYAS
FT                   GPEDFSSGGSGEALQPLRHGALLESTLDRTKEAYALRTAQAALALALGNFPTTLKEDET
FT                   KLEELTAELAELSGVGDALEKENLALAVKFRKGKKEVISRAMKAIDERLRVVLAS"
FT   CDS_pept        complement(15997..18225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631363"
FT                   /orf_name="MICPUN_63875"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67327.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR015916"
FT                   /db_xref="UniParc:UPI000199C13C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH6"
FT                   /transl_table=1
FT                   /translation="MEGGSDAAAERAVDAATVALSRYEFFRVHEEPLGERPTFGSGPTA
FT                   AAARLHESDRPKVLVCRSTKAYRRLALCVPRPGERTVDIGSAYGDATALMAEAAGEDAV
FT                   LGIDVSKHFVDQSSAARPGLRFERLDALEDPALLAREIEGSVNVFVDIGGVRAAEALVR
FT                   LLPAVAKSAAPSFIVVKCEALHDAMADAEVPFEGLRGATTITRFTVPERERSNGGANGV
FT                   DDCDTDCGSSDSRWRDAVAVTASSASPVFWRKTCEREVGNVRARSAFKRAHVARSARPA
FT                   SDLFARYPLKYPPRFVRGDVEICRFHNYSADGCIRREKFGMCMFDHEHCHWCGEHGHRA
FT                   WECEHAVKAHQSAVVDDGLAPAAAPVRDPNDGTANGVANGTANGVVDGLANGVVDGLAN
FT                   GIDEGLAKVSLAQPEDVYVYVAGGRNRGQTVGVTERYSLRRKQWERGPHIADPRGSHGL
FT                   AAANGVVYAVAGGGIKSNLATAEALHAVADHASTAWVPAGVVAEARHALSACNTGDWGV
FT                   CAIGGWADGNSCTGAVDFLDLRTDPTSTTWRSLAPLITPRKLHGAAGLPDGRLFVFGGR
FT                   IGDHGGPIAGAEAYDPTSNEWRAIRPLPIGACACACVDGSDEGKGTQYVYVATWGADNP
FT                   EGNKSTKRGGKDPRVGEAGALWRYDPDADTYERVCGLPLPEWYGFAMCAFDGWVYLIGG
FT                   STAGRWTGAAFRRRVDQGGESEWEELPPMKVVRRRTAAAVARAGLMRK"
FT   CDS_pept        18405..19439
FT                   /codon_start=1
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631364"
FT                   /orf_name="MICPUN_88413"
FT                   /product="Predicted protein"
FT                   /function="nitronate monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67129.1"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG683237"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199C13D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH7"
FT                   /transl_table=1
FT                   /translation="MVLKTRVTELLKIEHPIIQGGMHHVGYATLAAAVSNAGGLGTVTA
FT                   LTQRTPELLRDEIRACKALLKPGKPFAVNFTLLPSLAPPDYGAYAQVIVDEGVPVVETA
FT                   GRNPGKWIAFFKKHGVTVVHKCVAIKHALTAQRLGADCISMDGFECAGHPGEDDVGNLV
FT                   LLAKARTALTIPYVASGGVGTGEQLAACLALGADGVNMGTRFMATKEAPVHDGIKTALV
FT                   KADERSTTLVMKSVGNTERVYKNDVARRVQEIERENPGKIEAIRHLVSGENYRKSFQES
FT                   GDPDSSVWSCGVVMGLIDDVPTCEELILRMVADAERVITKRLPSMVGGRSGGLWSMVAG
FT                   RSRL"
FT   CDS_pept        join(complement(21334..21390),complement(19594..21198))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631365"
FT                   /orf_name="MICPUN_63877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67328.1"
FT                   /db_xref="InterPro:IPR006602"
FT                   /db_xref="InterPro:IPR010554"
FT                   /db_xref="UniParc:UPI000199C13E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH8"
FT                   /transl_table=1
FT                   /translation="MGNDENIPLLPGYSLTLPGARKLPQTLNYAGGGIFVTGLPDQSHP
FT                   ARPITARMAGDEKLATQGRPLTDKKTTLADHVKGSVAVDPQNGPAPPPGAPAVAALGDM
FT                   KLGEGSATPAWVAYDGQSLSYGAYFVEKALDGRDRIRRCVIRFHLEDGTVDVHEHKTDN
FT                   SGIVQGRILKRHAAVGASGEPLAIADFQIGSTVAIYGREYNVVCCDAYTREFLRKEGLT
FT                   IAADVPFPDTLVDEGPGVLGTIGMGVRGVGGKRVFETDPVEVVIGASSASSNQIAEPAI
FT                   DPFTKDVLSFKCSWDDSVQGIVHYTLNYFLADGTVEVLEEEAPGRDPFPKMLARSKLPA
FT                   GGAFDVGPPGEKTRTFLKPADIVMGQPVGVYGRNLTVHDCDDFTRAYYVKTLGRTILEM
FT                   APKPLNDGAVKHVHVDPPYNGFGSETDSLRNCHSLVPKRAPPNLRHFEQNFGKELRFNA
FT                   AFAGPGLVPPNDERRFIVTFYLVDGTISVYEPPMSNSGIIGGKFLERTLEPVRKPGARA
FT                   PYVARDFYVGATVTLNSHRFELLNTDESTESIIRSL"
FT   CDS_pept        21596..22675
FT                   /codon_start=1
FT                   /gene_family="HOG000264589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631366"
FT                   /orf_name="MICPUN_63878"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67130.1"
FT                   /db_xref="HOGENOM:HBG715286"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="UniParc:UPI000199C13F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGH9"
FT                   /transl_table=1
FT                   /translation="MPGFDYSKWDNLELSDDEDHHPGAQFIEANTLRRIKREAHENKEK
FT                   ERAEKIESLEKQIRKNERKIKELSEGENAAANEAEIAKLRSASATFQSEVDTERRQKKF
FT                   NAEEAVRDAWSHSLVGAACKPDAGPEKLDYEAFAKKYGDQLDALAVKDFGSGYEEMGDY
FT                   FRDNSHLLTEHAMGYMLLKCLYMEMEGNTLGMRRGARAGYALKSIVDFAEASKRSMRDA
FT                   APAFFGRMSDPEVAKEYEKMYEDYVDKLKKRAVDKKKEEDAAAAEEATRRLQLKGDDKA
FT                   LEELPREERLGPGGLDPVEVFESLPKEMQDAFESGSVEALREYVNGLPLEDAKHHMKRM
FT                   VDSGLWVPAPGEEPGLALQ"
FT   CDS_pept        complement(22755..24590)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631367"
FT                   /orf_name="MICPUN_63879"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO67329.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="UniParc:UPI000199C140"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI0"
FT                   /transl_table=1
FT                   /translation="MTSIGCQQGNRPICNVRTIQGLENRLFKTGKFLGNQSSRHGPRSG
FT                   LSLAMSSFAPVCIGRASLRAPARPVPMRAVVTVARAPVLRGLPSKLSAANWRARSVRVR
FT                   PAVSTQEPVDVEDDADEMAVDSGSNAKGPLRKGSKVTPEALRAFIRMRRGVFKITSFGS
FT                   LSEMPDVGGAVTSTLRRMVIHQCDILERALTSSLSERSEGWRSDELDPRHVPDASVAPA
FT                   PDETLDVAFKHRLLLLQARKGYRCNSDSLVLAAHVAGQISWHGVETKAGGLFGRKKVLK
FT                   PPRIADLGAGAGVVGLSLAARGGFAKDAQGPNVLLVERQVGLARRCARNAALNGVGEGV
FT                   TVCLGDVSAGSFGTQSSNSKTEDIVEDEVEEEEDDERQHVEVSLSVDGDAVGVELAVKS
FT                   AFNHERWAGADAKPGDWMGKCDAVVCNPPYFPKEDIKRGTKPIRNEKRLAHYETTAGLD
FT                   EFFAAGEKLLKPLTADVQPGNDPAMHVVYPSDRAAAVYAAATRVGLGRIYVREVFHDRD
FT                   ATEPKLVLVDARRSYVNNKGETVSEDGEPIGESNTESDDFLTQFRTTPTYDLRVMDPIV
FT                   LYDEVNEETGETDPEASTYSEEIEWFMRRLPAPGP"
FT   CDS_pept        join(complement(25426..25602),complement(24871..25320))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631368"
FT                   /orf_name="MICPUN_63880"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO67330.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="UniParc:UPI000199C1D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI1"
FT                   /transl_table=1
FT                   /translation="MALVNAFSSLSIAAPAKAAGLGFKKAVAAFVPAPAARVSASRAVF
FT                   TVEAKQNKKARTIQGSRVQLPRVAAASRRRTPARHVAAKNRDPKTFFPGRSGDDFFPTR
FT                   WLTYARLSSLSLQSRNERLYNKMRKSEITTRMKKVFLKATALGAQEACSEEEIGDLEKL
FT                   ISEATKAVDKAIAKGVLHKNTGARRKSRMSKYKQDLRRSKGLLTA"
FT   CDS_pept        <26224..26952
FT                   /codon_start=1
FT                   /gene_family="HOG000231901" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631369"
FT                   /orf_name="MICPUN_88190"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67131.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG608835"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199C1D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI2"
FT                   /transl_table=1
FT                   /translation="KVTLYQYDVCPFCNKVKAYLDYRGIPYDVVEVNPLTKSEIKFSKE
FT                   YRKVPIVMVDDEQLNDSAHIIATLDERLGKIAPPGFIGGKAMTEKEEKWAKWVDAWFVH
FT                   VITPNIYRTWAEAFKSFDYITERGKFGWVERQSVRLSGAVSMYLISQNVLKKRHGIEDE
FT                   RLELYKALEDWMENGVGGAAFCGGDVPNVADISVFGVLRAVKTFETFDDALANVKSVEG
FT                   WYRRMEKEVGEATRTDGIAN"
FT   CDS_pept        27114..28349
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631370"
FT                   /orf_name="MICPUN_103975"
FT                   /product="Transcriptional coactivator p15 "
FT                   /function="DNA binding"
FT                   /function="RNA binding"
FT                   /function="double-stranded RNA adenosine deaminase activity"
FT                   /function="transcription coactivator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO67132.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003713"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003726"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000607"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199C1D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI3"
FT                   /transl_table=1
FT                   /translation="MSSPAEEAQVREATRRIIQGLDLETTKEKQIVEMVEAQLGILLGD
FT                   DEALMRCLQEEIEKFLLDDTAKISPGKTKRITPKSQAGKRRRSLVKFEDDDDNEDLDDG
FT                   DWDHTQEDEDEDFDEDDAAPKKRRDDMNAAREKWSEPAPAPSDTVPLTLAVAPASAAPG
FT                   APVPEDKLLAALTLKGDDGATAKELAGFLKMGKSEVNKALYRLQSSGRVRSDGAGGGAP
FT                   TWRVGSSSAPPAGAPASAPAPAAPPVGASAAPPPPPPVAPQSQGAGAVEGQICALSRAR
FT                   RCTVSDFRGKKYVGLREYYEKDGVWLPGKKGISLPYEQWSQLRSKIGEVNQRIADFGAK
FT                   KPISDATVCVLGRDRRVTVDIFNGSVMIGIREFYEKDGAKLPGKKGISLSKDQWELVTR
FT                   HEDLIEAACGGQ"
FT   CDS_pept        join(complement(29476..30018),complement(28619..29419))
FT                   /codon_start=1
FT                   /gene_family="HOG000239525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631371"
FT                   /gene_name="AMY1"
FT                   /orf_name="MICPUN_96728"
FT                   /product="Glycoside hydrolase family 13 protein "
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO67331.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG318585"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000199C1D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI4"
FT                   /transl_table=1
FT                   /translation="MVPDIAATGVTHLWLPPPSHSVSPEGYLPRHLWNLDSSEYGDQNE
FT                   LVALNASLREAGIMPVCDVVINHRTADEIGPEGVYNVYSDEVDHTGTAVHWGRHMITCN
FT                   DPAFHGSGHEDSGDNYDAAPDLDHANDELRATLKRWLRWLRWDVGFGGFRFDFVRGYAP
FT                   EYTEEYVKETTSRGDFCVGENWVDLAWEGSHLNYNQDGPRGKLVEWLAATHGTCALFDF
FT                   PTKGILQRAVTHVEFYRLRDPASRPPGLSGWIPSRAVTFVDNHDTGAPQNHWPFPPDRI
FT                   ALGYAYVLTHPGIPCVFGPHLWGDDPVLSGVIRLLIDLRKRCCVCADAPVKIQMAENDI
FT                   YVAKVGHRLTVKLGPRYEMPVELIPKEPEWSLAVAGEDYAVWERVQYDTDADAKVVAME
FT                   REMMDVGDDGEYYPLERVPVDNSRQSIGSWIEPPPGIVEPSDGEADPR"
FT   CDS_pept        join(complement(31625..31987),complement(31224..31538))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631372"
FT                   /orf_name="MICPUN_63884"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67332.1"
FT                   /db_xref="UniParc:UPI000199C1D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI5"
FT                   /transl_table=1
FT                   /translation="MATAPIGTARVASARTGGAMVSRTRRSRARRSFRVRAASKEDNGK
FT                   PEAGTPSIDSKSLWRLRLELFSGKDADATTPDRTITVRARFVVDEGYEPPQGSIEIEDD
FT                   QELAFVQAGFHRWTLAEDPNERKAGLWIWGLFEEPLYPYMLLSFDCNRIEVAEGGYHIP
FT                   KGKLFAEVKHARGSKSGHVLSDGKLSFKVTKTYKADLVGLSEATIGEPTMCGRLQADCI
FT                   EVA"
FT   CDS_pept        join(complement(37647..37797),complement(36450..37560),
FT                   complement(32307..36120))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631373"
FT                   /orf_name="MICPUN_63885"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO67333.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniParc:UPI000199C1D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI6"
FT                   /transl_table=1
FT                   /translation="MGLVGAAGPSAMAKLKGAMAKLCATPGDPKTDVLVVIASRLIMND
FT                   GNGITPADVIAAAQVPPANDWIATAFDGKKINPDMVKTALSQAKQHFKVTSGFYEMIGW
FT                   PLPRRVECGVSAEFDPDPRLGRDLVDDVVAWREEKPAGGRGRGKHHLGDTNDEHEDRVS
FT                   KMGGDKKRRKTAPAESRKPGPKAKAKAKASKPSEPKAAARAPTPQPQSESESEEEILDV
FT                   DPGNITSKIKFIGAPRKGGVYRNRTYYDGFQTIINKAGKIHRLVYNTGDCVYAMPGDPS
FT                   EDMYLAQIDSVFADDSGQYVDCVWLERAGDVKNMVDGGTWKEMKCAPNEVFLCTTVNAN
FT                   PIQSIEGKATILSPEEFKAADHKKHEKDGENVFVCRRALVVKASKKKGAKKGNNMSFPE
FT                   VRKVSGKGFQVVGLGPKKPKGRLRDASLGKRRDEPDPPPKSDALKGVPKGGGGAAYRAQ
FT                   VERQRLRRIEAPRPRGDAWGVYESAHPRGDGASKRVADVLASARASPKNPEAPRAILKR
FT                   EGYTSSVFLPPTAHPGADVERTASPGRRYRVMPVLLSRVTSPSQGPPPEDTSILCDVSA
FT                   GESSPERAEEDASRDDDGGRFPNTPIVATPSGSGRFNAVTDDDRPATGDASGTSPAFAG
FT                   FRSTYVRPSPSPGGVARARARTPGSATSHQSESHTEFYERVTGQPFPKSPDPEAPSPTP
FT                   VSTRTAGTVLGGNGSGRDGGNGSSGPTPSAFLFDGSPEAVDLGTPERSGAVRSVPSEPA
FT                   EDPTETPAPAPMRISAAMPRVHPEPTPEPTPEPNKPGSSPAKRQTPEFLPRRRHPRFEP
FT                   SKLPPPIGGTLSLVDRIRSDGDEVMAAEFMETVAPAFSPATSTRSGPDRSNVSGNRSGG
FT                   RRVAFDVASSPPSRMRNLSDACRKPVGHRDPTRFTPSPARYGTAATRAAKARALSERSA
FT                   ARRKSALAATVLVDARRLRRLEAKSPRARYVAATRGDGLDASVDPEDDAGGAGTCMDAS
FT                   FDDDTQGLGTTTNLGQSDRRVREIAAVIRALDESASPNAVTDAARMMAQAAAKAAHAEA
FT                   ERRALMEDKHARKAISRMTRHRLRAWRQTAATARLARACASKWRVKARRGADLDRKKVA
FT                   VATKALFGWTHRKWQAGFTHWRDLCAQKAGARVMADLAYSGKRRGTAAAALREWSAVAI
FT                   ESSANRWRETRLKRRVVKEWSDLAAAQRHDGYRAVKTAMLGWRVAIRARERLEELVRSR
FT                   KAERADDVACRILNCWASLTRRREFSETVLAAMTRLVKRDAWIRRIADDQRRKRLIERW
FT                   YVVVRDENLRALGHWARRLASRLLAEWAALALAGRRNRERAFTARALRGVVRHQRAVDV
FT                   ARANGLGGVPLTPSPLARARRRRHRNEGGENEGTKHDGASEKAAAEDVAAENVTAKEDV
FT                   AAEDVTAEKDVATSPDDDAESHARWERRGAREAPPGSSRLARHSQALSDITDSIAAFGA
FT                   DANTPRKIARSVGALAMKAGGGRRVLVPTREVGSGRRRVSAPASGAGAVTHRAVTHRAV
FT                   THRARVRWDVDDGSARIDDGDDGDSADYELSSSESEADETRPEPPAADLSPDAAPKPSP
FT                   GAINPLGTPEPMPEFEELPKEVREALNSPQDPEERTTPIAPTALRDDATELVGFYSPEE
FT                   KDGLGSPMDRLVTLARNTPPRDGEGRSSSPEFEFRGEVERIDKVLRDLYSNRR"
FT   CDS_pept        join(complement(40363..41066),complement(39396..40233),
FT                   complement(37917..39305))
FT                   /codon_start=1
FT                   /gene_family="HOG000029666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631374"
FT                   /orf_name="MICPUN_88387"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67334.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG407332"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI000199C1DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI7"
FT                   /transl_table=1
FT                   /translation="MADLPDSAVDEGDVGEDDAAPINDSAQWQATVKRVSRAVVVIKTT
FT                   GVRSFDTESAGSAYATGFVVDAARGLILTNRHVLRPGPVVAEAVFQNREEVPLRALYCD
FT                   PVHDFAFFRFDPELLRFHDIAEVPLAPEAAQVGLEVRVVGNDSGEKLSILSATLARLDR
FT                   DAPKYSGKGYNDFNTFYLQAASGTKGGSSGSPVIDARGRAVGLNAGSKTKGTAAYYLPL
FT                   HRVLRALNLLRDAGTLQTTFAYKGFDECRRLGLRVDTEAALRAAQGGAADGTGGTGALV
FT                   VEDTTPGGPGEGALEVGDVLVKIRGEFVTNFVTLEATLDDNVCTTLEVVVERGGEEVVL
FT                   RITPGNLHDVTPSRFLEVCGGVVHALSYQQARNFQLPVGSVYVAEPGYVLGLAGLSKHA
FT                   IITSLNNVPTPDLDAFANAYARLEEGSRVRLQYFVHAERHRTKTGLLHFNSRWYPPPAF
FT                   YDRSWRTGRWERTLLTIPDKGTIEPDAKKRRKASGDSREGDDKEGDDDDDPADVPVVDI
FT                   ATVALADGVYSRSFEGSGAVIHHDPNTGLGLVVVDRNTVPIASCDILVSFAAFPCEIGG
FT                   KVEYLHPTHNFAVVSYDAGALPRRARESIRPIAFAPPDSALPTRGDEVVLVGLSAQLRP
FT                   MARVSAVTDATSVAAIPSADIPRFRAVNEEVITLDMDFGYNFGGVLTDFESRMVALWAS
FT                   YAKPVNGEVRDMVRGLPVAPVIDARDEVLRWREKGKRGAGSVRLLDAEFDVLQLAKASD
FT                   HGVPNAWVERLMRADPVRRQALTVASVVADTGASKALKGGDVVLAAGGEPVVSFRGVER
FT                   AVRVCKTGAPLPLRVLRKGEVVDVTCELSEELCAGTGRLLHWAGAQLQPTHRPVAELGF
FT                   RPTDPATGAHLDVFISRWYHGSPAQRYGLYALNWVASVNGTPTPTLDSFVEATKALEDG
FT                   AFVRLKLIALNGRPKVLTVKLDLHYWPTWELRRTTDGTNEWERVLL"
FT   CDS_pept        complement(41353..43281)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631375"
FT                   /orf_name="MICPUN_63887"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO67335.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000199C1DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI8"
FT                   /transl_table=1
FT                   /translation="MTVPRPPQPATRGGKMQALAAASSTRAPAPSRARDIARRVPRASV
FT                   DPRPSAVSCSTTRRFGARRAENFAARAAVFDGGDGVPFFALSDADRASELRADTEAILA
FT                   ASRDRRAILLPFVAGRALVVAVDEDGSRPGVRFAPAEVRLRDVRRSADGEGEGDEGDED
FT                   PLAFERLSFLGFREEDGAPVFAAEVKRCESLVREAVARNPAVIGRVGRGAVDEAIVAKD
FT                   AKSVGPEMSRKDAGLLAAAASLLRWQRNTRFCQKCGSPVKIVKSGHKAQCADSDCRAPY
FT                   YPTLMPAVLTLCTCGDYALLGRNSKWPRGFYSCLAGFVDQSESLEQAVAREVLEESGVV
FT                   IDPSTVRYVTSQPWPFPCQLMVGFRAEVAPKRVTVSDAVCDTRSMNTPSEEYAPSCEVS
FT                   FPPTPTLDIAELRDARWFHRDWLRAQLGKHVDPREGGGREIPVGEIALPGRHALARYLV
FT                   ERWCDEPNVESPDSPAPPPSVAMTDDREMPLVPTTNRSFAFRVVEMNLPTKSGGRHTVL
FT                   RFSPTGGGGAPTVNDHARLDAACEAEAGRIGASLRLLGGGQMCFRGGEISESAEIDDED
FT                   EASLLIVLRNGGGGDNGGAEVPRVDPELVRALVRRAYPMHDILIPGAFEGGGDGTTEQG
FT                   LARRYQY"
FT   CDS_pept        complement(43335..44816)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631376"
FT                   /orf_name="MICPUN_63888"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67336.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000969"
FT                   /db_xref="UniParc:UPI000199C1DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGI9"
FT                   /transl_table=1
FT                   /translation="MSLDSKELAALEVAIAADPAACASLAAVVAALKQAASGGSSTVPI
FT                   SATASQLIPVAAALAAKPTANGVAKPTANGAGPAVPAVDYKESDVVCKSSTPISFSTPR
FT                   GKFECKLLGDGRCVLEQRTPKGVTAYAVRPQHVRRAMRLDVGDSNNTTHLMVAIDPNHA
FT                   LVAGKQKMRTLLAQVRGKDAPATVQFLDANGPCPGRDVYEARLRDQPPGSTGAPNPANA
FT                   MAALVELFFGLCADGKRCAVPKTDRVFAGVGGRGCVKANHKFNQGHLFMFDDGLAFAER
FT                   PALWLPWEDVADLQLQRADGGSGTFDLKVTPEGGEPPHEFANVSREELEEVQRYLAKRC
FT                   SEAGGEDEDGDEDGGTAGGGAADMLDDVDSDEDSDEEDEDFNAAGIDDDDDDDDDDDDD
FT                   DDDDDDDDDDGDDDDDDEEEEEEEEEDADGSGSDDSEVETVPSRKRARDGDGDGDDATA
FT                   IPGTGGVQAMDEDESEDEDEDEDSDDDRAFEVVAH"
FT   CDS_pept        join(complement(45587..45712),complement(45092..45400))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631377"
FT                   /orf_name="MICPUN_106469"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67337.1"
FT                   /db_xref="UniParc:UPI000199C1DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ0"
FT                   /transl_table=1
FT                   /translation="MALRSSLARLARSDLLSKPAGAPVFSADLTEAKARSRQFFRDVCR
FT                   QVPWAMREFFLEEVTTTAKFRSQLANEWRRHRTDDHRVIDVMLFKANQELVTVLAHHFQ
FT                   RHHLITKYVAPESNAINRRSKSGKPQSKFLSAFLDGKATE"
FT   CDS_pept        join(46067..46099,46227..47135)
FT                   /codon_start=1
FT                   /gene_family="HOG000240638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631378"
FT                   /orf_name="MICPUN_109432"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67133.1"
FT                   /db_xref="HOGENOM:HBG745098"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniParc:UPI000199C1DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ1"
FT                   /transl_table=1
FT                   /translation="MSQGWAQQPQQGYGGPAGEYYSPNPTPMPAYNPAAGPGQDVHYRG
FT                   GGAGANAGPMGGPGGGMDGFGIPGGIPISPKSLARVGFGAYGDKVLGAGQAYYAKYFGG
FT                   GAARYYFDVTEAYVWNKLKLVACPFLHKGSWARIPEQVAGGLTFKPPRNDINAPDLYIP
FT                   LMGFWSYVLAASTLQVRRGEFTPEGVAVHASWGAALWAAEAVFVWAALRSLSSSHNHIS
FT                   APMMDLAAYTGYAFVLVAAALATKILNLPGWTHLLSGGWGALASAVFMVKTTKRIIFSE
FT                   ARSHGFDGNRHNYVLLMLAGLQFPLHFWLGSV"
FT   CDS_pept        complement(47492..50347)
FT                   /codon_start=1
FT                   /gene_family="HOG000100141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631379"
FT                   /orf_name="MICPUN_103981"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67338.1"
FT                   /db_xref="HOGENOM:HBG608989"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="UniParc:UPI000199C286"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ2"
FT                   /transl_table=1
FT                   /translation="MGKRNKRSKGELPLAAPGDGDDELVPDDDDVAFVKSHRGYGAFFG
FT                   ERLEVEGIRVATTKRRKKGPDEDDVTAEYERAPRTVASRAENGEDDAPKTLALPVKRLD
FT                   GTVIHAPTAPAPIEGAGVDDNMHNITPAARAALKKAREEWDRHEKESKALDASEAGAKK
FT                   GKKARKAEQLANELGKTEYRQKLTTDKWWDKKKDGEGDDDDEGDDEGDDGDSEDDMDPA
FT                   ARARLSQARAAAALEEEMSADERRESVKARVGATCQGVMEDPEGKWADLREVCKLCEDR
FT                   DGQIARLAALSMVLVFKDVCPGYRIRPPTPKELAMKVSKETQKLRDFEAGLLKTYGNFV
FT                   RVLVRCGGGKGKSRSQRGKGGPDSATALRCLCVLLESLPHFNYRTDVLSALVPHLSHVD
FT                   SAAADAVAGSIANAIKADMQGDTTLEALHMVAQLVKQNRCCCHPAALSPFLEIRFDEGI
FT                   LALEAQKAPEVLSRKQNRKKRADEREMIRKARAEKEKRKAEKERMKSFGHRDDSDSEEE
FT                   DLEAQLERDMGEASGRMDNAQKKKMQSRMLEATFEMYFRVLKNAAGANPARGLPLMTPA
FT                   LVGLGKFTHLISVTFMADLMEVFRQLLAGDALSTEQKARCLLTACEVLSGHGEALQVDT
FT                   GEFHRQLYAMLGQPSSGSSGWGGSDKRDGSSCDGSSSADRGTLRIRALQRFLGGYSHVD
FT                   QGRVAAFAKRLAGAALCAEPGEAVGALGVSRQLLAAYPRTRCLLENERVGTGVFNPAVD
FT                   DPESAVGLAAVLWDLALLRHHYHPAVAAAADEVARMPLAGAVPPALGSHAPAELARLHS
FT                   TTRGDFRPAIPPPKVGKRARTSVLDRQTSRGGEANVLTPGDELARIIAAERTPADERDR
FT                   LAQTLRRHFCETREFGVNVGLRAEVARLRRMSIQARERAEERRAAEAAKAKKAEKAKKA
FT                   EKAKRAGEEVRGKKSKKKVKA"
FT   CDS_pept        50494..52053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631380"
FT                   /orf_name="MICPUN_63892"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67134.1"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI000199C287"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ3"
FT                   /transl_table=1
FT                   /translation="MAEGSDDPFPEGLLAHAELQLRRAYEHSAFERAREVADRTGGGGA
FT                   ASTSDGPADVAALDPPSPNDGIVAALDALRRIAVESAARAGAHANEGKDDAADAKRRRK
FT                   GEAGTAEAGGSDGGGDATRRGRHRHLAKSAPARFNRDVRSLTTALRGDWTTAYELIVAR
FT                   TIDASRAVARAESHAARSAWRRETIVSRHRELRATVAASGSRPPPGESPPGESPPVSDA
FT                   DARWRLAVSSGGLEAYAEAAEEVGNRAWVVDALRWCAGTAMDFILGGGAESFAVRSARR
FT                   SHYESLGTRMSDEEEATMRAALRDRWHRRAPVRGDSPVGGDSLTGDKPTLIDVGSCWDY
FT                   FRRHEDVFDVLALDLEPRRPTVLRCDFLNVRIGDPGLEDADVDAGVDADVDGALRFLPR
FT                   NAAGAVVMSLVLSYVPTPRQRGEMVRRAREVLMDDGRGVLLIVTPHSTDKGHCAHKALP
FT                   VLKEWRASIESMGFERVKYERARSVHCLAFRTVGEGPGTKKAGEAPPVRIAFDGPDWET
FT                   KS"
FT   CDS_pept        complement(52128..55445)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631381"
FT                   /orf_name="MICPUN_103982"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67339.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199C288"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ4"
FT                   /transl_table=1
FT                   /translation="MKARMGSMGGRDDSKSNDRSSQSIMRQGQGTASRLSVMQASAEVK
FT                   GVQGFDSPPVSPMRGGFKRQAESKHPLGDADGFPLAPIDDAVNIMRETAGLTRGNSELP
FT                   RELGDPSDADLADYFPNEEHTKGGNPFMGSSSFDYRHARSPRGAGDDEATTPAPTRMRA
FT                   KGDVGQTNTPMRETPEQFAGGFVHGGAHRPTSQRDLRVDEDYADQRGPDEWAGLRASTH
FT                   AHAASSVTKPLRSNSIDPRDVFHPVPESTRKSPKGDRYVSGATTNTAMDAATQLKPFSL
FT                   MTGDAVDRPSWATQVRDNDNLDARDAAALGLESRTPYLFNPRGDFMFRWDVFVGVCLLY
FT                   TAVWTPYEIAFHQDWDSDDSVGVNWSDVLSDPLFWVNRVVDAAFIADIAVTFFLPYYTP
FT                   DNKLVADHRKIVWTYLYGWFPIDFFAVVPYDLIAYAVETEEAARLKFLRLVRLLRLAKL
FT                   LRIVRVGRVFRRFEANREINYAALSLHKFSLGILFLAHWMACLFYLVAMSEDRRVNWTT
FT                   EYFNVYEKNVEPDGTIRPVDKGSLYIASVYWAVATLSTLGYGDVVPETNAERIYSVAAT
FT                   FMGGAVYAYLLGSVCSVITNVDESSNMFYRQMDELNRFMREKGLTQDLRIKLRDYFRFR
FT                   RNSRAMVEWSNVMHLMSDSLRLDVAEEVFGRWVHAMPIFRDCPKRLPGLLSAHLSSLVL
FT                   SPHEDLMANPMKRDCLFIVEKGLVAHRGVIQETGALLGVERIYKTTAVGLANACAPAIT
FT                   LSHCVVLCLERDSLLQVVNEFPRVARNMRRMVVRIIFREAIIHYARAVRSSVSTEGGVT
FT                   AMNRLLGVHGAGLASLAESHRLKLLRRENPEYFKRLWRGALVAQKLFRGRRTRQLVRTI
FT                   TLKQQTSTPGARDLVDLLVNINMHRHISSLTALKIERRHLTVMSALELCQVTRMPFRDA
FT                   ADVILAARTGRTFLTPRNSMTAGGEFHESDIGFYPGRVAESVESRLATLERKLDSIKGG
FT                   VAVDSDDAPTPPPPPVEKRKMFAFTPPPPSPLPHRPWASEVPPTPGAGGSGPAADPAEE
FT                   RRLEDISLMPSSASVFAARALRGEKQDVGMLVIEAAAKFKEGGARYRARSAQNTPHK"
FT   CDS_pept        <62312..>62670
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631382"
FT                   /orf_name="MICPUN_73449"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67135.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000199C289"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ5"
FT                   /transl_table=1
FT                   /translation="DGEEALENDSEHDSEWETDDDDENAPFEPRPCESLFDGAELDTVH
FT                   DNVEYMRRTHGFVFPYRGNLKDPEGIIGYLQRKIYRGRQCVFCGRKFGSLEGVRGHMRD
FT                   KGHAKIRFEPPEVFKA"
FT   CDS_pept        join(63456..65557,65643..66609)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631383"
FT                   /orf_name="MICPUN_63895"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67136.1"
FT                   /db_xref="UniParc:UPI000199C28A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ6"
FT                   /transl_table=1
FT                   /translation="MGVSAPDAPATEGWTRDAPVEEWRAYVRAAYASNPGQCPLDVNVD
FT                   NIYSFNQGSMSFIEQDLRVLPEAMARQALDAMDRVALRDAFDLRRNVVNLKKVLLHSWH
FT                   TSEPLEKELRRMSTFWRGDMSWVNGFVDVARYREVCVAHTRCKGAAHAVFDGRVMTKAI
FT                   CCVPRHPELPRPAKLSGLPRTMTTHSWLDQALDTLAEMDEETTEGADEGADSPPPSARG
FT                   VGRRGTGSAAAKNAAGEPSDVRRQLDAFLTDATSSPHGPLRDWPKHILQYVELVLVARG
FT                   GAKALSVRAETGRYASRLRETSVRFEEALAALRERVRTVEDVLRDECGVVLPSGESPTG
FT                   RFVSRDDVDDRAVDALRVAMRRDKTLNLLEGCAPATAELSRWVHEICAKPAQRLFVAGD
FT                   GGTGTNADFVPPGFALGELIGANAKAVTARWGPELRRVIETACGPNGAWPPTEPLTYVT
FT                   GKVRCKECGGFFGTLWIGAGERCFRCEEGMRARGECPVSARCRASKVRTFCPHAQRCIA
FT                   CERWSCVECGVVCGDGEDVAALVEQIDPHVVFIDFDRTLCTTKSGASPARGSHRLDAEL
FT                   WNVVTGLQDVRVVTRNSHVDDIRAFMARHRGGGGCGLSGSTPSSSFDGIPPVHHVGKGV
FT                   SKGRVIREVLAEKAAQSAGRLAEESTGVGGGGVRAVFVDDSAAELLDPEVSSVPGLTKV
FT                   LFSRVLARLKYPAGETSFRRKPTRADMSLASASAPGASLAPSGRRALRGGRAPSRVVPS
FT                   AFGFGRSNHAQSLTLEQIEAEIRSAPPSTSPASTSRLSLADAVWKVSLDNPLSLRDRAA
FT                   CAIAAEAVQALCETGLDGASLAVTLGIREAMIANGFGDSVRAVAGYVSVGGYARAHAWL
FT                   EIDGRVLDVAGEGLALCEAARRLGVDYSDAIAMAKAFGPDALRFGGHEPNARRPLLVLN
FT                   MSVPTGGTSTALARPGLTMRAPPANVPGCQDAEKTRAKFAAVLSEPRTRLSDRVREMPE
FT                   EVADVFHRVASTRLDLVGDERQRAARLAAGGAQ"
FT   CDS_pept        join(complement(67238..67471),complement(66762..67184))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631384"
FT                   /orf_name="MICPUN_63896"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67340.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199C28B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ7"
FT                   /transl_table=1
FT                   /translation="MVPEYGDPLFDKSVLEMFASGTECVADVEQSRVLWDHGYDVLDVR
FT                   DEHEIEFFGDFPNPPPGTIGGVFETIVVSGPNKAGGKVFANKTRNRGFEEAVITAFPNK
FT                   EDAKIIVSCSDGRQRAVAALEALEQLGYKNLVLLKGGFNLYNRHWTKKLGRRLPNGTFR
FT                   ANNMAPGDVQGYGHMPEMNNANDAIEFGPWKDATDWKTALGCASASEERCEASFA"
FT   CDS_pept        join(complement(68673..70229),complement(68617..68622))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631385"
FT                   /orf_name="MICPUN_103985"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67341.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199C28C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ8"
FT                   /transl_table=1
FT                   /translation="MEATEELTVMTGDKDDEETRLAVAREDACPWLGRILATFIGLRFG
FT                   DDAPGSPKRSSLDKRSSLDAIDEDGNNDDDVRSDGALSMMSSEARMQELEQVVINTLQC
FT                   LINLSRSKKNRKEIADAGCVAPACTLLDLTLRREIHDRAVMLLINCCTGPIQYTGPVHD
FT                   VVEDSEGVQKLVEMIKLGPDQPTAHRAVQVLSLVSVDPEIKDIFRDKCTGGFEALRAML
FT                   ERPDGGLFLKHAALTVNHLCDENVPNKIAFMESGGVPAMMRLMGRPPNDPLTAIALDAV
FT                   TILAEDNDEVDEAVAVTGVLPRVVEMISNPENPKLTQAAVTAVMHMARDYKDAKRMLTT
FT                   AGVIYKLKHIIDECAIEESPESVHLAQMCVSSLTNIAIDTEYWGQSELAEENVLTNVRS
FT                   VFQSAPAESKMAQVCIAFVYAYTAGNSDNGWTVREAGLLPVVAYHHLCGRDKKTRESKE
FT                   ALVSLGAAVDDDEESQELVSSLFGETVLRECLKVGAAKGTYVPPENRDEKTRAREKQTL
FT                   SEG"
FT   CDS_pept        71199..72767
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631386"
FT                   /orf_name="MICPUN_88394"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67137.1"
FT                   /db_xref="HOGENOM:HBG558472"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniParc:UPI000199C28D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGJ9"
FT                   /transl_table=1
FT                   /translation="MPRLLDLALTLSETGVVEPACVFNALEQLVETCTIADCEDVFTWV
FT                   EARRGRLSADALWRRGKLVMLRTCNELQRRLSKTADTVLRGRVLLLLSSLYPLSERSAL
FT                   NLGGNYNAGNTTELDELDADTAEATDANAKAEGVVVDRAFYETFWSLQKFFSNPPAALE
FT                   PAAGWKTFCVSLRLVLDNFETHRLDKMSSGGVTPGVKPSVPSGATYVEAGIDAGTKYLT
FT                   AAPLLHLQLRDPAFRRHFLVQCAVFLGFCTSPLYKGVDAADARDAKKRVMEAIRQTPPH
FT                   GEEFAAAVALALRREEGWVLWKRDNCKDFEREPEAPRPPPPAPPVMRRRLRPGAAAPAV
FT                   PPEKRVRLGNPELDRLWNLSEDNVSALGDKRDAAPTAEVYLQNVVDDMDPEAQIEETYK
FT                   SKNDKTYVWKALRLIAKADMGAFQRLGAEDMETVVPAMLGVEPPGRPTGTDADGGTDGG
FT                   GDGEGGPAAMETDGGGDASKEANEPEAEEGGEADGEEDEADGEEEADGEEEEEGEEEGE
FT                   GEEDE"
FT   CDS_pept        complement(72841..74544)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631387"
FT                   /orf_name="MICPUN_63899"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67342.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniParc:UPI000199C28E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK0"
FT                   /transl_table=1
FT                   /translation="MNPPQGAGFPPHGPHGQGSHPHARTPAGAYQMMYVPVVQYPGQQQ
FT                   QQWTPHGGGTVPMMMAQGQVMMAVPQGAWGAPAAAGWAAQMQQHYGQPPQPPPQQPTQP
FT                   TQQQWFGTVGGGPPPPPPPPPASDVHPAPSSPSTNPPGGKRNAHRRGKNRGRGGKPADH
FT                   PSQPRPDADETAAPPSDSVPAQPRSESAPAFKREKGVTFPTVDEIPAVKQVDVASLPED
FT                   VRRYREERAKNWPSNAVVERRRAEAEERAARGQLSRDDDESSSSAAAAARRAALREILA
FT                   RQRELGHFEASEEIGDVGGGAGDEEAAGSAAAAAAGGGGNRKGKGRGGGRDPGAGGDDS
FT                   APAKRQRRDAGGAGGRQGTRPCRYWQLGKCRRGDACDFVHAGDAGGNRAGASTGAETCP
FT                   TISPTNAATNATPCRFFLRGRCKSGRRCAFAHDESAREKAKKDKKAKASSSNAAAGSQT
FT                   LLRKLLAREVRADRSRLLQVFRFLVNNDFLRAHDPSGDPGNLWMFPWVDDPVRSPKETL
FT                   RALAAEAARGGDGDGDGEEPSLGEEPSLEQDEETDGEADAEAGLNEEEDV"
FT   CDS_pept        74671..75753
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631388"
FT                   /orf_name="MICPUN_103987"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67138.1"
FT                   /db_xref="UniParc:UPI000199C28F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK1"
FT                   /transl_table=1
FT                   /translation="MRRSPARSTLGLCLSLACLALVWHALTLAGWLTSRVTAARGYLRD
FT                   VGDLTDLAERPGIREAVRSVVASGALARLERDVVGRLHVVDDETMSVGVDVSHSGEATW
FT                   VYRRYQQALRSSSSPGKRDGNKSARLDPGFAPLVVDVGANDGFLSSNSYNLARWGFSTV
FT                   LVEPNPAMLALAREAQEPMIDPYHEGVQRGCYVNAGMAGVEAATTMKLKVGGDVVAMES
FT                   SLVDVGGASGGGGVGKNGRGDDSREQKLAQLRGGGAWGGDVIEVDVLPASEVAKRCDVP
FT                   KDFALLSVDAEGVGDAVLREWIVAGHKPRWILYESMHNPTPFDVTKEWLEGKGWRYVRK
FT                   IGWNHAFELEELSARLRPVP"
FT   CDS_pept        join(75944..76488,76593..77349)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631389"
FT                   /orf_name="MICPUN_63901"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO67139.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199C290"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK2"
FT                   /transl_table=1
FT                   /translation="MPTKPAPPPVSDGHPGERHAFRRRHVPSSSSSPHASFDSETSFQS
FT                   CVSFISDELLETSQVPSPTAPATRVGIGESASPRTPDRRPMTASRLPTRPAPPARARFG
FT                   ARAEVRFMTTSEKTAGGWTLVASASGGGVSAAFESDRDRPSALRGVDLVALRDALRVES
FT                   MECTDGKVSIARLNACLHRIVPPASRASAATVSSLFAAVDSEGTGAVDVADLIAAASAL
FT                   CASPTDPTARMRVAFDACCDDDDVQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQ
FT                   DARPRVLSKRRLRTMLRGAVVAAAAAVFAHAPLNPGSDENDENVDPNGDANGGGGQSQS
FT                   QNQNQNQNQNVVTLTCAGGGRVVAPRLTSSSGATSTAFRTATSIESYADALVDDLFATH
FT                   DTDWVGAVTWNDAREYALGCAFLRAWFGLDRIIR"
FT   CDS_pept        complement(77477..78430)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631390"
FT                   /orf_name="MICPUN_98293"
FT                   /product="Aldehyde reductase"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67343.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199C333"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK3"
FT                   /transl_table=1
FT                   /translation="MPLLGLGTWKIPREQTPALVETAIRKGWRHLDCACDYGNEREVGA
FT                   GIRAALTEDPTISRDDLWVTSKLWNTYHRQEHVRDACLRTLDDLGLEYLDLYLVHFPIS
FT                   LKFVPFETRYPPEWVHDPDASDPADRVMVHDPVPIAETWRAMEQLVDEGLVKNIGVCNF
FT                   NVSLLTDLLATSRVKPAVLQIESHPYLSQKHLVDYARLHQVHVTAFSPLGSAGYVEMGW
FT                   TKRTEGAINEACVKAAAQAHGTSPGQVLLRWAVQRGTSAIPKTTKVGRLDENIDVFGWT
FT                   LTADEMSAIDALNRNKRYNDPAEFCVGMGGPVPIYD"
FT   CDS_pept        join(<79387..79769,79849..>80323)
FT                   /codon_start=1
FT                   /gene_family="HOG000272702" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631391"
FT                   /orf_name="MICPUN_70435"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67140.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG592040"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000199C334"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK4"
FT                   /transl_table=1
FT                   /translation="GALLLRGFPIKTPQDFANLTEALGWPNFGYEASGGNAVRRNVVGD
FT                   RVFTANESPPDKVIPFHHELAQTTRYPHRVAFFCENPAMRGGATPLLDSGNAYARLRSE
FT                   FPEGLAELQKKGVRYTRVMTVDDRPHSAIGRGWSDTFGVSTPQELEAKLASSGDKLEWL
FT                   GVSLSHLGVDGDRYPVRHYTDVRPAVLVDPSDPERRPRFFNQILAAHAGWRDELNAPGA
FT                   SVVLGDGTPMRQDMLDAMERIFREESVAVQWRAGDVMLINNLQVMHARETFVDGEAPRR
FT                   VLASL"
FT   CDS_pept        join(complement(81998..>82470),complement(<81014..81935))
FT                   /codon_start=1
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631392"
FT                   /gene_name="ALH"
FT                   /orf_name="MICPUN_67700"
FT                   /product="Aldehyde dehydrogenase"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67344.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000199C335"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK5"
FT                   /transl_table=1
FT                   /translation="PTTNARLSSIHVAAWPHVDAAILRAQKVQARWAKVPGDERVRIVL
FT                   AIADAIAKNSTHLGNLLTLEVGKVPSESLGELQEIAEVAAAIGERRDECGGSLAHPIRR
FT                   YESRDQTRKSLGWYGEERALPIGIVGKTTAFNFPYAPFAWGALPALATGNGVVWKPHPK
FT                   ATLCAMALTEVIDDVLRTNGGFSGLVTCVDAGDDEALTRRMWRDGRFAMWECTGGEAMG
FT                   EALLKSLASEGTRRLGVRTLLELGGNNAVIVHADADVAQAVESVLFGATGTAGQRCTST
FT                   RVAYVHDDVYNYFERLLVAGYKQELRIGDPFTPGVNVGPVFHADAVGRFKRGVDGCIAE
FT                   GSILVCGGRALGGNFVEPTLFRAPGFNHPPTAAELFSPVLHLVRYRSGQLPDVVNDINR
FT                   GGHGLSAGVFTGDEDVFETVASALRVGIVNLNYGTSGAEAGENFGGEGRTGGGRQMGPN
FT                   MFRTYTR"
FT   CDS_pept        join(83440..83761,83920..85112,85173..85352,85426..85571,
FT                   85634..86865,86923..87794)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631393"
FT                   /orf_name="MICPUN_63905"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="arginine metabolic process "
FT                   /protein_id="ACO67141.1"
FT                   /db_xref="GO:0006525"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C336"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK6"
FT                   /transl_table=1
FT                   /translation="MLASTSTPRRATAPRGFGFPDVTSRNRAFSTFGTRRPRLASARTF
FT                   RVAAKSSRPSLRGAANGAENESSGTLDAENGYWRVEAASVQRARGTLRRISEFAGERTT
FT                   DGIGDAHLAAALARDHDLIRAIDDAGALHDRLIHSQGLCGGRCYATLLALDEDSLRARL
FT                   TKDVLNFYPEDGTQPFVPLAARGPWIVTAHGAVVYDAGGYGMTGFGHSPDDLLDAVGRP
FT                   EVMANVMTGSFAQADLTHALRREIGRNWRGANRGRMMVTNEKDAEDDDAAWTNQLEHPY
FT                   ASFACLNSGSEAVTLALRVTDVRARTEIDVKGKTPVFIALKGSFHGRTNRAGTVSHATH
FT                   GLYAEELASFRPGNWREPSKSKGAFDVDDFFRAETQTSKDEFTAEDADDECDSDFAHPF
FT                   YDSWKDCWQHKRRKDDVEALRGAGRDANQREGFDTDESFQPPPCLFVEPNDVQTLVNTF
FT                   DACDRAGLFVEAMILEPCMGEGDPGRMITREFYDEARRLTKARGTFLVVDSVQAGLRAT
FT                   GDLSLVDWPRFASCEPPDFEVFSKALNGGQFPLSVVAFSERARDAYKTGIYGNTMTFNP
FT                   RAARVGTAALRAMTPARRANVVERGKELLSALEDLVRRYPSHLDRAAGSGLLAAVHCAP
FT                   SVRVTGDGGLEERCRRAGLNAVHGGENALRFTPWFDMSTEEVRLLANVVEEALLGWMRD
FT                   NGEGNDGVDVAKPRDSFSTAAYASAYGFGSTKTPKEARFAKFDKAKFDPPDIELKAKNY
FT                   DGTLRDSAKTRVARRVIDAAVGKYLARNPKVRAVASSVRAAAAASSSSEGVKFTGTYAP
FT                   SDGDCEGLPLDHVAFRTFALPNMGIDAVAGLFTSLGYVEASDPGKLGDGPMRFPEKKVS
FT                   ARWFRPPDATPPLPRIFISELDVSDLSNAARATIEAYVGGTGDGEHGMLFSTQSASAAL
FT                   PYDTRRGARKKEKKKSKVRYPGAFADPDFHKDTFECVLDLIEDVYATAGDHAAGVASHM
FT                   CCDGWDTPWDVRGIAKADFDLLTNESEYAAWTLVNGYAVNHVAIAAHRLPLESGIGDLR
FT                   SLNAFLQGDVPAARLVPVTPPGDSPGPGDSPAVSDSEDDAEKAVIRREIGGYGEIPEER
FT                   CFSERWEKFGEDGLYRFIVDPVACPTSGGPPNEWNDFEDEDDQTVDQTEPGSGVDAFTR
FT                   VSPDGGLLQSSISADVRLVKLFDERVGSLVECAVPGGYLEIVQRRPLDPNAISANVPAQ
FT                   SLGDSALRDGFHEGNANGIFESTFRANTHPRAKGAADAGKGGGGEVGKGAKSSAVSWSL
FT                   RRVRSAEKERDTFFVDADCDPSDEECHYAF"
FT   CDS_pept        complement(87968..89077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631394"
FT                   /orf_name="MICPUN_63906"
FT                   /product="Predicted protein"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67345.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI000199C337"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK7"
FT                   /transl_table=1
FT                   /translation="MALLAPSVADAAVLGSRRAGVARRRGLPRDARAAALGPGGATRRG
FT                   PGTPGRLTTTPIAPRAFFGKGDETKDPFKRHRLRDPTPFPESIGVGFQCALVGAKTAVT
FT                   NPSQVWGPMTGATLVVAVALDVGGTTLTGRWLNPGEDAGALWTLVERVALVAVDGAWLL
FT                   VSPLVAIAVVQQLLPLLGEKILFDALKAPPPGESPTGESPTGESPTSSSATPSTLAASR
FT                   TARVAQLEASDGLGLRSLGVAAARAQSLATLAGVAVPIGVGVSLVPVAGPFIAGALAAA
FT                   LAAYSLTWELLDPYFDKAGLDFEAQERVVWGNAVALTCFGVPFSLALAVPFFGPMTVAV
FT                   AQGAAAEVVWRVLERDPESEARRTEIAES"
FT   CDS_pept        89500..90036
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631395"
FT                   /orf_name="MICPUN_63907"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67142.1"
FT                   /db_xref="UniParc:UPI000199C338"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK8"
FT                   /transl_table=1
FT                   /translation="MGVASRGHGEQAPLLANRGGDASASASDSETPRGGGRSSRSGGGG
FT                   GGGATAVCFSVSMIFAGFIVLIVGAYSSSIYGFITGAFVDGVTAGATYHPSTEQVTIQD
FT                   RAAVVAVTMAGGSEDYEDLDDLSHSPKTPLDAQMEGEGFSKGYREHYHLQDKDHQQYTG
FT                   SATPWKEDTGGAGAE"
FT   CDS_pept        complement(90105..91094)
FT                   /codon_start=1
FT                   /gene_family="HOG000005811" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22631396"
FT                   /orf_name="MICPUN_109434"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67346.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG558525"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199C339"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGK9"
FT                   /transl_table=1
FT                   /translation="MFVRSAVPEGKGVSSSAACEVASMRALAVLANVPFDGDEGGAELA
FT                   ALCQLCENAVAGAPCGIMDQMTASLGRESRLLALLCSNNAVLGHVRIPRGCKLWGIDSG
FT                   VRHSNDGESDYGRVRCAAFMFREHLKQTWPEKGIDHLATSVDPRWLEVMSLNGALPKRL
FT                   SGENFLVMYPEGHGDDVTSIDERVTYDVAVCGSHPVMEHRRVTLIRDWLAEVADDDAIS
FT                   ELVATQVGNYMYQSHESYGACGLGSDATDKLVRLLEERGRDRGVFGAKITGGGSGGVVC
FT                   ALTADTDDAERAVAEVCDEYGGKPAVFVGSSPGAVSFGHLSVVIKPSD"
FT   CDS_pept        complement(91745..92041)
FT                   /codon_start=1
FT                   /gene_family="HOG000239207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631397"
FT                   /orf_name="MICPUN_109435"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67347.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745300"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniParc:UPI000199C33A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL0"
FT                   /transl_table=1
FT                   /translation="MLGAIAEWCREHKLRAIGGVWLTGMGASMAYNATQTSLSPSVKVI
FT                   HSRIYAQALTLTCLLGSAAAEWYDVKYNNRRVVDDDPYVYKPPQGTRTAPVGR"
FT   CDS_pept        93489..94556
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631398"
FT                   /orf_name="MICPUN_63910"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67143.1"
FT                   /db_xref="UniParc:UPI000199C33B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL1"
FT                   /transl_table=1
FT                   /translation="MSSPPTGSGAQRRGTMEPPAITPSPRGILRPSGSFKKRQLERLRL
FT                   EEAEEAEAAAVQPRPRVGQRLFAGDDDERPCPWRRAEGRSVDDDAAAREAVEARAASSG
FT                   RARDRREARERDEPGDENATGWGSHLKISDVDDPRARDDGFRVGRAALSLKAEVREVDA
FT                   LVDALRGMCDGASESDGDGPGFSDEVNEVDESDASFRSAEEEPAGGEDDDDDDEEEDGC
FT                   GGARWSPDTVLRPDGLFDESPSPTADHALRRQSSVTFDDDRITVHDIGSVKDLRREKRT
FT                   SIAGAILEWVKADVRGFVEGVVGRGRRRDSAEEAESAKATRKSLRESRRNMYVNVDNAA
FT                   YGYCGDLGDPDFTFV"
FT   CDS_pept        95524..96045
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631399"
FT                   /orf_name="MICPUN_63912"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67144.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199C33C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL2"
FT                   /transl_table=1
FT                   /translation="MAMKTTIWRPNVRVTLDEYGEVEDTERGGEEVTKKGTKRKRAPPT
FT                   KGPCEHGVKYRSNCKVCSACPHGRQRSVCKECGGASICEHGRMRSRCKECGGGSICEHG
FT                   RRRSTCKECGGASICEHGGRMRSQCKECGGGGICEHGRRRSRCKECGGSEICEHGRRRS
FT                   RCKDCRGERL"
FT   CDS_pept        complement(96139..97440)
FT                   /codon_start=1
FT                   /gene_family="HOG000165463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631400"
FT                   /orf_name="MICPUN_109436"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67348.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG409729"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="UniParc:UPI000199C33D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL3"
FT                   /transl_table=1
FT                   /translation="MQACAAYCIGSACMTATCSCCGSLGKAVSSISARAVYTVIFGLGM
FT                   GIAVVMRDYAKPMMMEIPWIGVVPGMQPSDEWFGQSAVYRVSLGNFMFFGGLSAMLVDC
FT                   KTRSDPRDRHIHHGSWTLKLAAWALCVIVPFLLPDGFIDAYAWLARLGSGVFLVVQMVI
FT                   LLDFAFLWNETWVAREHVGWVVGLLVSTIALYAGSITLVVFMYQWYAPKGLDCGRNAWL
FT                   ITTSLVPCVFFSALSTHPIAKEGSLLPSAVVTSYCVYLCYSALASEPTEYRCNPRGAYA
FT                   GDGKASEVASTVLTLASVAYSAVRAGSSDFFGGVNLGDGDGDYAALSGAEMGGGTDADA
FT                   GDADSEDDVGGAASYPSGPVSYSYSFFHFIFALASMFLAMLMTGWGRDDYKGAERVDVG
FT                   WASVWVKMCSVWVTAGLYTWSLIAPALFPDREFM"
FT   CDS_pept        complement(97656..99497)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631401"
FT                   /orf_name="MICPUN_103996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67349.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199C33E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL4"
FT                   /transl_table=1
FT                   /translation="MANRACASALLTRATAPSPLARSRRAHHRRVAPLRSRGIVAVSTS
FT                   TNADTNAVTRTETAARVMISETKSGIVQYSFGAVPQSRSRDPALAEERAARSGMDKYDD
FT                   KDASQTKKELVFDVTLDAEGGANATGLVFEKGPDGLLVVAKIRPGGTAAGVVKPGDVLL
FT                   GCSLLVNVEDEDGEFTEELRWHDATAHGPEHTLTMLLTHGEEMNVRTCRGYVVKRDKAI
FT                   RSAWAQLVPTSPAKDIRSCWNRLLYHVEQEEKPKNGAKKKKEMAKDNTPRGIWGGLVGK
FT                   KVVPVEDSVRDAWGAIYPDIIVPAEEWVGEDAVEQEPAAEEEPTLVAAAVEESTEARPE
FT                   VEEDEEDDDDYRLPEESIDLAAAAAAAVEEVAVEEAVEEEPPAVVDEEAVEEADEDEGF
FT                   FGKFKGVEGQFDVLEVSVDCSRGVNMTGLMLGQDRSDGLLHVRVCKPGGTAHKKIKIGD
FT                   VILATTYVVLTPDPSTGKPVATLEWLDATDGASNEDIQGAMMTHSQEMKLVLARGDVPS
FT                   GHFDQPSPAARERCSDAAIGGGVAQPEECVPEDVKAWAARVAAEAKAAQAEAEREREAA
FT                   AVKAAAGGNREEKLGAMSPEEIKAWAARVAAEARGEK"
FT   CDS_pept        99879..100838
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631402"
FT                   /orf_name="MICPUN_63915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67145.1"
FT                   /db_xref="UniParc:UPI000199C33F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL5"
FT                   /transl_table=1
FT                   /translation="MELLTWHLRGPLSRRAHGAGMRGGDLIREVFGSESDSDDADELNR
FT                   PGPSPPSPLMRPGCVVETPAGADACVGMFVAREALGEDARRWLLDSIRADDLVDFPDDE
FT                   PSTTASDRCAPTGGARNQAMRFGRDHLPRWALALADAVAKLATRRPGDSQGEHDVASAD
FT                   HTDDDDDDDDAAVFPREVLARARTASGVFNQMIVNQYAPGEGLTPHVDLEAFADGVAVV
FT                   SLRSTVVMDMYPPGFEPGTSHVPTNSNTVPVWLRPGDVLFLSRAARWEWAHGIAARDAD
FT                   PAEGETRSEGGAVVRRGCRTSVTLRAMREDGHELRVPA"
FT   CDS_pept        101012..101917
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631403"
FT                   /orf_name="MICPUN_63916"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67146.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199C340"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL6"
FT                   /transl_table=1
FT                   /translation="MSTFSALRCGVRVDRSAQTPFLGLRPGATRRRVAGWREDSPLAPP
FT                   DGASKKKSKRDKRKGAATPRVEGGGKGEVDGAELSTIDLGQGKSAALYVPTNVAEVEGA
FT                   VSAEGVKQLLDMYKDSLYGAGDVVWPASIALSRLIAHCPSLVKGKAVLEIGSGLGLCGC
FT                   VAAAAGASRVVMTDIDGDMLRLAAASADANGSANVETMTLDWGQRESWPKGEFDVVIAA
FT                   DVLYDGDAAAAVAGVAGRCLRGGGVGSMAIVCDPAQRTHRGTFAEEARGVDLDVVDADF
FT                   PGHPDMRLLQATRVELTAGA"
FT   CDS_pept        102107..102856
FT                   /codon_start=1
FT                   /gene_family="HOG000100142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631404"
FT                   /orf_name="MICPUN_109437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67147.1"
FT                   /db_xref="HOGENOM:HBG611165"
FT                   /db_xref="InterPro:IPR021855"
FT                   /db_xref="UniParc:UPI000199C341"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL7"
FT                   /transl_table=1
FT                   /translation="MSARVSIRARRLNGRAPNPAPVRRSAVVIEAAKGRNAKLAGRNKK
FT                   AQSIEDNKWREGMEAAAAERADKKKAEPKQSGLKYSKRGKVSSQPGQVSKAALKRMKLD
FT                   LEEKKANDAVSAERMEEKRAQYQAASAKGIPQVVTDRMLKRITIFSGVPLLLGFSTGPL
FT                   FYLGKTVAHFDLAPWQFFFASTATFGAALVGITYGVLSASWEPGREGSFWGVTEVKANI
FT                   PILWQTILGKAGGNIETQWEDEWDDGR"
FT   CDS_pept        complement(102952..104574)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631405"
FT                   /orf_name="MICPUN_103998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67350.1"
FT                   /db_xref="UniParc:UPI000199B979"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL8"
FT                   /transl_table=1
FT                   /translation="MADAGEHAPLILRRTARISSNHGSPSRARIVLGVVLAALLVALVA
FT                   STAPASLLVDVLSNLRVDLFGAGAPPTVRVLVNPRDWPERDTLDVVSDTWRRYHEESGA
FT                   VVVPLELPDPDRWPMGGGYAELTARTSDLLPGTRLDFLAFDAPDHPDLPLAVARGRQRV
FT                   AASSLGHLGAWLDARREDGVPALAVVDADDPGDPKLPPIAMAPAVARQLLRGGSPGMKS
FT                   RHPGTVLRDGRVPGDDPGDDPGWDKGWDVLFLDRGTARFRWKFYVVSARFLARLPLLLR
FT                   DHPYVATTEWQKGLCRAGTLRCFDYFGEIGGAYEIASPPPPTGEDRENGRTVRRRSEHA
FT                   KRKDETASRVLGSGGDWRDVDKAVASVGALDGGSNASTDVVPVRFSSNDKSYGKARKVE
FT                   KTIAYHVQDLPVNSSNPGDLAMTLARGMAPALDELSEDASKTADDVVDFILNGVLPKED
FT                   DWAAKNRARMEEELRDEEDAREREIREQEAAMERRAMEDLWSDGPAMEEAVERVREEEE
FT                   ETEEAEAREKKAEASSWLADVLG"
FT   CDS_pept        join(106409..106525,106565..106768)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631406"
FT                   /gene_name="SELH"
FT                   /orf_name="MICPUN_113704"
FT                   /product="Selenoprotein h"
FT                   /protein_id="ACO67148.1"
FT                   /db_xref="UniParc:UPI000199B97A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGL9"
FT                   /transl_table=1
FT                   /translation="MAPKKAPAKKKATAVKGGVAKKPAAKAEPEATAEIPKGGTRAAKI
FT                   ESAVKAKGAKVSINPVKPGKGNFVVKTEKKTVISLIGLARPFPKLKALDMDKVCEDVLA
FT                   AL"
FT   CDS_pept        109421..114613
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631407"
FT                   /orf_name="MICPUN_63921"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67149.1"
FT                   /db_xref="UniParc:UPI000199B97B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM0"
FT                   /transl_table=1
FT                   /translation="MAETVRVSLRQGEPEAVVDAPQIAGEDDAPGPRTSAVSWSSRENP
FT                   DDDDIMISALVSAMAKGREISASLGGGTDPVRVTVNLDAPEPTNPSGSRSSSVQRERVG
FT                   FGSSAPRVTAPKVPSDADVTGPGLAYANVENLSRVARPNAPGARWGKPPPRRPALAESL
FT                   APSSTRRAAAHAVSAVTGAAIGTGGVAEAIADLEWVVRGEAGGSSQPALVSPERLDVAR
FT                   RKPRATTFSKAGLVPVTHRAVTHQAVTHRAVEEDLGARTHRELPQYDERFRAVEKTPGR
FT                   LAKFSSLPTGRDAAGDESTSSSEGTGSEWDGLDDDADAWWNAPFGTLTFAEGLKRTPRK
FT                   VKKRTTVRAAGDEKENAAGTKRRTKTAAFASPANKPGPSKPHEPTKGATRGDKARQPPR
FT                   PGSMLDPVALARALDVTRAKPSGARGVTKWAPPAVSLPSPAGSVASIESTESDDWHGRN
FT                   IRRDLRRRASAERAAIAKTTAADTDMNAVRPRNVTGVTKWGKPPPAPDERRATSKEKVK
FT                   SAKGFKARESYENAARDHKLGRVTAAGLPLDVQLAAGLQLRPTEPKPYDPDGDAHTNEN
FT                   LPPLPDDAAVRKRVPGYTFPKPKPLDEDLDEFAKLKKARRKEELETPGPGHYANHTPRV
FT                   ETRPKAPAISFGDHPIVPVEVRQSMKIDLADFHPSDLDPVAAWHKLRGTEPKGFATFWK
FT                   HPEKKSHIDEVIEKVERVEAERHAGRIEHAVSKALRQSRTKDWKTSDDIGALGDAIAAA
FT                   AARVDEEGSPDANRSLVERRVDVGGAWARAGANKPPADGLAEEEYAFDYDAAIAEEAER
FT                   RRDPVGAWKTSVAPSKPVFSFPKGPSGREDVESELEPWPVLGIGEPWSERRVEGGALPF
FT                   ELMLGRSDAYADRLKAREAEENRKIFPGSYNVVAALDYLRRQTPAAIFKLAADRWRAHG
FT                   RARRLVRARNLLGADVAGYMAEEWDDDERDEDEGPAMLGDEARAAADAVMRPRAPAWEF
FT                   LPLRVTVAKANVVTGMKPGDRPELDVKLTLVRRRQPGATKFGSGTPTGGSKKSSARTRD
FT                   EANAARRGPGAYRLRYGQTERRAPRAVMGTSGLGDNAIMEDDEDAYAEGSVLDIDPAAA
FT                   FAAAVARRKGTAVDMSRMPHPRVDDAERARRREELDLAELTDRPEVETTPLKAFRAPDG
FT                   RGGWSALMDVSPAASRRRRLAEERRAKMEGISEGISGPDSSSPTKTRMRAKDKLTDPSS
FT                   DAYVRRRTDAGVMDFASMTFRVSERTPGNVELDLLEAGIGPGTYAAEPVSRRVPEVDFA
FT                   RGAARFALTDAEKAPPDEPLEGERVAIEPGPAFDATRPDATRGGVISPLPTRAESSKGK
FT                   DDAGKDGATQPPYADALYDVERGLRYMRSARDDVAPAFERGGPRVTDPALPDPRSNPEA
FT                   ADFYVGDLDERGRSTSTGESTRHRARGWMGGWKVAPAPPEFTEGDILYLDPARADDYRR
FT                   RRTIGNVPDLGAGGSRETYPGTQELTRDVDYVRDDALRSAYPPLVTGTGAVRVDRGRAG
FT                   MSDIFVRQTDAGDLDAGAYHDESHRAEARSRLSNRERARSVDFSKAPGRRGAASDGFGT
FT                   GGEGDVLVLDPIDPRTAPVGRGDGANNLAVDYSRDRTRRAFPASSPANPGGDVLHLQPG
FT                   RGDALGERARKADFGAGPGRGTHPAGTFGEWTDANVIHGLRAEVDLDKTAGGFGDANAR
FT                   RRERMARLVARQPRRGRGDQRPEPERPGKIVIA"
FT   CDS_pept        114909..115229
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631408"
FT                   /orf_name="MICPUN_104001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67150.1"
FT                   /db_xref="UniParc:UPI000199B97C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM1"
FT                   /transl_table=1
FT                   /translation="MAVSFAPLTSSLSSSGSLAAGAAVDSAAGASSSLARTIVERDPSR
FT                   LAAIIAVLRAPGVVPMRTALGARTTETTRVLDEDAARHPAMTAVLWRTKVDISRWDVPR
FT                   GC"
FT   CDS_pept        115391..116524
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631409"
FT                   /orf_name="MICPUN_109438"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67151.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199B97D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM2"
FT                   /transl_table=1
FT                   /translation="MSDQKERMVPADRSNWNAILKWSMAQQGDGTSSEPAREISEEDRR
FT                   WLLDAMASGFIDEIKRMKDIIACISAGIEATHDAEEIDARVELMEELTDRVSGVDNGGD
FT                   LHTLGGLEPLVRYVASSPHARLRAAAAEVLGTTVQNHPKAQEAALGCDAMDPLLRMAAG
FT                   EGDDAPPTDAAQAESTTTAQGDASEGTKELVKARVKALFALSCLLRGCTRAQEAFQLGD
FT                   GFALLKNCLRVDHARLRTKALHLARHLATLDMRFMRACVDAGYVLAAAASLAGSLPRVF
FT                   DRDADADANADLSADAFTEEDIEKGQVREAALRLMVDVARKVDFDAVPKAVDHLRSAIV
FT                   VNAINAVGKAYTRFGREEKETYRDEMQLCAQLAKMFE"
FT   CDS_pept        116741..117988
FT                   /codon_start=1
FT                   /gene_family="HOG000265933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631410"
FT                   /orf_name="MICPUN_63924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67152.1"
FT                   /db_xref="HOGENOM:HBG558536"
FT                   /db_xref="UniParc:UPI000199B97E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM3"
FT                   /transl_table=1
FT                   /translation="MVSTRRSARGPSATATAIGTGKDKKPKADGKRKRSASTAAAKATP
FT                   AAASAPAANTDAATPLLDLGPLEEGVLVGRPSERNRSPYVGDVRITSGPHAGRVAVTHL
FT                   PNMDSGGKCRPGVRVLCRRQPGVTPDTVGQYGTPKCELVCQLIRCDEPENDALGGCWVS
FT                   AHPTIGEKLVEALIRRGALDARLHAPVCNLETQVGKTRKVSDSASGGYRPDFRATHADG
FT                   TATVLETKQVVDTDYDPRTVHDAAALQPGHPVYAPRDDVNAGGYERAGIFPWGKRGQKG
FT                   PGGEQVVSARAIEHVRELAAVVDPGTVRGKKGTSGDVHAAVVLMAGRHDVCAIRANGAA
FT                   CPSFAAHLAAAEGRGVRVLGHRVRWGEGVDVGRAFDGGEVPVLPPLTEEDLAVLVPKPK
FT                   PGKEKKPAVKKARTDE"
FT   CDS_pept        complement(<118198..>118551)
FT                   /codon_start=1
FT                   /gene_family="HOG000006197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631411"
FT                   /orf_name="MICPUN_76789"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="ACO67351.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG318604"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniParc:UPI000199B97F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM4"
FT                   /transl_table=1
FT                   /translation="LSRERVAWFFALSTVGTLMFTLAFFVGLPTLILAPAKFALCFSIG
FT                   SACSMSAMGALRGLQGQLAHMTAPERLTHSAAYVGSLLGTLYCALVLHSYVLTILCSFA
FT                   QLTSLLYYQVSYFP"
FT   CDS_pept        join(complement(120145..120424),complement(119120..120060))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631412"
FT                   /orf_name="MICPUN_63926"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67352.1"
FT                   /db_xref="UniParc:UPI000199B980"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM5"
FT                   /transl_table=1
FT                   /translation="MVSQSGPAEDARFRLVWRETEKSWTPALVAALLGLDLEVDAADDM
FT                   GRPHDEGEKASAVGPPRHGRARVSGCPGTEVTVEVPTLRDLKLALSFNGLEVPLTHGYR
FT                   HYRLQPSPPHDNISDAQVPGEDPPLVAQLAPLSTEEILTRLKKARREDDTSPPSKRRKA
FT                   QAKGSKNKTLAHALAVNDLARAMGGVRPVYRCPGAAPLRPADFDELRGKLLEALRDFQD
FT                   FFDNPQRKGVRSRRYLVLKRKAVDDAEKFRRRSVVDVPDRCRSEMVGTGNKVRERARVW
FT                   SLCEEALRTFFLEGRHPEYDSLAITSDFRGSPHVDKKDTSHQYVLALGDFEGGELCVEA
FT                   GEGGEKTLAVDVKNRLGRLDGRVPHWVSGWTGERFSLVFFRTGGTPTPIEPVDAHVRWM
FT                   KSQSIGS"
FT   CDS_pept        complement(120501..122885)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631413"
FT                   /orf_name="MICPUN_63927"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67353.1"
FT                   /db_xref="HOGENOM:HBG608942"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI000199B981"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM6"
FT                   /transl_table=1
FT                   /translation="MDPSAEEKARRVRSLLSSYYGGGVGGPSPKTASLPAIDRDGFDHD
FT                   AYVTESVRDVPLAELQARCVSMAGEIKQLDGDMQMLVYENYSKFIVATDTVKQMRTNVA
FT                   TIESRVEELTASVDATAAAADAVNLKLSSHREQIEQLNGVRALIKKLQAVFDLPAKLRT
FT                   CADTGALALAVRYHVGARPLLAKYGDAGAFVGVKRECDAAMKTVEEKLRAGFHDAAVLA
FT                   AARRRRRREMHEKASEEASHGSKGDDGSENADTAGSDSPDPSPSTLDASECVELLERLG
FT                   TPSGELQGAYLASRRVAMDRSLGDAESAASSSPVPDARAFVVSLSASFLEDFRETAAEY
FT                   AELFKDREPLVALGRELLQRYFGVVKLGLAGGAGSGAAGVGTTPARGLMAALAQMAADL
FT                   SGINRLVPEIRLGDRAAEVVETATRERVGAAFRALELKLADAIERTGADVEARVTNADA
FT                   GGGGTDDGEDGAFLLDRFEELRDATLAGVKEALADTRSLLEERPVMVASWREEFESLVR
FT                   GHAASTLDALLAGLRSAAGPPPVLLVHARLASFMETDGVPTIARTLDAFFPAPKDSEAN
FT                   TRTLFAEKEQIYAQVADELVRAYAAEQTTRLSLMIRQSVALGRWDVANEPRDVSPVVKA
FT                   VVASLVAVETETAGILEDGGYGSLSALSETHAAPATGIDRGVADLFRGEGSASSSGVFD
FT                   VAVEPTRAHVLGAVTKSALKSFVECVRGVRRFNRCGYQQTQADATYLDRRVRRFVSIDS
FT                   DVAGVVGLCGAMVSAAGERSEDPTPLDPFVVDRILSQKANR"
FT   CDS_pept        123333..123899
FT                   /codon_start=1
FT                   /gene_family="HOG000265722" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631414"
FT                   /orf_name="MICPUN_109439"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67153.1"
FT                   /db_xref="HOGENOM:HBG558539"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="UniParc:UPI000199B982"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM7"
FT                   /transl_table=1
FT                   /translation="MGYAGYAPGHQVQIATPLQQLLKLIKNDATLATIEKLTRNTAQAP
FT                   AEEKFRKIRLTNAKIAEVITNVTGAVEAMVEMGWVKEDDGEFLVLPAGTSVSMREVREI
FT                   DDARRALKKWEEEELKRRIAARNKANACPEKARLLAEMAADRAEQKARGPVTQGSVAVE
FT                   RSDKALAERMQTAAGAGCCGSSGGG"
FT   CDS_pept        complement(124389..125231)
FT                   /codon_start=1
FT                   /gene_family="HOG000265718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631415"
FT                   /orf_name="MICPUN_63929"
FT                   /product="Predicted protein"
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="ACO67354.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI000199B983"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM8"
FT                   /transl_table=1
FT                   /translation="MRPAAAFAASVFAAKDDDDDWEDIDPDDIEFLDGEFVVEAFDDED
FT                   QLAKALCAEVEENAKACLAERGGFTLAVPGGSVAKALAGLKDAKGIDWSKVHLFFVNER
FT                   VPDGKCHKLAMDTWVGAVGMPDANVHKPDAGGSVEEEAAAYEAQMRTLAERDDDVMMLD
FT                   EVNGLPVFDLILLGMGADGHVGSIYPDSAALKDETGAAVLGVDMPGKRSITMSLPLINT
FT                   AERVVVAASGTKKAETVRAVLEDDESELPGACVDAFSTIFFLDSGAASKLVAYAEEEE"
FT   CDS_pept        125791..126480
FT                   /codon_start=1
FT                   /gene_family="HOG000194110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631416"
FT                   /orf_name="MICPUN_88301"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO67154.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="HOGENOM:HBG326467"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniParc:UPI000199B984"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGM9"
FT                   /transl_table=1
FT                   /translation="MLQKSLLSVAAGVGAVAFPHRADLVGAVGETTGWYALRRMRDRMR
FT                   RDPTGRDILRRRPRITDDFLERCHALPEGTFGGAYAKFMGRRKFNPNDRPPVRFVDDEE
FT                   LAYVATRSREVHDLWHVLFQCPTTVQGELALKALEFAQTGLPMAALGAAFAPILLETSK
FT                   REFLFNEMYPWARRAGARAADLMCLDYENEIGTDLAELRHKWRITPAPKQPKRPRANTD
FT                   EDKDEST"
FT   CDS_pept        join(complement(129306..129475),complement(126736..129185),
FT                   complement(126612..126700))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631417"
FT                   /orf_name="MICPUN_63931"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67355.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199B985"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN0"
FT                   /transl_table=1
FT                   /translation="MDDEEFGAQAETRRPGPRRDYQSGTRGRGFGGTEVAMLILIAHTG
FT                   KTVELECDGTSRVDSLLQALASLTGVPSGDQLLLFAGQKLEPSKPLATYGLPEASGTAA
FT                   PGPRSIHGDQVHHVEDEKPRHVFLYCKSLLRPDAQAPPEEPFEDVAVDPPPPAPPRSDG
FT                   THPLDDASSPLIRALPDYERQFRHHRQSAAAVWSATQMRFEECRRLVTEMHVQALAIDS
FT                   ARDNVDHHFNYICRCQAEFERSHSAQNAAHSELLECFDRDMETLESTALHPAVVEHCER
FT                   RRAEAVRTASETAATEGEKSGPKVAADPPSVTGSGSSAGSGDVTSSTESATGGEGKTQI
FT                   EGKTGGSAPPSPSRTQLAPPAIPPVRRNLLDCVPAERIRRWAQDCARSHDAFNAKVADL
FT                   AAMFNALHATTEELFMTGPDVDIAALEEELERAQGKLAEQAAVIQCLDKDLNTVGRLVE
FT                   ETVGDLASNRGGTGSVGGGALDACAALDPMNELHVKSHLPAVDAVDREMAALHWHCAQC
FT                   KHAMGACVHRQLQSISALQSQIHQTRNKQAGFKEWGKRQEQKFRELRIARRIPRVYRAC
FT                   LAEVARRVAFQEMYAAQAGKLAERMARHRERETRRREQFTKSHERYLPPEVIAGLGLCA
FT                   PPPQCEVTVTRSGTREGADVGTPPLARVTEEDLRRIGSDAAAAYVEELPSPPPSPMVGV
FT                   GAIEVGDDAAELLGSLALDDDEGDETDDDEDDTEDGDKDGDKDGVSLGDGAMTRSRAGR
FT                   DGDLYLENARLRADLAANVALLATIDSDRVRVLSKSAQTSQVLPSENELGREPVGVQTS
FT                   RGSLGPMGASTMGRSMQTARASTEGVGVQTSRTLRAPAESEGASTQTSQVLESEEGRTE
FT                   RARWRVEVRARQGYARAPAAGGARSVVGARG"
FT   CDS_pept        129714..131030
FT                   /codon_start=1
FT                   /gene_family="HOG000247596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631418"
FT                   /orf_name="MICPUN_109441"
FT                   /product="Predicted protein"
FT                   /function="UDP-galactopyranose mutase activity "
FT                   /function="binding"
FT                   /protein_id="ACO67155.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008767"
FT                   /db_xref="HOGENOM:HBG701924"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BA10"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN1"
FT                   /transl_table=1
FT                   /translation="MTTLGNDEWAGMDLSVRRGNDHDPSWFAGLNGLADEYDMIIVGAG
FT                   ISGCVFAERGSKELGLKSLIIDKRDHIGGNCYDFINKHGFRVSQYGVHLFHTKFDRVWE
FT                   YVNRFSDWIPYEHRVKGKVKDIRDEYQIVPIPPSQETVNKLFDANVHTEEEMEAWLDAR
FT                   RSVNPDPKNGEESALTRSGPELYEAIFKHYTHKQWDKWPEELDASVLARIPVRTNRDDR
FT                   YFSDQHQALPKDGYTRIFENMIMSDPNITVRLNVDFFEQRAALPKCGLTVFTGPIDAYY
FT                   ASQGLPKLEYRSLRFFEEYHEPDASDKSPHPGFYQPCLQLNYPGPEVDFTRIVEYKHKP
FT                   NQPAEAKQSKGTVIFKEYSCDVGEPYYPVPNPANRELYERYQALAKDEPGVCFVGRLAS
FT                   YKYFNMDQAFLNALECWDEVKAGGKVAARTELGEPDGPK"
FT   CDS_pept        complement(131170..132348)
FT                   /codon_start=1
FT                   /gene_family="HOG000100143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631419"
FT                   /orf_name="MICPUN_63933"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67356.1"
FT                   /db_xref="HOGENOM:HBG558541"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BA11"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN2"
FT                   /transl_table=1
FT                   /translation="MEPRRSERIKVSKEDGFGVLLGALIREVPDLFDAEVLSKLDVEDH
FT                   LRLAQVNKECLDAVYKLSPVEFMSTCPISRPYPKDSCPYDHNLWLYDSYIETGHLVPTW
FT                   LGIPPTTSGHEVQGDTRAFLNRQHQAAAMGRLDVLKWLWNHGHKCVHYETAYWAVKYGH
FT                   MHVLEWFFELPIERQLRKDDEDTLDPNCLFGDPEILCMGAAQVGNYEVLKFLREKGCPW
FT                   GKRTSTEACRYGRLEVMKWLQKEGCLCDLDGFLSVCGGHLDVLKWIRETYPGCAFDARA
FT                   SQWSSIHNRLDCLMWLREHGCPWEASVMNHAAGGKGNLEILKWAHENGCPWNVSTANCA
FT                   AISGNLEIIRYLHENGCPFSEDACRHAVEGEHWHCLDYLVNNELPGWEEYNY"
FT   CDS_pept        132561..134093
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631420"
FT                   /orf_name="MICPUN_104008"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO67156.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199BA12"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN3"
FT                   /transl_table=1
FT                   /translation="MPPHADVESHVARILNAPPNAPHVVFDLPRGSGVDAFRSRYKELA
FT                   RTLHPDKARCDAAEDAFKIVTEAFRQVTQGGVDRNAGVADAGGFRSGRKPFWSVDASAT
FT                   ASAAPAAPKWSAAPEDASTRSRWGGGGVSGAPTASKTSKTHPRASTRWDRWDHGFDVVV
FT                   EEEEEEEEIDEHAKAAQEEDAAWFSTWGASIYGDDERTGTGPKPARWSEGGGFGGGGGG
FT                   GGGGGGGGGGGSGGSRGQRSSGGSFDKWSAPELEPANRRRATRVRGGIGIGSRRKFPRE
FT                   DHWRNNRSESDDDEDDGDLDEAFVVADGAPHADGDLEDEPRVGWADDDGVATARDWLTG
FT                   GDTAGSGRYWSDPPATGGGRGGGWGRVAGATVSVAGATVSVAGATVRGVRRVTAASPHV
FT                   AIVDEEDDGEDGGEDVERRIAGAGPGGDEGRAAEGKGKGKTRSYPWRRRRRKGKGKVVT
FT                   AGDGQENAGANRDPSTAAAAARKRPRITLDEPRIPHTRLPKKAFTQATLAFS"
FT   CDS_pept        complement(134179..134754)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631421"
FT                   /orf_name="MICPUN_63935"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67357.1"
FT                   /db_xref="UniParc:UPI000199BA13"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN4"
FT                   /transl_table=1
FT                   /translation="MSGMSAIVMTKGVIRAPSATRRSGTASRRGGHGRTLSSSRTTASR
FT                   DDDDAATGFVNIKGDEGVDEARTEVPQSIKDQYRLIEDPTWLERELLRQDDGYPTSRAA
FT                   VLRQTFMTGDAKGFGYAVSSIQLTLAMFACAYVAFAAARVPGAEEGDLIYVVGGTWKWF
FT                   ALLGATSFYLECVKFVESVVGVEGRRKM"
FT   CDS_pept        134966..135493
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631422"
FT                   /orf_name="MICPUN_63936"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67157.1"
FT                   /db_xref="UniParc:UPI000199BA14"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN5"
FT                   /transl_table=1
FT                   /translation="MGKGGINPYSPPRVAPVHEDVESIARALGGGTGNSGNPEEAEVVA
FT                   GLWVGEAWPSPECLAQDPTVPTNPIRWSLTLDADTSASVTAFGAGYFDDSADVEGHSTI
FT                   FFTLRGSFDPLTRRVQFKKVYERPVPPTDVTYDGRLHALNGTPEITGTWDNPTQGTSGT
FT                   FSCMLRCSSGST"
FT   CDS_pept        complement(135585..136706)
FT                   /codon_start=1
FT                   /gene_family="HOG000100144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631423"
FT                   /orf_name="MICPUN_63937"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67358.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG558545"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199BA15"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN6"
FT                   /transl_table=1
FT                   /translation="MAEAAKERGNALYKSGKFSDAVAAYDEAIAADPTIASVHANRAAA
FT                   LSGQGRAFFAEAVRSCVTAVALDPSYARARSRLGQLCTKMGELDTATTAAEDLARADPD
FT                   SAAAKALTRLLRALRDGRNEGNAAFKSGEHARAKEAYTAGIAKAAESDPDRDTNKDAEQ
FT                   TTTTETLAERMPCALLLCNRAACSSALGNHADALADADAALAADPTYVKASLRRAHALE
FT                   ALGRTEEAAAAFAAIRAELPGDPNVADGVNRCVRATGKASDERAGPIHVTDGAQYARLK
FT                   AAAKLCVVDFTASWCGPCRSIAPVFERMALANPSVHFLKVDVDEVQDVAASENVRSMPT
FT                   FKLYRYGSKLEEFSGADANRLQAWLTRYLPTVA"
FT   CDS_pept        complement(136863..137525)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631424"
FT                   /orf_name="MICPUN_63938"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67359.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000199BA16"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN7"
FT                   /transl_table=1
FT                   /translation="MSTRRALLLVGRRLLGPSDSAAALEALAGTTVVHAREMSTRGRGR
FT                   FRGARRPVGKAAPPPALEDPWEEVKDETTGQTYWWNVHTNETTALGAPKPMGNTSLAPS
FT                   QQQAGAPPPVGQPPQQRSVMGAFGSMVAEGMAFGTGSAIAHRAIGSIFGGGGYGYGGGY
FT                   GGGGSAAGGPPAPGSAPEVPPSDAASGGSSMWGDEFDADSDSSDGGGWGDVFDGWDE"
FT   CDS_pept        137717..138532
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631425"
FT                   /orf_name="MICPUN_104011"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67158.1"
FT                   /db_xref="InterPro:IPR008474"
FT                   /db_xref="UniParc:UPI000199BA17"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN8"
FT                   /transl_table=1
FT                   /translation="MGGGDALQKSMAVLAAVKKGMTSVSELRDRCNDAIRAGVDVNGVA
FT                   ERQRVPVGGVHGRDYMKLVRDDVKLRLKEHAEKEGKRLPGFGNDDGDGADAKRLAVGGV
FT                   DGEPPLRLGTGDSTGERLVALGDGKERGKGRATSTSGSEDDGDDADIPGMSKGELVDAV
FT                   LKERVRGAKLKRRLERMEDERKRKRKRGRKEDDKRRRKGKGKKKSKSKSRRRSSSSSSS
FT                   SSSSESSSSERRYDHISGKVIKLKRKSSRVDDRLESNRLKTLKLLNSAY"
FT   CDS_pept        join(138740..140535,140629..141328,141386..141781)
FT                   /codon_start=1
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631426"
FT                   /orf_name="MICPUN_88167"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO67159.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG635183"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI000199BA18"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGN9"
FT                   /transl_table=1
FT                   /translation="MSNVASVRRAARSAASSSALRSHLGSLRGFWGSSSSTAALAAPDA
FT                   AWGTRWTRRSAVVAALGDTRGTFDRTRDPRRRLLSSDARGGNVATRVVTGGGGGGDTGV
FT                   EDERIVDLELHLEASQSYLSYAMSVIVGRALPDVRDGLKPVHRRILYAMHELGLDSKKP
FT                   FKKCARVVGEVLGKFHPHGDQSVYDALVRMAQDFSMSSALVDGHGNFGSLDADPPAAMR
FT                   YTECRLKPAAEAMLLADIGLDAVDFTETFDGSQTEPAVLPARLPNLLINGSTGIAVGMA
FT                   TSIPPHNLREVANALVRFASDPERCTLEDLLEVMPAPDFPTGGIIVQQRGGFKEMYRTG
FT                   KGGVNLRGAATVEKVSGGGRNGQARDAVVITSIPYQTNKASLCEQIADLVNSRTIEGVS
FT                   DVRDESDRDGMRVVVEIRRGADANFVLDQLYARTKLQTRVSVNLVGLVGREPKVLSLME
FT                   IMREFLAFRCDAVERRARHELQKASGRLHVVEGYLAVQAAPDAVVAAIRAAKDGPTAQA
FT                   ALQEKPFWLSEKQAEAVLAMPLRRLTGLEHDKLKTEEAELTARVEDLTGLLGDRSRVIA
FT                   TVAREAKELRDTFGVDRRTDIDTDAQIHAKKMNVTLDMLNSPSLVIMTNRGYIKRIDPA
FT                   VFSKQNRATRGRNMGKMRGGDEVTKVTHCNGLDTVLFFTDRGRVHAVRAFNIPQASTSA
FT                   LGTPFTRVLKLAEGESITAMLPVDTTEEPGEEGETSLCFVTARGLIKRTCASEFVGIRN
FT                   NGKKALVLRKGDRLKHVDIVKKGDGIIIGGIDGSVIHFDADSVRAQGRAAAGVKAMAFK
FT                   PDGLDDTSEDDDTSEALPANASAGDVEDDSEEDGEDEDAKGPMLFFVSSDGRGKRISVA
FT                   QFAQQSRAGRGKKGMGLMKGSKLAALCLTGLDSDEHEHVIIGSQGGVMNRYDVASIRPQ
FT                   SGRAAKGVNVMKLSDGDTVRDITLLPAELGDDE"
FT   CDS_pept        complement(<142625..143809)
FT                   /codon_start=1
FT                   /gene_family="HOG000243931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631427"
FT                   /gene_name="RCA"
FT                   /orf_name="MICPUN_88065"
FT                   /product="Ribulose bisphosphate carboxylase/oxygenase
FT                   activase"
FT                   /function="ATP binding"
FT                   /protein_id="ACO67360.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG320501"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI000199BA19"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP0"
FT                   /transl_table=1
FT                   /translation="MRAVAAASPVVSRPGGVRSGRLRSRVVAARAREERTDALGGQDYI
FT                   LSQASGVREELFKGSILGVDADVATGDLRARGEIKQFGDIKDHASYHIPDRFLDRFATH
FT                   IAKNLLIDGGANLGSVPLILCVWGGKGCGKSFNLELCCKRLGVFPVVVSAGELEDPTAG
FT                   EPGAMLRRRYLTAGKHMSASGAPTCVIVNDVDAGVGRFKDDKATVNNQIAQATLMNLCD
FT                   EPNRVSVGGEWRSDDRAHCPRVPIVVTANDPSVLYAPLTRNGRTDLWMWEPTRGEITKM
FT                   VHDALDGAPGYGGESDALELVNAFPSQPLDFFGAVRSRCADDAVRRFIARVGLENLGAT
FT                   LCGHRGREGGDPGWSASTLTGMDASLRSLLEAGAEIAREQQNVMDVALSREYVAN"
FT   CDS_pept        <144193..>145629
FT                   /codon_start=1
FT                   /gene_family="HOG000239474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631428"
FT                   /orf_name="MICPUN_75359"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67160.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG319535"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR015724"
FT                   /db_xref="UniParc:UPI000199BA1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP1"
FT                   /transl_table=1
FT                   /translation="PFDLDEYKAVVKLLVTFLEPDWVNPWQTKTAQRSTGSGAVIRRDA
FT                   DGGGLILTAAHVVANSTYIQVQLANSPDKVPARVVSVLHEVDLALVAVDEGLDGVDPVP
FT                   LPQAKAVRLPKLREKVYVLGFPVGGNDLSITEGVVSRVEVQSYSHSHARALAVTVDAAI
FT                   NSGNSGGPVLSQSTGGLVGVAFQGYAGSSVENQGHMVPAPVIDRFLRGIDDDDDAEEKP
FT                   PPNLPSLGVHLQLLQSPSLRKYLKMKDTDTGVMVTHVEHGSSAEGSLIPGDVLLEVDGV
FT                   KLANDGSAVFLGQRLAMVAILQARYVGDVVPIRLLREGVEMTIDVTLKTLHQLVPRGQY
FT                   DVRPPFVIVGGLLFQPLSLEYLQSWGGDLKDAPTHLVEQYYDGISGPDKKEVVVLSQVL
FT                   SDEANIGFTFDSVGLDYVKSVNGSPVADMHRFVAAVKKSIKAGDEFIRLEVTRGNVPNI
FT                   VVLETSKLKQADETIRDRYQI"
FT   CDS_pept        join(complement(147794..147796),complement(145816..147645))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631429"
FT                   /orf_name="MICPUN_63943"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67361.1"
FT                   /db_xref="HOGENOM:HBG592941"
FT                   /db_xref="UniParc:UPI000199BA1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP2"
FT                   /transl_table=1
FT                   /translation="MGAVCSRNNRNNDNNNSDRPNRALRRPRPRTPAVKRVRDPSTSPE
FT                   FLDSLLPPPDTLLACSVRCVAQSLEGWHERDEDEGDIENIDTDDEGDVSRVDLSVLPSD
FT                   LSQRVFEDLVQTRRLTARVTGDFIGCHLTEANLRSYPGLTDDWLAVLATSAPNLSSINL
FT                   SGCAALTPDGFNALAACVELESLDVSECPGVNDNALAAVASMSRLRRLACAGCDGITGA
FT                   GLRYVSGATKLRCVNLERCNGLTNGLVYLSGLTELERLDAGWCNHVDSNDVTSLRSLKK
FT                   LKHLNLARTKVDDQGVATIGSLSALETLNLAGCRITDGACFLLGGLTALKELSLEWCRV
FT                   GDGGVRRLASLAKLEVLNLGYSSVTDEGVQHLAPLVKLREIDLDSCQVGDDACKALAEW
FT                   PNLEDVNLSDTAVGNLGLKRISKLTRLRRVNLSYSNVSDDGVMYLENAASIRSLSLDTR
FT                   MVTDEGLGYLAKLKDIEELDLFGARITDEGAKHLRHMPRLKTLELCGGGITDAGVKHIG
FT                   DACRELTLLNLGQNFRISDAAVPFLLQLHKLGSLNLQYSRISNEGVTQLSQLSNLTTLA
FT                   LKGCNRVSQAAVEELRAKCPRLSEVGLDNATASA"
FT   CDS_pept        join(complement(150211..150303),complement(149051..150088))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631430"
FT                   /orf_name="MICPUN_63945"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67362.1"
FT                   /db_xref="InterPro:IPR009617"
FT                   /db_xref="UniParc:UPI000199BA1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP3"
FT                   /transl_table=1
FT                   /translation="MNRTYRGGSVTPDPSLFTAVMEGQWEIVREKLLALATTAAIMTAV
FT                   AISVSILLLFLSLALVVVFRILVVPTTPASTRQELVFDYVPAAPTAVSSFLGAKETKAL
FT                   ALYDNPKLITDAALTSSRVLTPGQRFDVSVSLTLPETRHNVDAGVFQVRAELLTARGEV
FT                   IANATRPAMLAHTGTEVRLLRLLVSWPLHALGLVEEVRTVTLPMFEGVGERLTRPFAGV
FT                   RVTVVPRAGGGPNAVPQMWRAHADLRMDMSALTRFLYHYPASSFAVMVLVTWGYLCAAA
FT                   LLVFAAAAAAGVVRVPTSFAGEVVRRASAADGKQRLDPFFDGMGLTTSSDDEAVSAGPT
FT                   PSRLSADSEGGETTTNGGGGGGGGEGLRQRRGRDFE"
FT   CDS_pept        join(<151057..151367,151440..152025,152259..152618,
FT                   153084..154037)
FT                   /codon_start=1
FT                   /gene_family="HOG000006176" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631431"
FT                   /orf_name="MICPUN_88269"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="ACO67161.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG318537"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="UniParc:UPI000199BAB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP4"
FT                   /transl_table=1
FT                   /translation="RTKALANAGSLPLGALVSPFAPAAVGAPAEEPALRRDPARCARCA
FT                   AFVSPFCAVDTANGMWRCCFCGCDNSDAMFAVGAPGAAAGFPELTRVDVEYLTDAAAAA
FT                   ASGAGSASTPPAVVFVVDESMDDDESASLRRSLLRCVRGSDPSTRVGFLTYAAAVAAYD
FT                   LSVNTGVAAAEVLPGSRSPTPEDVEDLVGDGRMYVAPLSECADAIDAIVSSLRPASGGG
FT                   SVRRRPRCLGPALETAVALLRHGTTGGGGGTAGGRVVVCASGPATRGPGGVAADEDSEL
FT                   FDFEEKAAKEYVDELSITIAKLGVSVDILVGGREAVGALKLAPLADATGGVILLLEDFG
FT                   ESFFENLSAAVRRPASNGAIFTVRASAGIGCARVIGAVEALSKAAATLATAPSLPASDS
FT                   ASTAKEAADAFRLKSRDISQASHVHVQFVAWFPSPEGGRVARCMTRRIPVAPSMPAYLR
FT                   GVDSSVAAVLAAKKTALDAQSDAVGPKEACKRVEARVLDVADVFARRDADGGSLHDPFP
FT                   RELGDFAEAMYHLLRGPMLGTLAGHEDERAAMRQLFLGAGEALARSMLVPRLYVWRGGD
FT                   VFEKIPPADLALRSVDALVLDHGTDVFVWVGHGVSADEERLAAARGAAAGHAATVAAGR
FT                   FPVPRVRMFREGSSQARYMVSRLMPLHRDAPHEQDAMFPPVRSLSPNERKALMESFLPT
FT                   DDFSFFGWMRQLGLAAPLDGSSVKLRMMSGDDTSTTASSLIL"
FT   CDS_pept        154209..156404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631432"
FT                   /orf_name="MICPUN_63947"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67162.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199BAB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP5"
FT                   /transl_table=1
FT                   /translation="MSQPLSPRVIHDALTPAQLASLRVGGAGWEGRVEGVPAAFRLGLV
FT                   VGGLGSGKSSLARVAQRAFGVKPQPTDPLQWPPDRAVVSCIGASPDASVAALQSCGLSA
FT                   VPALLRPFAALSGGERTKAELALRVHAHQTVFDDFGATLSRDAASSAAAGVAKLLVKSD
FT                   VVKRGLRRLFFTVFPEVGGHLGADWVLCLETNTLVIRHGAGPTLGPEIVIDDSDVDITA
FT                   APPGRQSSTDVKELKTSVIKVDDWVKKASEALAVPFDGNSVTSVHRLPWSVIERVKYPP
FT                   ADDSRNDAKEGETPLRILLVSGRSGSGKTMACADAFGPREDWAKGGFIESIDVRVARFL
FT                   ALGLDEFVRCGQHGRTVTQLCEADPSQMSTSEAYLVSLADSIGTGAVLDEFLTSLPPAT
FT                   RAVVARRVGAYVRRERIRGLVLLSCHGEEIARELQPDVMFSAETGVEVDVDSVDPVLTQ
FT                   SDTATWSPEDLIRRPTIRLTRRKIAGGDKGVKVDVKKAWWAEFSANHYLGGGGFNANCQ
FT                   AWVFFLGDRAVAFDSTIPQPGRSVQSIRQHRLVVMPDFQGLGIGSAVTRYDAAKIITTR
FT                   RPKTDVYDDPFTQRYHSSTYHTKLGKSRDASPLWRGTNLNGTPKNMADTSKSITSGLNE
FT                   FHKAKGKALAPIDRQKSSNAVKERKAIVYSHEYVGTAAERQLFLEGCGETCKEQSEKEN
FT                   AAFLSNRKIKGGAAPAPTPAKRQMTLGFAVAKKKIRE"
FT   CDS_pept        complement(156544..157260)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631433"
FT                   /orf_name="MICPUN_63948"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67363.1"
FT                   /db_xref="UniParc:UPI000199BAB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP6"
FT                   /transl_table=1
FT                   /translation="MTANGNSRTETPSRGPLDSWLIPSICKKPRSPGQSQPRTNASPRP
FT                   IAHALPLRPPDPRRVLPSSPPTPAAPKSNELTALTLKGELLVAAILAGAKRCENRSWQI
FT                   APGWYALHLGYGQPTEAEENSWRKHWRASEGANPPIPPGIGARLPSRGSIVGAICIGEN
FT                   TKVVSAAAARRCHGGWGDGGWAHGPRVHRIKHVVALKQPVTGVKGKLSTWSVVDESTAG
FT                   EAAAKAVCDAIKEFTA"
FT   CDS_pept        <158306..>159331
FT                   /codon_start=1
FT                   /gene_family="HOG000223641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631434"
FT                   /orf_name="MICPUN_68689"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67163.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG585708"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI000199BAB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP7"
FT                   /transl_table=1
FT                   /translation="RKLTAEEKATIDLFNSNTPSVVYITNMQQKRDVFTLNAVEAPTGA
FT                   GSGIVWDGDGHVVTNFHVINGANELRVTTQDQDVYPAKVIGFDEDKDIAVLKIDYANKL
FT                   PGKDGTIKTSSHDPTLRPLPIGTSSDLLVGQRVYAIGNPFGLDHTLTTGVISGLGREIQ
FT                   SGNTGRPIDGIIQTDAAINPGNSGGPLLDSSGRLIGINTAIYSTSGSSSGVGFALPADM
FT                   VTGIVEQIITTGRVTRPIMGITFAPDQAVEQLGLGGVLVLDAREGGPAWRAGVKATSRD
FT                   SAGRLILGDVIVELDGALIKDSSDLYRTLDKLSVGQEIMMKVMRGENKVDLQLTLDDLK
FT                   DQ"
FT   CDS_pept        join(complement(161135..161138),complement(159647..161007))
FT                   /codon_start=1
FT                   /gene_family="HOG000239662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631435"
FT                   /orf_name="MICPUN_63950"
FT                   /product="Major facilitator superfamily "
FT                   /protein_id="ACO67364.1"
FT                   /db_xref="HOGENOM:HBG317939"
FT                   /db_xref="InterPro:IPR008509"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199BAB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP8"
FT                   /transl_table=1
FT                   /translation="MEGYYWIQFGLIAIVCAMLEMQKMGTREKVTMPQNFMAFRNSYLF
FT                   VYSLMMAGDWLQGPYVYALYQHYGYTTGDIGKLFIAGFGSSMIFGTVVGSMADKYGRKN
FT                   AALTYVVTYIASCITKHWSDYGVLMLGRFFGGIATSLLFTAFESWLVAEHFKRGYEAEW
FT                   LDKTFAKAIFLGNGLVSIVSGLLANYLVTDMSLGPVAPFDAAAIFLAIGGVVIMFSWTE
FT                   NKGDNSENTSVQQGMKQAYEAIKNDKKVFYLGAMQSLFEASMYSFVFLWTPALGPNGED
FT                   IPHGMIFATMMVACMVGSSVASRIMSRSDMKVERYMQLVFLASAASLAVPVLVGNMGFM
FT                   TEGERGGSMTFGGKIQMLAFLVFEAMVGIFWPSMMKMRSQYVPEEVRSTVMNFFRIPLN
FT                   LFVCVILYNVALFPLSAMFAMCSIFLVLAAFLQKKLETLANVQSHKYVPMEQTFP"
FT   CDS_pept        161383..162864
FT                   /codon_start=1
FT                   /gene_family="HOG000100146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631436"
FT                   /orf_name="MICPUN_104018"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67164.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG558552"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="UniParc:UPI000199BAB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGP9"
FT                   /transl_table=1
FT                   /translation="MADNGKTAFGFAKKAAKRKDVGVNERTDDGAKKEFLTGVTGSGLE
FT                   LKDKVEKVVKSIPVQENTFEVGSGRRRKAPSFIPDESAIDADNKERFENADLLAKGETA
FT                   QHDVVYGLTKMGPKDGDTPKAKAEEKPAQESFIGKSLAEKELQAFKEDVEDLPEQATLD
FT                   DYEQMPIEDFGAAMLRGMGWEEGKPVGRNNNGMVAAVEFVPRSGRLGLGADPAPSKQEN
FT                   TKKYIKPGESREAPATMVLAKGPEGQSRNVKTLDEKLVKLEEPGAREGKRMCVVEGRHR
FT                   GLTGRVLKVVKQEGRSDRAQLELDTSGEVVTIRTGELADLGTRDADRAMRKKDDRAGGK
FT                   GDARATGKRDDGEGGKKRERSDRDDVGGAQKREKREEPAWLFASTRVRIVSKSFQGGKY
FT                   YLKKASVVDVLTPRTCVLQLEGGEVLTDVPQRALETALPKRGGAVVVLVGEHRGQRGTM
FT                   LDKKGEVAAVQLSEELSVHKISLDHIAEYTGALED"
FT   CDS_pept        164542..165306
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22631437"
FT                   /orf_name="MICPUN_109443"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67165.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BAB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ0"
FT                   /transl_table=1
FT                   /translation="MGEFPERALVKGAAVGAHIELGRRAAGEIFRAALTQTITGSPHPR
FT                   EIFKQDLLWAFKRLDRNKDGVLGRSDLLDGAQFIGTSLSDAEATGLLRDFTGGMMESAT
FT                   PDQFLSWYQRTLEIALAKVVEVHNVDEFEHYVESALEKPASSGMVQEDGALVVLECGYT
FT                   HCRPCMKFEKTYELVAKKYVDCLFLRVLGDESPGAAHLCRDVLEVQGTPEFRFFRGKKL
FT                   LHVMRGADKSKLENSLQSLLKEGEVGYALQPV"
FT   CDS_pept        complement(<167245..167525)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632389"
FT                   /orf_name="MICPUN_74160"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67365.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199BABA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ1"
FT                   /transl_table=1
FT                   /translation="MRASWVFALFILLWATAVCARDVDPYKILDVSRRANDGEIKRAYR
FT                   KLSLRYHPDKQQGKSAEDVERAQDRFVKIQKAYEVLSDAEKRRNYDMTG"
FT   CDS_pept        join(<167935..168132,168199..>168903)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632390"
FT                   /orf_name="MICPUN_67483"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67166.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199BABB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ2"
FT                   /transl_table=1
FT                   /translation="SRYKVIKQLGDGTYGSVWKATNRQSNEVVAIKKMKRKFYSWEECM
FT                   ALREVKSLRKLNHPNVVKLKEVIRENDELYFVFEYMTQNLYQQIKDRDKYFPESRVRSW
FT                   IYQILQSIAYLHKHGYFHRDLKPENLLITNDIVKLADFGLAREIRSKPPYTDYVSTRWY
FT                   RAPEVLLRSPYYNAPIDIFAIGVIAAELFTLRPLFPGSSEQDEIYKICAVNGTPDNESW
FT                   AEGMKLANGMGFRFPQYQPTPLEKLIPNASPEALDFIRACIHWDPTKRPTAQQCLDMPF
FT                   FSGMEPIPHSVTPSKKPEAE"
FT   CDS_pept        join(complement(171935..172068),complement(171710..171818),
FT                   complement(170775..171593))
FT                   /codon_start=1
FT                   /gene_family="HOG000195580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632391"
FT                   /orf_name="MICPUN_92401"
FT                   /product="tRNA-dihydrouridine synthase "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO67366.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396464"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000199BABC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ3"
FT                   /transl_table=1
FT                   /translation="MDAWEFYKGKNILAPMVRVNTMPTRLLAAEYGADIVYSEELIDRK
FT                   MMKVKRVENTAWGTVDFIDPDATNDDTAVVFQTTPEEKNRLVMQLGTGDATRALQSAMV
FT                   AVNDVAAIDINMGCPLKFSTASGAGSALLKKPETVHDILTTLRRNLPAETHVTCKIRLL
FT                   ETIEQTVELARVIEKCGVSAFGVHGRYVGQRPRDAAHWDKIKQVVESVSCPVIANGDVF
FT                   EYSDFEKIRAETGAAAAMCGRGAMWNQSIFRKEGVIPPRDNLNSLLTKCFEWNHSLKNT
FT                   KYLTREILIKSTGLENEEGWALNKSKSLADVAGVFNIPENVIGRKRVSNLKRPCEDLVE
FT                   NDENVRVKSSSEQ"
FT   CDS_pept        172501..173400
FT                   /codon_start=1
FT                   /gene_family="HOG000264688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632392"
FT                   /orf_name="MICPUN_104022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67167.1"
FT                   /db_xref="HOGENOM:HBG558554"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI000199BABD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ4"
FT                   /transl_table=1
FT                   /translation="MMFASVKQSGVAVNAPRRLGGASRLARGRANRAAVRCEAGKDEKL
FT                   PKLPKSPREQVGQAAEAVRRAAADGKKQLAIEFTLPLIGATDLDDWPGGIRQQYQAVAP
FT                   MVGELLKQIGTDGNAAEVRQKIVDDADAVVVLSTAGAKAMVFPTAETLGDLKSIAKENV
FT                   GLLATINNQIRTNDDGSNLISDLGIGPWRKKNEEFLASFELTYWISEQRIQGETVRLLK
FT                   SYPHPWQLFVLTDMASGSAEPECIKTFDEKPSYKELESLLMSREGSVAAMSIIDRVKRE
FT                   AQFNATSVQTPPNNIDQK"
FT   CDS_pept        complement(173474..175888)
FT                   /codon_start=1
FT                   /gene_family="HOG000174003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632393"
FT                   /orf_name="MICPUN_88102"
FT                   /product="Predicted protein"
FT                   /function="1-phosphatidylinositol-3-kinase activity "
FT                   /function="binding"
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /cellular_component="phosphatidylinositol 3-kinase complex "
FT                   /protein_id="ACO67367.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005942"
FT                   /db_xref="GO:0016303"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG320338"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI000199BABE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ5"
FT                   /transl_table=1
FT                   /translation="MAEPTSVGVFLSSDVDLDVRLKVGGLYGRLPASHLTRDGRTELSV
FT                   SFQLFSENQPLTTAISTTAALYQEGSVDWSETLFFPLKYRDLSAEAWLEIMVHDARDIL
FT                   RREVIGRAAFRLFDEKSSLRRGNQRMFLERTHGGVIAKEAASMKPSSQSLGDMGKIEAR
FT                   LKSYEQGEMPELDWLDKLTFRRIDEIQKAQRAAQFASGHLEIRVELPTFSAPVIFHEQT
FT                   PLSSHNTKPQWDQLIWLIDSEVNLGLENPAERKHQKLTRSVARGVVDHDLKPNGEERRS
FT                   LATAIALPPTRLLGAEHKALLWKFRFSLRTESGALTKFLKSVDWGDSEEARASIELMYQ
FT                   WAPIDPASALELLSPTFTDSEVRKYAVSVLSDAADDELLCYLLQLVQALRYESEDDSQL
FT                   ARFLVNRAVANPVLANFLHWYLVVEWEDPSFAPRSSHTHQLLEEACMTMGPKGEELWDS
FT                   LRRQSELMAQLTAITRELSGMRGQPKKVERLRTILSDDGSCSELASFTRALPLPIDPTS
FT                   NVSGIVPEESKVFKSALSPLKLAFRTTSNGRANMIFKKGDDLRQDQLCVQMISLMDRLL
FT                   RRENLDLKLTPYRVLATGSDTGLIEFVPSQAVADILAEHKTLTRYIALNNPDPDGPYGC
FT                   SHKSLMSFVKSCAGYCVITYILGVGDRHLDNLMLAPDGRMFHIDFGFIMGRDPKIFPPP
FT                   MKLCKEMVEAMGGTESEYFGKFKTYCCEAYNILRKSVVLILNLFSLMADANIPDISQDC
FT                   EKALLKLESKFALDLDDEAAMQHFQVLINESTNALFPQIFETTHRWAQYWR"
FT   CDS_pept        176194..181143
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632394"
FT                   /orf_name="MICPUN_63958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67168.1"
FT                   /db_xref="UniParc:UPI000199BB57"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ6"
FT                   /transl_table=1
FT                   /translation="MAGHAKNVEEEWTRSIDHLRDMAHQNEESLMRNKRLTSVLSVPNR
FT                   ELIDGIEHVVPALDERRASWAKDQEFQRRLLDERFCRIDQSREDVVHFQDIGMNSTEDE
FT                   EHERRVASAAAARMLKRRGKGNKAPKVLGVLELLRVKTGGAVSTLVSAPPPDLLQHKKK
FT                   PKLHDGKAAEALTRLKQRRNEEFIEAKVRREREAAEALVRKEEEERLLHEEEEARRNNT
FT                   VKSRAARAAAAMAKMRKVGREVAMGRKVATAVQDNSAEAIAAREAERAQQEASEQLIAA
FT                   AEALEAEENEASRQGREMGDLREKISRAQAEADEATRLAVRAEEIIADLIEDGQEDAAE
FT                   MASQTVEAWRARSIALKSEVDVLHDEYKALEERYGLAEGRRAQAEAQLESRNHLLNVLK
FT                   GEVLTKDSEADVARAARAKVMEHIANEVIAHIYSAEANSDRQAVTEIVGAAAELGMMSD
FT                   AAETFVSRIAAAVARASDTVAASLAAAHASNKAITAEISDRANLDTAQKHANDARDRLC
FT                   SALTEMFAASSVSGCEATLAHDASASSAKRLTAVVGGPIMSSTFVPGKTKVCKVNGGFN
FT                   LIGARVPASEDRENPPNDLMNLLTSALPLAPRQGEYNIEKLVAERSKTAKGDAEPTRQV
FT                   MQASTLEKRTKKLAAVAKKLGLVSEMTSDANPAFVTSVFKPPGSQSAQPEPILKSSADS
FT                   TPKVAGKKTAVTKLEPTVRVRLAVERFNRAYFGASRAEEAVRTALDNLVSACETAHTKR
FT                   RDADTFATSAELFEIRRVMVERVFSVGVRHMADAKPKITRLQLTSVDPREASLALLEAS
FT                   FSAYEAVAAEAEAVVNGYRNKVKAATTALSDAEKGVAAALDNLSEAENAERITKDEHVA
FT                   AKDRRALGEKRLKNLLQVMKEDKGIIWKAEITASKVDAAREAVEALREVELSASLASKE
FT                   ATKKVDEARQAIPEAEAFVAPAVVAREHAHRLLSSVEEERDDIRRLVSAAQTALKLDAE
FT                   GERLAIIAKDAAAEAAVAGESDADIHRLAVEAATAASKSIFEAAQECAVKAAEAATAAN
FT                   AAIAAADAEVVSCKAAVEAREADLALAKYEMTRAQDDERRNLAAEREAKIAEPIANQTK
FT                   SSPEKPKRQVKNPRALARFRLAVRLVIASIAFVTPAQRAAAEVAELRRRIVEAERALET
FT                   AIEDAEYARRKAKIAERHCEDARRAAAALRERADAILERESRDKKRASKATFAREVNDV
FT                   KSLDNAILTEKRAEEAVQRATDTLDAARDAVAAAKSSVEQTSQAVQDAESTLESATSDL
FT                   SEKKDAGTLAEAEARLTESKTTAEKLRAEGPGLEAAVAAADEAEMNALELRNELRRLHE
FT                   DHERRVKRATGTLRAAREMSESSTHRYSAELKRLHDAGRALKSAKKQLAEATKLRVKAE
FT                   ETSAKEAEKRRRMAELDGKARQRKRDKTVTVDLSVVNATTSQDVDKSRQIKQPDLTELD
FT                   VEVIHRMFEEADASEAEGMQERHRNDEAAMKHRHSKETFILADWHRRGGGAAPRHKVKH
FT                   EPGKMVNTLMLGFKQDVFRGGSVATRFEGGNSFGPPTDHAMDKVLKQQMISRGDWLPEM
FT                   DDPDKPQGVAANELARRHAAEVKEGQVRRREEERRHKASREARKEAFILEASEERKREK
FT                   LEAVKALLGRQ"
FT   CDS_pept        join(181319..181406,181495..182453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632395"
FT                   /orf_name="MICPUN_106477"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO67169.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG558557"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BB58"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ7"
FT                   /transl_table=1
FT                   /translation="MAALAASLSAITCVSSNAALKRQQRDKPRVRAHRSRVVSASVDGP
FT                   IVIAGATTPTGRLVAGLAVKAYGGSNVTLVVNQDAQDGYWPEDMPDDVVEKRMYAPAPE
FT                   LVKAKLVDPRNAGDALKAAKQVVFCAEWGATQAELAEQLLPFVSSDAKRVVMLSRVGIN
FT                   RREKAPFVEQNKPPKKLQEVALGLKLPVGENSGQPGTLDGFANAEKILRDAAVKSGFSA
FT                   HVVRSGELRGNGPLLLADLSARMVDNLYDVKYQDLYFKKGDEGQGYTKRLNLAATLLRM
FT                   TTTDSTPPADCAALSVVCEMIDPFGLMGEKTLTEPTGVERRKGYDMAKGKAPAPIANEL
FT                   IDELIAAL"
FT   CDS_pept        182736..183608
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632396"
FT                   /orf_name="MICPUN_109446"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67170.1"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="UniParc:UPI000199BB59"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ8"
FT                   /transl_table=1
FT                   /translation="MGARAVVVHVALTLLSLARGAKGQADLSDFNPPDLGRRVAGLQLA
FT                   LWKYYSRLYSIPNLDSKPPDLVTWMTQVNKPGTFGIWPEVQLMGSDVVPAFPFYDGRTY
FT                   QDRWAARITGNLFIEKTNTYTLELENREGAKLWVDGSLAVDNDFSVHETGETDMRSKHA
FT                   HVHLSAGYHHVRIEFFVDQTWTGLRFWYGAPGVPRMIIPASAFSLPDASCCLCQCKRGQ
FT                   CRIADYGTKIVDCLWPTDAGPIDFLRPLAMESTPDPNDAGTCKEPCEDPGSASAADTRQ
FT                   ASPHFYYGQ"
FT   CDS_pept        complement(<183761..184636)
FT                   /codon_start=1
FT                   /gene_family="HOG000157782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632397"
FT                   /orf_name="MICPUN_70830"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67368.1"
FT                   /db_xref="HOGENOM:HBG622739"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000199BB5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGQ9"
FT                   /transl_table=1
FT                   /translation="MVLKKAKTNLGKRALMKKAPKLVETEGKMCVMLHGGKSSQVLKNL
FT                   ITDLSVLKKGECHKMTRKNDGIRPFEGGGETSLEFFAQKADAGAFVLGTHQKKRPDCLT
FT                   VGRFFDYHLFDMVELLVRNYKPMDSFGSVGNGAVLGSKPCMVFLGDRFETEPALRMAKN
FT                   VLMDIFRGKPATRINLKGVDRVIICTALEEAVMFRQCVIRYKKSGTRLPKVELEEMGPS
FT                   FDFVVGRHQEPPPDVKKQAYAKAKIGKKVKNVEHDSLEGKVGRIYVEKQTGLEELAMMK
FT                   MKGLKRERRQA"
FT   CDS_pept        complement(184888..185787)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632398"
FT                   /orf_name="MICPUN_109447"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67369.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199BB5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR0"
FT                   /transl_table=1
FT                   /translation="MAPESPRWFASRDNSAGVHRSLAALRALPETSAEVEEEAEKMMHS
FT                   VRLTPPVREDQRFSVLNFFTQRHLSQPLLAGFTLMAVQQLGGLCSLAMHGLNYSMSRTH
FT                   GSPDEVAAVFTTSQAFGCVACMWFLGESGPGRRIALLVSLAGATVANLVIAITLNPVVF
FT                   GANPVFGSGAADGAVVVQYVAATAFAWFHAAGLGTIPWLVAVESFPQYARGTGVGLVAG
FT                   TRWYLALCLRSGFHSLVAQTGGLAVFTFFGVVTAAGLSVLAPRGQKLAPPEADCMELEE
FT                   VHAWEEVDLAAGKYAYLP"
FT   CDS_pept        <187574..187783
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632399"
FT                   /gene_name="SELW"
FT                   /orf_name="MICPUN_112681"
FT                   /product="Selenoprotein W"
FT                   /function="selenium binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67171.1"
FT                   /db_xref="GO:0008430"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BB5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR1"
FT                   /transl_table=1
FT                   /translation="YGPRYRQVENAVKAKYPGIESEGVPTQNTSGAFEVVVDGELIHSK
FT                   LNGDGYVDSMEKLEKILAAIGAKM"
FT   CDS_pept        complement(188128..189411)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632400"
FT                   /orf_name="MICPUN_104028"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO67370.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI000199BB5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR2"
FT                   /transl_table=1
FT                   /translation="MAPRSPSRKSRSRSLRDEDGVDSYGTAPTPTRPFVSQVPKTPASK
FT                   LKVAELKEELKMRGLETDGLKATLVERLEAALMQGLDNARAESERTGSAGQVRDVATSP
FT                   LKSRRGGRFVVDLGEGQGGMSWPLQAILAFAILVVAYLVTPRGASAPKTSPLSQTAPPR
FT                   EPTTGRTPAQSESQAPPPARAAVVDEDPDLALWAAPSCAARATDREVIELAHGDWSETV
FT                   AVFMDTVREADTSARGGVRSVAGVGKGPSLLLVANGNRDEARRRAKGVVAAFESCTEDK
FT                   CVLRLDCEAVAQTAMETSEREARGQLQRMIATFLQRCPRGVAVFAGVDAFTPELLGAVI
FT                   PALSEGGRYMKDGREVRADLATYVMTAALAREPEELAEWMESERQFARSAKDALSKLMY
FT                   SRQRDDARDDDGSVGAFRRRIDFVAPLR"
FT   CDS_pept        189950..190474
FT                   /codon_start=1
FT                   /gene_family="HOG000272647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632401"
FT                   /orf_name="MICPUN_63965"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67172.1"
FT                   /db_xref="HOGENOM:HBG318749"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI000199BB5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR3"
FT                   /transl_table=1
FT                   /translation="MFEQAFPERNLTVILFKDVTNAGEIHAKLLDRSLEPELALINPRK
FT                   VQSVFALHLAAHKSVAAHEREALATHTLHSEVVFNLSGLKHITEGLKRFGMAEDASEVL
FT                   VCRFDATDEDIAATRGLVKGIEVDIETALEGLRDQDAIKKNYKTGDLECQVGVGTIEDA
FT                   VLARIATAPMR"
FT   CDS_pept        complement(190549..191163)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632402"
FT                   /orf_name="MICPUN_109449"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67371.1"
FT                   /db_xref="UniParc:UPI000199BB5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR4"
FT                   /transl_table=1
FT                   /translation="MGPPPGPPGGGAKLRRGTTGIAKPKIPALQQRQRRAYHDTGLGKG
FT                   KSTAATKEYEGTKNARAKKVARDERRDRERARARLERDADFAEMSDTMMDYLEDEFTSV
FT                   FLAILYAFSIVFFILAIVSRWYGSRKPIWGWIIGLSVPWFMVTTAYLIEPRMERWTVDG
FT                   ITKFYFRLQELSRSDAATVHETLEKWWEWRKVQKPPRVFGV"
FT   CDS_pept        join(191629..191639,191920..193867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632403"
FT                   /orf_name="MICPUN_63967"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67173.1"
FT                   /db_xref="UniParc:UPI000199BB60"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR5"
FT                   /transl_table=1
FT                   /translation="MSSRPGGGHRVGRMVSLGRISAPKPINLPSQRREHGGLDPNVELV
FT                   PKGSHTWNAPAKEENALVHKPRIGEAAWAGGRPASIPPPSHARSPDRSDSFPDLNGAAG
FT                   GGSPVEDGRRDEYGRRNDRYDDGYHHGRRDDRYDDGYHHGRRDDRYDNGYHHGRRDDRY
FT                   HDGFDRDPRDGYHGRRRSFERDGGYGHDRDHRGYGPPDRRYHHHDDDRDGYGPPPPHGS
FT                   SHRQFPAGRDGWGREPRAYARDPRDFEGYPRDPRDPRDPRAEMHERRHGHEIIERRRSF
FT                   EPPPGPGSPSGGPPPGPPPLPPGPPPAWATKAPNTAGEGGKPVEPPRPTSPAARADRRS
FT                   SNGAPGEWGSAANEADTSLPPVPSDDSRGASPAPPPHGPPPGQPSPSAQGGSPAAPPKN
FT                   VRVLTRPSGHSPGKPLDDTGHFSSAKLPEHLRDLRLAPTGEKKLWTPDGSGSGSNSRNN
FT                   SIGERRAPVETVHKVVVARKGGDAGGGEGNGKDGKVKGAGPKNKKQGNKKAEASKPKAA
FT                   AAAAAAPPVNPPPPPGPPPPGTAKVAVPQPAPQPVANGSGPKGNKTSKANKTSKEAKEA
FT                   TTGDTVKQIPAPKGKGAKGKENPTEVAGNGTSPTPAKNKGGRGTKGGRGGKAPVVKAPP
FT                   IAGETALPAPQAAENAA"
FT   CDS_pept        complement(193998..195302)
FT                   /codon_start=1
FT                   /gene_family="HOG000225106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632404"
FT                   /orf_name="MICPUN_109450"
FT                   /product="Predicted protein"
FT                   /function="dihydroorotate oxidase activity"
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /biological_process="UMP biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67372.1"
FT                   /db_xref="GO:0004158"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="GO:0006222"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG472415"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199BB61"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR6"
FT                   /transl_table=1
FT                   /translation="MAAVASVFGFKHRVGGPVPSRAAQRASRISRGRVHQPLRVVARGL
FT                   EGRPWVELKDGVPTSGPDLSVTVNGLKFPNPFVIGSGPPGTNYTVMKKAFDEGWGGVIA
FT                   KTVSLNADLVKNVTPRYAKMKSEDGAEVLGWQNIELISDRSFEVMLAEFKQLKEEYPDR
FT                   ILIASIMDEYKKENWVEVVRRCEEVGVDAFEINFSCPHGMPERKMGAAMGQDCTVLDEV
FT                   CGWVKEVATVPVWAKMTPNITDITEPANVCLEKGMDGIAAINTIMSIMGVNLDTLAPEP
FT                   CVEGHSTPGGYSYKAVRPIALAKCMAIAQMIKKEFPDRTLSGIGGIDTGGHAAEFILLG
FT                   SDTVQVCTGVMIHGYPLVQNLCAELQEFMGKHGFESIAEFKGMSLEYFTTHTDLVARQK
FT                   EAIEKKKKAKVGIESDDKWTGEGFVAETESMVSNV"
FT   CDS_pept        195734..196453
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632405"
FT                   /orf_name="MICPUN_104032"
FT                   /product="Early light induced protein-like protein "
FT                   /protein_id="ACO67174.1"
FT                   /db_xref="HOGENOM:HBG558334"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199BB62"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR7"
FT                   /transl_table=1
FT                   /translation="MIAATSLSSRVTLNLPVRARAVSTRAARAAVVRVAADGEESSGYK
FT                   SMNVTKPNIVNNLDGETTRNIDGKVYTITVKGDEVTVKDKFGQVFPARVNKSAIIEADL
FT                   SNSVAGANTMSIGGMNFALTPDQVTGFQQRTETINGRAAMVGFVAAMGAELTGHSVAEQ
FT                   VFSPGGFLAAAFIGAATVAASVAPVALNKVTIDECFPSEQASYPDELLPTVWTPIAEKI
FT                   NGRVAMVAFTLMLILGQ"
FT   CDS_pept        complement(196664..197113)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632406"
FT                   /orf_name="MICPUN_98302"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67373.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199BB63"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR8"
FT                   /transl_table=1
FT                   /translation="MNAATGRIVLDLFAGTHPKTSENFRQMCTGEAGFGYRGSTFHRVI
FT                   PGFMNQAGAKGAGGSIYGGSFDDESFVHNHDEPFLLSMANSGPNTNSNQFFITVAPTPH
FT                   LDNKHVVFGTVVEGEDVVMAINEAGTNGGRPRRQIHIVNAGELKD"
FT   CDS_pept        197663..198118
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632407"
FT                   /orf_name="MICPUN_63971"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="ACO67175.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniParc:UPI000199BB64"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGR9"
FT                   /transl_table=1
FT                   /translation="MSLSIASPASAVRPSIACLSRRRPVGRSSRSQMRVEAASVKVTIT
FT                   PSDGGESITTTVDTASVLRTVILDTGAQLYGGMDRLMNCGGMGNCGTCLVDVVEGADLL
FT                   SEQTEAELRKVKAGKLKEGWRMSCQCLVGGDAAPEGAELSVVVRPKK"
FT   CDS_pept        complement(198194..198883)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632408"
FT                   /orf_name="MICPUN_104034"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO67374.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199BB65"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS0"
FT                   /transl_table=1
FT                   /translation="MPKPVSHGRKKSKNPFAGATGLKRAISLSQRQKDMKQKRKRVEEI
FT                   FADADMSYTGSLNREEFATVLEKMVEEAGVEEPVTPTAVEWVMQRADSTGDSSTLSMEE
FT                   MEKGMGVWASYLGRKEFIDDIMQRFDLDGDGKLSREELKSYVCELKGGEAPTAAELDWI
FT                   IQRCDKGGFNTVAGDGFIGRIELLDVADEWCYLPRDVHSDEKLLNEDETSAVPGSARGK
FT                   GGCCVVQ"
FT   CDS_pept        complement(199078..200571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632409"
FT                   /orf_name="MICPUN_63973"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67375.1"
FT                   /db_xref="UniParc:UPI000199BC0F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS1"
FT                   /transl_table=1
FT                   /translation="MSSRDRADLAAFTSHQHEIEVTLLDGPDGVALASCHLERDPTRRE
FT                   SKVRASKGPATGRRVRLRLPCGEESLRVPSTVGKTRWLRVRIGGLELTGAISPPLPESH
FT                   RTDDPPLERQVGTLRADGVAVQLRFKTASNRTDSATLDSATLDSTTLDSTTLLEYVLLD
FT                   GAFTADEHATDGIEAVEAAGEQVYTTARDVAVRNEPAPRVGRISDIWMPQKFEPGSEHF
FT                   DEKDPDRLQYDRRGRERNEELLVEIRRETEAWEATGRNTALLLNHRREARRWDLALLQN
FT                   RRSMLRDLAKLVKEQGLDGVTADMAERLKAATTFSKRKAMDFDNDCADIQPVDESDQDA
FT                   VSLIKEDLFEFLDELVETNVAELTRLHGEINRKCIRCTEGIRRLDQELDDRTRWDNAES
FT                   GVETRDVLENGVRRVDMERMLGRMVTKVDVDASLKIPDADRMRIVGGHDVEQSRLSGHQ
FT                   EYKGQLPSSCYVPRPRVKEDLPQGAEQYERKLARGMAPK"
FT   CDS_pept        complement(200802..203090)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632410"
FT                   /orf_name="MICPUN_63974"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67376.1"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199BC10"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS2"
FT                   /transl_table=1
FT                   /translation="MGGFDTVALVSGGKDSVMAAMMAQSYGHNIVALANLLPADGDVEE
FT                   LDSHCFQTVGHRAVGVYHELTGLPLFRRKIVGTSAHVEMSYDVCDERVKGDEVEDLRAL
FT                   LAAVVRELPNVRAVTSGAILSDYQRLRVEAVCADLGLTSLAYLWRQPQGLMLETICASD
FT                   VDAVLCKVAAMGLKPDRDLGRSLVDAKGTLYEIESAYGSHCCGEGGEFETLTMDCPLFR
FT                   RGSLRFEDTRVVVTSRDPFAPSAHLAVEAVAVDVKDHTVEPGRLVDVNADVDPPAVTRR
FT                   RRTIDAFEEVLTSEEAVIGGNARLTRSWRRAGPKFWTVAAAVPVSGPNLEAGSAEEAAR
FT                   SAEAGLHFVELSLRENGRDWSDVALVQLYVRDMSHFAAVNEAYLRVVPSTQPPARACVQ
FT                   LPLPGDTPVAMDVLVGVGSGASARKSLHVQSVSCWAPACIGPYAQAVTHLGLTHMAGVI
FT                   GMVPATLDMIHSSDGDANATEARRAWRSAAAVARASGATLASDCLSCTVYSSTAGGDGA
FT                   RTASDEAFAEVMRGEGWQDDVDVPGGPHAAKAGVPTGSVHRNGRDGSPLAVSGDGSGFG
FT                   ASAPRRWPWDPLVTHVTVPGLPKDARVEVQPVLLDGDGPGERRGGDGDGDEPWDGDVET
FT                   SRMAIESAAYDDTAGHGVACVALSRRGRFCRVHAAVPKSAEDIDAAVVVAFRAVVRAVE
FT                   DAGLTVSDVGCARAFVASDETLDTETVLALANAVDGVLEVQCAVVPVVRASFGSVDDAF
FT                   MVLELMAVS"
FT   CDS_pept        203363..205867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632411"
FT                   /orf_name="MICPUN_104036"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67176.1"
FT                   /db_xref="HOGENOM:HBG558339"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BC11"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS3"
FT                   /transl_table=1
FT                   /translation="MLELHRSRFVEWQPSAVVALAVAPGGRAVALARETGDIEVYDTID
FT                   WRCSARIPGHEGAAVSALAWCAPFDIDAEEDDVGGGAPCVLLSAGLDGQITEHDLNTLR
FT                   PRSVTDSHGGSVWCLCAEPRPKPGQPQRVAVACDDGAVRFVVVLAGEGVGRGLQHRRGF
FT                   GAVGGRCLSLAWHPAGVNIAAGTSKAHIHVWDVANSREIERITVQGRDKLNKYGKEGDE
FT                   LCVWALDYLPDGTIVSGSSEGDVTFWDGKFGTKLYTFKQHAADVLAVASSPDGRFVYAS
FT                   GIDSQVAQFERVDADANTWAYTTCKRPHTHDVKAMAMASGPAGAVLLTGGNDAQLLAYH
FT                   AHAFRKRHPVRVVSVPQRTPLALTGGGLWTGVSATGKKGKKGGGGGGADVNGKSERMEV
FT                   KPQVGHPDPPLLLCDHSRWVDVWRLGEGIHGGPGGATAEAVDSVKGHDGMMKLAAAPTH
FT                   VLRAKLGGSRRTLCSAISPDGKFIAVSDTHALRLFQLIVEEGGEYRIEKQDTPKGVNAA
FT                   QQLVFTPDGKVLIAVGASGAIHVIDLHAGEATGKLTAHVPKISSAALALEQASAAAKSG
FT                   KRKAGDEGGAPDADKGAVSVEDIGCPPVSHVCCSADNQWLAVITTKGHRRVAGVHVYSL
FT                   DNLKLHASLPAPPGHASWPPVSAVALSASGILALAVRDNGLLTYDVESKELTQWSSTLA
FT                   SAGMSAPREMASLPGQICNLSFDPTPGSSVLLAQTPSAIARMNLSKKPVVDAPAPSKKR
FT                   RKRERERGPGGHGGGDGKSELQPRNGNPGQGGDGDVKVATLDNPCLLLSYFAPRQALMV
FT                   ERPWEEVLEAMPAPLYRHRYGT"
FT   CDS_pept        join(complement(206809..206905),complement(205926..206662))
FT                   /codon_start=1
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632412"
FT                   /orf_name="MICPUN_92406"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67377.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG680510"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniParc:UPI000199BC12"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS4"
FT                   /transl_table=1
FT                   /translation="MAQAAANALTNLARAAIGLGVGATALNSSIYDVDGGTAAVMFDRF
FT                   RGVLPKASLEGTHFLIPFIQSPTIYDLRTRPRSITSVTGTKDLQQVNLTLRLLFRPDVD
FT                   RLAEIHMTRGPDYDERVLPSIGNEVLKATVAQYEAEQLLTMRAEVSNQVATALRKRASD
FT                   FGIVLEDVALTHLAFSSEYSKAIEAKQVSQQEAERSKFIVLKSEQEREAAVIRAEGESE
FT                   SARLISQATKSAGPALVELRRIEAAREVAETLSKSRNVMYLPGGNSQMLLGLSGN"
FT   CDS_pept        complement(207065..210997)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632413"
FT                   /orf_name="MICPUN_104038"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /protein_id="ACO67378.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="HOGENOM:HBG558340"
FT                   /db_xref="InterPro:IPR007015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199BC13"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS5"
FT                   /transl_table=1
FT                   /translation="MVRLEVPGHVLQHFWDLANIESEVRRESAVNLVNELKQAQDEHVG
FT                   GSDGVMMGGGGGGDSNGAVDGPALEGCSPVLVYALKRLARGLGSGRSGARQGFALALTA
FT                   AFTEIPLVSLPDGLKLLKSSLEPITQSTKGAEARDILMGQLFGIAALVRAMATRFKSGD
FT                   LPLDDALAFGASVAEETSRLAASKAYLAESAAAVVLELRAALGAGMGKLFDRSPTLTEW
FT                   ITTPASKAGPEVVQLCMELWPYLPQKVKERCECVPQGGVKAKDWAAVFRRDRVETVRDA
FT                   LMESSYVHPRVHGVWDGLIQRAVEVPGAVETLWDVACEHGLFTSGSHQRRYLGFRLFTQ
FT                   LLPLCEPEAVPALFSHGFIRCLLNNLNKEDNYLHAAAEECLDCVVAYCKAKDTPQQKRL
FT                   SVIAALQRLGPNRFDKVSKRNAVRELIGGLSVDDASGYMRELMGIFVHAPADGATRAEG
FT                   APGGELVGNKRRLWALEQAVGLWPKLPAASQATLVKFLVTHAFYQSDPNAAASKKGKKK
FT                   SAGLIEDAGVAPLAEPLDGLREACAVRVSSLLERNLKAQRASSAGKDDKPAETKPAKKG
FT                   KKGKKAADEEAEAEPEAAKEAPADLLSVAADLCRAMDAEGSGARLVDDMPRECADVRGS
FT                   LFAALDKVADLAEKIGKGGAGADASVAAASAVAPLLRVLAVLQLGDWREFTPAIEDLPR
FT                   CVDDLVKAPEPKKGKKTPAKKGKKGKKEEEEEEEEEDSEEEEAPKPMDVLVDILLSLLA
FT                   QPSALLRDVVEHTFKAVAPAVSEASVVDMLRVVMARDADNRNAGGEGSDEEDGGPLGEH
FT                   DEDEEDGGDDEEEVGGSDSDSEEEEPEANGDAEAMDLDFGGSESESDSEGSDDDAPFDE
FT                   KRAAAIKAALVKAGALKDDDDSDTDEDPADAMDDDAMFGIDKLLGQAFKSRREDINRKK
FT                   NLMRATRDFKFRVLSLLELYAKCQPASPYLPGAAMPLLGAMQDALIAGTPQSSALAERI
FT                   GGVLTKSVCHAKDLPSGAGAEPVTAESIAGELKLAIRAAAKPAGAGGDAKGFAKPATAV
FT                   AMYLLRVLEAVSRLEKKSGEDEASPDAVSAYRDALEVFKTNKRCRLKAPFFQSAFERHP
FT                   PLAAALLPDLAALLEAGADKESSRGEYLRAEGAKLLANALSLGRRRSPAVGVAAAKHRD
FT                   AIGSAVAAAIEAPCRNNAARAETAKLATQCMEALGRLSPDAPLSTVVDADAILNAVKKQ
FT                   FAVPGMPPKGVNSLTRACTLLGLVAPEAVPGAAVEPSKKGKKESGASGEKGGKKKEKKS
FT                   KGEKRKGPDGAKDEGKKVKKSKKQKA"
FT   CDS_pept        join(211410..211454,211851..213776)
FT                   /codon_start=1
FT                   /gene_family="HOG000228136" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632414"
FT                   /orf_name="MICPUN_63978"
FT                   /product="Heat shock protein 70, mitochondrial "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO67177.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000199BC14"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS6"
FT                   /transl_table=1
FT                   /translation="MLQSVLRTARRGAALEFFRRSFASSGSRFANEVIGIDLGTTNSCV
FT                   AVMEGKNAKVIENAEGARTTPSMVAFTDKGERLVGQPAKRQAVTNPTNTLYACKRLIGR
FT                   RFDDPHTKKEAQMVPYKIVPASNGDAWVEAGGKQYSPSQVGAFVLQKMKETAESYLGHG
FT                   ITQAVVTVPAYFNDAQRQATKDAGKIAGLDVLRIINEPTAAALSYGVDQKEGLVAVYDL
FT                   GGGTFDVSILEISGGVFEVKATNGDTFLGGEDFDTALLDSFVQTFKKESGIDLTGDKLA
FT                   VQRLREAAEKAKIELSSAQSTDINLPFITADATGPKHMAMSLSRAQLEKLVGPLLERTK
FT                   DPCRNCLKDAGVTASEINEVLLVGGMSRMPKVTEIVKDLFQRSPNKGVNPDEVVAMGAA
FT                   IQGGVLRGDVKDILLLDVTPLSLGIETLGGVFTRLINRNTTIPTKKSQTFSTAADNQTQ
FT                   VGIKVLQGEREMAADNKMLGNFDLMGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKATG
FT                   KEQQITIQSSGGLSDAQVEQMVREAEAHADADKNRKELIEAKNEADTLLYSADKNISEH
FT                   QANLPAEVVDAIKAAQVDLRTAVESENLEQVREKINGLQQAVMKIGEALNKGAGAGAGA
FT                   EEPKADDAGEEGEKKEETPKQ"
FT   CDS_pept        join(complement(214204..214314),complement(213888..214103))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632415"
FT                   /orf_name="MICPUN_63979"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67379.1"
FT                   /db_xref="UniParc:UPI000199BC15"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS7"
FT                   /transl_table=1
FT                   /translation="MGTGVQSEESQWPHHFNMMGQLFVGFIFLIVAGMSYMYWYLKGRR
FT                   MERLRMRAASGVMEGGGVAGLAQMRAKMSGRHSYSKLVDASESGLGRGSGRTGSGGGGG
FT                   GSAV"
FT   CDS_pept        complement(214990..216225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632416"
FT                   /orf_name="MICPUN_51963"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO67380.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG610367"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="UniParc:UPI000199BC16"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS8"
FT                   /transl_table=1
FT                   /translation="MSSSIAAASSIGVKANALTRVSKRAINSKPAVVCSASSKSDDVAV
FT                   GSSQDAVTRRQALAAGAAVTATLGASTPALAGLLDGALDGALTLGGGDVKEKRAVNLPE
FT                   LQIEFISREEGYPLANGGEKGRAQQQYLKFIEPVIVANIDLPYSEYMRLALHDAGTYEV
FT                   VGKKNGANGSIRFELDRPENALCKKAFASIEKIKKAVDATVTQPISYADLIAIVPHFAA
FT                   RIQFAKDYYEVMGEDDPNYEFLFIGTNPYLGAKMRIGRKDADGPDPEGLVPGEDASTED
FT                   LVAWFKRMGLGPNQLVMFAPYMYENPAKGLDLAVQDGTNASVANQYESQRKLGKRAPGP
FT                   AVTIIKKLKDMTDNCIPGGPPYVGGDRDPNYVEYAYIRGGGEIPRVTTFGAYPGSSDLG
FT                   SSKFAQKVRGDR"
FT   CDS_pept        join(216601..216819,216967..217074,217214..217684)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632417"
FT                   /gene_name="TIC20"
FT                   /orf_name="MICPUN_109453"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67178.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG610366"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniParc:UPI000199BC17"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGS9"
FT                   /transl_table=1
FT                   /translation="MASFTMQMAAPGLARPAVGARARCRTVRTGALDGAAERASATGAP
FT                   RRAQRESMAGDCADAAGVAKAKRAQRGKVITTAVPDTFIPPGQEPNRPKGFWETFMGKD
FT                   PNKGKIRADFQWRIFSCLPYLIPMMGAIAFTDQAFMAFPVTFKLAVLISPLLQIFYSNS
FT                   FIPFVTFFTLFLAVVRNTKLDHFMRYNTMQAILLDICVMLAGLIMQYLPMYITVSVIGD
FT                   MMEIFTLMNALFAIGYCMWNCLKGQYPEIPIITEAVYAQVRDQ"
FT   CDS_pept        complement(217946..218419)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632418"
FT                   /orf_name="MICPUN_63982"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO67381.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199BC18"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT0"
FT                   /transl_table=1
FT                   /translation="MSGIARGRLAEERKVWRKDRPHGFVARPETVDGAVNLLRWECSIP
FT                   GRKDTLWAGGFYPLTMEFSEDYPSKPPKCKFPQGFFHPNIYPSGTVCLSILNEDEGWRP
FT                   SITVKQILMGIQDLLDSPNPASPAQSEAYMLFTNDRADYDRKVKEQSLRYPAL"
FT   CDS_pept        join(218559..219042,219217..221300)
FT                   /codon_start=1
FT                   /gene_family="HOG000030812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632419"
FT                   /orf_name="MICPUN_88340"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67179.1"
FT                   /db_xref="HOGENOM:HBG317376"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="UniParc:UPI000199BC19"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT1"
FT                   /transl_table=1
FT                   /translation="MGPSAKVLALVVLVALADVANAQLSTPIAHDDAVTKASGKGNKFL
FT                   DRKSSPDSFDDEEAMRPQDECPANLRLRWMTEVTSSVYSTPVIADLFSDGHKEVVVPSF
FT                   VHYLEVLEGEDGAKAGGDWPAFHKSTVHASPLLRESGEGTEILLPMYDGEVHFFNDRGQ
FT                   ALDKRLYVPRLRVRKDWHVGLAPDHVDHRSPDVGADSTENFESGFREPDPVTRGAPEHA
FT                   HHALRRQEARSGANGGKGGKGRRLLSESEPSAERGETLTEEAAASFKVFDNDDGDDTDD
FT                   AGEERVGGLSTEDEKILGDYRAFWEGTDGDEGTQGVGGSVNEGDEGREASKNARPSLRT
FT                   HRDAHAGWEDESFHQRPRESGDDTHVYVDAHLLCTPSVADIDGDGRDELVLSVSYFFDR
FT                   EYYDNPTHSNELDASIDVSKYVAGGVYVVDLKTLELKWHTHLDLSTDTVSYRAYIYSSP
FT                   TLVDLDRDGKMEIVVGTSVGFLYVLRADGTTMRGFPIQMGEIQGQVAAVDLDGDGYPEL
FT                   IAADTRGSVAAFRRDGSELWERHLASLIAQGASVGDVDGDGSLEVVVGTSSGAIHVLRG
FT                   ATGEPVHPFPFYTNGRVMAPVLLTKLRGDESAMTLVAVSFDGFVYLVDGKRACRDVIDL
FT                   GETSYSMPLVDDLTGNGKMDLVLATMNGVVYAYESLDTPYDPLHAWTSQVHSVNNMAAR
FT                   CGVAFGVRGKDRGYHDVRGERIDVPFEIVDTRVVVPVVETKGGAPHGPYKVTVTVTSPG
FT                   FSAVARGSYDKPGAYKLSAPIPNWRARGRVTVKVSDASALHVEDSYSVSFHMRYYRVLK
FT                   WVLVLPFIAATTALMQMTRGEGNALPTWGGIAGGVRGRLGKDI"
FT   CDS_pept        join(complement(222125..222226),complement(222041..222085),
FT                   complement(221613..221927))
FT                   /codon_start=1
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632420"
FT                   /gene_name="GPX5"
FT                   /orf_name="MICPUN_112676"
FT                   /product="Glutathione peroxidase"
FT                   /function="glutathione peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO67382.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG648990"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199BC1A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT2"
FT                   /transl_table=1
FT                   /translation="MAAAKSFYDLSAKDIDGNDVSFEKFKGKVVLVTNEMSAMAKELGP
FT                   KGLEIVCFPCNQFGWQEPGSEAEIKKFVEDKFDFKGVGVNMMSKIDVNGGKTHPVWQFL
FT                   KEKHPGDVRWNFAAKFIVDGEGNVVERNGDSAGASKAKIEELLKPLVPA"
FT   CDS_pept        <222980..>223414
FT                   /codon_start=1
FT                   /gene_family="HOG000078773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632421"
FT                   /orf_name="MICPUN_76762"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67180.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG315540"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199BCB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT3"
FT                   /transl_table=1
FT                   /translation="LRDYAVAPLSEEFAFRACVATSLAWSGSCTVASVVFLSPMCFGAA
FT                   HLHHFRELRRRGLGLVGALAAIGAQFAYTTAFGWFATFTFLRTGHLCGPVFAHSFCNVM
FT                   GLPDLRGALRHRRRSVICGAYVVGIAAFIAGLWPATDPRLH"
FT   CDS_pept        complement(223579..224022)
FT                   /codon_start=1
FT                   /gene_family="HOG000261967" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632422"
FT                   /orf_name="MICPUN_63986"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO67383.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG741910"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniParc:UPI000199BCBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT4"
FT                   /transl_table=1
FT                   /translation="MGGDSTAVKRWPRVGVGVLIVKEGKVLIGKRKGSHGAGQYALPGG
FT                   KLEWRETWEQCARREILEETGIELTGDVTYAYTCEAVIDDDNHWITVFMRADVPADTTA
FT                   VNTEPDKCEGWEWMEWGDHKVPTPRFLPLDIILKETGPRRFEP"
FT   CDS_pept        join(224175..224237,224390..232033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632423"
FT                   /orf_name="MICPUN_63987"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67181.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199BCBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT5"
FT                   /transl_table=1
FT                   /translation="MDLAEALLHRYTTSVVAILNASSSESGDASRSLGALRDLLPALSA
FT                   LAPTGGPQLINTLTRWYQQQARTLASSSGDRNPLGRSRTLQLAFWHAAHRVLAPLPPGA
FT                   LAGTDVARVIDLAFDAVIAGRDPAPHVDAGWGARPLAGGASYLAGGASYHDESGGIHES
FT                   GGIHGGGGGDTAVNASPPPLDPSPSVAAMAARVLGFASRHDPDAVTARLVEELEPRVNS
FT                   ESKRGEVHLIVHGARFLHVSLDGAGPVANIGASSDAGPFDAASSRLRVKPGELADRYAA
FT                   SAAQTVRRLNPCAWHPTYRKSDLRHALCALLHAVLAPVAGARIPEGASDYTKRDWAEAV
FT                   TTCREDVDKWLRSKEKKHAAAGLPLLGALHAAETLCGGDGGAGLHAFLDTALLRAFREP
FT                   RHRAAAADALRAAVEGIAPPLPPGGTSPAPATPPLPEPTRGKLRAALGGAASAIKKGPH
FT                   GGDVHAVARAVAATARLDPLLAADVLMDLVHQGKVCDATAAGLAAVPDVILLTASRRLK
FT                   SGGRTGPKPGLAGVLECMRDEGLDPFSGLVDRIVAMGAAGVAAAGGADAAPAAVKASAS
FT                   AAAATASALVKSLRRELGATASALQRADPTSRASVIVATALLRCVPFIAPEEWRGAALG
FT                   EAVPPLCAHPHPAVRAAARDAMRRAVASTPAARDAIVQGAAGVLLSPPSTGRAGISLTD
FT                   ADAATSAARTLRDVCETWRVASSEEFESPSDSSSASSLASTTSETFDPCRSEAAGLLMM
FT                   CSPHAEVRVAAVEMLREVAKLSAALRHAQHPSGGDDSRSVLPSAPSMSSIVESCAGDMV
FT                   LSALGAEGGTGGLDPRVDPGLCAAAAAAVASAGGAAATARHVRGGAWTAALGVLAARAS
FT                   ASSPDVTTTARAQALQRVQAVMAQEGAAARSAGPRAPTDSATDTFEAWRNCTCFVCAAS
FT                   PARETGPPVLSASNAASGVGGTNPSANPLLAPQQVPLGVRGSLSGLFALLVPCLKEGGA
FT                   QAAAAAGVLARVPPLAAPQLLAALAPLQASLGTAPVNSGGHGAGTPFDRNRRNLELRAH
FT                   LAGLHLGLAAQGAVAAVAPGPAGRDAVAKHLLSFVDSTVSYARSTGAAIECSPDELNRL
FT                   VFAAAAAATACAPQIMALAPHVVDNEVRSRLWEDFHWWAKRASASVEDNKGGMGSSSSS
FT                   YRDGDVSPAVAALLGSSGGNNGGRGGGSVSSFDGSESRHGRRDGSLRGGGSARSGLSLS
FT                   VFDLAIGTQGGRGGGVDRAALGLGGDRWGAGGEGSRDGHETASDHDDQSSAGGKSTAPT
FT                   GPLGRGVADAARSPLAVYHACNEAAAALLAGPVFDNDASKPRGRVLTWIGGLLEGKVAG
FT                   SRRADLGTARRALRYHLHANPGLAHTVLDACYSAHDRTAAAHLAALADLFVRARSSSVE
FT                   VSSSPGGRQSPGLVRQSPAAAEAPSCSPAKLVALVLYKLVHPSATVRDDAVALLKAVAA
FT                   LDLCVDDTGGDGDLAEIFSQDTLPELPDAYQAFQQNVSRRLARSRPALGEELLVEALGR
FT                   QMDDGAADAGAHRHVLAALAPWTAALHLPHIAAAGRADRLLKSLYFVTFFRGDAFPREM
FT                   ETMWRHIGHSPRNVVPALRFLETKGLEDTSSATAMSTYCLTAKRVCLYLARAAPQQSID
FT                   QLVYAISLRGLEVDYPPGAGDADRRISGDDSMDMGSLRGSDAGSIRGGSSLGRSNDHDD
FT                   DDDDDDGLKLTAPDLAIILLAEVAAEHDEDFRVHLPVLLHAAVATLAGSPEPTVRAHCR
FT                   QLLANLTHALAARPLGAKGRGEFYGRDGRMDDGLAAYRTPGLQVTPGGGVPGWQGEVGQ
FT                   WGAAGMATPASHGIPGFGANGTVHPYEASSSYGTNGANNAGSYGGDGVDDDDGARGRAA
FT                   VARLQSLLARPGGGGVGAGTAAGGLIGGVIVRGGASEGAAPWTPEAIAQLVGLLPDAMV
FT                   FEPGLREQWADEARRWLLRAASYSLAATSARVLAALRVPLDLESGEALLAALCSSAAAA
FT                   EGGTVAHGLVSDRRGTDLYRPTRRGPAARQRVVSARSASAAADLAGLLLDTLTEMLGHV
FT                   ARGERDIIEYPHVLWGAAACLRTLHPPLYARAARLFSAMTLAWPLDDPTGASEEILRAA
FT                   APAPIGTRLPSSGSGHGRRNPAVASAVAAALDAWMRGATAKDFDATWRPPPGAPIPAMS
FT                   LPDLVPLLLKGLVRAESAAHSARGLAAIVPRVGVRDRWGGERALALATCGLLPLVLAAA
FT                   AYAEEDAARERDEGAAAGGVNAAGGVNADEQSSPSPIKTPAASTPQTGANVNASPSQTT
FT                   AQTSPSPIPSARGARAGGQKGAGPLGAGEGAATGRWLGAGLRAASPRGRLDSLAATLDS
FT                   VLPSPRARTAVARGRRFAVAPRRARGVKPPPSRPPPPPGSNVAGRLADILAEPLASFVF
FT                   PAHAVPVAKTLVDIAVGLGGENGGEEGPAAAAAALELLTALVSRARGEAAAAVFDPRAS
FT                   GSGSLFAPVAALLDGPHSAAALELLTKVATGTAAAARGPPPPYRNDVGDWGPVARLGAP
FT                   ATMWDSVDANGGRAVDLMYGVMLSGGMDPNRAALPACLVSDSADN"
FT   CDS_pept        complement(232385..232789)
FT                   /codon_start=1
FT                   /gene_family="HOG000201082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632424"
FT                   /orf_name="MICPUN_109455"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67384.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="UniParc:UPI000199BCBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT6"
FT                   /transl_table=1
FT                   /translation="MRTRNFESPLDLSGYDGIRLKIRGDGNRFKLILYDEDDWWGSIAF
FT                   HAAFDTVEGAWLTVDVPFDSFRAVRRGEAVPEGSPDLRAMRTTSVRSMQLMLSKFTYGM
FT                   GDLNKSFASGPFYLEVSKVSAYRGDAGATR"
FT   CDS_pept        233750..234625
FT                   /codon_start=1
FT                   /gene_family="HOG000230774" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632425"
FT                   /gene_name="CP"
FT                   /orf_name="MICPUN_98307"
FT                   /product="Cysteine endopeptidase"
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67182.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG746690"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="UniParc:UPI000199BCBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT7"
FT                   /transl_table=1
FT                   /translation="MILAAERQAQDRGSAVHGVTQFSDLTPTEFASTFLGTKLANEDVA
FT                   AIRSGMTTLPDYPAHDLPLEFDWRERGAVTPVKNQGACGSCWTFSATGAVEGANFLKTG
FT                   ELVSLSEQQLVDCDHTCDPSAPRNCDYGCNGGLPLNAMRYVQKHGLDTESNYPYKGVDG
FT                   KCASARHGPAAASVSSFNLVSTNETQIAAALLKHGPLSIGIDAAWMQTYVGGVACPWIC
FT                   NKAGLDHGVLIVGYGVNGTAPARPWHRRQDYWIVKNSWGPNWGVEGGYYHICKDRAACG
FT                   LNTMVVAADA"
FT   CDS_pept        235077..236237
FT                   /codon_start=1
FT                   /gene_family="HOG000195270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632426"
FT                   /orf_name="MICPUN_109456"
FT                   /product="Methyltransferase"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO67183.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG592917"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI000199BCBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT8"
FT                   /transl_table=1
FT                   /translation="MAKLRRHTLARPRLNRVQHLDDDHSLVLLDTASCPVDGDRDALPP
FT                   NVLDALASRGGDEAPTLVTHRVILGYDDLDADECLRRVLPPDVTVPTGFETAGRIAHLN
FT                   LRDEHEPWKRVIAAVLIDKLPQIETVVNKTGETGGPFRTFTMEVLAGEGGDGPLETTVS
FT                   ENGLVYAMDFRGMYWNSRLGTERARLVDSFDENDVVLDLCCGVGPIALPASKKCLAVYA
FT                   NDLNPAAVAYLGRNAKRNKGTSLAGVTNLDAGECLRVRIAEFAAAKKKGGSNFDERDLA
FT                   KMRFTRVVMNLPQGSLTLLPCFVGAFDRETWPPEFLPIVHAYAFSKSDDPESDAGARAA
FT                   KELGLEEDAAALGDGVGYRRVRLVAPGKHMMLVSFKLPERAAYAER"
FT   CDS_pept        join(complement(237640..237724),complement(236423..237504))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632427"
FT                   /gene_name="TK"
FT                   /orf_name="MICPUN_63991"
FT                   /product="Thymidine kinase"
FT                   /function="ATP binding"
FT                   /function="thymidine kinase activity"
FT                   /protein_id="ACO67385.1"
FT                   /db_xref="GO:0004797"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="UniParc:UPI000199BCBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGT9"
FT                   /transl_table=1
FT                   /translation="MSSAANQTAGHAEGVVSTAPRGTLQVIFGPMFSGKSTELARRIRR
FT                   HKVANRQCIVVKYAGDTRYEDEPGRAEAGTADAANLRGCVVTHDRQALVAYPARALEDV
FT                   DNVVHAFDVVGIDEGQFFGDLVEFCERWARMGKTVIVAALDATFQRKPFNDVLSLVPIA
FT                   EDVTKLSAVCNACGCDASFTKRVGSSDETVELIGGEGMYVATCRGCHDLPASSFSGARG
FT                   TNTHALAAASTPKAAFNASRTPQRPPSSASSAERIRKRTVGPEGTPVAGLVKTKGDVDT
FT                   ALKAQAGDKSAMSEIGDKMRSLAVMDSPATPGDAFGGFGYERSVGATPGTAARKKAAGL
FT                   GAAAMAAAAGVAGGSRSKGAGGPGRSPYNDLAGRGMGAVARSPLASLR"
FT   CDS_pept        238066..239346
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632428"
FT                   /orf_name="MICPUN_104046"
FT                   /product="Ataxin-3"
FT                   /protein_id="ACO67184.1"
FT                   /db_xref="HOGENOM:HBG558346"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR006155"
FT                   /db_xref="UniParc:UPI000199BCC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU0"
FT                   /transl_table=1
FT                   /translation="MGSLYHEKQVSLLCGVHALNTLLQGPYFTANDLRDIAAEFDQRER
FT                   DLMKEAGVDSADFLRYMAEDSGNAAVDGNFSIQVLTKALDVWNVDCVPVTGTTHSEALV
FT                   NTTNELAFLCNLDQHWFAVRKTRTASPTVHAEAAACGDGGWWNFNSMLPAPQPIGTTYL
FT                   SAFLAQLREERYSIFAVRGNLPDEFGRFGEGGEHGRWVTVHEAAAANRESDRVKAAGRA
FT                   RNIASNMLAKLGAGGWGTIAVPASVAERAGASLGGTTSNADEDAELQAAIAASLGGGNM
FT                   RAEGAGGGVPSGGVPSTDGGLDDADVARAIAASLEPNHHPSPHPPSDPDPTPVPTAAWA
FT                   VPEEPGVNEGIALAFRVPGGGRLQRRFRTTDAVGALEAWLGREAGIDFAVHSLTVAFPR
FT                   RRLTDRGSTLGECGVGDKTALSVESGR"
FT   CDS_pept        complement(239496..240014)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632429"
FT                   /gene_name="CBR/ELIP7"
FT                   /orf_name="MICPUN_63993"
FT                   /product="Early light induced protein-like protein,
FT                   chloroplast"
FT                   /protein_id="ACO67386.1"
FT                   /db_xref="HOGENOM:HBG562551"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199BCC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU1"
FT                   /transl_table=1
FT                   /translation="MSAFTVASNLTSRVALPKARAARRTARRATAVRASEEPAAEPAPE
FT                   VPAAPAVPTSFTLAQAFAFSGPEGSNFAGSGPEIMNGRLAMLGFVAAAGAEIATGEPVY
FT                   QQFGEAPTQILLTIALFTAASVVPFLSNTKAEDAGMWTREKELLNGRAAMIGMLALLGF
FT                   EAVKHVPCL"
FT   CDS_pept        join(240299..240383,240620..240777)
FT                   /codon_start=1
FT                   /gene_family="HOG000029884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632430"
FT                   /orf_name="MICPUN_109457"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67185.1"
FT                   /db_xref="HOGENOM:HBG318507"
FT                   /db_xref="UniParc:UPI000199BCC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU2"
FT                   /transl_table=1
FT                   /translation="MSATLIGASLGFGMQLYINALRKLPLLRNPWEHVFWTGVGAAAAN
FT                   MNAEWEAKLRKEVAELNKERQATNASFMESILKEK"
FT   CDS_pept        join(complement(242979..243249),complement(242803..242852),
FT                   complement(242409..242651),complement(241249..242181))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632431"
FT                   /orf_name="MICPUN_63995"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67387.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="UniParc:UPI000199BCC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU3"
FT                   /transl_table=1
FT                   /translation="MSLQPMRRRDREGVHAVTRTGFATQEKKNANEFLRVKANETNAAK
FT                   VTENGAGDVLETHEHAEFESVDMSHNHATCENCHTAPAAWFCHHDGAYLCTSCDHSIHN
FT                   ANKLAMRHERIPIEQKLANDAQCRPATPAFEGALMGTARSSGNGKTGTTAGFDPSSPQH
FT                   GHHGGNDMDWLMGGGGLDDPLSSLMTLEQEGNSSGGHFNLGDDLFGMPAANPSGMGGGY
FT                   GQHQGGLGAVKEEPVHALFRGAHAEGNGDSYAGHAHHRQDNSSGSSDQSTSTDLINGRG
FT                   HSVNGRASINQHQMGGQHQARAFEGGLQLREETVLTRPFAQSALRQAQLQRYRAKRLAR
FT                   HLGHKKIRYECRKTLADNRPRIKGRFAKVNSDADLAGMVTAQSCPDLSAMHRAAKLDEE
FT                   RAKDSSSDSTKQQTTAKVKAEPRRSRLSDGSDDTVANAKQSNGSPKKASPSGKGGKKAT
FT                   ASAAEEVFKKVGSLRTGGKPMMPYTQSEVSLVALDREGVW"
FT   CDS_pept        join(243828..244649,244824..244997)
FT                   /codon_start=1
FT                   /gene_family="HOG000197637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632432"
FT                   /orf_name="MICPUN_98308"
FT                   /product="Arsenite-antimonite efflux family transporter "
FT                   /protein_id="ACO67186.1"
FT                   /db_xref="HOGENOM:HBG646947"
FT                   /db_xref="UniParc:UPI000199BCC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU4"
FT                   /transl_table=1
FT                   /translation="MAKGKDRKYYMVGGKGGVGKTSLSSSLAVRFATAGHHTLLVSTDP
FT                   AHSLSDSLAQDVTGGLPVAVEGTDGMMYAMEVDPDQAKAEFAAFAKQADVSAGAKDFMS
FT                   SVGLGGLADQLGDLKLGELLDTPPPGLDEAIAIAKVVQFIKDEKYAKFTRIVFDTAPTG
FT                   HTLRLLSLPDFLDASIGKIVRLRQKLTSAGDAVKSLFGVADEAQDEAVVKLERLKAQLQ
FT                   EVKDLFRNEDTTEFVIVTIPTVLGISESGRLLAELRKEGVPARRLVVNQIINAAVTFCT
FT                   VKAKDQRRAMEMLDADAGLRTLKRIEAPLFDMEIRGVPALQFMGGQVWTD"
FT   CDS_pept        245147..245833
FT                   /codon_start=1
FT                   /gene_family="HOG000202506" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632433"
FT                   /orf_name="MICPUN_109459"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="ACO67187.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG525538"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniParc:UPI000199BCC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU5"
FT                   /transl_table=1
FT                   /translation="MNDAEVERQIHQMVAFIKQEAEEKASEIRVTAEEEFNIEKLQMVE
FT                   EERRRIKKEYERKESQAEVREKIEFSTQLNAMRLKILHARDEAVQGMLAGARADLEGVS
FT                   QTPKYGEMLVGLILQSVQKLETDAAVVRCRECDVEKVKVAMAEAERQTPGLKLTLDEHA
FT                   HLPPPPGPDNGDGASCIGGVHVISMDGKITCNNSLDDRLKVAFERNLPELREAVFGANP
FT                   NVAASK"
FT   CDS_pept        complement(<246139..>246366)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632434"
FT                   /orf_name="MICPUN_74109"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67388.1"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniParc:UPI000199BCC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU6"
FT                   /transl_table=1
FT                   /translation="LNAIQQRKERLDEELKQVEKQVYDLETTYLNDSSQHGNVIKGFEG
FT                   FLSQTKSTNLKKSRNFKPEDRLFSMSSTTSP"
FT   CDS_pept        246931..248727
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632435"
FT                   /orf_name="MICPUN_88240"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67188.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199BD49"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU7"
FT                   /transl_table=1
FT                   /translation="MKQDFKRIIQESKGQTNRLMLGIFFLILTALCSMFLPYFAGKMTD
FT                   AVTIAMTGDSARAKRKATEAFYGILLVSLLGGVFQSARSYLFNTASYKVVARLRNRLFS
FT                   NILKQEIGFFDTVTSGSLISRLTADTNLLKNVATQNLSMFLRGLATAVIGLAFMFLTSY
FT                   RLTLVVIAAFPPLIFVAMWQGRRLRNLSKETQAALAEATAVAEDSLGAIRTVRGFAREV
FT                   GEAEHFAMSVDKALGVEMKYGLGHALFNGAMMAAATAVLGATFWYGSLLAIEGDMTIGQ
FT                   LNAFILYSINSSAGLFLISATFVSVIQALGASTRVFELMDRTSRIPMDGKDKPGDESEH
FT                   GVAVALTDVHFAYPSNPERGILKGLNLDVPAGHTVAIVGPSGAGKSTIASLVMRFYEPS
FT                   GGVVTIGGVPVANIDHVHLHAVVGIVSQEPVLFARSIGANARFGAPDATEDEVWRALER
FT                   ANVADFVRGLDNGLDTWVGERGIKLSGGQKQRIAIARAIIVNPKALLLDEATSALDAES
FT                   ERLVNASLDDVMKGRTSIVIAHRLSTIQGADKVAVLDGGVVAEQGTHEELMNPKSAKGV
FT                   YANLMRRQLMGLGASTEHLDET"
FT   CDS_pept        complement(<248886..>249485)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632436"
FT                   /orf_name="MICPUN_71905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67389.1"
FT                   /db_xref="HOGENOM:HBG744424"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="UniParc:UPI000199BD4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU8"
FT                   /transl_table=1
FT                   /translation="AAARYAAANGLDPETLRQIAEMRGQYASLLADAGFIMSDTRGGGR
FT                   GAGRSDTRSDAPWGWADASDAPWNADAGRAPVVKAVLCAGLYANVAALEADASTGRARW
FT                   RDGKGEVGVHPGSLNARLGQPGERSPTHPFLVFHEKVKTSRVFIRDCTTVAPAALLLFG
FT                   GAMDVRHETGRVCLDGWLWLRASAQTAVLYKKLRKAL"
FT   CDS_pept        join(complement(250698..251402),c
FT                   omplement(<249702..250613))
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632437"
FT                   /orf_name="MICPUN_88188"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO67390.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BD4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGU9"
FT                   /transl_table=1
FT                   /translation="MREFRDALPIASLRDELLRSLRSRDAAVVCGETGSGKTTQVPQYL
FT                   LDDAIDAGVGAGCRVICTQPRRVAALTVAERVAKERCERNGVGGSGSLVGHHVRLDAAV
FT                   TRDTRLVFMTAGVLLRKMHGDPLLTEASHVVLDEIHERSLDGDFLLALLRTLPRRRRER
FT                   GMPPLKLVVMSATLDADLFRGYLGDCSVVSAPGRTHPVAVTHLEDVHDALAYVLDEDSR
FT                   CCRRPAGEGRHDSNPDYDPTRYERCSDLTRRNLSRLDESVIDYDLVERLLVHADESEGS
FT                   GAFLVFLPGVGEVTNLCERLGSHPSFASRRGTHRIVPLHSRCTPAEQREAFKVPPRGVR
FT                   KIVVATNVAETSVTIPDVVVVVDTGRVKERQWDPRRGMASLEEGWVSRAAARQRAGRAG
FT                   RVRPGKCFALYTSHRHEEKMRSHQVPEMHRVPLTEIVLQIKKLRVGASAEGFLAGSIEP
FT                   PNPAAVDAAVATLREVGAIWSVPREKGRPDEGELTPLGHHLATLPVDCRVAKMLVYAAV
FT                   LSCLSPALTIAACLSYKSPFAS"
FT   CDS_pept        complement(253904..255451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632438"
FT                   /orf_name="MICPUN_64001"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67391.1"
FT                   /db_xref="UniParc:UPI000199BD4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV0"
FT                   /transl_table=1
FT                   /translation="MSERSYRSGSGPASVRGGDGSERSRRSGSERAPPEGGGWGAVRES
FT                   VGVRAIDTRSRPEQALEVAIRMVTARTEEDFQRRELGQRHTAGGGGEMTVEEADAAVLR
FT                   DPTALAGALTNVDPQGNVHEDEGKIRAMCDEATAYALEQIPEEPGKFTNPAAAFRHAQE
FT                   TAYMRETLKIKVVEAIREKAKDESRQIRRRIRMASERTKPRERKTTGQLLQAAFLTSFD
FT                   KGSASLGLRVKGEGEQMQSLLAAPDPYDDSCFGVVNRALFQVKNNTRVNGRVLEYLLGY
FT                   SSVIDPEDLEEIEAGSQGLTVARGKGMRELALKYASHLDKTLPDRHVNVVCDLVRRAAD
FT                   EYSRHERMGTRVEDAYVNRPKEGCAQVVNTNKNAWLRVMFPDAPWPKESDRRGGTVEDR
FT                   YVAALTRGLDAAAADAADGSNPMDPTNGGFNDGGMARAEKVRLSRSGVAGLPGAVNAGA
FT                   ARAGRKQTAGLAGGHGARHGDGGHTGVMGIFNPLVTGGHGATTAAPAGMTNQRYGRR"
FT   CDS_pept        join(255837..255975,256117..256757)
FT                   /codon_start=1
FT                   /gene_family="HOG000175472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632439"
FT                   /orf_name="MICPUN_88148"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67189.1"
FT                   /db_xref="HOGENOM:HBG747960"
FT                   /db_xref="UniParc:UPI000199BD4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV1"
FT                   /transl_table=1
FT                   /translation="MSEEQWTREREAFLSLPRLAGRLTAELILRSPQGLDPSQDYAIDL
FT                   RANKIAAIENMGATQNQFDAIDLSDNEIVKLEGFPPLSRLHTLYLMNNRIARVGVDLSQ
FT                   QIPMLKALYLTNNRLKNLADLDPLKSCRRLTHLSLLGNPVSKNPDYRLYAVYSLPALKV
FT                   LDFRKVKQAEREAAEKKFGGKDGLKAREAAKTFEVGDVGVGGGGDAAGAGESNVTGPTP
FT                   QQLLALQAAIANAETLEEVARLENALSNGVMPSDFQI"
FT   CDS_pept        join(complement(258152..258232),complement(257653..257748),
FT                   complement(257385..257555),complement(256930..256965))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632440"
FT                   /orf_name="MICPUN_109461"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67392.1"
FT                   /db_xref="UniParc:UPI000199BD4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV2"
FT                   /transl_table=1
FT                   /translation="MASEWKEKAGGDDFDDEGLPLLRKHTQVRVTGNNRTKSSLVGLTG
FT                   VVKKAVGLGGWHWLKLSNGHECRLQRNALAVVALPTGDEIDSSDDDDDDAPPPLASGGS
FT                   SGSDQNNKNTDPPQTWGKRETRM"
FT   CDS_pept        258850..259548
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632441"
FT                   /orf_name="MICPUN_64005"
FT                   /product="Methyl binding domain protein "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67190.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR001739"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199BD4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV3"
FT                   /transl_table=1
FT                   /translation="MARGVGKKSDAARPPPQAWLANCLHPGARVVTAKDVVLAPVADHA
FT                   GAEKEKKPRGGGRPRGAAPGGEPVDYAAHEVVPPPEGWRREVIPRKSVQGADAYYYSPC
FT                   GKRMRSKPDVQRFLDKKRPEGKYTDVTIDQFDFSTQPRAVKAPKEEKPKKEGGGGRGGR
FT                   GGRGGRGGRGGRGGSKDAPAVATEPEAAPADGRTEEDAGEDADEPGAKRTKTDAPTDEP
FT                   AADVEMGDDA"
FT   CDS_pept        complement(<260562..261410)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632442"
FT                   /orf_name="MICPUN_88185"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67393.1"
FT                   /db_xref="InterPro:IPR019336"
FT                   /db_xref="UniParc:UPI000199BD50"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV4"
FT                   /transl_table=1
FT                   /translation="MDEKCDGPIDISYNFQFTNGYKFSDKHFSADEIGVMETMITFVCL
FT                   QTLLIGYFLYVRKLLKSIHKNHHTVKMLGASIFLAWFAHGWILIHYIWFAYDGLGWVGF
FT                   IYVGRLFQGASETVFLLLLILVGKGWTICCRKISARGRVKIAVFGTVYSITWLAIPTYY
FT                   YLYGDRASTLHFYQSAYGYILLTLRLFGLGWFLNACTITVRKYNAKVHFYHKFMMAMAL
FT                   WFLGLPIMAIAASAITPWTRFLIINALDWTFLFVFQSVLCYMYNPEGKLNKNFPFHATT
FT                   TE"
FT   CDS_pept        262891..263349
FT                   /codon_start=1
FT                   /gene_family="HOG000279780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632443"
FT                   /orf_name="MICPUN_64007"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67191.1"
FT                   /db_xref="HOGENOM:HBG458131"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniParc:UPI000199BD51"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV5"
FT                   /transl_table=1
FT                   /translation="MERRASYVLLVVALFILSCSFMTVAWYGHLKFASWPTHKAILLSW
FT                   AVALAEYAFMVPANRIGHARCGMSAADLRALAEVCILGAFMAFSVLVLREPLRVNHAIG
FT                   FAVVLIGVCVVLKGPFEHVLVDLGDVGDVRREKAVDPTAPGAGAASAV"
FT   CDS_pept        complement(263457..265664)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632444"
FT                   /orf_name="MICPUN_64008"
FT                   /product="Predicted protein"
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="ACO67394.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="InterPro:IPR007246"
FT                   /db_xref="UniParc:UPI000199BD52"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV6"
FT                   /transl_table=1
FT                   /translation="MRPRDAIVAGLRRVIRHHVAASTALYLLGVLAAALYPALARRTFV
FT                   DENAFLVAQTTVGFDRRDARDASEHYRAAIDAARTSPGDVHRSDALRGWLEDELDALGM
FT                   ERYRQAFALDRHSWTRGDDDWGRRSDASSIDNATHGVNVHAVARAARGNGREGIVLATP
FT                   IGAPGATLEADAAALALGLVVMRTIASAPWLAKDVAWLVADARWGPGDHGIAATDAWLR
FT                   EYHDPGSSTHHSAGHLTQHRRHRAQLSPSPLALFGRVGALQQAYVLELPEGAVADVASI
FT                   NVVGFNGALPNQDLLNVPVQLAKLAGFPRAGIFADSSRFSGTGGGDGDGGVKGGDLFDA
FT                   VGAVVGGAPFAADLRRVAGFALALARGTPAGSHASFKSYAVDAVTVRMSGSRGVPTGGA
FT                   HRRDGVSGEDAFLRLGTFAESAVRCSNNLLETLHHSMFYYVMVDDDRFLSIAEYVAPQG
FT                   LMLASSLVTAIALAVIGTSTGGVASVFVAEKTRGKNGGKNGGKATPAATAPAHDWSSAL
FT                   ALALLAHVAGWCVLLVATRTASTAAQLAAAYAGALATAAAALATWSNNVDGDEGSFDGD
FT                   EGDGRVGARREPPWATLKVVALSVQVASLGALTFFNFALAVAVTAPLAPLQLWAHGGVG
FT                   GAIKPWLRAALTLVAAPVLLVATSCAALGTDARACSLGDAAAAHVAWGERVHVLPLAWC
FT                   VAWPGLVLAACVHLGGVRGWRRGASTREEEAPGGPEGKKRR"
FT   CDS_pept        complement(<265860..>266681)
FT                   /codon_start=1
FT                   /gene_family="HOG000232651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632445"
FT                   /orf_name="MICPUN_71227"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67395.1"
FT                   /db_xref="HOGENOM:HBG611734"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniParc:UPI000199BD53"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV7"
FT                   /transl_table=1
FT                   /translation="WQLDFCSRPMKDERGKKMWELLICDETRSFEHSEFFPNNRINSVE
FT                   LAKAIDRVFVARGERPRRFKFFRSQMQTIITRACGEVGVNPLPSRRCQTMSRWLDERLE
FT                   TVYKTHPGYDGSAAPNMGFEGGGGPRPLPDALRGESWAFVALPLVGVREEAEQVRANRV
FT                   FGDLLEIDPTLEDDTLIPGIAVYTRRAAALAGWTKGLELGGISVDFDMGTLLLDTGVSD
FT                   SWQYARFRQTKELMKEAREWEEVKAAVNGLHFLAIQTDEDAETTDGFWILQD"
FT   CDS_pept        complement(267112..267843)
FT                   /codon_start=1
FT                   /gene_family="HOG000226425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632446"
FT                   /orf_name="MICPUN_88471"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67396.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG574115"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniParc:UPI000199BD54"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV8"
FT                   /transl_table=1
FT                   /translation="MGKRGFVDKHNASGAEKQQKQVDIIEKLGGYDNLVSQGAEGRVFA
FT                   VKFCGRDTIVKQRFKKTYRHPTLDTKLTRSRLGMEARSMMRARKLGVATPTLYYVDQQQ
FT                   SAIYMEKVPGKSLKELIREDSMSEKDMEDIGAQVGKAVAKMHDGGLIHGDLTTSNILVR
FT                   DDDERTVVIIDFGLASNSIIAEDKGVDLYVLERAITVTHSSQALFEHVMTAYRRASSQW
FT                   SSSFNKFAEVRMRGRKRSMIG"
FT   CDS_pept        join(268196..269867,269982..270163,270239..270411,
FT                   270679..271120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632447"
FT                   /orf_name="MICPUN_64011"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO67192.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199BD55"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGV9"
FT                   /transl_table=1
FT                   /translation="MASATASPWVQGIAAGRSLARSARLRPAPVRTRRPSPARWITTSA
FT                   GLLDALEVKVPKSSTAEDVDEKNEFRSLMEKAGVKHQVRLASGARGRGLFPTGPVGWTE
FT                   SAVLLSVPLDVCICAPFGDEDAVANELGLNDGYKDTCTILRRAWQRRNGAKVPEAIVSL
FT                   LDSGSGDDRELGVALWVLWACENGGEVWEAYARWLPKPDGQMPSLLLANERELSQLQDP
FT                   HLAGEARRLHEAMAAAHNKIAIANAEARSMNGRTVREFTLEELRWGFALVASRAVASPV
FT                   GDGGAAAAIMVPFFDMANHDDASMVSAIKSVRGTEDGDVENGLRVAVERAINQGVGGPR
FT                   VVLETTRGLQNADDEVVIQYDPSADNRELMLRYGFSLRGNRNEKLPRPNDGSPASTCAL
FT                   TPGALKLALEAKGLMRESTPPEERRRLISVVANACPGRRSPSEDDSWELDEDACAKEAM
FT                   DAVALRMHWQQTLDAFETSAMEDESLLTAAKAGVLPGATANVVCAVEYRMERKAALATG
FT                   IKALDAYVEWLSEDDGEDEGDGEEEGDGDGGEGDGAEVEADHIFAYRATRDPRGGRRAR
FT                   PRARASGRRYLMTFGDLLWGAEAEERRAREALEATEIAVPVDRKEEDARDADASEERAP
FT                   PLRQVLLPVDGTAQSEYMVDWALTNFCREGDQVNILHVIPNLKQTSRTSSIDRGPLTYL
FT                   SEPRDPVEQEAQWRADAEQYLAQAIFPAIDAAGLRYTAEIVAYETDNQSIGEIVCERAS
FT                   DLEAAAVIMAASGKGRVKEFFIGSVTNYCLHRCKRPVVIYRSPPVVRPGASSRGGKEVN
FT                   ESNGAYAHAE"
FT   CDS_pept        complement(271719..272147)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632448"
FT                   /orf_name="MICPUN_109464"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67397.1"
FT                   /db_xref="UniParc:UPI000199BD56"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW0"
FT                   /transl_table=1
FT                   /translation="MRLHALKPKFDALGCNLVCLLKENIPEQVESFLAGSGKHGEFWGA
FT                   DTPLYMDNDMAFFRALGGGKLRKGGLSSFLPFAGFWKRYAKIKDDVADHNLEGEGTIKG
FT                   GLYVVSKAGIHYEHFEKDFGVVAPPEEVLAACEAVTKK"
FT   CDS_pept        join(272765..273181,273314..273730)
FT                   /codon_start=1
FT                   /gene_family="HOG000238848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632449"
FT                   /orf_name="MICPUN_64015"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67193.1"
FT                   /db_xref="HOGENOM:HBG748023"
FT                   /db_xref="InterPro:IPR022051"
FT                   /db_xref="UniParc:UPI000199BD57"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW1"
FT                   /transl_table=1
FT                   /translation="MAFSAVTAAVSLRAPLATPRAPVASSVPSRAIPVAACASRPSGSS
FT                   AMRLARRAAMSGEGSLALRLSSKTPGAAVRGRNAAAARAMAKDEDSTAGISKKVARTSQ
FT                   ACKTLGRWGFWGQLILSTVSAVILVFSFLFKGITKATDAGLYFILFGIVTAYFTTFWSL
FT                   GIGKLGDKLRKAVDQLDLVPPRTEVVRQLSTGLAVNFVGLGATIVGIQATTGLLFAKSL
FT                   SAAAAAPFTPGYTGPVLALDIFLIQAGANVMLAHWIGAAVSLWLLRTVNLPTPQR"
FT   CDS_pept        join(complement(275398..>275640),
FT                   complement(<274090..275226))
FT                   /codon_start=1
FT                   /gene_family="HOG000171558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632450"
FT                   /orf_name="MICPUN_67331"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67398.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199BD58"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW2"
FT                   /transl_table=1
FT                   /translation="SEDEGAEGYRKGGYHPVAVGDTYKDGRYVVREKLGWGHFSTVWIC
FT                   DDVATGAKVALKVQKSAAHYTEAARDEITILDKIAAVVRLVDSFEHKGPNGTHVCMCFE
FT                   VLGDNLLALIKRYDYRGIPMRAVKAICRDVLAGLDYLHSRKKIIHTDLKPENVLLRKPL
FT                   PKPETETETETETETARDMDVDVDGASGEARVEGGGASGQVPGEAAMTPELAAIHLNGE
FT                   ADADGGKELTKNQKKKAKKKAKKVAESNGDANVSKGGEATKKSGEGDDEEEEEKRKKAK
FT                   GRKRRGPPPSTEDLENMQSVIVDLGNACWTYKQFTQDIQTRQYRCPEVILGAKYSTPAD
FT                   VWSLACMAFELATGDLLFDPRSGKDYDRDEDHLALMMELIGRMPKRIATNGKYCRDFFT
FT                   RNGELRHIRSLKFWPLKDVLTEKYGFADADAAAMSDFLMPMLDFSPEHRATAGEMLMHP
FT                   WL"
FT   CDS_pept        join(276240..276637,276686..276923)
FT                   /codon_start=1
FT                   /gene_family="HOG000199467" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632451"
FT                   /orf_name="MICPUN_88113"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67194.1"
FT                   /db_xref="HOGENOM:HBG558356"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniParc:UPI000199BDEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW3"
FT                   /transl_table=1
FT                   /translation="MDHGASRGYNYPEPHVGATRHAPHAPANDGVGGWRIADGPLASMP
FT                   YARDATFVEIGRGAGDYARAKGMMRRWGHFQLGWSEVAPDTGVKEGDLVCVCANVAGVW
FT                   IRNPLRVVYAEEAGATGRRGGGAGGKNDGFSFAHGCLGGHLLSGEESFILERRSDDSVW
FT                   YGVRTFSRPAHPLALASYPIVRALQRRFARDSTRAMAEGMAEGGVRSA"
FT   CDS_pept        complement(<277293..>278309)
FT                   /codon_start=1
FT                   /gene_family="HOG000247055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632452"
FT                   /orf_name="MICPUN_68567"
FT                   /product="Glycosyltransferase family 13 protein "
FT                   /function="alpha-1,3-mannosylglycoprotein 2-beta-N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="protein N-linked glycosylation "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="ACO67399.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0003827"
FT                   /db_xref="GO:0006487"
FT                   /db_xref="HOGENOM:HBG717617"
FT                   /db_xref="InterPro:IPR004139"
FT                   /db_xref="UniParc:UPI000199BDED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW4"
FT                   /transl_table=1
FT                   /translation="AAVVIMACDRADYLERTVASVRAALGVRPGDVDKFPVFISQDGRH
FT                   KATRAFAEGPKAKDFHWMQHLEDRPPTTRTRFRWDSVAYYRIAAHYKWAMKTLFDDLGY
FT                   ERVIVLEDDMELSPDFFGYFEAAGKVMDADPSVYTVSSWNDNGQKIHVSDERRLYRSDF
FT                   FPGLGWMLHKALWRELAPKWPDSYWDDWMRLSDVRRGRESIRPEVCRTFNFGEVGSSKG
FT                   QFFRAYLREIKPASERIDWASQSLAYISNGDAYEDQVRRTLASATIIDSPTQVRLVPPE
FT                   NAATNVYKVIYASERDFNRLAKRFGVFAEWKDGVPRAGYRGVVTFKMYKGRATVMLVP"
FT   CDS_pept        join(complement(280334..280444),complement(279478..280206))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632453"
FT                   /orf_name="MICPUN_64019"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67400.1"
FT                   /db_xref="UniParc:UPI000199BDEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW5"
FT                   /transl_table=1
FT                   /translation="MAVSPPRTPAPANGRAKNLSTPDILAAMMDSDSEDELTIVRAREQ
FT                   LTARRPTKSDWAEEDRRARASPPAKTKRGGLPFFSPRKNPDGSEHVAAKRMSRKDVRQA
FT                   EGAEARQKERAAALKVTKPSASSTSNPSRAASTSSDVEAASRAAAGSTAAQLAAQLARL
FT                   VWSTLVFFALVAAIFVVCVALDQRGAFPDVMTPRSMRAFAERAVAGMSAANLSASVDAY
FT                   AEAARRFGAALALRCVEGSHVVATRARVFGAACVAEGDTVARAVRAVVARATSAFER"
FT   CDS_pept        join(complement(281072..282447),complement(280780..281008))
FT                   /codon_start=1
FT                   /gene_family="HOG000181278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632454"
FT                   /orf_name="MICPUN_88042"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ACO67401.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI000199BDEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW6"
FT                   /transl_table=1
FT                   /translation="MEEEEVTDDEYRAALEALQSTISGKTRAAPKGPNDLTWEQQFDRL
FT                   HLYLERLGMTESVNAMSYIHVAGTKGKGSTCAFVDACLRRAGTRTGLYTSPHLVDIRER
FT                   YRIDGRPVSKTTFTRNFWWLHAKLRETCEADLGMPAYFRFLTLLGFRIFTERAVDAVVL
FT                   EVGLGGRLDATNVIRRPAVCGVTSLGLDHVEVLGDTVGKIAREKAGIFKPHCPAITSPQ
FT                   VPEAMQALELRAAEVDGCSLTTARPLREWRTPSGDPIRLGLAGKHQELNAALAIELMRT
FT                   WTRRTSPVWGADALRCLDAGTLPETWATGLAETEWFGRAQVVPDDVEDLSWYLDGAHTE
FT                   ESMRHVAEWFCGRADGDETDGGGGGGTAGGGSDGEKSIAEPPVVRLLLFNCMEERDPTT
FT                   LLTPLAQTAEAYGAPITAPALFAPAESSSKGLTPFAGAQDCAWQTKLARTWDDLARKHA
FT                   GAEGARVGAQLAGASVNTSPPSTASAVVPRLRAAVEQIRRRAREERALGSGRRVHVLVT
FT                   GSLYLVGDMLRILGRAG"
FT   CDS_pept        <282881..>284182
FT                   /codon_start=1
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632455"
FT                   /orf_name="MICPUN_67870"
FT                   /product="Predicted protein"
FT                   /function="xylulokinase activity"
FT                   /biological_process="xylulose metabolic process "
FT                   /protein_id="ACO67195.1"
FT                   /db_xref="GO:0004856"
FT                   /db_xref="GO:0005997"
FT                   /db_xref="HOGENOM:HBG511469"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000199BDF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW7"
FT                   /transl_table=1
FT                   /translation="GVDVGTQGTKAILYDLSSKAVAGKGSCSYGLMPTPAGRPNAAEQD
FT                   PSTWLEGVRVAAKAALEEAGLEPRAIAAVGVSGQQHGMVALDAECDVIRPAKLWCDVES
FT                   AKEAKELGDRFGWAMQAGFTSSKVLWMKRHEPHNWARTEHVLLPHDWINYKLTGEIATD
FT                   PGDASGIGVLDLTTRSFRDDLCEFVDPKFRRLLPDIVDPEERGVLGTVTAEASNSWLEG
FT                   LIPAGAIVSVGSGDNMMSALGAGCVDEGDLVVSLGTSGTVFGYSSTPVIDATGAVAPFC
FT                   DATGGYLPLLCTMNCTKVVEEPLLWYGCDHGQMVKLARSVPPGCDGVRFLPYITGERTP
FT                   NWPDATGAIVGIRPGSLVNPAVAYRAAMEGATYSLLAGVRRMSELGMPAPREVKVVGGG
FT                   SKSPLWRQIIADAFDVKVRRLREAESAALGAATQA"
FT   CDS_pept        complement(284498..286492)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632456"
FT                   /orf_name="MICPUN_64022"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67402.1"
FT                   /db_xref="HOGENOM:HBG610240"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="UniParc:UPI000199BDF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW8"
FT                   /transl_table=1
FT                   /translation="MEWRRSDVSEPFRQAGITLFPSLAGSLDGARGRSRGRMLGAAGAT
FT                   SAAVTAPRIRVRPANALRGRTRRGGHGARTRAASFPPSPPRRPRDVREPAARGLGRDDA
FT                   VDVHDDEEEEEDDESSSIAEPSPAEPGDASRDASPSSGASSSPASNPKPFAAWSRRLQR
FT                   SVVADDRRGVPFRVASAADIASALANARALLGERTDIAGEMARAIEKTANSRRDVGWLA
FT                   RDPTATPALDGTARFEEILHDVRRRPVALDGSGSRYEPSPALAGPDAPAYLLVPGLFGD
FT                   YYPGYMSDVRDWFVARGARCKMSVACDTEGTVRANARALAAEVSAWRREMETELLDHGD
FT                   GRAGTDSSSSSSSSSSSSSSSSSSSSSDERLAVVLIGHSKGGVDACAACAEYAQLLRGM
FT                   VRGIVTTQAPYAGSFVSSDLLATPALESLSTAALEVVTGTKRGEGETLLLPAVRDLTYA
FT                   SRRTYLASAPRLDVRAFPVVSFHTETKHFGSLLFLPAAYARNRYGVGSDGLVARCDAEV
FT                   PGAVCVRWTDEQDHADCAYPREVSDGAVRAHRASQRMARRAAAAAGEVTTGEAVDADAD
FT                   GGGGNERGWAAGEALVRARAALERATPERLRGVASPGEYHEALATLLLEQSWDPDAGAD
FT                   EWTEVGGVGRTMTDGGETRAGAVARGSGE"
FT   CDS_pept        286491..287405
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632457"
FT                   /orf_name="MICPUN_104065"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67196.1"
FT                   /db_xref="UniParc:UPI000199BDF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGW9"
FT                   /transl_table=1
FT                   /translation="MAHRGSSLIRRAAASFSTAAFHGSRPRRPFASSAFARTMSSSMGY
FT                   DEFASEVARATAGDATRDDQAHWSDLLAKVETRCDEWRHPMAPISFWLLKHKDAPRDVA
FT                   YDPSSDALADDPNGPNKDVIAMLIQMADALYGLRGCTRGVAPRHAIPLIKAAAKKHNSS
FT                   KYITEPHAGALVALPGLCEWVRAGERWDDPSVDCDDVAREAAKAVALGVPRPGHSVLGH
FT                   GTFGAAEPCWVQLAAKYEEGNGDVQAEKAAYERALVGRSGGEGGEKAKKAKWTWRVKHM
FT                   ADGDAEYIAEAGGAMLIFNGDEE"
FT   CDS_pept        complement(287626..288831)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632458"
FT                   /orf_name="MICPUN_64024"
FT                   /product="Predicted protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67403.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BDF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX0"
FT                   /transl_table=1
FT                   /translation="MDQPVTPGRTTPPPRPTPAPARAAHKRRGPTAKIPFAATRGVDVD
FT                   VPSASASAATGAREPPIPSRVLVVGGGRVGAYLARALKDGGVPHVVLKMSNRNRARVHA
FT                   PGKTEPRGDAVDPTRTGATAIATHAGATCVTAYEDLPEVCDGHESRAHFDLVFVAVKTY
FT                   ALRAVREEMEASHVTFDAIVAAHNGMVEPVFDPSLTARASMPQSWDIVKDDGEPCGYRM
FT                   VVRNEDKPWVLPATTIGERFASVLGRCGIRAVAAPDFEYLLLEKYFINGVANLLSVVGD
FT                   VNCDGLLANRGLTARAHRLFDEMMDALAVDHAAGLALAPANFRDVVFAKVASYGAHYPS
FT                   SKQDFDAGCALEIDSLNGYVVKRARVNGLIATENEALVNEVRRMVEARDAARDAAAVPT
FT                   SA"
FT   CDS_pept        join(289223..289894,290039..290743)
FT                   /codon_start=1
FT                   /gene_family="HOG000206192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632459"
FT                   /orf_name="MICPUN_98314"
FT                   /product="Predicted protein"
FT                   /function="actin binding"
FT                   /biological_process="cytoskeleton organization "
FT                   /protein_id="ACO67197.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0007010"
FT                   /db_xref="HOGENOM:HBG444917"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI000199BDF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX1"
FT                   /transl_table=1
FT                   /translation="MESLVARLEAVAARLEAQAGAPAAAKTTASTPGAKTDAAGGVAPS
FT                   VAAFDALIAGPLAELVAATSALGDAEIADATALFADAFNAERTVIECIASCRKPEMDAL
FT                   QSLLAPVGDLMTRVGAKSEGKRTDAFNHLKALAEAAQCLSFVAYTGPETGMSLPGPHVT
FT                   ETWQSAEFYANKILVQHRNSEGGDAHVTWVNSLKRLVSVATRDYAKEHHTTGPAWNPKG
FT                   GDPTNGPAAPAEGMSAVFKELNKGEAITSGLRKVTDDMKSKNRADRSGLVATGGGAGGA
FT                   PAVAAVTNVSKTAKPPKFALDGKKWAVEHQVGNRTLVIEDVNPKQTVYVYDCVDCVIQI
FT                   KGKANNITLDKCAKTGVVFEDVLATCELVNCVSMQVQCTGAVPTVAIDKVDGCQVFLGP
FT                   KSYGAEITTAKCSEVNVVCVPAEGSDADAIETPVPEQFVTTRDPGTGKWVTVPMGHSGA
FT                   "
FT   CDS_pept        join(291025..291078,291146..292450)
FT                   /codon_start=1
FT                   /gene_family="HOG000246369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632460"
FT                   /orf_name="MICPUN_64026"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="glutamate 5-kinase activity"
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67198.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004349"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="HOGENOM:HBG507643"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniParc:UPI000199BDF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX2"
FT                   /transl_table=1
FT                   /translation="MKTAAHLESVQEQVSGRFPTLTPVRPFRRSPSSQPTVVIKVGTSS
FT                   LLRTEAGTLHLSQICTLCETVARLTRAGVRVVLVSSGAVGAGMFRMGLTEKPREVAKKQ
FT                   ALAAVGQVHLMRYYEDIFNTIGIKCAQVLLTLENLSNRKQYVRARNTFNALFDMGVVPV
FT                   VNENDCVAVEELRFGDNDTLSAQVAALCEAQWLFLLTDVDGLYTSNPNTDPGARRIEVV
FT                   ENINELDVDVGGAGSSVGTGGMVTKLTAARIACAAGCKTIVCLSSNLEKDVEACVLRGE
FT                   PVGTAFLPAKIAAKGKKKWLLAVPIQGEIGVDRSGASAVLRGMPLLTSHVTRCEGSFRV
FT                   QECVRIVNEDGQEIARGLCNYNSAVLEDTAKDYGLAAPMGSIMEDGWVDDEDGPPECMH
FT                   ANNICVTHVETLKKSFTFNDFLGAGYDSNESRGASPGPGTSPRQSHEDHEDNE"
FT   CDS_pept        join(complement(295443..295739),complement(292598..295300))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632461"
FT                   /orf_name="MICPUN_64027"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67404.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199BDF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX3"
FT                   /transl_table=1
FT                   /translation="MRPRVRDSPREPRLRPRSARGPLPSCGPLHFPLVSVGRHGRSVTI
FT                   NSCSCSCIGGNEYCRAETERTEAPGLTRAGRHLPSNREGAPSEETQIMQSVAFQEKENV
FT                   STVADKTLGDMTDRGYHARLRAAAAAAAAASSTRPLSSAETNVRFASDPSASKLSKETR
FT                   DAARLEALRSVEETLARSRRSSTSPPGASSAPQPSVARAGSFNAAGTSSTSSTAREQPR
FT                   RGGLERSVSDATNVSSRRDAIPPAAYYPRSSLFDVDIDSDGSESSNGTAGDTAGESPSS
FT                   ASSSDGRKENAGPAGADADPEDAAWTPPPPPDSPDVNDDVEDDVEDDKRENSAEAPTTP
FT                   EGGTELKAGSGYRGVSEWMDAVVAQAKAVRQATGMMNGGVNGAGKPSAQTLASAAASGD
FT                   SLRAAESIAAAMSPAVSTNASKPDRSCTNPTNPDGVTDEEVEVMTVDALVTLCKSRGEL
FT                   IKSLSEELEGARGAHEETAAALARSNAREETLEEELRRSAERCSEVEAGRRSARAALAE
FT                   MASQNARLVSAFSAKKEEVRSLKSEVAEARKGVDDDNADIAAKLLAAQSEAASLRETAT
FT                   RKDADVARAEAAAESERASSRAASRELEKLRDQLAQMERSRRRLDAEHAAARARTDDEI
FT                   AIAVRVARKELDVERAQFQTERVRWEAERKRIMGELSAAREATAKAADDAAAARAEARA
FT                   APRDNTGASASAAFNHQIPSQKRSGSSTGSNPSAPYRDPFRDPFRQQTNGSNAAAAANA
FT                   KAVSPLRNPKSWSKTKTKTPTKQKHSSSTAKSPGPNATPRQRAEHHKVKGNNEFHAKRY
FT                   EAALAQYSAGLALDFSDDAFRAILHANRAAALQAMRQYCEAVMDCCASHLLDPKYLRAL
FT                   QRRADAYLSMGDWPNAANDLEALTPHMGAECATKLAEARRKVKKGTTCDHYAVLGVGHE
FT                   ASGSEIKQAYRQLALKMHPDKAPKPELRSAAEAMFKHVAQAYATLSDATQRKRYDSTVV
FT                   MSRFRRSGGY"
FT   CDS_pept        295926..296843
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632462"
FT                   /orf_name="MICPUN_109466"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67199.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199BDF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX4"
FT                   /transl_table=1
FT                   /translation="MEEDLYAMLGVSRSANGDEIRRAYRKLAVRWHPDKNPDDKERAEA
FT                   MFKKVAAAYEILSDDDKRAAYDRYGIEGVEGAASGDGGGFGAFYPRGGGSSSRSRGGGG
FT                   YQPPGGFYHDPFEIFREVFGGRDPFDDFFGDVDPFAGRGGGPGYMDDGRGGGAGRSGGI
FT                   HSRRRDPFGDDPFFRGGAMGSMSAFGGGGGLFGGAGSMFDRMDRMMDAHHNAMGGGGSF
FT                   HSSFSSSGGSLGAAAGGYSKSTQSQTVIVNGQRVTKTTTTIRHGDGREETFTEEHRDDN
FT                   VGGNGGYLGGGQPRAGSRGYLSNW"
FT   CDS_pept        complement(296958..298136)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632463"
FT                   /orf_name="MICPUN_104069"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67405.1"
FT                   /db_xref="UniParc:UPI000199BDF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX5"
FT                   /transl_table=1
FT                   /translation="MARHGAEDYAATAYLRAQLKDAVAGVKRMEKEAVEKDVAFEERLA
FT                   SHAKAAASREREIIEDRDAKVAAAEATVGEYERKFEAVREFKEDYEKVEARLNAKSEEC
FT                   EELRRRLDQKAADGERRLIAERATLTREWEARFEDLKRSMEASVEDRYDSGVKRILEQN
FT                   RRMVAELKLHSEVSAESEARARTVAQENRRLRRELDLRREMEGLFAKRGMKQKEQVVES
FT                   REKMRDLERSMSDMASKYGAEIEFARAEAREVKASAVDDAARTRRLLRARSDELREIKA
FT                   LAKEAVRQRGELERFMISSLDLVKREMEAERARAGAGAGGRAGSRPAAGGLEEAVAGDV
FT                   DVAGMSWAERERVLRLAFARMNASNPDHARDRRGGGSAMDGAVAEATPPAMI"
FT   CDS_pept        join(<299229..299282,299600..299657,299785..>300188)
FT                   /codon_start=1
FT                   /gene_family="HOG000200854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632464"
FT                   /orf_name="MICPUN_88104"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67200.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG750380"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199BDF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX6"
FT                   /transl_table=1
FT                   /translation="RIGGPTRRSAKGGWTPDEDDILRRAVAQYKGKNWKKIAEYFEERT
FT                   DVQCLHRWQKVLNPELVKGPWTKEEDDKIIELVGQLGAKQWSKIAQQLPGRIGKQCRER
FT                   WYNHLNPEIKREEWSREEDRKLIIAHHQFGNRWAEIAKTFVGRTDNAIKNHWNSTLKRK
FT                   VDEALARGL"
FT   CDS_pept        300306..301523
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632465"
FT                   /orf_name="MICPUN_51989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67201.1"
FT                   /db_xref="UniParc:UPI000199BE9D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX7"
FT                   /transl_table=1
FT                   /translation="MAKQHAADAKAAAKAERAAAGPKGRKRKAAEDAALAAKKAAYGVN
FT                   PAAAAAAAAAVFDATLHSMMSPLGGPTQQPSPFGLGTNSWYGPSGTGSMFNTGGHGVGM
FT                   DGVHGGAHNPPRSPYGGIGGIDGFFDGVGEGSNPPIHVGGSPGGSKNMNGGGSPLGALS
FT                   TMMAGGTSPLLANFPGISGGSPGNLYASLLSSPGSMRKNTVLRSTPGTGGGMNGAGAMA
FT                   PPKSAKASEKVHAADLPQIAEDSPSISGLGGWFDTPGGKNARGSKISPPANAPVPRMAG
FT                   ISAELAGLQSPPHLKGGAAAIPGRLSSIFRRAASGADISSQGGVGVKATKEPAASRRAD
FT                   DVLEVMRQLEQQQNAGDYAQAEQFLAAQERKTRAGAAAAAAAAAAMGVRVEGGDGLSPS
FT                   QFLEMR"
FT   CDS_pept        complement(301758..303080)
FT                   /codon_start=1
FT                   /gene_family="HOG000202273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632466"
FT                   /gene_name="RAD51B"
FT                   /orf_name="MICPUN_64031"
FT                   /product="Rad51 DNA recombinase 2 "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="ACO67406.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG445225"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI000199BE9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX8"
FT                   /transl_table=1
FT                   /translation="MAAKRSLARVAGLDVDLLSRLESNNFRTCEDVLTRHPFDLVELLD
FT                   VNLPVAEKIVTCVARACCPKPVTAKQLLDSRTDDPHGDDDGSSGGGGGSSASSTRKTPA
FT                   FVRAHLAPLDDALGGGVPTGSISELVGPAGAGKTQMCLTLACACAAPKRCGGLESGVVF
FT                   IDTEQRFSSQRLAEIARAKFPETLSPAHAPDAASAERELESLTSRILVLTPSTLSEMLQ
FT                   RLNGLEEALIDRGVRLLIVDSVAALARAQFGRGQLTQRQELLGQIASALKQLAERLGMA
FT                   AFVTNQVTTRVGARVRHAHDTAVRGGGGDTAGGGGDDADSPGSVTAALGTKWAHCVNTR
FT                   LVLEGAEGAVDGGEGREEGGEGGVARGGGGGGDTAGDDGGARFVARVIKVVKSPRCPLV
FT                   GFECEVYAGGLRVHGDRKVRVDPSGADAQGGIRGIYQGAVL"
FT   CDS_pept        303428..308218
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632467"
FT                   /orf_name="MICPUN_104071"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67202.1"
FT                   /db_xref="UniParc:UPI000199BE9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGX9"
FT                   /transl_table=1
FT                   /translation="MAHLPRSRAATLGRTGDTSDAGGEVEHRILASAEQSLLASLAKQR
FT                   ISNATAPPKIFAKTVLRSTDDPTFQGAHFGEGAAEVRALSERDNCANPWDGVHRVLPGV
FT                   AHLARQRRERHERVVAAWTGERARLADVARARVATAVRELRDAIATSDASLAKGTGVYD
FT                   DDAALVELTSDDAIKVWDEFVATRLRDRQLWIDNLEKDVASAATETREEMASALAHTVD
FT                   ALTAVAHVSRGDVERFAAEATMEINADALEDRRGVAELLARLRTREVELERSERGRYDA
FT                   ALVKWRTLRTERGVSLFAELIESERMSDNPEREAITRELAEDQVKARDSLLAHADAFKA
FT                   LLPGGFDGEPGSFDGVGSLSRAGVELNPVGVKRWAAGLLARCDAWDGACALGLKRLETL
FT                   ESTLRAEADEALATVVAAVEEYAGPIMDQRAREKLVRKRCVRVYDKRNADASDYIERVR
FT                   SMVEPQRVEWRRKCECLMRFARRVARCRDVHRREAEAIHESVFARLDARRAEHERVDAA
FT                   KEGAFDAACEDIAVAADEAKLEAAVDVAHQRLDDIELNYRDFNGAMGEIARSNPKSQSE
FT                   AWEEYQRRLCLVLRLVPNVAPRPEPEPEPEPEPEAEGDAEVGAEGEGTTTEPEAGDKVG
FT                   EEAKVIEPERENDGEDEDDEDDGDESAWRESDAWKVEDESEEGREWLTTSSGTRFAVWD
FT                   SVYEHVFAKPPEPEPEPVEATPTDGEDAGETPAEAEAASPAEGDAEGDGDADAESDDDR
FT                   EPILDDEGNPVLDDEGNPTFHPPPPPPPPKPIPHVQPQLDLAQADLLPVLVATRDALLD
FT                   DAERHLELVLDRAERFVAGEIEDLRDELEDNLRSHRPRAGRLEETNARSRASTLAMQRR
FT                   RFDAHLARVAQGARRAENRMATAIASADEEIDAQCAKITALKESLVHVASTKGLDIRGR
FT                   EELRELERIKARCAQTVRTLRAQAERNKTATEEANALYVTETLKTREEGGEYSPEVREE
FT                   FVAKLARVDAAAAATKEERDATFDAMEERATQLATEVHAAYEEAAPHHRKDLELIEAVD
FT                   RCMADAKSRLKALLTNADEEAASLAREIELVRAIGDRAMYVAPKDHFGKFRAPRDEGVA
FT                   VDTLRSLDRLRRVLLSRCKFVGILAPDTKIEPLAEVSFNLEDVEEAAPDEEILAKEAEA
FT                   AAAAEAVKAASGGKYLKGWHTKAEEYPTVVSQMDELVEQCRERVKEAAEPYYADKEADK
FT                   ITRPEKIPAKLDDLAATKDAVVAEMRADAARHAEEAAATLRVQVMTLQDLVSNQVEAAA
FT                   EYLLEESRRRVAEAMHAEAAKHSGDAKRLAGDRHRHRDLMRPQLALPSRVAERNALVDA
FT                   ETARGKEALEKLEAEASAVAGAIAASAGEFARRLTRMSIALATLCSDLVTPADLAPDGP
FT                   GADAPKVLTRKNLKQLRRMRHEAADGGEKGKAKRRDAANGGRPHKERRWLPVNADELSP
FT                   EACGYARLEIPPMRWPGDPPPSPPPPPAEPEEGEGEGEQAPEQATDGADADADAAAAEE
FT                   EEEEDDAPREGEVWGLDVMSVQVAVNARDRAFDELRSSVADHLASHERSMRRRLQDEVL
FT                   HKERWDQLVTRTESAHS"
FT   CDS_pept        308485..309420
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632468"
FT                   /orf_name="MICPUN_64033"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67203.1"
FT                   /db_xref="UniParc:UPI000199BEA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY0"
FT                   /transl_table=1
FT                   /translation="MDKGGESDFGSILNWRDLGSTPGTRVAPGRVFRTATPGRSSEEDA
FT                   ATIVGLGVARLLDLRSLDEFEPSPGALQSRFQLRSFTRPADAADPSTGAASTSTAIAAF
FT                   RASILDDVDAGRAVRYHAPLLDYDRYYRSIYERMEGVERVKAAVYAVQAKLYDDTNQRR
FT                   LFVRKVNAGGLTLLNEVMVDGSGPEIAAALCVLSATTPGGATAFYCKAGKDRTGLVAAL
FT                   ALHCCGASDDAIVADYTRSQGSGKAALGGGKTEGDGTAIDYSRFHGAPETIMRDTLSYI
FT                   RRGYGSVEGYLDRVGFDADARRTLARALCE"
FT   CDS_pept        join(309562..309903,309998..310291,310368..310884,
FT                   310950..311638)
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632469"
FT                   /orf_name="MICPUN_64034"
FT                   /product="Ammonium transporter channel family "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67204.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="UniParc:UPI000199BEA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY1"
FT                   /transl_table=1
FT                   /translation="MTAVAAYVLGVSSSAPARKLLQIPLIPGDVVDTPQDQLPTADTSE
FT                   GVESLASAFDSGDTAWMLTSTALVLLMAIPGLALFYGGLVRPKNVLNAASNVFATVAIV
FT                   TLVRHFRDKNVWVLWGYSIAFSDVEMEKGRYNLHSFFGSLTNGGLTGVSLFSSTGNYPA
FT                   SIFVTFHCMFACITTALITGAFAERMKLTAAWAFAVLWSTAVYCPLAHQVWGGDGAFLH
FT                   SLGAIDFAGGIVVHVSSGVSGLTVASMIGKRTGYPLIPKAPHSLVLTHIGASLLWVGWF
FT                   GFNAGSSTAADFIAGQAMLVTQIASAAGVVGWTAVELSCYGRPSSLGMVSGAIAGLVGV
FT                   TPASGSIGAMGAICVGVVSGAACFNFCTYVKEAIGTYDDSLDVFGIHGVGGVVGALLTA
FT                   VWCAPDLGGAGFGEIVLRGGEVKPIREIGTQLGVQAVSIAYAVCWSVAATVLAVKFIDV
FT                   CHGGYHLRLRRLSHVRSTPKEEEAGLDDAYFAESAYNFAPQDMQISVEVGPLRGRKGHG
FT                   LSLYYTDDEGTRHPIGFSGDAQDPDDPSQRDAMARMNDAARPHALSDAVANALWSGGGT
FT                   VNIRRERGGDGKVTAEHISVTPGESREGTVRGGEDAA"
FT   CDS_pept        complement(312020..314404)
FT                   /codon_start=1
FT                   /gene_family="HOG000232962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632470"
FT                   /orf_name="MICPUN_64035"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67407.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000199BEA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY2"
FT                   /transl_table=1
FT                   /translation="MRSRLEQGARGSCLHLTHGVGSTATARIDPDASHLGHIAAHASTM
FT                   TVTGVTAGMRVSLARPVHRGVDRRLGRTSDHRGRSARASVKPLHPPPHARVDFRRRVAT
FT                   RGAVETAVSEPETSTSSSAAADDAPVEPKPAAPANGLEDGFVVVSAGDGTVLRRPKDPR
FT                   AKREKVRDERSETEAWEQLDMEQNFCVLKRRYDPEAIRKEALETPVALARRGAVVVSKF
FT                   AALFSRKESLMKLDAEDGGTRYATELKNTLTSLGPLFVKLGQNLANRPDLVEEEVMEEL
FT                   TKLQDRVPPFPSAEAFKIMEEDLGRPVAEVFKVITPEPVAAASIGQVYKATLMDGTEVA
FT                   VKILRPGTRPQVILDLWILRTAAERIFDDWCRENIGCTATLLVDEFAEKLLEELDFVQE
FT                   ANNLRDFKRNFADDPSVHIPGVYGHLSSPRVLVMDWQEGTRCTAEGAFEDDAALRIFLQ
FT                   NGVESGLRQLLDFGLFHGDPHPGNVLALPSGDIAYVDFGNVAEISRNNQENIIDAVVHV
FT                   MNGDYEGLAECLENLGFLQEGTDVKPIAEGLAQAWSGEMLGEMAATGNFSFRGLTREFN
FT                   KLLYLYPIRVPERFSLVIRALLTQENICLTLDPNFNFLEAAFPYVARRLLTDPDPNLRM
FT                   RLLRVVIVKGRFEWERLAELVKMAEIGAQGGVSLPVSTMVELATDGAKMLATDGVMRTM
FT                   LMDGLKAVPMREHVAQASKMALLVWQLTIGRAWSTSSLGRWLRARRVGLVYRLKLMFAT
FT                   TTSSDIRTRAKIPKNRGVGGSWDESSPVLPGNEDWNGVAAA"
FT   CDS_pept        join(314854..315022,315184..317390)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632471"
FT                   /orf_name="MICPUN_64036"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO67205.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="UniParc:UPI000199BEA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY3"
FT                   /transl_table=1
FT                   /translation="MACHVGGRPGLLSFRRGSMAGSSLGRAAVRSDAGVDAFARGVGEI
FT                   TAQEGQRGRGRGGGRGGGRGRGRGRGRGRGGRGFKLRQSSDGKSHLGTTLRYQDNKPFP
FT                   DHLATSPAYPDALTSPIDPSPGGLVDDAPIKFLPLGGLGEIGMNCALVGTENRYVLLDA
FT                   GLMFPDHEELGIQKVLPDVSFLARWRDKVEAVLITHGHEDHIGALPWVIPALDPDTPVY
FT                   AGLFTMQLIQRRMKEFNLWGDGSRFKVIDMGERFDAGPFEMEAVRVTHSIPDCCGLIFR
FT                   CAAGTVVHTGDWKIDENPVDGLNFDREQFERVGKEGVTLMMSDSTNVLSPGRTISESLI
FT                   RDSMVQKVLGHNGRIITTQFASNIHRLYGVKAAADASGRKIAFVGMSLNTYLEAAKKAG
FT                   IHPIDPDELVPAEEIENVNPNELIVVTTGSQGEDRAQLAQAAFGGSRLLTLQPDDLLLY
FT                   SAKMIPGNEKRVMRMMNAIAARGPQIAMKREDGLHSSGHAYRDELEEILKMLNPEHFLP
FT                   VHGEYAFLKEHELLARECGVRHSTVIGNGQMLGVTPLRNGRSHGTLGNLHLLGEARLQT
FT                   MFNDGGKGSGTSEDLAIEERMRIATEGIVVVDLEVFDNPPAQDAPAADADADADAPDGE
FT                   RRGGGYMTARARVTSRSMWTDEGRMLAKIRDAAERSVQALESGARLSAVERTCASAVRF
FT                   EARAYSGKRPDVIVVAHRGQGSPSDLARLDNAMSTAGGGVPGDDRGGMVGASGTKYRPR
FT                   QARRDTAPRNVRPLRGPGSARGDGGGGARHMRRDTEYQ"
FT   CDS_pept        complement(317508..318590)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632472"
FT                   /gene_name="LUC7"
FT                   /orf_name="MICPUN_64037"
FT                   /product="U1 snRNA associated protein "
FT                   /protein_id="ACO67408.1"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniParc:UPI000199BEA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY4"
FT                   /transl_table=1
FT                   /translation="MASDFAAMLDEMMGPERNIDLDKVTGKRRRFDDEDVDRHFLVGCS
FT                   PYQLFQGSKKNIGYLDEFARHVGMDPARNSRMVCDEACKAEYEALPQTEKDRLGWERDT
FT                   FFLLGFLIKRCDDRVRNAREQLEAHARRVEDKVAERKVGWQTRVDAKMRASEEAGEAGL
FT                   VDECQKLIAEADAVRAASEKDLEQYRKEQSRGTDHQKVCPVSGAIVTKDATPESDTSGH
FT                   YAGRNYVGWKKIREWHAAHAAQLSTRPPRSPFRSPRGPAADGRRVGPSPPRTSREWDRE
FT                   RDRETRRGDERRGRDGSRERDDSRDRGRRGGDRDGRRDRDGDRGRRPHPYTRDRSRDRR
FT                   VDGGWGDGRRGRGHDVHDGR"
FT   CDS_pept        318752..321115
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632473"
FT                   /orf_name="MICPUN_113310"
FT                   /product="UBA/THIF-type NAD/FAD binding fold
FT                   domain/deoxiribonuclease"
FT                   /function="binding"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="ACO67206.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BEA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY5"
FT                   /transl_table=1
FT                   /translation="MSAAMRASAGGSAGLLAVPHGRRGARRPVVARRPVRAPASSATPS
FT                   SADDDASCALRTRDETAAEFRFEGTRRLYGDRRFEKLATSHVAVLGMGGVGSWTAEALA
FT                   RSGVGALTLVDLDVVCVTNVNRQVLATDASVGASKADTMAARVRDINPLCDVTIVRDFV
FT                   SEENVEAILGLENLNRNRRDDVPYKTIDFVVDAIDAERDKAAVIACCVHHRVPVITVGG
FT                   AGGVDALGDVVVEDLSRATFNRLCQRVRRLLRRDYAFPRGEERTPREIYGVRSSFKKGN
FT                   DGDSKRETKARGKGRKKPQGKFGVKAVYHRENVNFFKPDPGTRGRGGMGCDGVGGSAVF
FT                   VTGALGFKAASHVCLALMDDDTKDDSCAAAARGPAASGWRSRVWPKGRGERGERGGGER
FT                   GGGGGEGGGGGGGGGGGGGGGGGGGGGGRGGGGGEGDGNGEGVDDGDGSPAGEVQGIES
FT                   AYPAATQLCAAAGVAAVAANLEDGDVGVEEARDDVNADAVAAGASANASASIAAAAAAL
FT                   PASAIFDGHCHWHLGGDLSACVALASSLRGAAFTSTRPDDWEMATACALGGNVNVDVEG
FT                   EGFGLCLGLHPWWAHHHPPGSDPTWLPDLRRRLERSPRAVVGEIGLDRVAVPMNERGEV
FT                   IGEPDYPNQVACFESQLLLATELQRPCVVHCVKAYGDVADRFRAAASMPPRVLMHSFGG
FT                   TRAYMESLTRMKRWGKRFYFGFSAVVNLRSPKTRAVVTACPDDRILLESDLVGVNGAES
FT                   DLRRMLAFVAECKGWSAEETAGITRENALRFYGE"
FT   CDS_pept        join(complement(323751..323807),complement(321176..323599))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632474"
FT                   /orf_name="MICPUN_64039"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67409.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000199BF46"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY6"
FT                   /transl_table=1
FT                   /translation="MSADPNALLAFKQSNLKERLEVYREEIANGERQIADLRRKQASYE
FT                   ERLNAVASEWNTLQDDIVAMVERTGGARASTTRASSSASTADIKDPFLRRLFDLAGADA
FT                   IAGRKRARDDDGDKGAADKDGGSATDSEDEDGAAAKEGGPDDDAVKAVDAIKAKAAATK
FT                   AALVTVLDAVDERSSGDAAGAAGADLIRSLEARAADATRALERCRERTAKQRKRNEELA
FT                   SRLEDAQAECELLRRSLAAARANAGHHEGLPPMATAAGARAAGAAAQAAAAAANTPGGG
FT                   QPQTPGTAVKTSGGEGGDTAVRTPAATPADAPDANAVARLEADLAELRGRLAHQTKQLD
FT                   EASRREASLTGELHAVRDGASGGPNRSGEPNTAASTAAYQSLERRAREAEEDASGFRAE
FT                   CQKLRREADEARRDLRSLRAEAARAGEHARRAQLAEERIEGAEARRRAVCDERDELATR
FT                   LASEAESASRRRLHEERAAAVERLGEENKALRREAEAARSLKGELASARARAANAEAEA
FT                   KNAKDEASNALQALERVEKKTPPAEGSAEELKRLLDAANARAELAEAKALAAQAELAAK
FT                   SEETDAFVAEVEAIGAAYEESQSETARLMQRLTERDGTEAKAIQDAANANNRARRLGDE
FT                   LAGAEAAARHEQGVARAAAQRCADAEAARAEQSAELQRAKEESTRLAERLEEQTRTMRA
FT                   LQAASSGHREAAEDASKKADELSRRSAGDAEKVAAAERKVAALEEQVAGLKRRGEKLLK
FT                   RGGGADEYREEIDAYKSMLRCSVCNDRPKACIITRCYHMFCQECVQVRLDNRDRKCPGC
FT                   AAAFSASDVKSIYF"
FT   CDS_pept        324321..327077
FT                   /codon_start=1
FT                   /gene_family="HOG000271593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632475"
FT                   /orf_name="MICPUN_88465"
FT                   /product="Predicted protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /function="homoserine dehydrogenase activity"
FT                   /biological_process="aspartate family amino acid
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67207.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0004412"
FT                   /db_xref="GO:0009067"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG298754"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniParc:UPI000199BF47"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY7"
FT                   /transl_table=1
FT                   /translation="MASSVAQLRAVLAQRRSDFARRDPPRVAKVVKPARVRAAPARAAV
FT                   AEPASAPGGVSGVERGSGHEVHKFGGTCVGSFERISGVCDLLIESAKSGVKTFGVVSAM
FT                   GVATKGEPKVTDCLINATDMAAARNPAYEEELVKLEHKHRSTAEALLTIPEELTKYMDN
FT                   FMAELEDLRAMLRAMSIAGTSTQAFADFVVGHGELWTARLCAAVIRCKGFDAEWIDARD
FT                   VLVVTDAEDGGVDVDYERSNANLDKLFDARGHGVAGSNRVLIATGFIARTPEGVPTTLK
FT                   RNGSDYSATIFGAMLIAKTITIWTDVDGVFSADPRKVKEAVCLESLSYNEAWELSYFGA
FT                   NVLHPRTTLPAMRYHIPVVLRNYFNQAAPGTSICDQCEVETGGVMNPIDVNSDRVNFIK
FT                   GLATIEDVTIINVEGTGMVGVPGTANAVFQTVKEAGCNVVMISQASSEHSICFAVRSHE
FT                   AAAAVKALNKRFEKAIAAGRIKAVEAVDECAILAAVGQNMCQTPGVSAMLFEALANANV
FT                   NVVAIAQGASEYNITCVVSKKDIAKALRAVHGRFYLSKTVMSVGIVGPGLVGKTLLRQM
FT                   KEQLAALKTDYNVDLRVVAVAGQSKMLLTGESEVALDLDTWEDSYAKGQAVDMEAFIQC
FT                   VTDSGAPNAVIIDCSASEDVALHYKDWLQRGINVVTPNKKANSGPLPYYKELRNIQRNS
FT                   YTHYFYEGTVGAGLPIISTLNNLRDSGDRINKIEGIFSGTLSYIFNTYGADDKFSAIVK
FT                   TAKELGYTEPDPRDDLSGTDVARKVVILARECGIDIELEDVPVESLVPEALRSVASAEE
FT                   FMEKLPEYDDEMAAKCAEAAAAGEKLRYVGVVDVENKTGSVELRRYSGDHPFGQLSGSD
FT                   NIISFETKRYVGPSTLVVRGPGAGAEVTAGGVFGDVLRVAQYLGAPS"
FT   CDS_pept        complement(327294..327605)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632476"
FT                   /orf_name="MICPUN_64041"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67410.1"
FT                   /db_xref="UniParc:UPI000199BF48"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY8"
FT                   /transl_table=1
FT                   /translation="MACPMRVWLLVISSVVAAYLAWTSSLFGGGALGMSDGEDEALNDR
FT                   AAKVKSRVGKKGAMTWRDWGWFVVDGLTGKYLYGVAMNGGGRAGSQRGTRRSARRKQD"
FT   CDS_pept        join(complement(329256..329489),complement(327747..329180))
FT                   /codon_start=1
FT                   /gene_family="HOG000177995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632477"
FT                   /orf_name="MICPUN_98316"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="ACO67411.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="HOGENOM:HBG386594"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI000199BF49"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGY9"
FT                   /transl_table=1
FT                   /translation="MTLTPNEKTLDPPEGFTVLQEGKARILQRENDVFYNKAQVVNRDL
FT                   SLSVMRQFQKVRAKEHAETKRAPKNRRLKGDMCHDEPETGDDDKKEPRGKKDGEAEAGG
FT                   DDETPREKPPLKPVRILEGMAASGLRAIRYARELDDVGCVVANDLDPTAIASIARNVEF
FT                   NAAHSAEAANRVRVVVPSAGDVRMLMMQHEKMFDAVDLDPYGTPSTLLDGAVQTVADGG
FT                   LLLVTATDMAVLCGNNGEVCWTKYGAYPHRAKYCHEQAVRILLGSIDAAAGKYKRHIVP
FT                   VMSVSVDFYIRCFVRVYTSAQQAKLAPTKVSYVYQCVGCDTFECQPVGKAVTKGNSTKF
FT                   QAGSGPVVPRECPNCGWHYNMGGPFWTEPIHDMEWVDAIKKQVEENKAMYPGYDKIHAL
FT                   LTTVSEELPDVPLHYDIHSMSHCLRVTPPPMALFRSAVINAGYRVSPAHCNPLAVKTDA
FT                   PAKVLWDILRCWVKEHPVKPIPEKTPGVVILSKEPELVANWTRVHGAFTKAQREGVTRF
FT                   PSNPEENWGPKMRAGRPVPGGGLEKQGMTKKQRTEASK"
FT   CDS_pept        330153..330842
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632478"
FT                   /orf_name="MICPUN_109467"
FT                   /product="Predicted protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67208.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000199BF4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ0"
FT                   /transl_table=1
FT                   /translation="MGGNVRYAAFARLSDGLTLASFKGKGATNAVTETAHKVLRSGNLK
FT                   PNGQLTVTVDRTIGTLHLAAGDGDVLAVITAPDYPRRSAFKLLDEIREMVRAGCRAEDV
FT                   GAASREGELQSAVPALASTCRRYEDLGEVDKLTSVSLQVEEVKATMEGNINKMLDNAET
FT                   VGAVEDKAEALRDGAQQFQRRSDNIKRAMWWRLFKIKLIFGLLFVVVLGYIFIPIIVKA
FT                   SEDSEKK"
FT   CDS_pept        complement(332139..332810)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632479"
FT                   /orf_name="MICPUN_64045"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67412.1"
FT                   /db_xref="UniParc:UPI000199BF4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ1"
FT                   /transl_table=1
FT                   /translation="MSATVAAAAARPSSRFPSTRRFNAGIKTRTRGRLVVRRVTQPEEP
FT                   QPDDFVTFNAIVGGGDWSVVQAQVREAAVSGRLTPGVLGAAYSVYEKCKETAEAPEVLK
FT                   TLENVILLLTQTLQQLDATPAVRLIDELMTIDPFVEGARVKAAVDDAYAKGTVAPDDLK
FT                   GSLQMMLDGMAEQDEAWEKHVAQASQTSSKEEFEQLLAHATGRMEAQRRLTQLKAICDA
FT                   Q"
FT   CDS_pept        join(complement(340219..340354),complement(332929..340079))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632480"
FT                   /gene_name="FAP42"
FT                   /orf_name="MICPUN_64046"
FT                   /product="Flagellar associated protein "
FT                   /function="ATP binding"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /function="nucleobase, nucleoside, nucleotide kinase
FT                   activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67413.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0019205"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI000199BF4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ2"
FT                   /transl_table=1
FT                   /translation="MAEEEENPYPVAPGASYIESKFPPWNVDRVVDELGSLTLDGKPAA
FT                   HEDGKFYDAEDGDVCPEALAMYVQKTWKRPEQFMDDQPAVPMLLLKPPPPPPEDGEEPP
FT                   VDENADPDDPSQPRQPRELVSESVLFSANPATEWMWNALRLVNQRADVIDAGDFLWENI
FT                   WPKDNDGSDPENPPNPCVSANGKYAVRMWVVDRWRCVWVDDRMPVDVFGRAAFPGARPI
FT                   QLWPLLLCKATLKVMKHYGVLNRVGSHRVPMVTWLTGWPKENFGVNNAEGALHDRLLNA
FT                   LTDAVPPVRDKHKAKNALPTVYLRERWLPDHPPPRIIALCGPAGVGKQALVDRLCEEYP
FT                   ERFGYGLATTTRPPHAHEVDGTHFHFVPLRAPEVEDLAEGSRGEKIYWETDLEEEGKLL
FT                   ESGVNVETTLPLVPLTGDKASEVHRRDANGADGAKVKRYRYGTSIKAVSKVAAGGKLLF
FT                   LTIDVDGCEQLRDNPAVDAYIVHIDTSTPELLRERIKQRLKVDESIVQRMLTEYADQLV
FT                   LASPGLSDDAGEAEPEEGADEGAEPKEKPPITKRIVHPPQCAESFYKLLLIDDPNDLYY
FT                   EFKVCCATLSPIVRNRLYGLPPHILDYSDVIPANKTEKVIVKPVILVGPNFLEKAELQR
FT                   LIFEEFPEVFHRPQIVTTRPLRPDYPAEDDPAEFEDDGMIHVLKDKWTEMEGAGEFATT
FT                   WKDLYKHETCTYKYAITKASLDEAKEKGLLCVCDVPTAAMADQIKEKYGDETMAIYVGP
FT                   ATLEEYERRLREYFTETDRDLEERLIAAEAEKKRGLDSGLWQSTICLDDPDVAYERLKD
FT                   IVIQERPDVLPPRDPNEGKPIVPVVLCGPSGVGRKTIYRALDEEFPDRFAYVCSKTTRA
FT                   AKEGEQAGVHYEYVDRASFESEIADGKFVEYAEIDGELFGTPVEAVQAAHDANKVPVIV
FT                   VDVQGVTRLREVYPQGAFCLVTPSSVDGLESRIRKIKETPPPPPEGEDAAVAEGDAEGG
FT                   DEDEVKLPDEPPELTDEQKEEIAERLDKISRQMTGCDVDGLFTDVIVSLDDAPELAYGD
FT                   LKTAIARVHPKLLVPPPKPLVISGPLGSRKEEVFEALLKEFPDSFGFPLATTTREPEPG
FT                   EIDGVHYRFVDEATFDAEAEEGKFLECTEVIVGYGEWVDEDVGNPPITVRYGTPFAEVK
FT                   RLSVEGKMPVLETDAAGAAAMRAAGLDALFVFFAHPTHDAREHERNLADVGEEPDAFPE
FT                   RVAEAEAELAAANEIVQCSKDGTTGTVPTRVYDYVLAYEPHRARYARFKEAIALAAPAA
FT                   VPMRTVWGYGRSRWDPAARVYGNMPTRVAVVGAAASGKSTVAQRLAKALDVPYVYPGAL
FT                   LRDAAYDNPTELGIEAKRYLDSTKTVPDDFMMTLVKDRLGRDDCVVRGWILDGFPHNHY
FT                   QAKALLDAGHEPDKVCVVEIDHETVFARTRGRLIDPLTGRVFHKEFAPCDELEEGKEVA
FT                   QRLTIRHDDANEDNVKNRLAKYDFSDAPVRSLFPQTAHFFDGAEAIDDVYQKVEDFVTL
FT                   EDREHETRHVTDPRTLPLLEYEVLEACVYQRRCCVSVREPEMVNPDSRRPAVWVDVEDF
FT                   ARTAEDFTVAFRTNVFAHANRDARLDRFDLGPGAKMIHVDSPEPTRLAVTLTVAPPEPP
FT                   PPVPLPAPLVLCGPGADELAATLAARYPAIYRVASIRAQRSAEEPEPAADGTDGGENPQ
FT                   NSEAAEGEGEGEDAAAESPPREPDAPEKYPGADSAAAIQAEGLCPVVCLDPAGVQAFKD
FT                   AHAPPPPELDEDGNPVEPEPPADGEEEEEKPEVPVPTLVCVGLPPMEPKRPRPPPKEES
FT                   EAEGEEGEKEETPLEDPKPKALTFDHVIYPNVRSLDTPETTFEMLKGVSAVKVRLPLPP
FT                   KDKVDTSTCEAVLHDYDWYKTGAPQRTVLTLATNTSQSATVRLPRGRHVLQLSVDPGHY
FT                   FAADVRSQRAFDLDDPAKMLEEKQLAAPSLAEGTYPEMAAGDWHVWFRRVFRVEKPTTV
FT                   AAALEVPDPAMSPFARFAVVNNDGAGTTTHFVAGAAPPKTFQPNEHGYTVMAYSKALTP
FT                   VPSGPWRLSALCDVPLASFDDQPIGDPTRFDGEYRPNYSHLVCRVRVAIKARVVLALHF
FT                   ESDLPAGFRVTLTDPEDGWEDKQAEYLRGGHKGHLRGVELHAWNAYTMLTVPAMAFEPT
FT                   ENGKYLVLEVKLDNPRCAFDVQPNGDIPSDMRWKLTSYASDPKAAEWTVDTARENYFDQ
FT                   TLSQWNAADGARKSKAEEAYAKRVAELRAREYAQGAENAPPRTPAYRELSGDIATHAGA
FT                   KPLEPAEPKNDEAPNEAGDDAEPPGPPVIELDPASHRRVLRGTTGGERKVISMATYEAR
FT                   EAHLREQIEASKARLAAYVEARAAGAGARPERASAKRAEFRSWREGTSARVNETARSKR
FT                   AAYLQSLKRDESGVEEGGDGGAE"
FT   CDS_pept        342491..342649
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632481"
FT                   /orf_name="MICPUN_109469"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67209.1"
FT                   /db_xref="UniParc:UPI000199BF4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ3"
FT                   /transl_table=1
FT                   /translation="MSADELREQVAAAARAAQTAAKVAASPSGRSSKQMLAKVKADLKA
FT                   LEEIVRS"
FT   CDS_pept        complement(342841..344940)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632482"
FT                   /orf_name="MICPUN_64048"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67414.1"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniParc:UPI000199BF4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ4"
FT                   /transl_table=1
FT                   /translation="MPTHHASFSSPLRKEQSRCSGRVPRGRHTRAASETTTAAAMTMGT
FT                   RVHLGTAPDIRTAVRRATSTSIGRHARPAPSHQSPPPSTRGSSRRRTRGVRTRGAHHPR
FT                   VHAASIAASYDTPDAPAPGAHPRAHRYEHPPETYRSAPGEKFLMQFGESMRIEELPEGT
FT                   RVVYPGVRKNAPSSPSAMRAMVERALDDPVGQPPLREKIRALVAAKGSTGAKILFAFDD
FT                   VSLPLPPMRSPDIRRVIMEECERRVVEEGVDPSCVKFVCSIALHRFIRPDEFRHICGDY
FT                   LYNKYSKLGAVSNYNAVDEEHSVVIGRTELDEEVKVCKDFAEADMLIYANCNYVAMDGG
FT                   YKSYATGLVHYTTLRYNHDSETLKKTRSLMDPARSSLHASIIRIGKVMQKHTDVFHVET
FT                   VLDDNRFPFYLRWVQILFRRMNWIQKAMARISCFFLRFLPNWLRLWIFWGPLVRGQFGL
FT                   VQCVAGETEAVHKRTLEANYEDAIVDVDGQADVLILAPTCIGPYTKDTYLNPLLVNTYA
FT                   LGYYYNMYVEGVPLLRQGGAMIVVNPMPYDWTEPTHTAYKAIFEEAVAPLGPTRFEEQQ
FT                   ERFATDEALNDIYRKGLGPAAVHGFYMYTWAAHGMEKVGKVFVVGAVDARGPDVLGWER
FT                   HDSVVSAVRAAKEWLRGRGTKEPDATFWQCPPVGYARVSVGSEEERAAIVAGNVCKKTG
FT                   RPRGN"
FT   CDS_pept        join(<345212..345826,345977..>346231)
FT                   /codon_start=1
FT                   /gene_family="HOG000199032" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632483"
FT                   /orf_name="MICPUN_69198"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="ACO67210.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG594279"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199BF4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ5"
FT                   /transl_table=1
FT                   /translation="ENNGFNFAAYPSRHVALHVMYAGWDYRGFASQGAERDGVRTVEEA
FT                   LFRALKRVRLIAPDATWKTCDYTRCGRTDAGVSALGQVVSARLRCRVPRRDDDDDDDDL
FT                   SETGRLHEGDEIDYPAVLNRALPRDIRILGWTYVPPAFSARFDCDYRHYKYFFTDWNGL
FT                   DVRAMNEAASAFVGEHDFRNFCKMDARNVHNYRRRIDSCRVVLAAGEPPGVAHIEVVGT
FT                   AFLWHQVRCIASVLFLVGLGREPPGVVAHMLDLARCPRKPQYEMAPEEPLLLWRCGFRD
FT                   VSFRLSDAA"
FT   CDS_pept        complement(346724..348652)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632484"
FT                   /orf_name="MICPUN_64050"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67415.1"
FT                   /db_xref="UniParc:UPI000199BFE8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ6"
FT                   /transl_table=1
FT                   /translation="MLTAPAPSRGAIARGCARGYAASGRAGAPARVVASISARVSFRDV
FT                   PFRVALAARPAGGNGGVPLRNGTRRGPRVVAAVNPVSLVAEAIAGGAGAKAAGVATAAA
FT                   GAAASTVTNAATSAAAAGGGGFMGYVLSFLFGGFFFSTLLGVAALFISVGGENVRRAWR
FT                   VFNFLGGRVWALVVKTAAAVKESLQAENTTLEDTKKVLLEGYQATKREVDDALTAFNQE
FT                   RDFYAAAVGIPGLRTAQYVIDHMMPGLIAQKLENSMADSIANVKHPNVKKMILKGVKAG
FT                   TAAPLLTGARFYDVGDRAMAFDVDVKWTSEVTATMDVVPEMGLLTDLGGGLTRVPVMVH
FT                   NVVFDGTIRVLMAELTREDPGYGAVVLSFPDPPQLSLDVRVLGGLEVNRVPWLRRVVVD
FT                   ATKTWIKEEMLWPQRMLIPAEKNVAKGEKPGFVLTDAQLKKVLQEDPLLLAEQRLKSLQ
FT                   QIATGEIGQKREPGEGLASGDEDDPTGPEIDVELTDPSNPRVVPPKPTAQQQAWAWLSG
FT                   TAKVTADKTVDLSLKTVEVTKQVATSEETKTVVKNVGTWFQRDLGGWVNNVAARAQGKV
FT                   QTDARGYPKADAWTEAPKQNKADAAKMASIDESSEEGANGNKNGGKNGVQKNGGAATNP
FT                   SPAPGSA"
FT   CDS_pept        join(349070..349424,349524..349558)
FT                   /codon_start=1
FT                   /gene_family="HOG000100103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632485"
FT                   /orf_name="MICPUN_51998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67211.1"
FT                   /db_xref="HOGENOM:HBG558379"
FT                   /db_xref="UniParc:UPI000199BFE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ7"
FT                   /transl_table=1
FT                   /translation="MALIITGEQYVQAWGAVFGVYALLMLLAPEKMVSDHFKAKCTPMN
FT                   AFWIRGQSVSVAATAYLLQKIPTAEAVDFGLLITAAIAILYPFNAKFGLISKNMPVKYT
FT                   GFPNHYVPEVLMTGFLAAGLYLKYA"
FT   CDS_pept        join(349779..349968,350048..350313)
FT                   /codon_start=1
FT                   /gene_family="HOG000100103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632486"
FT                   /orf_name="MICPUN_64052"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67212.1"
FT                   /db_xref="HOGENOM:HBG558379"
FT                   /db_xref="UniParc:UPI000199BFEA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ8"
FT                   /transl_table=1
FT                   /translation="MRRSTWSIAPSHSSLNRRTSLNDMVDAQLFVNIAKTVFGGYSAMM
FT                   LLMPKKMVTDHFKQECDPMTEFWIRGSSVGFFGLVAAIHKMDLDDAVDMSLATVVASAL
FT                   MYPFNAKFGLLSKNLPLKYDGFPNHYVPEVLMASVAALGFFVKFIKK"
FT   CDS_pept        complement(350518..352494)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632487"
FT                   /orf_name="MICPUN_64053"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67416.1"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000199BFEB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EGZ9"
FT                   /transl_table=1
FT                   /translation="MGGPIADERRAANKKRLLHISLGFIVGLLVGGIGVGWLSQWANGT
FT                   DWRDVGGSLIRGPRCPRCPKGGEVRYVEKQCPVCPKTPEPEVRTVEKSQTDCPPVIECR
FT                   CDAPIAAATGAAIGCPICDPCPESGAERGESPSRSAVEIVESRPGKEAKVEMEARLKAL
FT                   ETTATDDAPPAPAVNRSKSTGGSNDDENDDEPPPEIFDWSPFVYRAMFPYNKISKADVD
FT                   TAELVARGSVNSFRAQIIGGRLFVKDIRALEFARDYAPSWKITLLETMRRRRDLPDIDA
FT                   VFNEGDYPIVLLPNDGAHAQRLYGREGMSNGQKPPPLFSPTTNVQMTRDVPFPDFSFSP
FT                   PGVKGADRLSTTRWSVAHGRLLEAGAKIPFEDKLPLAAFTGNTQAEPRQRLAEVARSNP
FT                   DSVFVNQVFKKSPTGERSCVQLGLADKGGLQADKCALSFEEMCRYRYLVNVGSNGYANK
FT                   LKSLFLCGSVVINVESSAPNKEFFEHQLLPGVHYVSVRDSSDVPAAVREMEENMRRAKS
FT                   IAAAGTRRMAAFNADAVYDYVATALTEYASRMTFKPERSPGSFEVSCEDDLYRHYDHDG
FT                   GMSRFLTEDNSTCLDSREGAKTTTAIGAPGWGGSYDPDEGRIPCEVANDVKEVPDKCPG
FT                   VRWAGWGKRCARVECAEWMPDET"
FT   CDS_pept        complement(352608..353963)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632488"
FT                   /orf_name="MICPUN_64054"
FT                   /product="Predicted protein"
FT                   /function="manganese ion binding"
FT                   /function="pyrophosphatase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67417.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016462"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG558381"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="UniParc:UPI000199BFEC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH00"
FT                   /transl_table=1
FT                   /translation="MAPIEAAFRVASTDAAYTQAEAPIDLDALNLFLRDSRAIAMDPNG
FT                   APVTLVMGNEAADLDSIVSAITYALHVTRRSCIDYEWMDRDPPDPVTGDFDGWNNEKES
FT                   QCELRFAVPYVACAREDLPLRGDAAWLLDDIGVDVDSIVFADDLDPMALDASGRLRDVV
FT                   LVDHNVPQAKHRELLSKTTRVIDHHVDEELYPLECDVMIGPVGSCATLIAEQASEEAEI
FT                   GLDGMLGHGYTGNARGLWAGPLAKMIAAAILADTQNLDVNNERTRMEDYVWCHRLAAFA
FT                   GYEDVEAMTSLYETLKRRRFDQSGLSPRDLLRRDYKQWTLGDDVNVGIASFGVALNAMG
FT                   DAGDVKATCDAFMRDRGVRVLVLMSAFEGEDGSFERQLGFTSLDDEGARLCEKMAIAIG
FT                   DGLGGLRTIEGAGGAFGAMAFHQGDAKASRKKVQPLVAEFLEAEKAAADGVG"
FT   CDS_pept        join(complement(357249..357309),complement(357032..357126),
FT                   complement(354156..356858))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632489"
FT                   /orf_name="MICPUN_64055"
FT                   /product="Monovalent Cation:Proton antiporter-2 family "
FT                   /function="2-keto-3-deoxygluconate:hydrogen symporter
FT                   activity"
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67418.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0015649"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI000199BFED"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH01"
FT                   /transl_table=1
FT                   /translation="MVLGRLLLAASGGGGEEGVHVPFTFEELVAFCGILLIFWIVGKCV
FT                   ERLGLPALVGEILAGIAVGPHGLNIAPKPDALMMVGEFGLVLMVLEAGVEVDLASLSLV
FT                   GARGVQVAFFGSLVPLAIGSVLSKLVFDMSAKTCLAVGASLAPTSMGISLKVLQDGGVL
FT                   GTPTGQLIIAAAVMDDVIALVLLSELEALKNPTPVNFIVPIVSSLCFIVFVGYLATRVV
FT                   PDVLVKQLVPRVPKKHLEGVLLGMVFVVAYGMMVTTHYGRSSHLLGAFLGGLCFCSLSS
FT                   MQTVWHQQVEKILSWLIRVFFACTIGFEVPIRDLWTGPVLARAAVFMIAAFGKVATGLF
FT                   ARPLTAVEASKIGFAMSAWGEFAFIVATASREAGTLGHQEFSAVILCVLLSAVYAPLCV
FT                   SQAIKAEKRGAGLGKDGKRSLALVNSGKRQWWCCGPKVMRREISFTTAAMPDGNKRAIY
FT                   RVYYVCAIECPSRWGLNDAVLRAVYNPLVDLDVLDVSLESRGNDVMACELFLKDPMLQA
FT                   PLDAEIECEENAAVNAKIVKIKEALEKLVLHRAPPRDGEKVGEYEGEVLLARWVPDIQE
FT                   PAPESEASSTVGGDTWRNGAENGGFDESFVLKQAHTLLYGREEDVDVELGAELGPELVN
FT                   GAAENGGDSGASSGPSSAAASPRPSATIVRRRRPPARRAIDALRAHKNRPFYRTASLAN
FT                   LLNAGETGMLQDDRDEELHARIVEARMETGEARAMASARSGGHGMGAVKRTTSVQQHAA
FT                   AAAADAAGRRVSAGEWSLLERINEDHHPERDRHVVLRRSIDGDDGSLILGSEGYPSANT
FT                   TMTADVARGLAAEIALQDVMLSSQTLSGAGGRALATELRHAIAARSPPRSPERRVSMGD
FT                   RHIRFNADVSPSRREGGGGAHSDGSDGIGSPVTSLTGAHARQLAAQLKEQLRAAEAMDP
FT                   AERSAALARSASSPPRSPPRRR"
FT   CDS_pept        complement(357657..358565)
FT                   /codon_start=1
FT                   /gene_family="HOG000229136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632490"
FT                   /orf_name="MICPUN_64056"
FT                   /product="Predicted protein"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO67419.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG716360"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniParc:UPI000199BFEE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH02"
FT                   /transl_table=1
FT                   /translation="MDAATSLEDPMRRVKERWRAVRDELRVGLIPRDDVDFAVDFADQT
FT                   PNPNPKQKRPLRLVAGLDVSYRREFIYDSTHRAETAVACLAVLRFPELTPEWVDFEEFT
FT                   VDAPYVPGFLAFRECPAMTTLLRRCPSGAKPDVVLVDGNGALHPEGFGLACHVGVECGV
FT                   PTVGVAKDLHAFDGLDAKSARAACDEIAARGGGGGSKGVSKGVSKANPGHGGYPALWPD
FT                   AVALVGASGTTHGAAMFGHEHSGDGAGCPIYVSGGHRVSLATAVAVARACRAPGRKTPE
FT                   PIRVADARSRARVRLLEGKAP"
FT   CDS_pept        join(complement(366674..374416),complement(359465..364189))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632491"
FT                   /gene_name="FLM"
FT                   /orf_name="MICPUN_104083"
FT                   /product="Filamin like protein"
FT                   /protein_id="ACO67420.1"
FT                   /db_xref="InterPro:IPR001298"
FT                   /db_xref="InterPro:IPR002859"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniParc:UPI000199D588"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH03"
FT                   /transl_table=1
FT                   /translation="MGARGPAGRPSIAELARSTLLAVLAVACAIPPGALATSHDDTDGP
FT                   QAVAVHENVRLVEGWSFREVDAIWGDYSPGGLSASFAVSTWAERLDRTLYANLTNADAT
FT                   SLEALPECADSSKFSTQHVNHTHVPSYVINTTLTCRPKPFGVGVTAGYAVETRYDAPSI
FT                   DVVVKVNNVNATVRMRSSDPRLGYPATAFLNEDETDGWIDAANTSGTGDDRDASGVALV
FT                   MDARNPTLVEIDVSGDGGTRATYWLLVTKNSSQFSCPGRNANPALVDGVDTTCLGKEST
FT                   VESVPAVVQIHQTTTLLVRGKDRAGKINAEGGEADGIEVKIQHYWETTDLHLNLVTNYG
FT                   METYGTAEDLGNGNYAIAFSPGKSGLFFFTVSFWGVQHTVERFRVEPKKALVVDYEVTS
FT                   PALDRVVDDPKLGAATVEEIVDFTVRSSDGLDHAFDDDAAITATIQYFGVGPESGGKTR
FT                   ADWLADEGWRDQHGFYHEPSPTPLVISRDDRIGERYFKFAKTQAGQYEIHVKLGAAPLG
FT                   DSPYTIHVKGGPAVNYVRANASSRVGLTTIVYEGETADRPSNSTDQLLPSSYKQGETDT
FT                   YEAGTKVQIDVDLRDKFGNVATIDTAHRELLVKFQDKNGNGGGGGDFIIAEVSRNFEGT
FT                   AAGFGYKAYATLTRATEYAVTAQIGGAQLCVSNSTCNATTCGDDPINFTAIDVCIHDAN
FT                   VTVAKASAEKSLLLGSGAVKDGRIVADTEVSLAVVPLDAYGNVITKDSSAYEFNVTRDS
FT                   DNHAEESKKPMTYDAAANDGTHTGTYKLTKSGVYTVGVTQTAPDGDMFHTVGGADGEFK
FT                   VTIVAGDPKLDNTQIAVAASSFAAGEDGSVDITLRDANDNDVEEDRTHDLVVKMIPSST
FT                   SSTSRTFASTDDSSASGTGGAVRIAWNRTSLKHVVSFNIPAAETYVVAAYLGGERVGGT
FT                   SASNARFTVTAGAPDASATSVVGAGLQTATAGTPASFHVVAADRYGNARTSAHATITPA
FT                   VHVSVTVPGSTFGACGAVDVVQSPTVVWNSARMRYDVSYTPTVSGTSSVRVTMGGMDVT
FT                   DSPFAGAVSPGAADAAKSLVYGAGVRGAVVNGAGRVTVRARDANGNYAVSGGDPFRAYV
FT                   VDASTGTGYADVTMTDNGDGTYSARWTPASTGTEYELNVLLRGTPVASSPYRGLKAVSA
FT                   AGAATPAMFEAAGDGLERAVAGERATFTIEAADADGVGLAVGGSDLTVTLTWTPVTGGA
FT                   SQTKTLAKKNAGDAGADDTDVVLDNGDGTYAVTYTVTAAVDHALDVREGVGSNAIGGAW
FT                   PKTVTVVAGATDASRSSVDQSTIPSTASAGDELVLRVHAADANGNAKCHDETGDGHDAF
FT                   VPAFTLDGVPVSNPDDVVSTPPTRNKTGGYYDFTVTPKAAGTYVFSASLNGVNVSGTST
FT                   VTVTEGTLDASSSTVDGAGLFGGLSGVKHFVRVVARDAHGNPITNETTTLADGDCSATL
FT                   TATAAAAASPNVTATCNLTDASTGTFNVTLLSYTAGSYKLDVELKGVAAGDSPYTKVSF
FT                   AAGGPVAKESTVEDVAANGADLTAVAGKETTFTLTARDEFGSARTVGGEVVSATLDRDP
FT                   PVFAAVRDNKNGTYSLTFVPPVTGTNQSFSVMIGTSHVKNSPFNLTATHANTSAALTYA
FT                   VKNAASGRCPDEKAETGSYAACGVANAICGVAGADNVFIIKPMNEHGVPQDFESVTDAF
FT                   DVVISPSGNSFGNVSDGSFPGEAVATKTTCGYEVKWRADRVRYKIDGTVAPYELNVTLG
FT                   GAHVQGSPFKLVAAPARAAAKGTIVFHTNSGVMGYDSSRMRDNTFVAGEAQKLVVQTRD
FT                   IYRNDAKYDPYAAPQVTVTARLNATRGHIDQNRGEEISVRVTNMLNGLYRLSFTPIKAG
FT                   PYELWVTVNGEVVGEDKVPLPVVVQPAALSPRHFAVWGPGITEPAIVSQPNYFRVQVRD
FT                   RFGNNIVHDGSLLVPVRRGCQPYYQHYYEIEDCKGYEIGVKLDVRVGEIFDATSAIVAA
FT                   EETTVEFIPDGPDLSGHGTLAGSSSILNATNNHTNGTYLVNYTVGKIGFILATVDVERV
FT                   VESKYPNDGRTLWHSEYYNVTDSPHPARAVRGFMVSGSMSGFGTEDGAAARVELPVIIT
FT                   PRDSRGNHAALRPGDASRYSLSVSPTHRAEVTTQPAPDGVGNLVASWTGKSPGDVTVSV
FT                   KLDGVDVPGSPKTVNILVNPLYMNINPLLSRASGPALTGSYAGQKTGYTIELVTDSGAG
FT                   FPASADYEWNGVDPCVVGSAARGFVQVKLDKEPLGAGPAGDASILDNCNGSYSVSLTQT
FT                   KAGTRLFQTLIGPEEDNPNFKAGVPRGIGPVVSASGVVDAGLVDVVVYSGPTATAVVEW
FT                   LGHAKAGNGYVGDKIEVMIYPEDAYGNRIDYHVFPRDGLGVAVDVNAVGTDAFTLTRLT
FT                   DTSRPGPATYHFYGEYVPTEAGKYTFTVHFNAQDGTYETVGKPQTMDIAASTASVETSV
FT                   VSGDGVAKAKTGVLSWFRVELFDRGGNAAGRGEYIAPQDKPSLPQHPRPGEVPTIVEAR
FT                   LVPFGKEYAQGRVASVHYDEEHDVYIGSYNATESGRSSLVVLLYGQQIKMGTDYLGTDL
FT                   VATLGGVEIAATDGVVVKVRHAEVFALATTFNPTLDVCKYMGVGGEIFEFIVEARDAFG
FT                   NLHDDGDERFTLSVTAQPADAVTIKSPAVVANPNGTYTATFTPYTSGDYSLKVTHEGSG
FT                   LTLLNDFKIAVASGKADKDRVTLGGAGGFHGGKAGVAQSFTVYVRDAYDNPVASNPADG
FT                   IAMPVYSDESLATKITECELTETPGEVGQLTATYTITDTGTYWIGATLRGALIAAAPFK
FT                   LEIAPAEAPEITSATVSSSLMRIDAAFDVATDRGAGANVANDVGCARYLAADSVVDVGS
FT                   GAECVWADAKTLSIYFGVNATIRPGDFISLAQNVIKSADGNSHGASGSYVVNAPAVPTP
FT                   PEARLSVPDKIGPCDGVVLDASQSRGGGGRPMEFRYSVVATATDGSAVADALGAAVSAA
FT                   AAARGGVTNPVIVLESAHLEPGVSYTFTVRATDFTGGTSTASATVTKSVYPMPISKISS
FT                   GRTYTATRSHAVTIEGDVQLPSVACDAIAATEVGDGIDYRWSIVEGPILVEENFQSAHH
FT                   FDVHARTLTTRSLYIPPRTLEPNAVYKWRLRSSLRVNPRAFFSDQIVTVRVSSSPIVPN
FT                   LLTGDHRTVFADAPLALEVAPEDPDDARDTQGAAFPFTYVWSCKLLTPSSGAGPDRIDS
FT                   ESCDLPPDKTPGSYHLSEPRVVFPPGALTPGRTYEFSVRVAREPVAGGRKVDVPMRVTV
FT                   IERPNATVTTTVTTAQNTTTARNGSNPPALRVVGTPTGVWSASRRLNLYAYVDDCPEPD
FT                   PATCAVAWSCVEGDLSATGALAAAALTGVNGSVLSIDRGTLTEGMSYTFRASGVGGGGA
FT                   ANLTADVNVNVNAAPRGGTLEVAPIADADAGPFADIGVGKFLARAVGFADDPDHYPLTY
FT                   EFFKKKNVTVDVTDANSSSVTARDPLGGTQTANNIVVILGPGWHEIEVRVTDRHGAAAV
FT                   ATATVTVAPAPVPSPPPPPPMPPPEFQGRRRLLAGVEADAGDETYYLSHQPPYTRGYNA
FT                   TTAARFFELMVAPSVAIGAHSQIVQAADAYARTFAVEPSGVLPGVLPAAGIDPATSNAC
FT                   GDEDPDALDVARVHARVAAALAAARDATPRTNAGVNQLWCASAILSTDPRLVRAGVGRD
FT                   LMHALVADARELALSSRDKSRDGPVADPDSGVLRCAVELASNLLAARVGGCDLRFDEIS
FT                   EAAAASAVDDVVSAIGVALVPGAVATTADARHVSLAVAAADPSTGVGFPLVAAINSRGK
FT                   SFAKASLDADASKVGPSGYNGTRGNSIVAVTHYRAGDGIAPSLAKEVIAPRLVSNYTHV
FT                   TFQHVANLSETDTARSVVKAITITLGYDEASRSSELNAGRHPEVRIYDHALALATLNAN
FT                   ATDSLGNKLAKYPGWTDRGASWSSAVARTAAEDESADSTYAVFEGLESNRLMLGVVMVN
FT                   TNAPPPPQPPPPPSPPPPIPPSPMPPPAPEPEPEDHTAWIISGVVIGVWCLLSYAGYYY
FT                   YVNYYSKRDWSAEYKAYIARKKHAQRMKEYFKKEKEVKEKMSMIDAFKREQNRRKVLRW
FT                   AKVNMGALRDRLRRGPPRVAPAPGGRLPRRPPAKLALPY"
FT   CDS_pept        374919..377870
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632492"
FT                   /orf_name="MICPUN_64058"
FT                   /product="Endonuclease/exonuclease/phosphatase "
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67213.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199BFEF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH04"
FT                   /transl_table=1
FT                   /translation="MSSDELRSWVVALHAPRAVHKFRLKAWAGFLRERGCVVVVPAKDL
FT                   RRRATHVLLVDPPCAEEDDPRFAAYLASMPASCVAGAGGGTPPTILRQEWMYDSIRQKR
FT                   ALPTGPYALGSAATRTPLADVQPAPRASNPRTRAHPNDDDASAKPPAVPPAPTRGDDGW
FT                   GGEILRAANDARDETRRLTFAAAGEPGQGVGGVEAGTLRGCLAAECDAAASSAASHAPW
FT                   EGASTRGDFARFRREGYPGFVGATNVVEDEIERRLGARWDAREAERVAGEDAAWAAAAA
FT                   AKAGTRARARAGVGSGPEESSRPGGFGRRTLLLDLPDGVLGEVMERLCLRDALNAGATC
FT                   RRLLDVAFGRRVRRRRQRRRREGGIGHENAGDGDDDAEFVLGGSARDPPPWPDRSGGVR
FT                   QHACLRVMTWNLKNNDPDPAARFANQPGANERGGGWHWHVRCPIVARSVQRDAPHVLCL
FT                   QEDLGCMASELMCAREMREEGYDATEYRCYPPPVRSLRDADAAARARRVLLSPSETDPL
FT                   CAGDAIDETIANALREGARWEQNSVWWRDDAFEAMDAGQFEWLDGRTRARFRGLSVLGT
FT                   VPGTVPRSEHGGVPGSVVTFTWVLLRLKGDERGCGMAKGVTRSIDKRIVACSTHVEAGH
FT                   DWNDDVPAKRNSAICVRACVRRIQDLHGRDVPIVVGGDFNMQKIQQHYRLLTGAGAGIS
FT                   RGLSNVSGNLSSGTANRATGKGGGGGGGGGGSPADAPDASPPRKQREWDLDEERADRAS
FT                   ELVDVFDCLDADNPIARFDRKHRGVRSGGHAGTTWHGWEGPAHAEMISNTIAKHCKHNA
FT                   QLGWWDPGELGDGPGDGGFHSFKRRRGWGRDDQPGVGGGHGGAVGGARGGGSTARVLGA
FT                   VGHQRHIDHVFVARGDGVRDDTRADVQCRARCVRAYVRVDTNSETFRRRGESRCACGAY
FT                   AVGGPMSETCACHDVDGVWASDHFPVVADLRLSWSADEGEPVRRFRSRRPHTP"
FT   CDS_pept        complement(377964..378602)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632493"
FT                   /orf_name="MICPUN_64059"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67421.1"
FT                   /db_xref="UniParc:UPI000199BFF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH05"
FT                   /transl_table=1
FT                   /translation="MALRASARRLSRLVSGRCAGGTGRSLSGGPTPSSSGGGGGGPVKP
FT                   AKGAADPAAPSVNKNPAAGAAEPANPLAVSMFPWERAVLSDGRQDGPMKPWQKLYWAAF
FT                   GAAVLFLAGNRARVYYQSVKSKEELEADLRENRRAMQAALEGKSFADGDDPFEGMEPHE
FT                   IEALLRQNAPDGDPYAGMAPDEINAYLAKQQEEQVGKHLSMPRNIPRPR"
FT   CDS_pept        join(378735..378814,378944..381848)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632494"
FT                   /gene_name="CUPA2"
FT                   /orf_name="MICPUN_64060"
FT                   /product="Putative uncharacterized protein CUPA2 "
FT                   /protein_id="ACO67214.1"
FT                   /db_xref="UniParc:UPI000199BFF1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH06"
FT                   /transl_table=1
FT                   /translation="MAPKVNFALAQKRSADRRLLHYDVDTRNVIVAGTGRPFPLDVSHA
FT                   AIGKHSEGLALYFETIKFFLYLMLALLVCCGIQPLAHSSANNNLSTDYTVNVQSNTQAR
FT                   AQVCARETQPSAILGTSIGATCNDPLTASYYSCPTLCDVYMDTSQDLATLGDLCAAHLP
FT                   CTNSALTSAEKATCCVERLMPELAKENMPGANLACGLFVSVVVLLLWTAFYHKEQLKNA
FT                   QRINRNAVTVGDYAVLVQGLGVNQLTRRQVAEFMSHYGEVASVSFTKNVGNLLKAEQDL
FT                   SEARVKLAELKAWNEHGKGGGDGGGRPGASFRAMFLQSTDYSDAAVAKAEATFVRLLKS
FT                   VDQLARLPVVNNGEAFVTMNYEAHANNAFIDHRRGWGELALDYLFGCFGFVWGAPRLNG
FT                   RRLTMSVPPEPDDVNWENVNIRGQAWYERSVKAWLALGAGLGIGAGIQIVFEQLREDAR
FT                   ADVMDDEIRAAALGENPSGDDGSIGALTAFSGFMIVAINVSLQYLAKVLTKFQRFHTRT
FT                   HFEASLMVKIFIVTVVNTAIVPITASRCDRTKSTQGECLWYAPGGLIESAFYLQLFNAF
FT                   LPDLIAYLDFTGKSRQSMAKHAKTQDMAERALEPDEFILAEKYAATLKTVALAVIYGPV
FT                   LPISYLIAFFGLCVTYCSDKYIALRRARKPVRMKTMHSLYVVMSMRVLALTQLFIAFDL
FT                   WFGEEKKAADWFIGALIIWILWILFLPLIKACIGIERDEAFEDGGTGGVSYHTNMGKGA
FT                   GANAAPPLPPRPEEDGESELSKQEKLIKCDLLGIKLEDFDKGRLDMYHPPLPANASEGT
FT                   IKNLVAEYRLFDEPTKGDPTLMPGQKPRTGGFNVNPPGTMPRPQGNMFAWMGFGGGGSG
FT                   WFTPAQQGQPTHQVQPQPGTAPATGYGPPPPGQMVRMMPPPGAPPGARVVYVQPPPGAP
FT                   APFPGQYPAPPGAPPPAGYPAPPPGPAQAGMFPAPGQMMMQAAQRRMPAMFGTGQPTIQ
FT                   QHPPR"
FT   CDS_pept        complement(381917..383725)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632495"
FT                   /orf_name="MICPUN_113309"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67422.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199BFF2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH07"
FT                   /transl_table=1
FT                   /translation="MDAMVRGGSGDGTPSIADVSDDVLVTVFLKMDPIDLGSCLRTCKS
FT                   WRRLICDGALDNAYWWNKARADLLEDLLDEDGKLPLHGRRVCDVVAPRWLRRRETYALL
FT                   DGCKAEVVASARGDNGEGRKPLVPLRLREWVKTPYPRWLEQPARVDNEDIALFYRASMR
FT                   EIREQRPTNAHVTDFVEVEWLADLAVMMGERRAMATFAEAMNDPDFHVRSHARCVELVE
FT                   RCAAAVSGLIDPYLAGRHQRMWGPTPPSHVSSHVENPGALHPSEKWLWVMREDFRSFGS
FT                   DLRHKKPSLPEESVVDALDRMGEEFKRRLDSSRVDPRDDPKGALRVLTEFMCGVYPGLD
FT                   APGDNPGSTHVADMDFREMPPATHELNPHLLHPKFAMPTEGGLGFRGAGSTVTHDYYDP
FT                   MCSSLFCVLHTRVGIPITLSIVMASVASRAGLKVEFLNAPGHFRCGVHDENYVDPEKPG
FT                   TNARHVVFTADPFEGFEATDPRKLRTIDWDRMGEEAGRGRVAELVPSARDVVMRMLNNL
FT                   FLIYGTMECGGSGSPDGPDLETYPNDEEYVPNYVGLPPHRWMVRHAVVALAGLVVSPGP
FT                   HAEFLQQELAHLKLKWLPMSAHRLFM"
FT   CDS_pept        join(384067..384135,384372..386909)
FT                   /codon_start=1
FT                   /gene_family="HOG000261467" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632496"
FT                   /gene_name="FAP189"
FT                   /orf_name="MICPUN_64062"
FT                   /product="Flagellar associated protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67215.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG719254"
FT                   /db_xref="UniParc:UPI000199C094"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH08"
FT                   /transl_table=1
FT                   /translation="MSETASGRASPTIGDRLTDDFNKVIAELENDPAMAKFKEEYEKVF
FT                   SALVNSNDSEKRLVQKCRDLNAEIVANAAKVQSALKLADEDQGTIDKLKGEVEKAWKMV
FT                   DASKEKETRAKENVQALKKEVADLSKAAAQGGSGGAKQQEQLKDMMRQRDELAAERDEQ
FT                   VNQIVMLREEVMEVTEQLRAAEAEKLRMENELQILRDDAASARAATDKETKRKEKMERD
FT                   MKELKELLEEKTYEIKQKQHSLKEGDEAVKRLEKLLKDQQGATSRAQKDYNGLSDKLTK
FT                   LQRDLSDAVQNNANLAQSNANAQIELKAKDDEINLAKLEAGRIDKAKDAALGKLRAAEA
FT                   AKEEVEKNRDDLKRTIADLERDIDAMRKQGELEKKKQEELMRERDVLTKLKSQADSATQ
FT                   KQADLVRITENNKKTLEQEIAGYRSEASKQAKAIFGLEQEREKFANEASATTAKFLEAL
FT                   EEVKMREMAIVDLQKSIADGNAKLKAQQSMYEAVRTDRNMYSKNLLEAQDEIAEMKRKF
FT                   KIMNHQIEQLKEEISTKDLALVKEHFDHMKVEKEKESLRFELNKAAMNIKEAESSIESQ
FT                   KLELQRLNQIINESDAAIGKQEKELAGVVNDRDILGTQLIRRNDELALLYEKIKIQASI
FT                   LAKGQIQYQDRLNELRVLKIKLGDLKRELGVLKHSVGSIDVLKREVHRLGKELLQERTK
FT                   TKALTEELENPLNVHRWRKLEGSDPTAYEMIQKIQALQKRLIAKTEEVVEKDLLVREKE
FT                   KLYKELKAILARQPGPEVAEQVSVYQRQLREKTRQMKAMASELNMYQAQSSEYKYEVDK
FT                   LTRDLGDVKKKYFDHKRRQEAELRGADRENAGGKRQTAQATARGGARFTGGGFGLN"
FT   CDS_pept        join(complement(387545..387961),complement(387094..387321))
FT                   /codon_start=1
FT                   /gene_family="HOG000242325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632497"
FT                   /orf_name="MICPUN_64063"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO67423.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI000199C095"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH09"
FT                   /transl_table=1
FT                   /translation="MALRQAARRLGALAGSSPQVTRAFAVGSQRATMSTEAQRESVKEF
FT                   LDKFKQHAPSTMDPPSFPSDFLPPAREVPATPPAKLTLNFYMPHEIEYEGAEVDSIQLP
FT                   AVTGDMGVLPGHVPTVAQLRPGVVAVNMDDKETKKYFVSSGFAFVHANSVTDVMAVEAV
FT                   PVEQLDGEAVKKALADYQAKLVNAKDDYEKAAAQIGIEVTQAMESAVTGKA"
FT   CDS_pept        join(complement(389755..389799),complement(388197..389573))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632498"
FT                   /orf_name="MICPUN_64064"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67424.1"
FT                   /db_xref="InterPro:IPR012446"
FT                   /db_xref="UniParc:UPI000199C096"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH10"
FT                   /transl_table=1
FT                   /translation="MPYNNAGELASEVAQTFLGALDTSLTRTWREEERRWRGEDREWRA
FT                   QDMEFRVEERDWWHLEHLWRQENRKWRREDIEQRILENARWVWLRHAEKNRRDVEEKSE
FT                   QLKSISNLSALIGGFAVVAFVELQFSDPNETPERNEGLIVAYAATTALVVALMLNSMVL
FT                   CSFMLCSILRNGKTYVSDEEEADYLFRCRRFAHEFKLGDAPPRPHRSFERHWETRCEDD
FT                   WRHAFRMFTCGVPVFLVNVSCMSWLKFHYSPLASWTVTAIAAVASLGWLHTQNNWGFHI
FT                   AKSQAGVGRDGVGATSVGAATHTPAGMPFDWHYRENGAGGGARGAESSRADAQRGTGGA
FT                   RSRGPRGGTGAGRAGGAGTAEEVVDVVVENGSAPSSPPPPPPPPPPAVRTTRAVDLGAD
FT                   DAGVTEGAFTRRTSPRARDLAAGAKAGAGGGEAVGRNLSSGGTGGGGDGEEEDAGDPFE
FT                   DAAAELMRRAGDREA"
FT   CDS_pept        complement(<390230..>391411)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632499"
FT                   /orf_name="MICPUN_67619"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67425.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C097"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH11"
FT                   /transl_table=1
FT                   /translation="AEVGRLGALRTMNLGVNQLTSLPAEIGQLTSLRELGLEGNELTSV
FT                   PAEIGQLTALVELKLEDNMLTELPAEIGQLKSLVELKLEGNELTSMPAEIGQLASLVVS
FT                   NLNYNQLTELPAEIGQLKSLRELNLSNNHLTILPAEIGQLTSLVELKLEGNELTSVPAE
FT                   IGQLASLVELKLEDNMLTELPAEIGQLKSLVELKLEGNELTSMPAEIGQLTSLVVSNLN
FT                   YNQLTELPAEIGQLKSLRELNLSNNQLTSLPAEIGQLKSLVELKLEDNMLTELPAEIGQ
FT                   LKSLVELNLYNNRLTSVPAEIGQLTSLVELKLEDNMLTELPAEIGQLKSLRELKLWNNR
FT                   LTSVPAEIGQLTSLTELDLRCNELTSVPAEIGQLTSLTELVLHKNQLTSLPAEI"
FT   CDS_pept        393506..393997
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632500"
FT                   /orf_name="MICPUN_109473"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67216.1"
FT                   /db_xref="InterPro:IPR007608"
FT                   /db_xref="UniParc:UPI000199C098"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH12"
FT                   /transl_table=1
FT                   /translation="MPHLGTSLPRPIERGKGPSGNSPTDSAHETFDPSRVHGGISTALN
FT                   HPNVHGVSLQVPASMPGHEPGFVPPHIYASTYSHHAGGGLMDAHQHDPMRGFGYGGAGT
FT                   GSMIDGRGHTLKGRAALKARNAFMRQTGFLEPDTPSALSQQPPDRIATPAIVVDANGAE
FT                   "
FT   CDS_pept        <394738..>395802
FT                   /codon_start=1
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632501"
FT                   /orf_name="MICPUN_69676"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO67217.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000199C099"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH13"
FT                   /transl_table=1
FT                   /translation="GGNVRVAVRCRPFNAREKQLGSPCVLRMADKTTTIVNPVTGDEKT
FT                   FTFDYSFWSHDPSSTDPPFASQQDVFDSVGADVLENAWRGYNVCLFAYGQTGSGKSYSM
FT                   VGCGDAATEGIVPKACREIFARLDKTRGQKAQVEVTMIEIYNERVRDLLDVATNANPFE
FT                   TSEAAGLKVRTHPTVGSYVEGLTPCAVRDYDEVEALMARGAAARTVAATNMNAGSSRAH
FT                   TIVELRVRRWESDGVEVSSRISLVDLAGSERSDAAGSSGTRLKEGAAINKSLSALGNCI
FT                   AALAERSSGKGSSTKQIPYRDSTLTLLLKDSLGGNSRTVMIAALSPAAVNYEETLSTLR
FT                   YADRARHIVSSAVVN"
FT   CDS_pept        complement(398260..399234)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632502"
FT                   /orf_name="MICPUN_109474"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67426.1"
FT                   /db_xref="HOGENOM:HBG608802"
FT                   /db_xref="UniParc:UPI000199C09A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH14"
FT                   /transl_table=1
FT                   /translation="MLRAAALRALSGALASTSARSGAMRSFATCGASRATGGRPGDDDG
FT                   HDPFGDCTSSGWEGTEGADADADAAGGSTARTHPTTHDDGWEANFEDLMAMEDSYGSGV
FT                   EDLSTAAMEMANARMAEQKRLQEEMRRLRGIQPGDRVRVRVRHGAPYPDPIKRYHYTSP
FT                   FGGAGLGHDPSARGKGATAADADDNHDAPGGGDDEGGQRESSKGIASKGDAATGTTTKG
FT                   DAARRWKIVVEIGYVVCTRGDRVGVKRNGHPEDTETSFPTYPKSWVEVLNVGEMWDIKT
FT                   GPRNLGAFASEEDYAQAQAAWAEATNFGNDAGAPSGRAKAAER"
FT   CDS_pept        399366..400709
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632503"
FT                   /orf_name="MICPUN_64069"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67218.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000199C09B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH15"
FT                   /transl_table=1
FT                   /translation="MERQRGTFLTNDGVRLAYEYAGVGFGKANTGDSPIVLVHGWSGSM
FT                   HYFDNSFSHILAGRNRPPMVVRYDLRGHGESEKPSFGYMISRFAADLRDLLDHLELDNV
FT                   TLVGTSMGCAIIWSYLALFGEGRVKCGVFVDQAPLQNRAPDWELGSRGCYDIASLTRLQ
FT                   ELLKYDYVGFAKGNARSCLSTEIDPAHERLLIAETLKAHPEGLGQIMADHTAIDWRPYL
FT                   RRVRVPCLVLAGGRSQIFPLEGVKECGRLIAASTVVVFEREDHWLYVEDFLRFAELVCD
FT                   FACHGELTEGDGAPPRVPDPEPIRAGRSSRPGTGASVDSRFVQDMLDLAVADPATYTAT
FT                   RSPSSRPPTNGSPRVSNMGPRVAGRAATPRGLPGTYKKPELSTLDTLALEAELEKRRRA
FT                   AGGSSGGGGGSRPTTGGSQRSMPLDQQNAAAIDPVAEGLPGSKMPAAP"
FT   CDS_pept        complement(402525..403844)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632504"
FT                   /orf_name="MICPUN_64071"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67427.1"
FT                   /db_xref="UniParc:UPI000199C09C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH16"
FT                   /transl_table=1
FT                   /translation="MSSKSAAKTRTMVLDTHDANMFVTGDKPALPAPRSSRGSQSVTVN
FT                   STARSSRAASTRARAPPPKYAASLTGLPSEGGVTRKVGEQSNRDWAIMSRFEMEVYARQ
FT                   QAEIKAQERRAVVAQRRELDQQMSLIERKKQRAKEEKAAMAATVAADVERFKREEEAKR
FT                   ERQRSANEAVRAEQSAIMAAVESRRLEAEAAKRAEEEAALVEITRQLEQERLEKAAKVE
FT                   KLKKDAAVTMAFNREQDAIKARALRAEAEEDARKQAEYDALLEAQERQRAAALEEFHAK
FT                   IAARAGKAGEAATAAREIKEREERDRNLRIQREKDAAQAQKDALAAAKRREATSAQLEM
FT                   LELQLAMKAEERQRRREEGERFARETANQIAAAESADRAAAAERRAKAVANRLALEAQM
FT                   TEKSERAKLAHDDFMDETELRMNTAILTQARAVVLNGEEF"
FT   CDS_pept        404226..404576
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632505"
FT                   /orf_name="MICPUN_64072"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67219.1"
FT                   /db_xref="UniParc:UPI000199C09D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH17"
FT                   /transl_table=1
FT                   /translation="MGKSRRRSKKGDDEPMTVAAPSGGGDDGGWLTGSAITAMAEDTEG
FT                   ADANANAAAPTQHRALTAGLAKLKKRTVLRGVTKRKNKAIARGIAHADRKEVKAKKKVA
FT                   RRGLRLEGKQLY"
FT   CDS_pept        join(complement(406558..406590),complement(404654..406438))
FT                   /codon_start=1
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632506"
FT                   /orf_name="MICPUN_64073"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO67428.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniParc:UPI000199C09E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH18"
FT                   /transl_table=1
FT                   /translation="MSLQSVKDKSKETARRAEDRKRSVLVLARRFLLENNMPDSARALE
FT                   REGGVSSTTFDAADNASLPGVIAEWETVHEERFGFRPKMTRGCDDTKPGTSAAALAAAR
FT                   GKAGAKAGAERRAARIAAEREASRVTHYASTSDESRHRAVDGGDASSSSASAATGDVLP
FT                   PDFDLPPGHPLLRRYATDGVAKPVGGTTLSDAMDYVKKVDAVRRGEPPPAGTEHLGREH
FT                   SESRLAPGGYRGFMNGGAGGHGQRRRENGDENGDEDDANDANDESDGEAWEERQRVLKP
FT                   PPSFSGSVELRDLARTISRDIYTSNPDVRFRDVSGLDEAKRLLREAVVMPVKFPQFFHG
FT                   LLRPWRGILLYGPPGTGKTMLAKAVATECGTTFFNISASSVVSKWRGDSEKLVRVLFEL
FT                   ARHHAPSTIFMDELDAVMSSRDGGGVHSGGGDHESSRRLKTELLVQLDGLNRDEGELVF
FT                   LLAATNLPWELDPAMLRRLEKRILVGLPSEAARARMMERYLAPHAVAADVSLRDLAAGT
FT                   DGYSGADVMLLCKESAMRPLRRLMDRLMTTEDSDEPSVASTDDDGAEVSVGEITRDDVA
FT                   GALAATRPTQTDAHARRYEEWTRSFGAVL"
FT   CDS_pept        406817..407716
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632507"
FT                   /orf_name="MICPUN_64074"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67220.1"
FT                   /db_xref="UniParc:UPI000199C09F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH19"
FT                   /transl_table=1
FT                   /translation="MAEEDPAPPADGDAAPTPPPPRPPLTPEILAAFYENLDANPDPDV
FT                   AADALAEALELRDRTTDARVGSRVDFIFNALDFARDAGLTPAQTVAVHEVGQAMLDACA
FT                   VEPGPSFVFADAESLFQSTILPKVAAEPDREGGQFSVTDVRAVSDYFAKGFFQHFSLWR
FT                   FVWSEEQEMDKHETFKRVEVAFPARPLPDFLTEQANEERLAKEAEEAEAARVAAEEAAK
FT                   EAEEAERLRLIEEEDAKRKAEEEEYARRKPATLADAVEHAVKTALAQERAALEAEYAVR
FT                   EKQLREKISVLEQQMKAK"
FT   CDS_pept        complement(<409225..410298)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632508"
FT                   /orf_name="MICPUN_88011"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67429.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199C0A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH20"
FT                   /transl_table=1
FT                   /translation="MHGVEITPELIRELQLDRDSERDDPNAPPPVKLDVLECLGRTETP
FT                   LFAALERCRVAARSVGERPSVELGEEWDEFLRGCAFSLDDKVVVVTGASRGIGESIAVR
FT                   LAQRGANVALLATSWTPNSTLPGTIGEAWERCRKVRKDEDCVIGVRCDITDPGQVDFAL
FT                   NQIVKKWGRVDVVINNASTHWPKTVAETDRRRYDKMMNVNVKGAFNVTTACMPWLRLAH
FT                   NAHVLTIAPAPLPDNAWLEPHACYTASKVGMSLLSIALEARWRDAGVAFNTLWPRHAVA
FT                   TAATSFIGGDRLVRASRTPAIVADAAFRIVVSPANFLSGRAFSDRDVLRSCGITDFAPY
FT                   NVDPDLSHEPVSDFFVAQ"
FT   CDS_pept        410539..410880
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632509"
FT                   /orf_name="MICPUN_64076"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67221.1"
FT                   /db_xref="UniParc:UPI000199C0A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH21"
FT                   /transl_table=1
FT                   /translation="MVNERDGTIIAYLEERLRSLQLENDALKSAKDENETLKARLASTE
FT                   EKDSLRGRREEQEMMAYQRWEAALSPDPVRTRIADTDRLIRRMIKERRTGGEILEAVHD
FT                   FFFDNAGCD"
FT   CDS_pept        complement(410948..412834)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632510"
FT                   /orf_name="MICPUN_64077"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO67430.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199C0A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH22"
FT                   /transl_table=1
FT                   /translation="MGDARGDDRDRRRRRSRSRGRDGDDRDGRDKESSRSRARTRSKKI
FT                   EGASRSRSKERRKGGGRDRERDKDRRRRRGRSDSREKKRRRRRRRSSSSSSSSSSSSSS
FT                   SSSSSSSSSADARRRRKDASNDDKTREETRAKLLATVTALDAKVGDLPGTKHSHQAPTD
FT                   PNNPPLVDDGKAGYIVSADGSHMTFFGGRGGSEGAGFGLRGTAGGDAADAVREEAKGKR
FT                   GMNAAMVDALLLHNKVRWRDDTKPARRVHIGNVNAGVKAEEFARVLETRIRTLSPEAVP
FT                   WHYPLDKRGRVDERRAPGTRVIEHLYLNDKGFGFLETTALEDVPAILALNGVRVNGGVT
FT                   RFRRPKDYDPDNNPLVRDGSYRDVFQRVFTAVLSDEVVDSPTKVFVGGVEPRALTKLDL
FT                   LEIVSSFGALTAFRCETDGAGLCRGFAWMEYAEGESVAAKAVAGLSGYQLRGKPIAAAL
FT                   ATPRAEAARTRGERRYTYEVPPEVEPLLKPPQRVLAFSNVLVRGGSREDRAAATEDTLA
FT                   ECDGFGNVLSTHVVDGGAEGAEGAEELDAVRDCLFVEFARVETATIAAHAFHRREYDGR
FT                   VVECRFFPLTEYQRMFGKGFPPRTVEEKQAAALKMMDYLAGTAGSGTGRLAA"
FT   CDS_pept        413164..413640
FT                   /codon_start=1
FT                   /gene_family="HOG000195281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632511"
FT                   /orf_name="MICPUN_64078"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO67222.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG592325"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniParc:UPI000199C0A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH23"
FT                   /transl_table=1
FT                   /translation="MAGPAGCYQKAVEEDDVTALKFGDLDRGDKFNGCLSMDEVRIIQE
FT                   SKINDDENDGVETSTTQTRTFQKTLEYTRRFSTVRTPEQTQMLRELYDEQTTAATNMHE
FT                   FERAAFSNLQPQDAHEALTLIPSLGAKNEAGEDRFTEGQISSIVEQSANIRKFD"
FT   CDS_pept        join(complement(415191..415335),complement(413843..415047))
FT                   /codon_start=1
FT                   /gene_family="HOG000238447" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632512"
FT                   /orf_name="MICPUN_92425"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67431.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG591526"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniParc:UPI000199C141"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH24"
FT                   /transl_table=1
FT                   /translation="MTRSRILATLVALLALAGTASARIQVEPVERDGRDLIPIAMDFGF
FT                   EQGGSIEISIKHPVHLFTVEGADPVDKTRYGFFITASKADTALENDIAKGGCLLDDLDH
FT                   TLVLFTFEDMQSHLSKDGDEYKFSYTIAEGKAGEYSLYYTKCVPNSAVSFTITVDLYNT
FT                   LPNGDKDYLSAGEKPLPTMYMFAFFTFAAAAVVWAWVLFNAKQTQPGSVKRIHWLMLLL
FT                   VCVKSLSVLSKSFMYHVIRVHGDPDGWNVAFYIFSAAKGLMFFTIVVLIGTGWSFLKPF
FT                   LNEREKQMLMLVIPLQVFANIAADIVDADGPALAGWLEWRDLFHLLDIVCCCAILFPIV
FT                   WSIKHLREAAMTDGKKVRNMNKLILFRQFYVMVVAYIYFTRIIVFLLKSTAAYNLTWLA
FT                   DFAAEAATLAFYLTTGYMFRPVVDNPYLHLNEDELDLEEIEMRVEEGRSL"
FT   CDS_pept        join(415456..415557,415696..416391)
FT                   /codon_start=1
FT                   /gene_family="HOG000196008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632513"
FT                   /orf_name="MICPUN_106499"
FT                   /product="Predicted protein"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="proteasome regulatory particle "
FT                   /protein_id="ACO67223.1"
FT                   /db_xref="GO:0005838"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG677040"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="InterPro:IPR019280"
FT                   /db_xref="UniParc:UPI000199C142"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH25"
FT                   /transl_table=1
FT                   /translation="MADLASAKKTLDGLVKAYAAGDATKTASLLGTLKVAITAFPALPP
FT                   LFEQTPTAVEELMLARDVLEHATLFAVSQQDDAAAERNFNQLRPYYSDCAGMIPPSPRQ
FT                   ALLTGLNLLRLLVQNRIAEFHTELELIPNEAHDDRHVAFCLDLESSLMEGAYNKIFAAS
FT                   GSIPTPDYAHFMTMLNATVRDEIAACVERGYTRLGVKDAARLLDVDAGGMDALAAERGW
FT                   ARSTDGGAFVFREEAAPPSAKDIPSMRLINQTLLYAKELERIV"
FT   CDS_pept        complement(416529..418025)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632514"
FT                   /orf_name="MICPUN_64081"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67432.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199C143"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH26"
FT                   /transl_table=1
FT                   /translation="MAALNIRSLAGAVQPSRGGKRAASPNGSHKRRAENSEDDDFIPCD
FT                   DEARGTPKGASAGASNTRPRRKAVAPKRLSPTFGGARSYSKEEPEDEEDPEDEEEPEHD
FT                   EDAECLYCGESEFPEGDDFILCDMCNKGGHVRACVGLSEVPTGSWYCSDDCLHKSVAIP
FT                   SLKYRSANSQSATVPGLKYIRFYKQTGRYGASIKVAKGHRKGLGGFDTVPEAVAAYNEV
FT                   AVDHGIATQQVPSEYVVSPEPKPEPDPEPELEPELEPELEPELEPELEPELEPELEPEL
FT                   EPDPEPDPVPDPEPEPEPDPEPKLPAGYVAVDVSSLDCTVRFGPMSCPFCDKAYKGVRG
FT                   VKRHLTSCQAAIDAGLDKAAVPEGFVVAKVAADGSTGFLVPEGFVVAKVAADDCTGLKR
FT                   KANEAGFEEIPARRVSTRRAPAPLILAKPELATDGDKGERRVVTSAADVGDAEELRMLR
FT                   ERLAAQERRNREMREINLLAFELTKRVMAMSAEGDGGATR"
FT   CDS_pept        complement(418197..418757)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632515"
FT                   /orf_name="MICPUN_64082"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67433.1"
FT                   /db_xref="UniParc:UPI000199C144"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH27"
FT                   /transl_table=1
FT                   /translation="MAAPDEPTPLVEVPIVDDSFDDSRSRSVSEEERRRRCAAFAALNE
FT                   TFVLGTTTTRRDSHDALEAPARGQVFAAAAAVDTPAAVARGPREGTSTPPVRDTTPRAA
FT                   EDSPNDDSAHDDADAPKPAFTKSEVAGIVAMLGFLDASQQSIVHGIMRREHADEPPEDL
FT                   MKLSPNALACVDEYVRELLLLPS"
FT   CDS_pept        join(418938..419038,419113..420439)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632516"
FT                   /orf_name="MICPUN_64083"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67224.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199C145"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH28"
FT                   /transl_table=1
FT                   /translation="MPPKRKRRGSAGGDAVVLPRTPGLRSDLECTVCGKPATMSCGGCA
FT                   GFYYCDRAHQEMHWSYFDHHESCERTKKQVARTQELREDIFSAFDWGRLSTEMIDENVH
FT                   TRCTLLEKLGVHNANEYRRECPCHAKTPFGKLPPVADTRCPPGEDPVTSWSRGLDEANW
FT                   QAYKLENWLEKRVPNSIDARVRELRKPLPENWDVMMSCRLKALVEHQDGPFKIPEFAPK
FT                   YPTPITLHTAATIDYAVRQLADFRWRPPDAGPERGVCVDVLGAEKEVDQLEQTIIALHW
FT                   LHYIDRPVAHGKGDFVDPPFHLNLIGPEVPFDAYKSSTRTYGVTAHMYRGLYHEVKGTI
FT                   WSHAYARKNFLHSPHRLVFMPNAGIAAFTSWEPTLKMLVNEFGPVVIITDYTEEAANMG
FT                   LKELKKMVLREKAAARWNFLEVQVNPYRQPVSCKGADNAMPSYANGFIFGMIPSDFTYG
FT                   DGDEKCDEVQVVDLSSA"
FT   CDS_pept        420524..421522
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632517"
FT                   /orf_name="MICPUN_64084"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67225.1"
FT                   /db_xref="UniParc:UPI000199C146"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH29"
FT                   /transl_table=1
FT                   /translation="MAAVATPHVGATQLRARLHRGCVQRVPRASTRTRRPSRLIARASE
FT                   GVPGDDAEEEEEEEVGIDDLVEMEIGGVSVSPRGFVALLVPKGSAGSIPRAPNPVEELR
FT                   RAEPRVPLGSLRTAQTLPLLISKRPEDREGAASEWAQAMLQLTQDPPIDMGIQLPYGAL
FT                   DELTGAEGSILGAVFLGEARWDDTGTRYVFESTLLAGKDLDQSTYDLRGGEDEAWRALA
FT                   LALRYAPYGCRIFATKKALATVDARAFGAAADHEYEEQSAPTGGGLSFANLRDAFPMLQ
FT                   TTKEARAIAAEARKRYLLDPFMAASGGGGASQDEDDGRSVDDDEDGGTFSK"
FT   CDS_pept        join(complement(421992..422645),complement(421672..421896),
FT                   complement(421601..421615))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632518"
FT                   /orf_name="MICPUN_64085"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO67434.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG558403"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniParc:UPI000199C147"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH30"
FT                   /transl_table=1
FT                   /translation="MAVAADDDGLTDYERQRLAHVARNREYMARLGVLDLAKVVATEKP
FT                   TTAPSRKRVKREPTEPSRRSGRLLNVKPEHDGSAVDALRDDEDAGERRNKRTTGRIATG
FT                   PAGDASVWDSEDAALEASRQWLEDARALMLARTSAVADMPKGSRSEEATRARWRKEAVS
FT                   RWGDGVPAIDAVEDWERWVKSRVGAPPPPSDLQLLQEYYAHDAWQLLVACVLMSRVSSW
FT                   DVKHNTISAFFAKYPTPTHALAASPNDVLEVIRPLGLFPARFRSIVEVSTKVVSDVGEF
FT                   DVGPEPTRKVYGAARG"
FT   CDS_pept        423022..427158
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632519"
FT                   /orf_name="MICPUN_64086"
FT                   /product="Polycystin cation channel family "
FT                   /protein_id="ACO67226.1"
FT                   /db_xref="InterPro:IPR013122"
FT                   /db_xref="UniParc:UPI000199C148"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH31"
FT                   /transl_table=1
FT                   /translation="MFNARPTGAKDDDLMSSGSSGSVVAQVQMPSRASGLFGFFSKTLG
FT                   TSSSRASPEPAVGRGRIGAATDWDLNEDSRLDRNELKAMARADVTRYDRYMAADLDGDG
FT                   VLESGELRVAEEAEDQHNRVRMLHRVKDAYKRNVRKVSSYWTLVSFSCFLVIYLWLLHK
FT                   QADVDAAYGMASTVTNALVPTNPETNEDQRVYADKSEVFGWLKDTFGPIWADPKCGNGE
FT                   CEQMEFPGFGRFGCTADCGAYPHLTKVDVEITPIYTLQNDTEGVDAQRAAFLAGTKWNF
FT                   CTKELRPERGEECWFETDRPVSNYVGTVDKWQLEVPGMNWYVRLLAPFGGTAGKVFVTD
FT                   PNTQLKKVKYTWGYCQLDRDKAIETADGYRYDMYIAAGVPPPDAATPGRKLLNHLPGHT
FT                   PVRRNPPPPPSSSPSPPPPPPPPPPPPSRATRVPDVSPRAKPECTSGFRLLEVLTQTSI
FT                   NGNKNEWAVKHVVFDDAAIVAAGINTTTVNATAFSAHITSETATEVVSGSLSAYETKID
FT                   QWCVKPGNYSLVMSDSHSKNFGWRGGGVFITGADECEIVKAFADGVASETTYFTIPDVN
FT                   DADVRGRDCAAVGLERRDYKNGWCTFDVAASAAACNPITARTPITPTSSEIQKRCYLGV
FT                   CQNPRCHEPMLLADYRTAGDGANGCCNLVQYDVPFAMEAVAVPKPSNATPPVPLDTSVR
FT                   KRYVSSKNVIVGGVLLYQTRSGNEPCKGKFGDGRADRGLSGKVCPVVDKSDVDPYGVDP
FT                   VFISTSRLYDPEAKNKMCCRPESDAQGGSNASDPGFKFYKNSELNVRGVPYGFYPSTLE
FT                   GREAGFAVVIDINLRENAFNKLIEYLEDGFFIDKYTKNLKVEVLTYNGELRYFCNLVVD
FT                   FDFSQGGNIQVEYSADSAATQPYYHDPDDETEVNNYNLRCLLEAVFCLFVLSAMFTELT
FT                   ELIGTTLKTGHPMDYFVSAWNYIEVLSIWLHVCCVGMWLWQVAEMRAFDTEPRFNVYLN
FT                   TQHARSARLLELRDDGSQLEKYVVDVLGKFNSVIEVQVLYGTFNGINIFLCLLRFFKAA
FT                   DFQPKLGIVTRTIGKSFQELAHFFALLGIVCAMYTFLGQVVFGSKLLQFSTLSQAGQTI
FT                   ISWTLSGDDRGVGEELFDLPGRLAVAGALFYMTFSFLTTLMLLNFLIAILSEGYMKVQQ
FT                   ESADTESIISEMSKLLTRWLRAKTSGGKLLTDRAALKRVRAMLAAEEYERDRFEEKHGM
FT                   ENTVARRGRATRDGDSDSDEEDRDASSAKVLELSGDRGGGVEVEELRRVLEGSHQAARR
FT                   ANESGLKKAKGGLGDVAVLCESIAASVGNAKSVDGASPMEKKVNEMHSLILMIAKQLDE
FT                   QKWALSELRSTKLDESPATAARDKSTATPEIENRL"
FT   CDS_pept        join(complement(428101..428166),complement(427458..427832))
FT                   /codon_start=1
FT                   /gene_family="HOG000088675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632520"
FT                   /gene_name="PRDX"
FT                   /orf_name="MICPUN_112683"
FT                   /product="Peroxiredoxin, bacteria-like protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO67435.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniParc:UPI000199C149"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH32"
FT                   /transl_table=1
FT                   /translation="MVGVGDKFPDANLHDQFPPDFKVPGYLAGQDKLKAAGIDEVLVYC
FT                   VDNAAVMSAWAVDQKIAGSNISFLGDPNSELTSALGMTLTNPGPVGKLGPNRCKRFAMY
FT                   CDDGVIKVIQVSENKGGADDPAGDDFPEDSCIDNMLKLISEL"
FT   CDS_pept        complement(428431..430599)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632521"
FT                   /orf_name="MICPUN_64088"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67436.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199C14A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH33"
FT                   /transl_table=1
FT                   /translation="MGCGASVPAGELENELKIEKTKNEEAQRQLDHMKELYQRERERNK
FT                   DLRNQLKLNASSELPNSSEAPREPEVRGPTAEDGAPAPEEIADAPVEPDAPVDDGAPAA
FT                   AEEPERAASENPNVAAEGKVTSDDAPAEEVAPAPEENADAPAGDVVAEPVEAVEPAEAE
FT                   PVEAVEPAEAEPAEAEPAEAVEAANSAEPEPAEPAEAEPAEAVAAVAVPIAAPIDVPVA
FT                   DPPRFGPYGPEHEASALKIQTSARGKLARSASKRIREEIKGCPYGVMDVSETWAPDTAV
FT                   EPAVDPGDDPERHRPIWSKLRTNLHAHATKDPSSPAKPHGERCAQLWRDASTLAKTGAF
FT                   DLAIEAYWRFVHERMSELGHTRYGVIPPFFAHDHQDYLNALYNVATLLEAQAVDPGSNP
FT                   TADEILHPEQILRADPHAQAYGIFSELVEMNDAVPASFWVTLGGHPAGAPDAAARREGL
FT                   LVLAADRGRAFTAHDLATHDRERAVAMSYRGGNSASRDEAHAGGVLLSRHGKHEEAAEM
FT                   FARAADISLAENKKHSALYAINAQFGSLLRLGVVHENRDEDDAKVREVRDRFRRVAGEP
FT                   DGMLGDASSFANQGRHPGALAILTNEVLRFRRYELTLRDPRKSASHGPSPWPVYDRDVA
FT                   WVTHRIAREFEAMRWYPEALQWAEEAIGMFEGCEGSEAAAAAAATRRRRDDIARKLATR
FT                   DATLTAFRLAGKLASDARGDVTGEASMS"
FT   CDS_pept        430762..431229
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632522"
FT                   /orf_name="MICPUN_64089"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67227.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199C14B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH34"
FT                   /transl_table=1
FT                   /translation="MAAASQLSSSIRVSPTRVALRSTAVKRVAAKAPVRGLVRAEAAPE
FT                   FAGLGPEMKTAVDKFLGDNKIVVFMKGNKDQPRCGFSNTVVQIFKSMDVPFETVDILQD
FT                   EGLRAGMKIYSQWPTFPQVYIDGEFYGGCDICIDGYKDGSLVEAVEAAMAS"
FT   CDS_pept        431410..433143
FT                   /codon_start=1
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632523"
FT                   /orf_name="MICPUN_64090"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO67228.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG525304"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199C14C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH35"
FT                   /transl_table=1
FT                   /translation="MLDGWTDEEFEVLRSPWLVWGHFALTCVLFVVVIVHQWLRSGPEV
FT                   PNSVGFFHPFTSDGGGGERVLWCAVREIQRARPDCQCVIYTGDDASGEELARRAKERFG
FT                   VELRTVPGVVKLRWRDLVVPERYPVLTMVGQAIGGALLTAEAVTSYRPTVFFDTVGHAF
FT                   GYPVARLAGCVVACYVHYPTISSDMIARVATRSDMYNNRSIVARFWLLSALKLAYYRLF
FT                   AVAYGWCGRYATCVAANSSWTAAHLRRLWRVDRIRVVYPPCDVAGLTDFSLSDRSGWGR
FT                   STGVQGGEGGVQGVEGGVQGVERVEANERVEGVEGGGGNGDGPYLVSVGQFRPEKDHAL
FT                   QLRAWAKMRADERDATTPSVPPNARLKIVGGCRNEGDERRLDALRSLTKDLGVDDSVEF
FT                   HVDVPYARLRELLGGAAGGVHTMLDEHFGICVVEYMAAGAVPIAHDSAGPAMDIVVPAV
FT                   RPEASEGDDESPNDGPSGDDVARLPVGFLATTVDGYADAMWAALSMTDDERVTMATLAR
FT                   ARANAFGEGKFNGAFLDAVAPALASLAVDRRDAILEAAGVRTRGPHGVVSPAGGPRRRR
FT                   G"
FT   CDS_pept        complement(433208..434785)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632524"
FT                   /orf_name="MICPUN_64091"
FT                   /product="Glycosyltransferase family 7 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO67437.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="UniParc:UPI000199C14D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH36"
FT                   /transl_table=1
FT                   /translation="MRQHVSRSFIALLCVSALVALHVAVPSDRAPRDRLARPAPSPSQT
FT                   SQTSVASQASRAVASLPSPAPPLCVVVPYRERPGRTAREPERFAAYIRRWLKRVKGITR
FT                   VRVWVLEQEDEHRFNRGFLINAGVALGRLVDGCDVFALHDVDLLPVDPRVPYAFDDDDD
FT                   DDDDDGSRRRFPSSRGPVHLSPPGVHPEYCYPTFRGGAWLFAWKHLARVNGYSHAYWGW
FT                   GQEDDDLGARMRDANVTHARAFDYPGPRREEDGEKTPATAPCTGRVQNCHPGDHDPTVR
FT                   DCGVYPYDTFVRAMFHPTPGGIIEGISVPPSRSLAEGTCFVHAHEGGFSRDEVERSGAK
FT                   GVVARTSEAFQFGRRWDDVVNGRFRRDESTGLAGLVPRRCAGSIRRPSGSVDASFVREA
FT                   NPNLHNPNPDPIPGHGFQLLAMDKIGVVVRADGVADKVRETSHPAFREWLASSSNAGFE
FT                   PTTSRWSGNAFLAHVCDEDSTYPYVSYDVNANDLRVGAYTRTRVRLTCDEEESPWCRQP
FT                   NVPAIATE"
FT   CDS_pept        434996..435496
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632525"
FT                   /orf_name="MICPUN_64092"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67229.1"
FT                   /db_xref="HOGENOM:HBG558408"
FT                   /db_xref="UniParc:UPI000199C1DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH37"
FT                   /transl_table=1
FT                   /translation="MGQQSQSGRARTKRAPIPNSPAVRKAIKKAAADKKEKTIVRSYAE
FT                   KKRLKQERAARFENVKHKNNTNFGSEGMKLKAEAKGPMEVRYRALAKKLRQIQELEAKK
FT                   KEGASLDQWQLAKLRKKPFVKAEIRALARAVGGDGAGEEDGSEDSGSEDDEDEDEDEDE
FT                   DEE"
FT   CDS_pept        complement(435567..437132)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632526"
FT                   /orf_name="MICPUN_64093"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO67438.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C1E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH38"
FT                   /transl_table=1
FT                   /translation="MGRRRPLATPPLFLLLLLLLALTPAGSSRSAGRGPAGLDAPAARR
FT                   VLNVTRESTRDEIRAAFRRASLTTHPDKDGGSTERFVLVGEAYEVLRHGNHDDGGDYDD
FT                   DDGDAGHDDAGHDAGTSRWDAAGHRHRRRRRHPRDDDDYNNDVGRSFRRRSFDEFARSR
FT                   GAWDAAGVGGVGGDGWGGDLWDSPTGRRRAAAAFGDASAGSGNFRASRKWYERGRGDAP
FT                   RGHAANAGGVRRGTGRDAGGRGGAGGSYPRNVNPGDSFGFGVGDDDDWVGRDVNDGDPG
FT                   ANNPGHSRTNPRAARLHDDTEAGAIPQGPIGAEGGGGGKWWERRGGNGDGEAGVFHPLF
FT                   RDKFSRSGRRMSENSDRRGAFHGGYAPPEGADTSPPGGEGEFGDGGDEKSAPGTAGDAF
FT                   GDATRRAPQSEPPKFDDDETMEEYVARRAYADSFGMTGHDRTLGDGGDEESAPGDAGDG
FT                   EDGGGVPSPSAPANEGMAQAEWEWRLEDLEAALGGDAWGATGPGANPGNDYLCAEGVEE
FT                   FCVA"
FT   CDS_pept        437336..439477
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632527"
FT                   /orf_name="MICPUN_64094"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67230.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C1E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH39"
FT                   /transl_table=1
FT                   /translation="MAELFPPGTTLRSSKEALDVEIFGHAPGALDGEDAYVCTFIRDGE
FT                   DAGEDLMPVSRAHDEAEFARVEPPSSSPAAEPEEEWWPDGASGGGGGGARDPPSGAAQD
FT                   DAPISPFRETTLEVPREDDAPERGDPDVWGEGPPPLPASPASPASAPPRSKPRGEPPKG
FT                   RGDDAFNPGARLCDAKTKPHEVNFIVEVVSYDARKDRYRCVFRDGKGKKLDEDVVKGRR
FT                   LHDPSAFRQIGAGQKRVATDGESNNRKSSNRTKSSASDGRPTRNGRNGRVAPAPANGTT
FT                   RGGSRTTTTRGRTPGEGANGATGGRDWRRNLPKFARRCLGAADDDAGGDDRRSDGSTPA
FT                   NRSMVTALERLEALADGAVEDAGERIRLLDQLADMTSKASCGEHDWTRKTASGWNVFQI
FT                   AAREGCGDALDNLHTNCVKRGVSTVAQVNRGKWRQPENAVTMEWLVDQKSPDGRNMLHL
FT                   IAAGWDKLEDHDQPEVASFAKGIINAMTPKQIRRQAPVHGTCVHACAEAGAGAFFRFLL
FT                   EHGGGDCTQVRCAPDPEPAHKPAKTVMDRFRKMLFAAAPGVKPRAKESDAKTPLEAARA
FT                   ALDGLEAEETSLVAALKGEARREAAEDGMTSGAASPVGFKPTGDAARRLERQVASMQRK
FT                   LVGLRKCVDELVAHERIFLRSDTKKEAARTRAEADADEPPHEAQTTGFLGRPISASDWT
FT                   EDADGHVHRTARPTAEGGG"
FT   CDS_pept        complement(439575..440597)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632528"
FT                   /orf_name="MICPUN_109479"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67439.1"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000199C1E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH40"
FT                   /transl_table=1
FT                   /translation="MTKPVESAYHDGNNAPSAPPMSASVYPPPYGEQVRYPAIPSGGGD
FT                   GGRYVDPNALPTAADAARMHGAAAGTADRIVRRIMLVDPINAVGWLGEPRTRTGVADYT
FT                   YKREITHTGDLIDAPTGDRIGKIHDVTPHRADPQTGLRLSGPNVFGKYETVDGPEVTLG
FT                   SFELDARKLTVSGTAASVAVRLVYTGACVHDAHVFHMGNGWADHFTIAHLDGYLKFSLS
FT                   PNNASGAWENRVECSSGIRDKDFEPGKMYTIVAVCTEEGRMRLYVDGELRGEGDGLAAL
FT                   PEFETSRTRKEAWCGRFMRPDTSMPVRAGILSVEAFDGALDDATVRAEYSVREVYANVE
FT                   "
FT   CDS_pept        441718..443148
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632529"
FT                   /orf_name="MICPUN_109480"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67231.1"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C1E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH41"
FT                   /transl_table=1
FT                   /translation="MEVRHDDKTPKELAKGIYESLTKELRASKQAARVSRVGLRPLRET
FT                   NVYGSDMEERLGWYDSPETEALLRHIDDVKERQQHTQLCFEDMVEHRRKSARMERIARL
FT                   EAEKPPSPEPEESPEEIAAREEKEKKEKLSAARKRAVERLSAAGIDAKSGKTRVLTLNE
FT                   VLRKMHDGLPPPSKTSDEITRGPDAIDVVLANMASKTQCRKHRWDTTHEGWNVFQLAAR
FT                   EGLGDALDNLHSNCVDRSSVFGYGKKVAPAETAVSWEFLVESVAPDGRNMIHLIAAGWN
FT                   HLRDRDLTEATSFAKALASRMTVAQLHVSDGGGTCLHALAAAGANTRNLLKYVLDRGGK
FT                   EMLEMTNARGETPVQCARAALEALKAEDAAADARLAKILPPHVTEDPAEVEDIKRRLMA
FT                   KFHRKKQGLASCIEELELAAKASGAVSSPPAATGRSERRKAPSAQKPAPEPEPEPEGDK
FT                   AGEEDVEGEEPDFGGAEE"
FT   CDS_pept        join(complement(444212..446034),complement(444188..444194))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632530"
FT                   /orf_name="MICPUN_104103"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67440.1"
FT                   /db_xref="HOGENOM:HBG558413"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016060"
FT                   /db_xref="UniParc:UPI000199C1E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH42"
FT                   /transl_table=1
FT                   /translation="MTETRPNSTALPRATLTRWLCVAVFLLLSGKSTALEIAGHGRSAS
FT                   WTQIGATFTGSGSEKPGSVLSFSEDGSRLLVGSIPVPAYVDVYEWQSGSSAWTLLGARI
FT                   SPPHGSIVSACLSGDGKVVAIGDFNGGDFNGAGLEVWWTVAVYHYASGSWQRVGSDIVG
FT                   SSSEGYYAEVSLSSDGKVLAIGNNNQTLSSYDSSDHNATMTGRVRIYQWPASDLTASGV
FT                   AWTQMGEPIEAWSTSSGFYPWFGPYSQKVYADAGKLSGDGKRVALFKTNGWAQKGYVYE
FT                   WKSSSWSIVGDSIDLEGTASISYDGNVVAGSYGNVYKWSSGAWSSIRTEYFGYYTSLSR
FT                   DGTRVAYADSWNEGVVLVHQWDSEAESWGRMLDIRGESASDQVGAMVSLSGDGSRVAVF
FT                   SDGAKHTRVFEVGTTCDTSVAPPNASVGNCPAKLASGSSCQPTCNSGYSATRPTTCVSG
FT                   YLKNATCAAGCEVSSAPVNGGKGDCGNLLAKSKSCTPTCNDGYVRKGNKKTSCDSAGVL
FT                   SAAECRKRYSWGDAKFCPKYENVVFCWSVKKKEDCLAARPKRDCKWSNSSSGGSEYCYH
FT                   DDKEFDEMWDESYYHDFAADKCGSVDPWTRDAL"
FT   CDS_pept        446830..448098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632531"
FT                   /orf_name="MICPUN_64098"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67232.1"
FT                   /db_xref="UniParc:UPI000199C1E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH43"
FT                   /transl_table=1
FT                   /translation="MSAIATSSCLSAAAKAVARDALGALQSRNIWRTRGGRAGLRPRDR
FT                   RSLVTRATATAGRLSGFSGPRISPTKPNSQTMVGKTLKKVKPGDLLALTLTAGDGSGHL
FT                   ASGEDLNQVTWMVATKLSTSTGGHLCVDGEVNGLRVQVIDQGARGGARLGIVGLVVDPG
FT                   DSWWHERFPGWRAHLAKREELETSVMNSVVDLRICMSLDKIERCVVTNPSLWCAGADSP
FT                   RRRSVITDPIERATQTAGEILALLNGERGVVMCQLWAGWAPMHEQPVEAPYVTQLLRRA
FT                   IESGVVGVAMSESDDVEGNPGLTAVLYSKKDGQESAGDGDARKKRVRTWRAKDCERWAR
FT                   KIAELGAQADCPAVTPYECVLVGMALGYDERDIAYHLQGLGSPFSAALFERAREVLEGK
FT                   DGASGKNEEKKKKNGGLMGGIFK"
FT   CDS_pept        join(complement(449232..449294),complement(448188..449117))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632963"
FT                   /orf_name="MICPUN_64099"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67441.1"
FT                   /db_xref="UniParc:UPI000199C1E6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH44"
FT                   /transl_table=1
FT                   /translation="MNDPPAQHRKGVKQRSPDEWKDRLRADVIERVRASRTAILSRARG
FT                   GTAGESPALFRDGVRLELADILADEVTRAERHHRPDATPERRDASPAPSTSDDGMWNDD
FT                   PIVKPRSRRSPSPAQLSSPALSWDEHAGTKLTSVEYEDLMLAMHEAVEEDLRREEAAML
FT                   AAELESVEAQEADELAAAVASFEAWTVDSIAAGAQLSSGGGDSTPAVPCPVCSTRRVLM
FT                   TDDVLFCGCGNFRLARGEVPGERRVRARAGNRGGSGSSAKDGLLDASSREASFGLDHLR
FT                   RRLAETYAAHAENGGCDDARALAFDVRNAFGVEALWAECGRCGFIETVM"
FT   CDS_pept        450061..450705
FT                   /codon_start=1
FT                   /gene_family="HOG000100147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632964"
FT                   /orf_name="MICPUN_109481"
FT                   /product="Histone deacetylase"
FT                   /protein_id="ACO67233.1"
FT                   /db_xref="HOGENOM:HBG713516"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI000199C1E7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH45"
FT                   /transl_table=1
FT                   /translation="MGFCLFGTVAAAARHAQRARGMARVMIFDFDVHHGNGTNDIFRDD
FT                   PSVLFVSTHEDGSFPGTGKMSDAGEGDGVGATINVPLPPGSGDAAALAAFDEIVAPAAA
FT                   RFAPDIVLVSAGYDAHWRDPLAGLSFRTGTYWRLSARVKALADELCGGRCVFLLEGGYD
FT                   LTGLGEGVADSFRALLGDGSGEDPGAIAGLTDEPTEKVRRVLAEAKAMHQL"
FT   CDS_pept        complement(450809..456034)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632965"
FT                   /orf_name="MICPUN_64101"
FT                   /product="SNF2 super family"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67442.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI000199C1E8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH46"
FT                   /transl_table=1
FT                   /translation="MGGRKRAEPQRLVPGDGAAAAKRVKKEEVKAEVKVEPGVDEPIDL
FT                   TGVSDSDPDDDAKLADSLRGGPRTIVDAPLYPPTIAFDDPFHPRGVPVRCPPDWHTVDG
FT                   ANAAAERIRNEVRLLGVATLTLASAPGEAHARATLASLAAGVRASKRTVRKNYRGPAGV
FT                   ETWNDVGEPGSARGTSVPVGKLAECVSAGILDVAEPHGLPLLHALAGGQHPVTSPWKVP
FT                   LTRCVCLLEAVSDAPANPPGAVGGSHEGETESSQSTAVKVELAVYASRLMFEMIADDGV
FT                   RLIVSHLAPPVPVAKALETEVLRPARFYVDAAVAGADTAGAGPFTLPGLLAAAVSDGYD
FT                   ECPTPPNLALPLMDFQRQTLAWMRDKERSERGLNGVFWEERRWADGGKYWYFPLAGELR
FT                   LSEPPLVRGGMLSEEMGLGKTLEVLALVSADADAARAAVEAKTAAAKEEPPEAEEEEEG
FT                   EEGEEDRLNGKGSRNADHPDEDEDEDDAEERRQREEEDRDGLIPSRATLIIVPPPLLRQ
FT                   WEAECAKCVRPGTMKIGIHSGRGRGGRGAPRQVSERELASKLADNDVVLATYPSLQKEA
FT                   KKRRRETGTGDGASAPRNERAQKILSRVSWRRVVLDECQMVRSSTTQLAVACRCLVADF
FT                   RWMVSGTPLHGGVDDLNGELAFLGVWPFCLSDQTDGFWAHRVGRPWAAKDPDALPLLHA
FT                   LLRGVIVRHTKAQRRIVDGTPLLTLPRASRVWRPVVHGYEPGDASERFVCAFLEHHAAA
FT                   AARGALATLQTAWLAGEYQGSSRATQARLLAQRLLRLVRGATTSATLVRSRLRDVDQAL
FT                   RAAATAPGGVGGAGHGDGVNGRGAGGLRNRGLAGTVDVSAAEAAADADFCRVRALPAGA
FT                   ALVELMTARDAQEVRVARQGDASGASGAALSAFQLRNRDMHTFEASVQAWRGTSREYAD
FT                   AGGSDLAHKLAAVCGNVFKLLAKGDERAPGREGITCGTAANVAKERATRQRQKRLLAHA
FT                   GLHALQHAFPGRLNDLCGCNWSPCPCSRRIKSSDDPSCCEALEAHRALSDRENKSGRVK
FT                   EAVKIARSVAAAATEAIADARAPLPKLRWLLAVELITSGAAFRLFREHGQPPETLRFID
FT                   DDFNDVDANALGSLTNLSEAVVEDRRRLGVRFLRRALLADALAAPVRSADADVETRRAR
FT                   AQARDPTTNKPTRAIRDAPEEDQLALERARAAKRDAEARLRDELPGGCRPVGGALVLAV
FT                   PAASPAYSGAGGPLSALAVAATLRDAIAAHSQHANRLANEVGSLLPYLRALRAAGEAGA
FT                   DWTSLDHATVQQSGFDLLNEVMAGKAPQCCICVQPAVHPCIARCMHLACTRCMVTWYHA
FT                   APLHGGGASSAPPCPLCRKPFTIDELIRLIPPAEEEDVNGEEEDEEGKGTEARAGGSKE
FT                   RRRRRNGEERNDAREEPARNDAVEVHGAVVRFTPAARPSEFSRLPLPDGENPADYRDGR
FT                   YPALSMDGGRFLAHLHRASMRQSPKMSALVRDLREALAAPGGSGKAVVFSQLRDALAHA
FT                   EQVLRWEGIGCESVGVHNRGGGVNGGTNGGTNGGGTNGSNNGSGEGAIARFRDDPATQV
FT                   LLLHAGSAAAGLTLTQADLVVLLEPFLSPGDEAQAANRVHRIGQTRPVRCVTYFVEGTV
FT                   EERLLAFRTRQREFGAEFGGGDGTVVGSIPGDGDDDGDDPEGDGERADRLAVTRDGGDL
FT                   GLGGGSIGRRTFERMRFVFGIGDGRSTAEGATARGADVVDLANE"
FT   CDS_pept        complement(456146..457771)
FT                   /codon_start=1
FT                   /gene_family="HOG000238823" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632966"
FT                   /orf_name="MICPUN_95887"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ACO67443.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG748119"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000199C1E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH47"
FT                   /transl_table=1
FT                   /translation="MAAPDWLTQLNRLWGGNSEIPVADAKLEDITGLLGGGLFQPLFKW
FT                   MKEAGPVYLLPTGPVTSYVVVSDPDCIKQILFNYGSKYIKGTIAEAGEFLFGLGVALQE
FT                   NEAWKIRRKAVAPSLHRRYVEAMVDRCFGPCAERMVELVESAIDSEGGEKKRLNMESKF
FT                   SQAALDIIGISVFNYDFKALTSAAPVIQATYTALKEVETRSMDLLPTWRLPEPFLRVVS
FT                   PRQKAAQDAVKIIQEVTTKLVDDCKRMVEEEEKVGGAEEWARDYLNDSNPSVLRYLIAA
FT                   REEVSSTQLRDDLLSLLVAGHETTASVLTWGTYELLKPENAEQLRLLRAELDEVLGDKP
FT                   FPTYEDMTKMPYLERCFHESMRLYPQPPVYTRRAVVEDVLPKGLGVVPAGQDLLVSIYN
FT                   LHRSPENWGPNSQVFEPMRFGPLALGQPNELNTGYRYTPFSAGPRRCPGDKFAVLEGMA
FT                   IWAVMFRRLDLTLVAGHDVVMTSGATIHTRDGMLVNARRRRGEKGQKVDWAQLKPEKDI
FT                   GAGWFEKGIEAKGSSGGGKCPVAH"
FT   CDS_pept        458596..462363
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632967"
FT                   /orf_name="MICPUN_104107"
FT                   /product="Chloride Carrier/Channel family "
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67234.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000199C291"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH48"
FT                   /transl_table=1
FT                   /translation="MAKILASAAATRLREVAPDAGVSTPIPSRRRTTKMDRTASTPTPA
FT                   RRKTGAPDVASPKGRRTLEREMRRLSRARSAPDSPDRYGARAEDDADYDAGDRSCSSGS
FT                   DTPDSTTPLRREDRSSSVAGAAARAHRRPGRSLRDSPSRHLDKSPSLASVAEDDDGERR
FT                   DDFDDFDDFDDFEGDSTAPSSPGRPTAARGRPPATTTTTSMTTLSGARRALRSVSTFLF
FT                   GAAAAAGDRGGDASGNSTAFATPYASKRASVVRHGECPADGEASHARTGPPPPPTIRLR
FT                   RTSSYYVAGGACGGDRGGSGFGSFGGFGSGAGDASTREERERARRVELARYRGRCAAAG
FT                   KLAVTTLAGTLAGVVLWAMTTVTAQLTMAKFNATRALLGNDDGALPRAWAFYCACAVAC
FT                   VGATAFGILHPKGAPMARGSGIPELKGYLNGNRQQGLFHWRTFLGRSVGICLVITATMP
FT                   FGREGPSVHIGACAASVALNLPWRTYLGWQPSPEERRQILQLGSAAGVAAAFNAPIGGL
FT                   LYVMEEVASNLPPDYVWRAFMTAGVAVGVALVLYSANEGRVDYASLVISDPNGSSTGWG
FT                   VADLPLVAVLAALAGALSAAYTVAADFFGKWRRRPGAWTPQWLANAMGTRWGMWLDAVM
FT                   GAALNASMQVLLPAAFGCRAAPTTSNEYGPDGSLNVYTGRRKLTSSAIYIPRTFVQYTC
FT                   EPGDFSEMATLMLQNEEGVVKHLFARDELYSEKLFTAPVVFAFLAYFFFIASVTFGGAF
FT                   PAGVFIPNMLMGASLGRLFGFFAEQVSPSVNKGTYALIGSAAMLSGFTRMTAAVTVIII
FT                   EATASMDVLAPIILACVIARAVSMAIVSHSLDERQIIAKGVPFLEHHAHPSTAAVKIGD
FT                   ALKEADSRRGPIIAFRKQERLEVLLNALLLTEHNAFPVLDDVENNTGLGGLVTRAMLQR
FT                   VLRIVLETDDDDDDDADADADADADAGADAKANAASKKTAAAPRRSTPTLGSGRSSWSR
FT                   KSIDKWCVEGVCPARRDSRKRPVAASSSSSSSPGNGASQVIIHIDDDVEEGGERGGDDG
FT                   RDVEAISSASSDAGGSLKTAPSTPPPASPTAKEGCEFMTSLARWTARNARKGLHNLHLP
FT                   NPGKGAFARHGVAGSKPGGGGGNGGDDDVPTRVGAAAARSGAHQVSSHRGDENHFDELK
FT                   EGTSIVDRLRRGVMNVPGTQLTRMVDLTHAVDKAPWTVDSCMKLARVHNLFARLGVRHL
FT                   CVVSDNGRRLEGIITRHDLIHVHRLAEEGR"
FT   CDS_pept        complement(462518..462853)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632968"
FT                   /orf_name="MICPUN_104108"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67444.1"
FT                   /db_xref="UniParc:UPI000199C292"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH49"
FT                   /transl_table=1
FT                   /translation="MTTGDRRAGLAFAFAGGAGGDEATGGDGATGGGDGMNSDNLPPEM
FT                   LEKDPWEGETFEKLGDAVKNWGLFIVVFMAVGAGVVAANTYNDGAAFVDFQDYDSPDQA
FT                   VAAALKK"
FT   CDS_pept        complement(<463028..>463270)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632969"
FT                   /orf_name="MICPUN_74414"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67445.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000199C293"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH50"
FT                   /transl_table=1
FT                   /translation="SLARVRALIASDDVVVFSATYCPFSAAAKAALDDAGVPFTAVEWN
FT                   QTEGGAGFAPALATLTGRSSIPSVWIAGECVGGCND"
FT   CDS_pept        463868..464641
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632970"
FT                   /orf_name="MICPUN_88101"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67235.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG558420"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI000199C294"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH51"
FT                   /transl_table=1
FT                   /translation="MYWYSVPGAGFLAEGKQDVVAWIGDLSVALPATATVLYLSMCYFG
FT                   PKIMAKREAFEPKGFMLVYNAYQTVFNIITVAIFLAELNRLGVKAWGGRLSWSDPNSFY
FT                   ICLAIWLHYNNKYLELLDTVFMVLRKKNNQLSFLHIYHHCLLIWAWWMVCFVIKNNDCV
FT                   DAYFGACMNAGIHVIMYSYYLMAALKIKCPWKQYITMAQMLQFAIVFAHSCYVIYDGHC
FT                   PAILPWSQMFVMTNMLVLFGQFYVQTYTKKKVKAK"
FT   CDS_pept        complement(464817..465896)
FT                   /codon_start=1
FT                   /gene_family="HOG000006413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632971"
FT                   /orf_name="MICPUN_64106"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO67446.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG320571"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199C295"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH52"
FT                   /transl_table=1
FT                   /translation="MSCALVRTAPSAPRARAANRAPPAGGRRASRQTPARLIATPRAVE
FT                   GGASSVGPAVDGVDDTHRRERARPQLACPICLRAFVAGTTCACCARTFPTIDGKILDLC
FT                   LDAGGANGTYTDPPLRKSGTTLFQSEAIANVYENGWRQSFAWAGFPGESTEWEYAMEYV
FT                   KAAGHGGGGGVLLDVSCGSGLFTRRFAASGAFDHVVASDYSASMMRQTVTYCDADDATC
FT                   SAVKDGALSFVRADVGRLPFATGSVDVVHAGAAMHCWPSPSAAMVEVARVLRPGGVFVA
FT                   STFMDPTSMLEDVFGAGAEAAAAPLAEAFVNSGVGTGGAFNQFWREKDLRDLTGMCGLE
FT                   GFERRRSRQFILFRVNKPL"
FT   CDS_pept        466736..467407
FT                   /codon_start=1
FT                   /gene_family="HOG000285833" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632972"
FT                   /orf_name="MICPUN_88302"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67236.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG558421"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="UniParc:UPI000199C296"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH53"
FT                   /transl_table=1
FT                   /translation="MAGSGAGPPPDLPSLLLNARIVYIGMPLLPAVTELVVAELLFLNY
FT                   EQVDRPGYVYIHSPGSINEKGECVGVDSEAYAILDTMRYIRPKIHTVAVGKCFGNAAML
FT                   LAAGDKGCRHALPNAQIMTHPPKLNRTFDTSVNVQIKANEIEVCEDTYMGFMSEFSGKP
FT                   IETVKEELDRRRYFTPQQAIDYGLIDRIIQKGTDVFEKRNYEAELMAAQAGQRGAMPTG
FT                   R"
FT   CDS_pept        join(complement(468709..>468836),
FT                   complement(<467800..468556))
FT                   /codon_start=1
FT                   /gene_family="HOG000115821" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632973"
FT                   /orf_name="MICPUN_70318"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67447.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG610285"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199C297"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH54"
FT                   /transl_table=1
FT                   /translation="KHLIMALVYIVGWGCASSGLIFLNNHLLTEDGFHYPMTLCSMGLA
FT                   ASWTISSVMVNAGYVKLDKSRDISPRWYCTHILPIGAFAAISLALGNYTYLYLSVSFIQ
FT                   MLKAAVPCVTMIVLVATALEKPHRMTVLGVLILTFGTALAAYGEIAFQWIGVIMMFSSE
FT                   FSEAFRMAVLQYLLGNLRFDLIEGLYVMAPASFAFLVLGIMLFEFQTFQEEDGFAKITG
FT                   RPHKYLAAAFLGFCVNLLTLAVIKSTSSLTFKVVGQVKNTVVILVSVVVFGSEITFLQV
FT                   VGYSISMVGFAVYQ"
FT   CDS_pept        <469050..>469451
FT                   /codon_start=1
FT                   /gene_family="HOG000006955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632974"
FT                   /orf_name="MICPUN_76603"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67237.1"
FT                   /db_xref="HOGENOM:HBG713937"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI000199C298"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH55"
FT                   /transl_table=1
FT                   /translation="LTEKLVLEKTKCTSLYGVRNINLWGSSLDDVDVVQRMPNLESLSL
FT                   SVNRLASLRVFARCPNLVDLHLRKNDIADLDEVRFLVGLDRLRTLWLCDNPCALEPNYR
FT                   MRVIAMLPSLLVLDGDEVTLDERRAAETMP"
FT   CDS_pept        complement(469972..470172)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632975"
FT                   /orf_name="MICPUN_109482"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67448.1"
FT                   /db_xref="UniParc:UPI000199C299"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH56"
FT                   /transl_table=1
FT                   /translation="MHANSYAMKGRDVPCATEREACRLCYETNKSDTLRCGNEVAAYDM
FT                   CAREAQRSFLEGARGAAVANP"
FT   CDS_pept        complement(471015..471761)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632976"
FT                   /orf_name="MICPUN_104114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67449.1"
FT                   /db_xref="UniParc:UPI000199C29A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH57"
FT                   /transl_table=1
FT                   /translation="MVAFVVSAGRAHASISPRARLNRGRGAPSHRPTPRVVPSPPVPRP
FT                   STLSPLGVRSPGASLRCDAGRGAARFGKREEYWDPDEQRRVNENKSWKRTDSPQDAWDI
FT                   DKERDATMYKRESLERLLQLTPSEPKPDKAVVCGKCRAPVSKRSAETQKDRAHLHRLYY
FT                   ADKYVAVGVYERDGTTVTVDDAIDSRASRWWPPRAARRCRCGRCGEVLGWAFEDNPEEK
FT                   VGPFYALLQSRVATNEGGGGGGGGEN"
FT   CDS_pept        471882..475049
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632977"
FT                   /orf_name="MICPUN_64112"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO67238.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C29B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH58"
FT                   /transl_table=1
FT                   /translation="MFAVCNFGEINVGRLPNGAKRTPSLGEKAQRRVASHVCVERSRGV
FT                   PRPYRLGREAATMTAHSPDAPPGDDDPRSEGYGYGGRIASFRANEFARIDDSGVAYCDH
FT                   AGAPPHSESLVRESLRMMERTLLGNPHSAHDAGARTKALVDEARDATLTHLNAPFGEYA
FT                   VVFTSGATGAMRLLAEAFPWSAGRSEFAYTRGNHTSVVGARGCAMAAGAKVSVVDVVAT
FT                   DSTSSVGSSGESKLLDDDDAERGWRVTRSHEIVPETADGVHGDRTHAPVREEPGAYHST
FT                   NGARPVSHSLFAYSAECNLSGERRPPTVARAFVNGERGAGGSDEAHQTTRWWTVCDAAK
FT                   ACALAPPDLSAADAPDFVLVAYYKIFGFPAGVGALVARRRALEVLTPRYFGGGVAAGVD
FT                   ACEDFFVRRDGAEGFEDGTLPFTAIAAIPAGFRSLARLAEDPPAHHGDGDGDEKSAPGD
FT                   GDSTQTRATNRRGSREGAERADAHARAVAARCVTSLLSLKHRSNGAPVVVVYGWSTTEL
FT                   NAATGPGVRVGSPLGVTGQGPTVAFNVLSQHGTHVGYAAVERALAASGVHVRTGCCCNP
FT                   GACDYFTSLPLARASKTADDDGPLRTGGCGGDADGDSPAGMGGGRPGRPRALHAAGKVC
FT                   GDGVDVDDGGVATGVCRASFGWCSTFEDADALVATIAEHFVLEEDERVVNTEEDERVAS
FT                   PSTEPRALTPTAIVASLCVYPLKSAAAFSPPSGSWPLGPNGLLFDREWALVSPRGVVLH
FT                   QRTCPRLVKLTPVIDVDAGVMRVSVLGEPELGRCEVALAGGSNGGGTGVSVRLCGEDTR
FT                   VTVGDDDVDAWFTAAVGAPCSLVRQRAGARRSIRRAPTDADDDESQSRSPPTIGLANSA
FT                   QILLVSQSSVDHLQGLVDGRRRRGRGAVEAGGGARGTTVTATVTSANESSVEVEFVSRF
FT                   RPNVVVSGDALPPYDEESPAWTSLEIGDAPGGGGGQPARARLRAVRPCERCSAVGVEQT
FT                   SGERTAEPMLSLSRFRSGSRAAGGGGGGVTFGVLFDVDAGDGAGYGVLSVGDVVRAVGC
FT                   AAAATAA"
FT   CDS_pept        475226..476734
FT                   /codon_start=1
FT                   /gene_family="HOG000100148" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632978"
FT                   /orf_name="MICPUN_64113"
FT                   /product="Major facilitator superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67239.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG558425"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199C29C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH59"
FT                   /transl_table=1
FT                   /translation="MSGGMAASGRYVASRAARRGANGGFAGGVPWRVPIVRARAKRAFF
FT                   APVAASSARSRRGRVLDVATRAVEPEAVTVDDDDLLFGLPKRDVGEPLAILLASQFVLF
FT                   IGVGALLPALPLYAQNIGLSGSANGIVLSAPALAMLLLNLPAGKLVDSWGRKQMMMAGM
FT                   AVIALSDLATSQCRTVAALIPARLALGAGRAAAENGDRAYLADLTDRFPSARGTMSGSQ
FT                   QAIQALGLVIGPLIGGRAVEAFGAPTVFLLISGAAFACTGGYSLLPDINVAAEREEERI
FT                   ALSMDMSAEEEEEMERELEAIKAKSDWRVLLASDRQRVITAAAAANALGFVAKLTCIPW
FT                   FATQALDATPAQVGELFSVTALLGMVSAPLSGIIADKIGLKAVVVASLGMCAAGLVVAQ
FT                   DSSNFHELQLCIGLWGMGTAAAGPAVNALAQESAPRGGEGEALTLPKTAGDAVFLVGPV
FT                   FLGGFDDFLGSAGASLDIVAGAAAAAAAYALVSLKPVGEEDGDE"
FT   CDS_pept        476840..477715
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632979"
FT                   /orf_name="MICPUN_64114"
FT                   /product="Predicted protein"
FT                   /function="chaperone binding"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67240.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG751004"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="UniParc:UPI000199C29D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH60"
FT                   /transl_table=1
FT                   /translation="MWRSRRAVGEVLRAAARRSAGPRCLHRPDHLASAAATTRAPRRVD
FT                   IDARRPSPGRESRRDSLASSRSFSADASPSSRGACWSCGVATTASDLFFCGGCGGVLPA
FT                   LAEGDDVNGSLLLFRVLGVDPPRFAVSNDELERAMKNLQKTLHPDKFSTAPNVAREHSA
FT                   DQASLVNRAYATLRDPLRRAKYMLRAFGAGVAEESGMGDEQGSPAGDTIDPTLLMDVME
FT                   TREAIERAGDDASALGAMATANDAAEHECVAALGAAMDAGDLATARKETVRLTYLVRIR
FT                   DEIKRRLPPG"
FT   CDS_pept        complement(477814..478803)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632980"
FT                   /orf_name="MICPUN_64115"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67450.1"
FT                   /db_xref="UniParc:UPI000199C29E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH61"
FT                   /transl_table=1
FT                   /translation="MSFARDEGRTLPPSVDAFINMRDLVVGDNDWYNVTPSVRRAIEGF
FT                   ALILRDHEARLMNGGDSGSPMPTARSPASPRRSPSDELGSSTLEVAQLKDRIARLEEEL
FT                   AVAKRRVAEVTDVAVRAASDAKTAVVEVDAIRPEVDRLANGLSSLHTAVGAHLKDIRGT
FT                   LANGTPGNSNSPGTPTGTGGSGPPEGGEIGDLTRRVRDLEGDVERIVVGSDGQSAGVAR
FT                   RVAALEDNHKTLERRTRRVERVVEDVRSAEDRRARAEEAERMRELRLGGHAGGGPSGGG
FT                   GPRRRRGSSSSSSSSEDGREWSSSGRGDDPIAALAGASVSTGLHGGFG"
FT   CDS_pept        complement(479170..480474)
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632981"
FT                   /orf_name="MICPUN_96733"
FT                   /product="Cystathionine beta-lyase "
FT                   /function="lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO67451.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199C29F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH62"
FT                   /transl_table=1
FT                   /translation="MATKLVHPAAHVHDPFDSTNPPLYQTATFGQPSATENGPYDYTRS
FT                   GNPTRDLLEKEMAALEGADRAFAFSSGMSALMCVTRLVKTGERIVTGDDIYGGTSRLLA
FT                   QVVPKVGIEVVNVDMNDLDAVRRAIESGPTTMVMLESPTNPRLQITDIRRISEMAHAKG
FT                   ALVCVDNSMMAPVFAKPLELGADISMTSATKFISGQSDITGGILAVKGEQLGKDIYFHQ
FT                   NAEGLHLGPFDCWLALRGIKTMALRMERQQENAMKMARWLEAHPAVTYVNYPGLESNKG
FT                   HGLHKSQASGTGSILSFATGDVNLSKIVVEKTELFKITVSFGNTSSLISLPCFMSHASI
FT                   PAEVRAARGLPDDLVRISAGIEDADDLIADLEEAFEEAMAATGWHSKNGGGGRVTDGSA
FT                   SLMDAAARREDELLRRIAALEAQLAGQHNVKSPPR"
FT   CDS_pept        complement(<480661..>481557)
FT                   /codon_start=1
FT                   /gene_family="HOG000265924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632982"
FT                   /gene_name="MDH"
FT                   /orf_name="MICPUN_75917"
FT                   /product="Malate dehydrogenase () "
FT                   /EC_number="1.1.1.82"
FT                   /function="malate dehydrogenase (NADP+) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67452.1"
FT                   /db_xref="GO:0046554"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG553037"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="UniParc:UPI000199C2A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH63"
FT                   /transl_table=1
FT                   /translation="VSVPITELTETCRRAIKTYGYDDVETQILLDVMMYAQLRGNNQGI
FT                   IKVTTKGIARDPACTPIAIEHETQLSACLNGNKNAGMVVIHKAMDIAIEKAKTHGFGIC
FT                   GTNNTSTSTGALGYYAQKIAEEGLIAMVFAVSPEFVAPNGAIQPIFGTNPIGVGIPTAG
FT                   KPVVLDMATSAYSFFGLLEARTAGKKIPHGVAIDSAGKITEDPNAAIDGGAIVGFDGGY
FT                   KSSNLALMVELLAGPLVGAAVTDKMAAKNWGNLVVAIDPKLLGQDEFERRAKMVTDRVK
FT                   AAKRQPDVDEILLPGERG"
FT   CDS_pept        join(482446..482530,482792..483160,483349..484358)
FT                   /codon_start=1
FT                   /gene_family="HOG000227986" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632983"
FT                   /orf_name="MICPUN_64117"
FT                   /product="Adenosylhomocysteinase"
FT                   /function="adenosylhomocysteinase activity"
FT                   /function="binding"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="ACO67241.1"
FT                   /db_xref="GO:0004013"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="HOGENOM:HBG352029"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="UniParc:UPI000199C342"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH64"
FT                   /transl_table=1
FT                   /translation="MSAPSAMCTVETVNGREYKVRDMAQADFGRMEIELAQVEMPGLMS
FT                   MIKEFGPAQPLKGANISGSLHMTIQTAVLIETLVALGAKVRWCSCNIFSTQDHAAAAVA
FT                   RDSAAVFAWKGETLEEYWWCTDKMLDWGSEPLDIIVDDGGDATLLIHEGYKAEIEFEKS
FT                   GAKPDPSTTDNAEMKLVLKTIAENLDKDPKRWHKIVSTCVGVSEETTTGVKRLYEMQKA
FT                   GELLFPAINVNDSVTKCKFDNLYGCRHSLPDGIMRATDVMIASKTCFVAGFGDVGKGSA
FT                   QALKAAGARVIVSEIDPICALQAAMDGFQVAPIEDVVDICDIFITTTGNKDIIMVHHME
FT                   KMKNNAIVGNIGHFDNEIDMAGLESFPGIKRQNIKPQCDRYEFPDGHGVIMLAEGRLLN
FT                   LGCATGHPSFVMSCSFTNQAIAQLELWNERKTGKYEKKVYVLPKHLDEKVAALHLEKIG
FT                   VKLTKLTTEQAAYINVPVEGPYKPAAYRY"
FT   CDS_pept        complement(484621..485484)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632984"
FT                   /orf_name="MICPUN_64118"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67453.1"
FT                   /db_xref="UniParc:UPI000199C343"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH65"
FT                   /transl_table=1
FT                   /translation="MARVRSLITREKKIPGNSRGRTISQVDFGYENLHYALDLFIRTGK
FT                   QLQVNCSEKSTQQFSALLPCPRTIPRLRLQARRCVPHPTDNSTILSDDTADRDPATPHA
FT                   RPQVPPSGVPLDYNYLDVKTVAGFLDVTPFDGVVKHGDRSKLPKGAKLNACGVRLANNK
FT                   LTSLAGLDEFLERVLDDPGELRWLDVSGNKLTKVESLLLSYPKLSCVYFHGNQVRRSDE
FT                   FETLGELPELRKFTAFGNPCEQSDKNYRYAVAASLPLVRSLDFTGITRKDREDIHLWDK
FT                   RRGGKR"
FT   CDS_pept        <486370..>486817
FT                   /codon_start=1
FT                   /gene_family="HOG000230584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632985"
FT                   /orf_name="MICPUN_73623"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ACO67242.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG714413"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199C344"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH66"
FT                   /transl_table=1
FT                   /translation="KEVDVSVLDIRVGTIVKCWEHPGADKLWVEEIDVGEDKPRQVVSG
FT                   LRAFKTSEQMTNARVLCLCNVKKGPLREQMSEGMVMCASNEDHTTVDFVVPPEGASNGE
FT                   RVTFAGYEGEPVEVLVPKKKMFEACAPKLRTNADGVACYDGVPFM"
FT   CDS_pept        complement(<486998..>488002)
FT                   /codon_start=1
FT                   /gene_family="HOG000175516" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632986"
FT                   /orf_name="MICPUN_70764"
FT                   /product="Predicted protein"
FT                   /function="pantoate-beta-alanine ligase activity "
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67454.1"
FT                   /db_xref="GO:0004592"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="HOGENOM:HBG428839"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000199C345"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH67"
FT                   /transl_table=1
FT                   /translation="EVITDAKAMRAWSRAHRIAGRRVALVPTMGYLHDGHLSLVSAALD
FT                   RADAIVVSIYVNPAQFAAHEDFGTYPRDQDGDLAKLRALGVHAVFQPEALYAGRAPHGH
FT                   DEAAAKEETKAAKEETEGTEKAQGGTDEKARLAAGGTKRDVPPHETFVTVEELQRGFCS
FT                   VTRPHFFRGVATVVCKLFNICEPDVAVFGKKDYQQWRLIRRMVRDLDFEIDVVGVPLAR
FT                   EPDGLAMSSRNVRLTPQHRKNAVRISEAIALVKEVCELAVANGTPKDATHFKGLICQAI
FT                   ANSGGVVDYVDIVEQRTLKPVEWPLRGPIPAHVPQVILVAAKYGDVRLLDNVEL"
FT   CDS_pept        488350..490128
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632987"
FT                   /orf_name="MICPUN_64121"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67243.1"
FT                   /db_xref="UniParc:UPI000199C346"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH68"
FT                   /transl_table=1
FT                   /translation="MGTGARSEGLPGWDALAVFSVTLAHCLALQVLKDARSLPSLGPST
FT                   AWRWTPTALLALSVARVHAAPRSTDALVALAMNGIITLACNGSQSNHVLLELAMCAAVL
FT                   LCAPSVTSGRRRASSTEMDPSRARRAFSRRLTFSTRAALCVLYATTGFAKLNDDWHDPN
FT                   VSCCVQMLVGALSGMGLDARHVSVVAPERLRAFIPYAATAFELGFPLLCVTSTCRIFGG
FT                   RGFAWDGGAPTTVRLLTAVGASFHALIAMPPPPMSVYPFSMIMAPMYVAGAVPHETGVA
FT                   ASAFAARWKSGGASFRAGVWAVAILAVAVAIKQHEAHSYFEYPPYFAWELGALWVVCAF
FT                   GALAYAALRGTRGTSTSSSEGNGGEEFEKGDEGLSRRARAKALAPAAFIFLVSASTYVG
FT                   VRTYPSFAMFSNLRVEGGASNHWVFRNHHPMNLDAFDPIAAGRDETYRHGVLVTETNLP
FT                   SLRTAQVNLAPLLPSATIDALNAAGCRREFHVTPPKWPYPPTEPVFVPYAIPPVEVRRR
FT                   VASALKDGTGMADFFVEYRWVRGGTEEDGPVRRLVVKGGKVVVGAESGLAVGLGAFEGW
FT                   LRRFRTFDVGSSPCRH"
FT   CDS_pept        join(490271..490547,490699..492755)
FT                   /codon_start=1
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632988"
FT                   /orf_name="MICPUN_107228"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="ACO67244.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000199C347"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH69"
FT                   /transl_table=1
FT                   /translation="MDFAELEKKEGVRLSWNAWPSSRIEATRVVLPFGAICTPVKAMDG
FT                   MPVLPYSPVVCTECSGVLNPYCHVDFHQKRWQCCLCNTGNSLPRNYHEINENNLPAELF
FT                   PGYTTVEYQMENKNPRPPCFLIVLDTAMSAEELQDAKDSLGQLVALLPEECLVGLITFG
FT                   ATVTVHELCDGNAFPKSYVLRGTDDVTQDQLKKLLNLELSPSEYASYDKQRGSAVAEAS
FT                   NALRRFILPVSECEFTLQTALDELRPDPFPREPGMRPFRATGVAIAAAQGLIAECHSAQ
FT                   GARVMVFTSGPCTMGPGSIVGRDMSETMRTHQDFNKGSAKHYKAASKFYNQLGIRLATH
FT                   AHTLDVFACSLDQVGLAEMKTAVDQTGGVMVLAEQFGAEAFRSSLRRMFARDASGALDM
FT                   YFNATFSVFCTPHVMVCGGIGPMSALAVKSKSISENEVGMGQTTSWRICSLNSNTSVAV
FT                   YYEIVNQHSNPIPSGTPFYLQFCVRYKRSNGEIRLRVMTVARRWAETSSSHDVVSGFDQ
FT                   EAAALLVARVSTFRIEHEETFDLLRWLDRTLIRVGTKFGEYAKDAPETFRMPGPFAIYP
FT                   QFMFNLRRSQFLQTANNTPDETAFYRLMMGRETVLNSLIMIQPTLMSYTFNGPPMPVLL
FT                   DVASIQPDCILLLDTFFMIVVHAGSTIAAWRKANYQDQPEHEAFRALLAQPVADAATAM
FT                   GGRCPTPRLVECDQGGSQARFLLAKLNPSATHNTSDASMPSYDRAMGGGGGYDGAGGGA
FT                   EIIFTDDISMNVFLQHLAKLAVQG"
FT   CDS_pept        join(493079..493450,493658..494578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632989"
FT                   /orf_name="MICPUN_109485"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO67245.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000199C348"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH70"
FT                   /transl_table=1
FT                   /translation="MLAEHPQLGCLAGCLSRNRRNRVYRGETKRVVIVGGGFAAVHMCE
FT                   ELAKQPHDIKITMICPNDHLDIAWASPRAIARPETANRNVIPFHKIFERSKHAASMVTH
FT                   VHDTVAWVTETYVETAMSCEKYEYDVLVIGTGATYAEGSEAKRLKSNHTSMSGKDRVKE
FT                   LRELAERVKGAKGVMVVGAGPTGIELAAELGAAYPRVPVKLVTNKYEIGAGMPKPVKAA
FT                   LQQAFVSRPNVTVIAGERGSVLDAKRHGCDVVFMCAGMEPNTSFLGGGSLKASLDEKGF
FT                   VKTGLTGQVLGFPNVFALGDCAKSYAADGSGMEMMSERYRREHDTEKFARRVCALNVLR
FT                   CIAGEALVDKAAKERRWWHAVGTHRGSTAGGGGEGYVYPGAVISLSPSDSVGYVQGSVA
FT                   RGWYMAARKRKDLWRMRLSKKLTGHDGPHYT"
FT   CDS_pept        complement(495261..496679)
FT                   /codon_start=1
FT                   /gene_family="HOG000256695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632990"
FT                   /orf_name="MICPUN_88360"
FT                   /product="Predicted protein"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO67455.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG387011"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="UniParc:UPI000199C349"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH71"
FT                   /transl_table=1
FT                   /translation="MGEPLKYRTDFDKHVVTCNFERRGWERWDPRYDDDWHVFWASVST
FT                   IKQIFAPENGIRLGDHQIVNHFPNHYELTRKDLMVKNITRWRKACEKEAALEANGAGQT
FT                   NGNFNNTGMSATELLPKLDFVPATFSLPSDYSLFVEEFRRRPDRTWIMKPVGKAQGKGI
FT                   FLINKLTQIKKWSNGYAAKDGSSAQWKSAEERRAENEKTESYIVSRYVQDPLLIGGKKF
FT                   DLRVYVVVTSYRPLRAFTSRLGFARFCSVSYSEAKSEMDNPFVHLTNVAIQKRGDDYNE
FT                   SHGNKWPIHLLRLYIAGTRSESVADELFWGINEAIIYSLKSVQNVIINDRRCFELYGYD
FT                   LLIDERLKPWLIEVNASPSLTCTTEEDRRLKDRVIRDTLAVAVPPGKLEAAAGGVSITT
FT                   AMSRLSRGGRSNSVGVSGDVYERDWARTGGVPESVLGTMDVLIDETVVGVGDAVGRRSG
FT                   TAQRGRSVTRGVSR"
FT   CDS_pept        complement(496884..499199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632991"
FT                   /orf_name="MICPUN_64125"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67456.1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="UniParc:UPI000199C34A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH72"
FT                   /transl_table=1
FT                   /translation="MAASAPVLATAATAARVPRPRPRRRVSRRRDPRPVRATEPNQADV
FT                   EASSSRREIERPQLEPKLAEAREVATRRSFSHADDSPALAAKVGPPAEPVRWPLVHARS
FT                   VEALARVLANPGTDAQKVMRQALRAQYRPRGSLVYDENDPARWPGSDAPTNAERGAIAD
FT                   AVLASEVNRLRLAYLAHLAAMDPDNITVPKFGRAALWAVLCDQEIADACEDDLPPDELS
FT                   YLDAADAMIAAHWAGLDDDTAGEYDDTAGDTAVLRDTCFDAAKLRAIRAVVADADSMQW
FT                   PADPATALAARRSVPTWLAAKLIDQHGADVADRVAASLLRKAPMFGRLNRAKQSDVQSL
FT                   LGRLRNEGVESVDMTQWQLNLGAEAEERGEPRASVITTPAAGAPDAIVFPKNRSPFRLD
FT                   SWREGWFEIQDAGSQAVARAAVDAVGESSVSSRLDETETETETRRQRGRRVRVLDMCAG
FT                   NGGKTLAMASELSRRVDVGTIDGYVIDAFDVDARRLRHLESNAERAGVAGNVRVVSLEK
FT                   MRDAARVGNGERCVDGRVDVADPRYDLVLCDAPCSSTGAMRRTPSMRWLIAGDVAEWKE
FT                   GAQGDDGDDNADSDRRDPLRYSTAWGDGDGDGVFAEVDVDALGDTAGENGRNGSSPVTD
FT                   GSRGTRDDLSLPEVQRRILAKAAGLCRPNGGALVYATCSLLREENECVRAWFDTRFGDD
FT                   FVPVPFEAHWPLAPDDVTGDVDEGDVARDDVDEDGNAMDDGTVAPSHGFALRPDLHGCD
FT                   GFYVARWIRKPEPGWEPG"
FT   CDS_pept        join(499312..499647,499742..501049)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632992"
FT                   /orf_name="MICPUN_64126"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67246.1"
FT                   /db_xref="UniParc:UPI000199C34B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH73"
FT                   /transl_table=1
FT                   /translation="MSSRGLARLVRRLASTGAPSPKVASASHLGAIKCDNQGNAWKVEV
FT                   QVGRGSGLLGHLHPRDAPLLERTGSFGDTPATLTSRPGMLIARFQPFSAVIGDSCALLM
FT                   DSDRASSKAAAGAIAGVMSSKSADDAGTPLTDAVAASSEGIDPIVHARIATSSVEHKTS
FT                   ASSSSADIPVDDFPLRALECVLDEATGYYHQKMRRLKLLTDYCLETITDELKTTRSGVA
FT                   GEAGFQRLLPLRRAMTELENDIREAHHAISDAMRSDERVDGLLPRCSRVAYAGDGRNSL
FT                   NANLNANLNACEGASDAATANDGKRTENASEGELSEAEVVARRKATVRLLQTHLWRIRA
FT                   AGGQLEEMSRQVEDTRQVWELFLDGVRNRTVRLNLQATIATLALTVTAVPASLAGMNIP
FT                   SGLEHAHPFVFWGITAGLAAASAATWGRFMGIYRGGTGLSSARAADLRALRFVLQRMDE
FT                   LDDAMRVRGEGGKGAVKTRDDLAGVVREAGLHSGLDGVNVAALDPAALELLFKVFDRDG
FT                   DGRINPSEEWVIRPWPLRDENRRGDDVMGT"
FT   CDS_pept        join(complement(503606..503762),complement(502093..503489),
FT                   complement(501085..502026))
FT                   /codon_start=1
FT                   /gene_family="HOG000256816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632993"
FT                   /gene_name="IFT80"
FT                   /orf_name="MICPUN_88460"
FT                   /product="Intraflagellar transport 80 "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67457.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG358331"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199C34C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH74"
FT                   /transl_table=1
FT                   /translation="MRLNVTSTSNVHKELVACVGWNAFNELYSCGDDKTVSRWDINGDA
FT                   GGKVRTDRYVTDMHWFPAGKGGGSTGGNDVFACSFSDGCFRILTRGGRVERHVPDAHRG
FT                   ACVSLRWNPDGTALATCGEDGALKTWGRNGMLRAVLEQLQHAIHAISWSPSCDAVAAGC
FT                   GKDLYVKSADPGGRKTIRWKAHDGAVLAVDWSPRGDVIVSGGEDCRYRVWDAFGRTLYA
FT                   SPTMDHPTTSCAWAPGGDVFAVGSFERAYLCDRTGWSSPGGGKCQLADGFGSVFGLAWS
FT                   PDGTTLAGCGGGGYVFVAGTVGDAKEWGDAEASVSEADPHAVIVRCVSRENTSSTIELR
FT                   DRASRLSLAHGYLVCVTTNQVCVYRADVQTGRWSNQPACVLDVRDVVTLVLQCRACFLL
FT                   CTGGADGGAARVYGYEGRMICELKTQGFARPESLSDGVVALAPDTCAVVDRNDARVVRF
FT                   LDTNAGRPVGTDVTHDLDVVHVALSQNGQAPDRRCAFVDANRDVYVVPVLRRGADENHA
FT                   LLATMVDDVRWSDTTDMLAAMCDGTLHAWYYPDAFYVDPDLAPRTKLVKHAGQAGVDFG
FT                   KSPRIVAFDGARCTVRRVDGARIACSVSAHAPVLYKHVLANQWDRAIRLCRFVKDDSMW
FT                   ACLAAMAVANKDLNTAEIAYAAVEEVEKVQFVQAIKKIPTEEGRMAELALFRRKPDEAE
FT                   SILLQAGAVYRAIDMHVRLFNWRRALDLAVQHRTHVDTVLYRRARYLEEAQRRETDESF
FT                   KEYSRSVQVDEEAVLAKIAQEGEKEKERARPVGGGVGGGGGGRTSRDTGGAPPSVRSMM
FT                   RESGSASGGSSARSRASRR"
FT   CDS_pept        504119..505321
FT                   /codon_start=1
FT                   /gene_family="HOG000234169" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632994"
FT                   /orf_name="MICPUN_64128"
FT                   /product="Mitochondrial carrier protein "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO67247.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199C34D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH75"
FT                   /transl_table=1
FT                   /translation="MSSTDADRVASGPLAAGSVPKEVTWDGLDKRKFFVVGAGMFSCVT
FT                   CMLYPLTVIKTRQMVDGSAVGSRPPPAMSIVKDIVKERGIPGLYRGFGTIVVGTLPIRF
FT                   VYLSTLEVVKARARVVCEALDLPPMAHGIADAAGGATASMCSQVLGVPVDIISQRQMVQ
FT                   GVAVRAASGEGTVRLRGYRNGVHALREIIAAEGVRGLYRGFGASIATLVPGSAIWWGFY
FT                   GTYQRVFWQLVPAELGGARVRDEGLNLATASKKGPALDKEDPSMEFKAAVARGMAASSA
FT                   RSETGVPAEPGEGTVIGVQVASGVCAGATSGFLTTPLDIVKTRLQVLSGPQGAASAGGG
FT                   GGAVRHTFWSTAAELYREHGALGFFRGVRPRMTSVSIWGTTMVTTYEFLKRTSKIDDAE
FT                   P"
FT   CDS_pept        504257..505321
FT                   /codon_start=1
FT                   /gene_family="HOG000234169" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22632995"
FT                   /orf_name="MICPUN_64128"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67248.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199B986"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH76"
FT                   /transl_table=1
FT                   /translation="MLYPLTVIKTRQMVDGSAVGSRPPPAMSIVKDIVKERGIPGLYRG
FT                   FGTIVVGTLPIRFVYLSTLEVVKARARVVCEALDLPPMAHGIADAAGGATASMCSQVLG
FT                   VPVDIISQRQMVQGVAVRAASGEGTVRLRGYRNGVHALREIIAAEGVRGLYRGFGASIA
FT                   TLVPGSAIWWGFYGTYQRVFWQLVPAELGGARVRDEGLNLATASKKGPALDKEDPSMEF
FT                   KAAVARGMAASSARSETGVPAEPGEGTVIGVQVASGVCAGATSGFLTTPLDIVKTRLQV
FT                   LSGPQGAASAGGGGGAVRHTFWSTAAELYREHGALGFFRGVRPRMTSVSIWGTTMVTTY
FT                   EFLKRTSKIDDAEP"
FT   CDS_pept        join(complement(509046..509081),complement(505475..508933))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632996"
FT                   /orf_name="MICPUN_106505"
FT                   /product="Predicted protein"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67458.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI000199B987"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH77"
FT                   /transl_table=1
FT                   /translation="MAETTPAPPVFACGDKLAVDAYLKSLIEPLPTTLGTPSHGPLSGG
FT                   GGDEPFAAAAPILARLLDAEEALLERRESIARRAARLASAVRDEERAFLRDAPALDTAT
FT                   REMHAALDDLDARVSHVAASSSGIGESLRLAAAHRAATERARLTALHLAMFNARRHDGL
FT                   LDDDDDSLDVDLDDSDDDFNDAGGGGGGGGASPFGLGLDGDEDVVAAVFTDPKRNAEAA
FT                   KLAQSLLELARQHERSRHDRAGEPKPSLRVAVENLERYCDELENRLLEKFERYEAKRDV
FT                   VGMRQCAKTVSHFNGGASLVQRFVATRPMFLKVEALERLDALRDFAPAYGSGLSEEKEA
FT                   SDAAEAALEVLDVFFQETLAEATKEVETARAVFPATCDAVDQLVRRVVEQRIGAAVDAI
FT                   AGPRPPPPPVPGPPAASEGSYFASFMSPRKAPATTTARKHRRNVSFGGDLRGFDPAQAQ
FT                   PAQAPMTDFPASRLGHSRSFGMLEGRPGSGEKGEKETNDDEEEEDTVAPLGEPAQPASP
FT                   AAKTARPKTAGHSRSKSYTEYMTPSFMSSKANGGFYGDPARDEFENSHGVGRDAIVEGT
FT                   PPGAGHFALLAYLKILAGAVDRARALGAALAHVAANAGRRRVDAVNACDALFSERREGY
FT                   GNLEGDCLVGLAASGAAASPGAAPDESGVHESGVPGFDRLIRWHREASERCATVLAPPF
FT                   RDVTALNGSADDDDGDFDGIADAPGERSSSSSSSTAAAAAGGSRVRSVGTSSRVASAVA
FT                   SASALRESVDTELRLAETFVGETERLCRLALDAAVDACERRSGRFDARSDPREVATTGI
FT                   GCVLRAAADALDAVERARDANARLCDAIEARTRDASAEIESDVDAFIQKRSSSSSGDET
FT                   VVEDLTGSLRMARRAAEACRVAVDGRHAECVRDVSDAVVQTLRKGLKSLMFVVEKTLTG
FT                   LQRRADFKPNEEEMETWTQFPGQEPTPACAAALALVREAYNVAAECLAPDESVVESSVQ
FT                   SASANEGFEHPNIRTFAEECASMLHKTVLAHVARFHHTATGALQLKRDVGELDAFVGSI
FT                   CASGRKSSPASRAWRDALDRCNALIIPAHALPELLRETRAAAVADAEAERARRGIEEAG
FT                   GLGENDGDAASGGDDEERRARVAKEAGDNAVEEMVRIIHLRADFHPSMLKVLSPKKG"
FT   CDS_pept        join(509313..509395,509520..511935)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632997"
FT                   /gene_name="CAF1.1"
FT                   /orf_name="MICPUN_64130"
FT                   /product="Ribonuclease"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67249.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199B988"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH78"
FT                   /transl_table=1
FT                   /translation="MDVTRDNFEEALSALQEAIDDPLFAFWSFDCEFTGLNASPTTGHD
FT                   LLDTPEERFAKVHACVRAFTVLQVGVAIFSFDPHTRRWTCRPFNFWTIPDAKAGRGVFS
FT                   AQVASLQFLVDCGFDLNKCVARGIPFVPAAERSRAAAREARLAQRPPIIPSSDRDKAFV
FT                   ANLLIKVAEWLSRSDDDGDGDGDGARDEDLCLDPTNGFLRALTYQILEGDPSRFGGNKA
FT                   RDDPGFIASTSCDFADGRPRIVLSRASREEVATHRAAKEAADRKKDQMKEGFGLVLAKL
FT                   GACGRPCVGHNALFDCVYVVDKFLAELDGSFEGFKREFDRTVKGAFYDTKLIAQRFMDG
FT                   YLDTLQEYGESRPKATRTRRPGSGEGEDAALPGGTSSSRRATDGGGDEGTSSGVRARTI
FT                   STTGNAAADVETAKETANGDASLARPSPGNLPAPLDTALGPLYRALSSRPLPPMWTEEL
FT                   LRERHGSTRAEAAANAEAEANEPFGGAGTQWRGDGGAILDWIAFPDAFQRYDSALRIVP
FT                   NRSQRDDVVAAAYGTHKRVSHSFGFEHEAGYDAYMTGVCFIVMVLHSRGVMASSEHGQV
FT                   RVFADPDAFAGVDAATGLPDRNRIGRLGTCAFSAADGVVPLQRSDMSQMSLRPGTVDVV
FT                   PDRGNVYFLVGVTQGTTTAAVAQLLAAAGLGIPLHIVFVDKGTVRVIMHGKQYAGNVAH
FT                   THYAGAFGGGLRSNRRDPGATVMRDRLRAVGAGVEVLAYTEWVRAKAYERETEASNAAA
FT                   VAANLAAELAKRTRSTAQISAEVHAGTYYSRSASLSGAGGFLGALLGRSGSKRRREDGG
FT                   APAGFPPRKRTRSEYGCVVM"
FT   CDS_pept        complement(512065..512907)
FT                   /codon_start=1
FT                   /gene_family="HOG000180645" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632998"
FT                   /orf_name="MICPUN_64131"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO67459.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG289811"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniParc:UPI000199B989"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH79"
FT                   /transl_table=1
FT                   /translation="MAGDGGGTYPVIGGGDASKRPVAGAPSSSDGACPDGYDPLVWQAR
FT                   VDLAACYHLCDQMDMNEGICNHLTVMVPGTTDRFLCIPYGLLWTEVTASNLLLLDDAGN
FT                   VLEGEGTIDATAFFIHKAIHKTGVTCVLHTHQPYATALCCTKGFRLRMCHQNSLRFFDE
FT                   VAYDPVFNGLVLDDTEGDRLVAVMGGKSVLFHANHGVIVCGPSVAEAFDDMYYLERCCK
FT                   VQILAMSSGEDLNIVSDEVAKKFKEDCASDGGKANWAKLHFDALKRGLMRGPGRIFRE"
FT   CDS_pept        513189..515012
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22632999"
FT                   /orf_name="MICPUN_64132"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67250.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199B98A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH80"
FT                   /transl_table=1
FT                   /translation="MSVPKTSSEVWHILEVRTSRAAAVGGGHHAEIQSLSHRRAFGPKN
FT                   GPRLRRRRTPTRRSTTARPDPRPKPIAQERETERDDELQDIEDLVDRLKSGAVIDRRDA
FT                   LMDLAGKMAADERVACFAESHGARSLLLRGLDAAVKRGDEELIDAVSAAVAENSRAHAK
FT                   EHKQVELKAVAGSQVGAAAQRPPGVEEVRLPGLGRTLRVHESSWGDAGLAWRIWGSAKI
FT                   TAHAIDAANSHHDDAGGEARVHAWEEEEAIILGRKRSMDGTKPMGDTARRKSEGARSIV
FT                   TAATTLSEGDGSCDGASSRGDASPGGDSPGGDSPGHSSRASPTLGVRGLTVLELGAGCG
FT                   LCGFAAAAAGAKEVTVTEGAPGALAALGRTARDNASAFEGCAVRVKFLDWRDDQAALDG
FT                   EEVVAVETNESGEMIDVEQRRTAAAAESNDDVNVGSYPPRAGGNWVHRLHGGAAAARTL
FT                   DRLRDSERFDVVVGSDLLYDDAHAEPLAASLARRIAKPFGVAHVTLAVRRGELLEALAR
FT                   AASRRGLLVGAQAAEPYLEEEEALREATGGHITRAEPEGVGAWRERSGAALAAGEGVIL
FT                   PVGRSSGEEMREAFMDAEGRVAMLTFRWPQS"
FT   CDS_pept        join(complement(517813..518182),complement(515088..517636))
FT                   /codon_start=1
FT                   /gene_family="HOG000242613" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633000"
FT                   /orf_name="MICPUN_104126"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67460.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="HOGENOM:HBG722112"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199B98B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH81"
FT                   /transl_table=1
FT                   /translation="MLAGSTTPAGDLACRAATSLAVRARATRTFARHASTSHATRNGGF
FT                   AAGPVRRHSKFWGERCSPAWRRSMSVRSAVAFPDDAVESADSDEENDDKPPKILRFNGD
FT                   KISLHKTNGNGNGRRAASGVYELDVDADDKRAASSATDDDKPSNLAGLIDEVAIVEDAA
FT                   EARRVLKILMANTGDADRPVYHAVDTEVSHIDVSEQCPVGHGRVTCFSVYCGPDVDFGA
FT                   SQSGGNGSKNSRKNGSTGPAGGKPKTLLWVDTMSLGDEGWKIFKPYFESPDVKKVWHNY
FT                   GFDRHVIENHGVKLAGFAADTMHMARLWNSNRKLEGGYSLEALSSDPKVMSDAGEMYSE
FT                   AGEELIRSKRGMKKIFGKAKLKKDGTPGKTVILPPIDEIQTDPEQRETWIEYSALDAQA
FT                   TWFLRESLEAKLRGIDCEACPVLSKKPTFRRCSNLWDFYVHYLREFGEVLTDMESNGMY
FT                   VDKAHLADAEKRALEDKKVAEDYFRAWATGKCPAAEHMNVGSGIQVRQLLFAGAPNKRR
FT                   DKPGVEKTREFAMVSKEWTEWDENGREGKAPKKAAKFELHGITKRNLQPPVYTTTGLPA
FT                   VSSVVLRALAGKPGAARELVDNWDALADDQKKDEALAKKCGSAFLAFGGGFDGVEACAA
FT                   IDALNDVAAIDTLLSNFIIPLQSDNLRGFNGRVHAALNINTETGRLSARRPSLQNQPAL
FT                   EKDRYGIRKAFSAEPGNILIVADYGQLELRLLAHMAGCVSMREAFEAGGDFHSRTAMGM
FT                   YKEIREAMEQGKCLLEYGDIDDDAGGEKPALVKDMFASERRKAKVLNFSIAYGKTAHGL
FT                   AKDFGVSTREAEETVDLWYSDRPEVREWQAVQHKKAAEKGKVNTLLGRHRNLPEASSSD
FT                   EMRRGHALRASINTPIQGGAADIAMLAMIQIHRCPRLRELGFKLLMQIHDEVILEGPEE
FT                   HRDEALALVKLHMEKPFNDHENLCDVELSVDGDYAKTWFEAK"
FT   CDS_pept        <518893..>521328
FT                   /codon_start=1
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633001"
FT                   /orf_name="MICPUN_65270"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67251.1"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333519"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniParc:UPI000199B98C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH82"
FT                   /transl_table=1
FT                   /translation="HACAYCGIRDPACVVKCVATDKWFCNSRHSTLPASCIVYHLVRSR
FT                   NKEVQLHADSPLGDMVLECYLTGQRNVFTLGFVPCVDDEVVVLLARDPSMGVAGGAAAK
FT                   QLADMNLDLAQWQPLISDKQFLPWLVKSPDEKTQVRARALTYAQANRLEELWKTNPNAG
FT                   LDDADVLDDDEELQPVALRYADAYQYQNVFGPLLKIEADHDRAQKESQSKDGLRVRWDV
FT                   GLNKRRLAYFSFPADEEIARLVVGDALRLRHAAYPAGKDQSGGATWSAEGVVLKFTDRE
FT                   EVVLELRSGSGDAPVEETNGFSVDFLWNSISFDRAQAAMKAFALDETSVSGYIYHLLLG
FT                   HDVEPKPLAVTLPKKLSAPNLPPLNHSQESAARAVLQRPLSLIQGPPGTGKTVTSATIV
FT                   YQLAQQHLGQVIVCAPSNVAVDQLAEKIERTGLRVVRLAARSREHVASPVEHLTLHYQV
FT                   AHLDSPETAEFKKLQQLKDELGELSSNDERRHKRLKRKIEREIIAAADVVCVTAVGAGD
FT                   PRLADFRFRQVLMDESTQATEPECLIPLIMGAKQVVMVGDHCQLGPVVTSKKAARAGLG
FT                   QSMFERLISLGVQPIRLQVQYRMHPCLSEFPSNAFYEGALQNGVAAADRLLTHVDFPWP
FT                   NPTSPMMFWSMTGAEEISASGTSYLNRAEAAGVEKVVTHLLRAGVDPGRIGVVTPYEGQ
FT                   RAYVSQHMTRAGVLATRLYGEVEVASVDAFQGREKDFIILSCVRSNEKTGIGFLNDPRR
FT                   LNVAMTRARSGLVILGNPKVLSRQRLFHDLLNHFRDEGCLVEGALDSLRQSAVALSRPK
FT                   "
FT   CDS_pept        521781..523505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633002"
FT                   /orf_name="MICPUN_52024"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /protein_id="ACO67252.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniParc:UPI000199B98D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH83"
FT                   /transl_table=1
FT                   /translation="MNFFNQRGKFSRILVRDDANQPAGRTPDASWSGSMLPRSLTVRGD
FT                   AGARHELPASHQPSAAGTVASLAPRAPAPSHKLLSLSHSTRHHRPRASSGSDAEFDADK
FT                   DGAEPTASTSICAQMAHVGRRGRTPNLYWLAPHDEQLRRHPRFVALPPVEDVVVGHESS
FT                   YRYVRQHTELWDDLHAGRITTGCLTAALGFQEDGVCKTLGMGRGRGGDHGPLLGAYRRL
FT                   RLGTMPTPSGMSRAEEERANAERTRAYNSGLDALGPAAPIDGGSDDDDGDDPIVAEDLA
FT                   AGATTSGGVEGGGDGNTQKKNKNKKRRPKKRPKGAAPKRDASALVGDATPWAAARAMRC
FT                   KMAARRGEGGVRMAWGSAQEAGTVATLMLHHPECVCEEVGLCCVDVDRWRDEWGLGATS
FT                   VPPIGASPDAIVRFPTKDSGSGPGWERLVVEVKNHSPFRRDPGKPGVFYVNDRTPFETP
FT                   PPYHVPQLQMEMLAADTRAGLLCMQSATRGVRVFRIERDDEYCAGMLRTLGAMHEEYVL
FT                   RGREPPERMFSDRDWYFDLVRRTVKIAKGATLWEEIPYHARLPGEAYDERPFLPASG"
FT   CDS_pept        complement(523695..524516)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633003"
FT                   /orf_name="MICPUN_109487"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67461.1"
FT                   /db_xref="UniParc:UPI000199B98E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH84"
FT                   /transl_table=1
FT                   /translation="MSAMSAMSAQRDLLTLLGRGSVQTPMMPPGLMAPGGPPGLNNLES
FT                   IFGGGGPGLVGGGPGASIAGLQSMPGHQHAGMLGHQQRMAAPPPGFGQASTQNPFDRVS
FT                   TPAQLAHQQPPQPQTQFPPQTQQFGGQPVGPPGLDGMFRQLSFGSGSAEINQQQPPPPP
FT                   PNAFDGGPVQMNPPTHGGVNDAAQMQNGVRALRRPQPGDGAYVAAAAPEAPNGTGGGGG
FT                   GGGRRNRGRGGGGGVNGGGGKGGKGKGAAPPPPVSTGPKTLPKPRAVPPKA"
FT   CDS_pept        complement(<525174..>525437)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633004"
FT                   /orf_name="MICPUN_77083"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67462.1"
FT                   /db_xref="UniParc:UPI000199B98F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH85"
FT                   /transl_table=1
FT                   /translation="ARVPLIKFRDPRTGVKCDVCVGNDGVYKSAVLGAMADLDSRYRDL
FT                   VFLVKMWAKNFDCNDATAGSFNSYSLSLMSLFHLQTRSPPILP"
FT   CDS_pept        join(526863..527009,527237..529246)
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633005"
FT                   /orf_name="MICPUN_106506"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67253.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI000199BA1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH86"
FT                   /transl_table=1
FT                   /translation="MNAVVAQPAAVPRQFAARSALRRNAGKAASAAPARARRSVAVRAA
FT                   GNNEDKTVAIASIAAFLAAAPLAAVADDFAPPAQEAPASALAQFQAQAQSAMSGDSLTA
FT                   PDTKVVDPNALPEGNTWRYSEFIRAVMGGKVERVRFAKDGTSLQLTAVDGRRAQVTLPN
FT                   DPELVDILAKNGVDISVSEGDQQGNYASLFGNLLFPLLAFGGLFFLFRRAQGGEGGGGF
FT                   GGMGGGGPMDFGKSKSKFQEIPETGVTFVDVAGVDGAKLELQEVVDFLKNPDKYTQLGA
FT                   KIPKGCLLVGPPGTGKTLLAKAVAGEAGVPFFSCAASEFVELFVGVGASRVRDLFEKAK
FT                   SKAPCIVFIDEIDAVGRQRGSGMGGGNDEREQTINQLLTEMDGFEGNTGVIVLAATNRP
FT                   DVLDSALLRPGRFDRQVTVDLPDVAGRIRILKVHARGKTIGKDVDFDKVARRTPGFSGA
FT                   ALQNLLNEAAILAARRDLTEISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYHEAGH
FT                   AIVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVAMGGRV
FT                   AEELIFGAENVTTGASGDFQQVSRTARMMIEQMGFSEKIGQIALKTGGGQTFLGNDAGR
FT                   GADYSQATADIVDSEVQALVEVAYRRAKDLVQENIQCLHDVAEVLLDKENIDGDEFEQI
FT                   MLKAKAKLYLKDDNSAVDVPFKTA"
FT   CDS_pept        complement(529460..529798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633006"
FT                   /orf_name="MICPUN_64138"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67463.1"
FT                   /db_xref="UniParc:UPI000199BA1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH87"
FT                   /transl_table=1
FT                   /translation="MSSTKRNNAQLDRSYKRARGIKDDRRGPKVDPNTILRIAFIAMGL
FT                   KALNEHVKRTHGINAFAHGKRLAVDAIRDVRSAFSRMLAPKSGGGRGDRGRPNSRSFKG
FT                   KGKRLGKR"
FT   CDS_pept        529909..530646
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633007"
FT                   /orf_name="MICPUN_64139"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67254.1"
FT                   /db_xref="UniParc:UPI000199BA1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH88"
FT                   /transl_table=1
FT                   /translation="MAAGNDGAGATPGGGTMFAPKVFTCMLEQARCAPQPTLRPSPARL
FT                   ARPAPGAHDVPATLAHRPSPLSPPSPPRRLPDGDVGACGPAYHFPNLPHSPRFTRVWVQ
FT                   GVVVWTDGGGDDGDGRRRCVDRFALDDGTGPPLRIATPPSCHCASTRDPFTRRTPGVGD
FT                   YVACVGFVVPNEGGGHVTTSSDGDGAGEKNDGQQRRRGCPRFTLVAERVHDLSREGDAQ
FT                   REAMWNVEVPEAFKTLEAAHAAG"
FT   CDS_pept        join(complement(532546..532711),complement(530851..532385))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633008"
FT                   /orf_name="MICPUN_64140"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67464.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199BA20"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH89"
FT                   /transl_table=1
FT                   /translation="MSEERGGGAAHRALEHFEGELMFEGEWIPPTPFNGIAFLAAGAVL
FT                   RHLHRRTQARENGEPNPTRRGRRRHGNERGHRWGRRRTSRDDDDDTAGGAGNDLRADPS
FT                   GAVEAASASAAGGTAVRGFSGGDGRRRTDPETDPVTRLAAESREAHLRRVAAALAARHG
FT                   PNPSIEVHPDGAPPPPSPSVGEILPEGLPETDQILPELPSVPGTVSPATSTLLAAESLP
FT                   ETARSQIAFFRRLSQDGGRRTERDGEGAVEEGALEEGAEEEGAADEGAVEEGAAEEGAG
FT                   APPMNDLVGADDPEQRTCRFCLGGEEEGATGDGALIAPCRCAGTQRWVHAGCLREWQRV
FT                   SVSSTGRVERRCRVCRHAFRLPRPPIKDVLTQWFNPTATDRLQCYRRAWWQMLSNSIMA
FT                   QEGVEHIGTANQLVRLFLATELRVWGGREVRGGNGALRALARAARLCTNAHSVVLLTWL
FT                   ASIGAAHVGERIARRDERRMNNLTVVTRLANTNGVVTDGGPSPVPADAGGARVGKLAGV
FT                   LDRLRRAVGGPLGWIVRLAVPGTTRAMRLADPVQAAISFFERYPQYRVM"
FT   CDS_pept        join(533015..533083,533216..533533)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633009"
FT                   /orf_name="MICPUN_106508"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67255.1"
FT                   /db_xref="UniParc:UPI000199BA21"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH90"
FT                   /transl_table=1
FT                   /translation="MGPVARILVIALVAMLVYTAPAEAKSNKQRRTQSLDREVKARRSE
FT                   CEEEMKLDARCGASQIDFDNCVLRCVSETCYDSVYGADALEEGEVDVVRGRTFRSCARN
FT                   ELRNLKVAENQRSKEDARRSAEAM"
FT   CDS_pept        complement(533646..534296)
FT                   /codon_start=1
FT                   /gene_family="HOG000006092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633010"
FT                   /orf_name="MICPUN_109491"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67465.1"
FT                   /db_xref="HOGENOM:HBG610297"
FT                   /db_xref="UniParc:UPI000199BA22"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH91"
FT                   /transl_table=1
FT                   /translation="MATLAANGVSIRCAPRATRIQRTRSCPPTRAASDTGSARLRVRVR
FT                   ASSNDDDGTGAGVRTKEVDVDKELKKNAAKIAGTFAPRSSTAKKNPAFKGSALYTIFEV
FT                   QAYLSLVVGSMLSYNVLLPSDEPNIARLMGMWSVWMFAVPSLRARECDAKEKDALNFLF
FT                   IAIPLVNVLIPVVWKSFAAVFTADCLLMAYMYYDKGAGIFDDGSEKAAEEPTA"
FT   CDS_pept        complement(<534932..>535543)
FT                   /codon_start=1
FT                   /gene_family="HOG000068029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633011"
FT                   /orf_name="MICPUN_72450"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67466.1"
FT                   /db_xref="HOGENOM:HBG507134"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199BA23"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH92"
FT                   /transl_table=1
FT                   /translation="DEPLDKYLARLTHLKMDGRNIARIDALGCAPGVRVLYLYDNAITR
FT                   IANLAPLANLTHLYLQNNALTRIEGLDTCANLQKLYLDGNSIAHVDGLDPCQRLEELHV
FT                   SGQRLGPGEELRFDADACAALARTLAVLNVGHCNVRDVKPLKELASLRRLDLENCGVES
FT                   VRDLEPVLLNCKRLVEVKVLGCPFAKNPKHRDHITLLSDSL"
FT   CDS_pept        <536111..>536356
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633012"
FT                   /orf_name="MICPUN_77172"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67256.1"
FT                   /db_xref="UniParc:UPI000199BA24"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH93"
FT                   /transl_table=1
FT                   /translation="KKEAFRKYLESAGVIDSLTKVLVSLYEEPDKPATAIDFLKANLGG
FT                   PTPAEYEALEEEKNTLAAELEATKKELAETQAKLEAA"
FT   CDS_pept        join(complement(537743..539743),complement(536534..537676))
FT                   /codon_start=1
FT                   /gene_family="HOG000163047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633013"
FT                   /orf_name="MICPUN_88392"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO67467.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG610926"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="UniParc:UPI000199BA25"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH94"
FT                   /transl_table=1
FT                   /translation="MPTAQNAPSEAAAAARAILAARKPPPPADDGDSDEEGAAAPQAPQ
FT                   RSSCRHSVAVPPDWQGDRAALDAPSYDGERAKTYPFVLDAFQETSVSVLERNESVLVAA
FT                   HTSAGKTVVAEYAIAMAFRDNQRVVYTSPLKALSNQKFRELTEEFGDVGLMTGDVCINP
FT                   NASCIVMTTEVLRGMLYRGSDVVREVKWIIFDEVHYMRDRERGVVWEESIIFAPAGCKF
FT                   VFLSATLPNAHEFAEWITHLHNHPCHVVYTDYRPTPLQHYGFPKGGNGMVMIVNERKEF
FT                   LEANYAELEAKIDALTQSAKKRKRDERVKADGGRGRGGGGRGGGGRGGRWGRGGGRGGD
FT                   SGEDASEVDIKKIMKTIRARDLYPVIVFSFSRRACETHANDLMTGKTQLDFTTQEQKEL
FT                   IRQIYDNALLCMAEEDRELACVQKIFPMLERGIGIHHGGLLPIIKELVEILFGESLVKC
FT                   LFATETFAMGLNMPARTCVFTEVEKFDGKEMRVLQPGEYTQMAGRAGRRGKDDRGTCIL
FT                   MLDKKLDKEELVHMTCGTGSALMSEFKLTYYSILNLLRRASGEEDAEYVIQRSFHQFQH
FT                   TREVPRKKLELQEITAEADGIQLDMSDAKAELVRLQNAARDARTALMHHAVDPEKLTRD
FT                   VLKPGRLVRVRDGDDEWGWGAVVGVRDLPAEAMRVRRRAIDVLIHCGPGVDSGVLRPAK
FT                   RILGRPGKLAEKGCTCEIIPVALRLVDAVGAMVLTLPRDLTDATSRAQVGLAINELHHR
FT                   FQGKAVPELDLENDLRLDGDEFHESMGRWLRSESELRAHPLYAASTKEGGLNEKQIELY
FT                   RKKASLMERAQDLKKEIKTTQLSKFREELRDRSRVLTRFGMLDEEGTVTHKGRAACEID
FT                   TADEVLVTELMFNGCFVAMDHHALVALCSMFMPVEKTNEVYPLAGAAKEALEGPVKQLR
FT                   EAAKAIAEAEIDFGVRTQAAEGEDGRHEAVTEYVDSFKDALVGMVYDWSKGTNFDTIMR
FT                   GTDMFEGTFVRAARRLDELMMELHRAARAVGSAELADSFEKGAESLRHGVVSAASLYL"
FT   CDS_pept        join(540329..540439,540590..540667,540813..541691)
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633014"
FT                   /orf_name="MICPUN_107230"
FT                   /product="Putative uncharacterized protein "
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ACO67257.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000199BA26"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH95"
FT                   /transl_table=1
FT                   /translation="MGAYLSQPITDKESTDGEDAKFKYGTTAMQGWRTNMEDAHSTVLG
FT                   LDEDTAFFGVYDGHGGKEVAVYISRHLHEVFKECESYKRGDIPQGLIDAFLAMDTNMLH
FT                   VSGKDELNELAGKSDGGRGGADLSSKMRQAILARARANGDDVDFEDDLDDEGPWEGPQA
FT                   GSTCVVAVVRGDKLVVANAGDSRAVLSRRGEALALSRDHKPMDDDERARIVNAGGFVQE
FT                   GRVNGSLALSRAIGDLEYKQSKNLPAKDQIVTAYPEIRECVIEPGDEFMVIACDGIWDV
FT                   LTSQQCVDYVRARLDADVQLSKICEELADECMAPDTKGSGIGCDNMSVVIVLLKDTAFV
FT                   PGADGKPTLRPRSAF"
FT   CDS_pept        complement(541963..542934)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633015"
FT                   /orf_name="MICPUN_104135"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO67468.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000199BA27"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH96"
FT                   /transl_table=1
FT                   /translation="MIGGPSVDADADADVLSSALPTHVSKAAHDPVVAKPPSARARVPR
FT                   RDTPRSPLTRDLFDGGHGTSESDDLDEDDLAAIARGLEQRTAALKLGVRATHARRIGAV
FT                   DAALAKLQLAVAGADGAKVHPNTHRATTSTRLDATDNTHTHADGHRARSQQDARDRRRL
FT                   LNRVGVDLAATSRSFGSAVDARVRDASNKVLRGAPSRFAAEAAASGVITVGTTTNDKNA
FT                   KAKGPGGSTKSVKIKPVADDPDAEVTGELKFNAQSVKTQPLRDWLLAHFDKPYPDDEDK
FT                   VKLAEASGMTRAQVGNWFINARVRIWRPMVLRLGEEIERESD"
FT   CDS_pept        complement(543633..544094)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633016"
FT                   /orf_name="MICPUN_109493"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67469.1"
FT                   /db_xref="UniParc:UPI000199BA28"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH97"
FT                   /transl_table=1
FT                   /translation="MTDFTIETGEAEAAKFHAAFAAGFAANNHAETMAGMFAEKIDVEW
FT                   SDGFAGDKTPSEVFEQFAKSWGFMVSNFLWSPDTIVDTSNDKIIMFGRLIINIDGKLGS
FT                   PNLIDNKLSFVLKYDSAGKICQWTGYWDNTYAPMLEALGKVSAALEAAK"
FT   CDS_pept        join(complement(547016..547515),complement(546784..546853),
FT                   complement(544255..546606))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633017"
FT                   /orf_name="MICPUN_64149"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67470.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000199BA29"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH98"
FT                   /transl_table=1
FT                   /translation="MPAGIAVDATPSARLPPRHPHSPPSYREVGDLIGVNDGKSGCGRV
FT                   GPRSPPERLRRSSGAGPSSRAVGGCDLGSSEDDRVEAEPKTPTTRRAPPSYEDALLSAR
FT                   RIPPKSPPRPGAEHDGERGPKKPTRAHQPRPIARVPRRTPVDPSIPSSRHSQRERSTTR
FT                   SGSRYEEIRVTYPAARARQLTALEAYKTAAPEARLPGGEARAALAVTGIHHLHRAEVWA
FT                   EALHAEHKETAADRCYDDYLEEGLRSRDFAAARERIRCDVPCVFPSHPRFVRTGPRTAD
FT                   GWGGDACPRDRRSGLSRTSSRDLSGSLYESSSGSLYGSACDLSLADDRSGSSFTDAVSG
FT                   RLDYCLLDALERVLVAAAVRSPQGYVPFAATVAGVLLLETDDEENAFWMLAAFCEDVAP
FT                   WAFTAGALPFLAECATLDRAVAAEMPALDARLHRAAVRPSLLCAGWLTKFGVSVLPGES
FT                   ALRLLDAIVLEGSDVLPQAVLAFLRAHGDQILSRGKGCGAALLDAADDVAAGSFVFDEV
FT                   VEDAVHSARCARESPAWCRLRADARAAVHSRASALGSLRELDRSFGRFAEENRGVCRDE
FT                   FDDLVWAAYPVGVEADDLGVEGVDPTADVSADAATRAFDLARREVAEEHGCGFGSGFRT
FT                   NSAPETPRSARSCVSSLCGSRFGDSSDEAHVVSHARWRAHCDRDPALKARLRVANLPGD
FT                   AADARVRALLRGVDGGFGYAARLGGYASANCTSASEDEKNPGGTNPGGAPSPAKLASAV
FT                   RTAHAAMGVLDAGARSGAFPMNRHAAAALESAMLFAGGGVGWLEKIRFGARGSMVLASI
FT                   EATVRAAHMDSRDAFHVSVIASRDVVPSVTSLLSWSTPFFDRTPHTRYHLLVQSPGSAP
FT                   YVLCKRYSDFKQLHADAEGKGLAADVGPSLELPTGFGSFSSDPSVVARRRVALQRYMDA
FT                   LACSGSAGALAHLRVFLQLDSPPRAKRRVRGACYIGCDGFFGA"
FT   CDS_pept        547748..548515
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633018"
FT                   /orf_name="MICPUN_64150"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67258.1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="UniParc:UPI000199BA2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EH99"
FT                   /transl_table=1
FT                   /translation="MTPLTRALAGPARALARSGRSPRAPARRLVAAASAPSSSSSSNDA
FT                   GVLVLFAPTLRATERVAALLAADARRGDVLCLHGDVGAGKSALSRAYVRAVVGDPHVDV
FT                   PSPTFLLQQVYDDHCDGDDAGPPPVHHFDLYRLKGPGDCDRLGLEESFATASSLIEWAE
FT                   RLGERCPGERLDVYIDAAAVGDGAGASGGAVVVVEDDDGEEHEEDGDDDDDDEEDDDAD
FT                   PAFVDRKPRVIRLAPRGDVWRRRVDALAAKLAR"
FT   CDS_pept        complement(548557..550332)
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633019"
FT                   /gene_name="HSP70"
FT                   /orf_name="MICPUN_52033"
FT                   /product="Heat shock protein 70, putative chloroplast "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ACO67471.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000199BA2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA0"
FT                   /transl_table=1
FT                   /translation="MGPLAMPSGRDARTGAVASSSSPSASSRLSARRRLAPARPRPRAP
FT                   RDERAPHPSSRRGRALRVTTRAASICGIDLGTTNSAVAIVVDGKPVIVADAKGNRTIPS
FT                   VVSFAADGSVLVGHDARRRLAKDPANTFSSVKRFIGKRFDSKTVKDDAQRVPYEVVAAP
FT                   DGGVALRCPALGADVTPVDVSGHILATLLATAEDGAGVERGDIKRAVVTVPAYFDDAQC
FT                   AATIEAGKRAGLEKVKLLHEPVAAALAYGVDVEADETVFVFDLGGGTFDVSVLDVGGGT
FT                   VEVLATGGDAHLGGDDLDRALAVWLAKEAKSLNAEVDPRGALMAARRAREQLSEAMEVA
FT                   IPMPGGAVKTLTRPLLEKVCARVLRSMRLPVEIAADSAGINLEALQAAATKGGKGIKNK
FT                   RTLARRGGRPFDHILLVGGATKTPAVRRFVENTFGRKPRPGLVNPDEVVALGAAVHAGS
FT                   LEGLLAETETLGPMQASLIRAFASKMRRERGEEAFEDLLVDADESLFGDDSFDEDDQLV
FT                   WTEEAMAAAAAAAGLDLLDDASGDDDDWGPEDLNDLLRELEDEFIEEELDELDELSVNK
FT                   DDDEGWPRSSWPRRA"
FT   CDS_pept        join(550485..550602,550703..551835)
FT                   /codon_start=1
FT                   /gene_family="HOG000159961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633020"
FT                   /orf_name="MICPUN_64152"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67259.1"
FT                   /db_xref="HOGENOM:HBG717153"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI000199BABF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA1"
FT                   /transl_table=1
FT                   /translation="MDAKIAQFCQVTGCADPAKARFFLESSNGEIDAAISAFFEHGDQD
FT                   VPVAANPDPAPTEPAGGASGTGTAPPARASSNPRRGPARLDNVRGLGDVRGDGDDDDDD
FT                   DKPQEWYTGGAQSGSVVQDPKKKPSRVEDILDGARAAGAVDGTADDLNPSGSDNPNTAG
FT                   GARRTAFSGSGRTLGGNGRESTAVGVPPDAAGSAEGGAPPGATTPTPTSHVITFWQNGF
FT                   TVDAGGELRRYDDPANAPFMQAVANGQCPPELAPADRNQPININLVRKETEYEPPPEPK
FT                   YRAFQGSGRTLGGSSSGPSSDAAAAAGGAGVTPGGSSSGPSSDAAAEGSGAGAWSVDEG
FT                   APTTSVQLRLRDGSRVVGRFNLTHTVADVRAFIACASPANASGTYSLQLSGFPPKRLED
FT                   EAQAVGDGLANSVIIQR"
FT   CDS_pept        complement(552039..552422)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633021"
FT                   /orf_name="MICPUN_109494"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="ACO67472.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000199BAC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA2"
FT                   /transl_table=1
FT                   /translation="MRALCPHVGRGGAAPVRCLGGVIGRMEPETLMRSTPELIPGLCEA
FT                   FNSPSADVRKAVVDTLVSMYDVLGDWLLPQLSGLSPAQQKLVTIYINRAMEKNGVGGGK
FT                   GTAKAGAISIGDASRRPLAPRHQ"
FT   CDS_pept        557182..558165
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633022"
FT                   /orf_name="MICPUN_64154"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67260.1"
FT                   /db_xref="UniParc:UPI000199BAC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA3"
FT                   /transl_table=1
FT                   /translation="MTTVHTPTGPPKVRAAKSWDKLRRKPSWSQPSSPEEKDAVAAGKR
FT                   SPDENRAGRSSNTHDEGAFAGAMAKLKVSPPKGTAGARRGESSSPPKPAPASAQKKPAE
FT                   TEQPPTRSAQDARVSSSAEPSSTTSAPGADAGGEDGLDRGAAFEWLLQRQIEVEMTLRE
FT                   KKVASAEDLEHVAETFRDLNQLFLELHAAAAELTVANKRPCSVAALFQELLHKIAGVNA
FT                   GLGMEGQRGEGNVPMHQAKVLDRRHRTSTECGDVNMVLGPERVRGMVLRVRDLRQALRI
FT                   KVEDANDVRMAEEAVKAGHAFWTKLREHANAHGADAFAALAKLRDA"
FT   CDS_pept        join(558494..558639,558739..559471)
FT                   /codon_start=1
FT                   /gene_family="HOG000182245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633023"
FT                   /orf_name="MICPUN_98326"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67261.1"
FT                   /db_xref="HOGENOM:HBG715523"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000199BAC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA4"
FT                   /transl_table=1
FT                   /translation="MAQGENAIDMMLDLYFSFLRRKTDFFSQGEMCERAVQSAFERQRA
FT                   IVAKQAEEDEKRRARVKQAELERKMAEQAKAADGSDKIQEITDEEAEKIKSGGDDDDVS
FT                   HDLTADEDDQDKLAPGTMMPNSGNGGEAEHYVWHQTLTDVDVRVRIPVGTPAKQIVCDF
FT                   KKSKWVFGLKGATPMIEGDLYADVQIDDCFWTMEDKTTVLVTFQKKNDMEWWDCVVRGH
FT                   PCIDTKKVTPENSKLSDLDGETRATVEKMMFDQQQKMQGKPTSDEMKKQDMMKQFMDAH
FT                   PEMDFSQCKFS"
FT   CDS_pept        join(complement(559766..559965),complement(559592..559652))
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633024"
FT                   /orf_name="MICPUN_87987"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67473.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniParc:UPI000199BAC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA5"
FT                   /transl_table=1
FT                   /translation="MAATVPVNPKPFLNQLTGKPIIVKLKWGMEYKGFLVSTDAYMNLQ
FT                   LASTEEYVDGKFAGNLGEVLIRCNNVLYLRGAEDEGGDAME"
FT   CDS_pept        join(560454..560481,560838..564010)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633025"
FT                   /orf_name="MICPUN_64157"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67262.1"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI000199BAC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA6"
FT                   /transl_table=1
FT                   /translation="MSAGGDAPGDLARFFAREDGWPRPFERRSASHTHVRPVASSRANK
FT                   QAASINSALIGNSALVGDGVSNGGGDGGGGGAGQHGSPGSSFSKQDARRASTDRGSKWR
FT                   EDERDTGGTHRSRGWKDGSFGDKKRDGRRGRAQGDEGSHTAGGWSGSAGDIPGLNRRTD
FT                   SKEPTRPGGKGFSMGRGRGGGLGGGLGPRGGGLGAPIGFGASPAVHATDEPKVRHGPVK
FT                   YAYTREDLVSMLERLAAASGMNGELPHPPDGIDPETVPLKTVKAGDSMYELTVEGANRG
FT                   GGNARISGNSSREWTQGGGGGQGVLTQGVPAPNGKVGKEVPEWADATATGGGPNGAPAA
FT                   GFLGSGAVPRLTASERSVVFGESQTPSSDADVGALDRKMHAAAQQAAGGFFGLAPGGGG
FT                   MDGKLIGALESDGENTNLGGGLDDAVDPPLHSTRNQTQNQTQNQQGVPPPTGPITDAPW
FT                   FYLDPSGTHQGPFKRAELLEWHDSGYFPLDLPLRPADAPPSMPFVPLAEMLECGWRYPG
FT                   PRVAAQMRAEHEAQIKQAAAQAREAQEAAMRARAEAEAAERERAQEAMRQREEAARQQQ
FT                   MQEMQRQQQMQEMQRQQQMQEMQRQQQMQQQMQMQQQNGLHFGTSPPVPPPQQGGQTLL
FT                   ANIFAGGGGGAGGGGGGAPGGPARGAVSLADLERSMSLPMAPAPGSFDAASPPSTGGSG
FT                   WPNPASQTPHSHAQTHAHHHPHDTTQQVPASPPAKPAWGGASTEPPGGNSGVKSLAQIQ
FT                   AEEEARAEARRREEEARSRANAPVNPVVGGVWGGGGGGGGPSLAQIQAEEMRRAEAARA
FT                   DVTAGAHETTRTNAAPPGGAWGGRPSAAVSQPLPGGGGGGGFWDSLPPAATQPPAGHQR
FT                   PGLTQQQQQQPRSEFPTLGATAAAAARAGGGGGGGRAAVLPGGVVGGLGGHVGPGGQSD
FT                   AGHPTAPTTKAQFREWCRSEMKALHGSDDTTLVDFLVSLPSAGEVTEYVQLYLGDTARA
FT                   AAFGKELIRIKRTNPQIMGGLAGGGEFAGVGPSAASGGSGSSGGVSGVSGVTRDTAGGP
FT                   GEHDGWSQQPKKGKKKGK"
FT   CDS_pept        564305..565645
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633026"
FT                   /orf_name="MICPUN_64158"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ACO67263.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000199BAC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA7"
FT                   /transl_table=1
FT                   /translation="MASSTSPISASRVSSRASIVGARRIPGARGASTSRACSRGGLITT
FT                   EAIFGRGRKVESVKVEEQVEQEVEAPPAIEPQIPEPSLKGTELTLSTDESCDDADEYCS
FT                   YFDFDSDGRLAEPLEAAIPMDYYSLLQLDFEATDKDVKRQYRQLQKWCHPDIAGEAGND
FT                   LSIILNEAYDTLMDEKTRRVYDKDLKEMRKQMDLAMELGADFKPYTGQPMSKFVGQDPT
FT                   ERGSNARAVFVNEAACIGCRQCNHSAPKTFMMEDEWGRARAFQQWADSEEDITIAIESC
FT                   PVDCIYWVKQRNLPILEYAMQRVERVSVGMMNQGSARVGDPFDVANTMIRKGEEERMRV
FT                   GMDAAGAEAGMASAGKLGSRIRLAWLNLGENVRGRWSAYDEARSSYMASMSFDEDDGSL
FT                   DDIMEDPCPNDECMIDEGDIEMSPKEAGAKGTPFRNEAAQPKDFDFE"
FT   CDS_pept        join(complement(566662..566997),complement(565769..566548))
FT                   /codon_start=1
FT                   /gene_family="HOG000091644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633027"
FT                   /orf_name="MICPUN_64159"
FT                   /product="Splicing factor"
FT                   /protein_id="ACO67474.1"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199BAC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA8"
FT                   /transl_table=1
FT                   /translation="MGGGGAGKRKTRAAGEEGVDADDDPENLALQVVAQKPKTVDDRAV
FT                   SIVGVPSQQPHPKPGMNRTSSLDAPIMLLEGHGDAVNSIKFSPDGATVASCGADKTVLM
FT                   WNVRGDCENYMMMQGHKNSVLELHWTADGDNILTCSPDKTLRLWDATTGESVKCMKGHQ
FT                   SFVNACSAAPKGKPLCVSGSDDGTAKLWDFRRKGEVATFADRFQVTAVAFDAEGDRFFS
FT                   GGLDNVLKCWDIRNDAEPYMVLPGHTDTITGIAVAPDGSHVLTNAMDCTLRAWDVRSYA
FT                   PEDRCVKYFVGHQHNFEKGMLKCGWSPDGAKVTAGSACRNVFVWDFDSRRVLYKLPGHE
FT                   GAVNEVTFHPTEPIIGSAGSDGKIYLGELAD"
FT   CDS_pept        567091..568140
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633028"
FT                   /orf_name="MICPUN_64160"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67264.1"
FT                   /db_xref="HOGENOM:HBG558452"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000199BAC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHA9"
FT                   /transl_table=1
FT                   /translation="MARAKHQGKGKGGSARAAEPSPRKQRGPNHRSSSTAEEAELRTQL
FT                   HELGLRVKEVAADGNCFFRAMCDQRWGDEDEHLHLRRLTIEYMKANRDDFEPFIEDDEK
FT                   WDAYVERMGEDGTWAGNMELQAASLVCMTNVCVHQAGQPRWEIVNFPTADRWFHVTYEG
FT                   GDHYNSVELISRRWYLEGDESGGEREASGPISLSKGRDGRAAPGWHCTREPTQSVVNEC
FT                   VARSGGEAKKQRAREVLRLFDGDVDAAAAALRAETSYRGALKGGVGDPKPSESDETGRP
FT                   MLSEDDWALRGVTGGGTKSSGDLIDEEGSDDDDDWEPVVTKRRGGGGRRGGGSRRDDDL
FT                   DERVAALRI"
FT   CDS_pept        complement(<568337..>569491)
FT                   /codon_start=1
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633029"
FT                   /orf_name="MICPUN_68497"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ACO67475.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG635316"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniParc:UPI000199BAC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB0"
FT                   /transl_table=1
FT                   /translation="VYLDYNATTPIFPEVAAAMEPFLWEHFGNPSSGHAFAAPCRDAIH
FT                   KARGQVASMLGCDPTEVVFTSCGSESDNHAIASAVDLFVAKNRSSDSKPKAMMNKPHVV
FT                   STAVEHPAILEYLAAKAKANELTYDLVPVNEEGLVDPKAVAAKVRSDTCMVTVMHANNE
FT                   TGAIQPVAECARLAREKNEDVLIHTDAAQSCGKIPVKVNDLGVDMCTVVGHKIGAPKGV
FT                   AALYVASAAPFSKLLHGGGQESGRRAGTENVLEIVGLGAACELVEREKDILPSHMSAMR
FT                   DELSRRLASGLGGDDGSGVRVNGPRDDAKRLPNTLSVGIKGVSASQLLDVLKDDVAASA
FT                   GAACHSGEAAASVSAVLSAMAVPEEYAIGTLRLSVGRHTCPADVE"
FT   CDS_pept        570102..574451
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633030"
FT                   /orf_name="MICPUN_64162"
FT                   /product="Predicted protein"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="ACO67265.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199BAC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB1"
FT                   /transl_table=1
FT                   /translation="MGEDGDRGGGGLGSLPPEPPGPSPRLAPPRFPHQERALSRQGSLG
FT                   SDTSGGSTPTASGGGRDPRATAFGSTGATPPHLAGAPFMGNPLYESSPSDARGVSGVIG
FT                   GGVRKAGGIGLSQKEAPESHLRKAKAGGLLTKLPFGATASATARPKIRFFRVTPDGREL
FT                   QWGDPKDAAKPALPSRLALADVSAVVAGHETAAFERFKRRAAPPAMCFSLVCDARTVDL
FT                   FAGTPNEAAQWSGALDHLARLARESNIEQRPSDVDDGAAGANDRPSQHKQQGGLARTSS
FT                   NASAQSQGSTGSPSSVKRSAPVRFTPAPRSDADVALDFVPIASQPPTPDGHVSAGPTPD
FT                   GHVSLDLRDGIERDGGWGTRGVVYGAGVVTGVAIDDGVGRTGGNRSERGREEDLRGSAL
FT                   EPVAPAFATATRLAAGAARWRERAARGAVDPGVTEGRRGAGARGRAAGKTAGEDVVEAF
FT                   SRARHGRTKELDKLFQLERVDPGVRDQHGLTLLHIAAQNNQRKAAKLVLKRTDFATDPP
FT                   RLSLIDAQTSAGHTALHFAFAYGYKDLGKYLLSLGADDTVANVHGMTCYEGLDPDEPPR
FT                   DCLNTPEMRELARSAELRRRVDAMRPGAGAGAGGGLGMASSRGGTITHPLGRPSGVAGL
FT                   ARDSGAFTARGGAGAGTAPSSSRGGGGWEGSEYDVGSEYGAAYPYTPRDGPGYGPGNVS
FT                   GNVSGAYGGGHPGFPPNPYAAPGAVAPPPPPYPAYPPTMTPGFHAGYGAMDPMGAAAFA
FT                   AQQQMAAAAAMAAAQMQAMQMSSPAGSAGSTHSPMGSHGGGGGGGSMPTGFQPNHRRSA
FT                   GGGGAVSSRGSAVGGVASSGASAVSKGGGDVDSDVPLEPPSPIMGPMKGSSSRSRGSGG
FT                   RHDTEAAWERALDSRRRRKSDSSNLDSSDDDDDESRQVNKKQQQKQQQKQQQREENKRP
FT                   HPRRRAGAEASARVAAAGGRRGDRAARDEALDREAALRAAALRKHGYHTSDSDSPTSAS
FT                   EAESSRRRQQPAPHSVVAGSNPPPSGVVVGPGRRERAERSRAAAVDGPGSAAKAAAGED
FT                   LLGGRRSPTTTTTTRDIDVAAREEAARVREEKRRQRAGTMRGATAVGETGRASCLPART
FT                   ASKIAMVLGAHPRADPRSVRDVLATGSLAGTGVTLEALRAIRTVVPTPADVATCRATHG
FT                   MGAAADAKIASAALADRFVHEMAKVNRADAKLDALILRETFAQRADDLETALVLVKDAS
FT                   ERACASDALGRLLDIVVALSAILDKGKAGAAGDASQPKKTRSTYKLSSLAHLAATPAKS
FT                   STKSGLGGDTLLHHLSKTVEQKAGAGDVIRWAESSGEGFRKASDAPDPAEVRERVAELR
FT                   RAVRDVEAEAAACERDDEGAEGAEGAEGTLAASLRSFAAKARVRLDVLWATSEAADEAA
FT                   ARLLVAFGPAPKGTAPRDVLRTLGEFAEAFERATAENRRARMERGKE"
FT   CDS_pept        join(574550..575272,575370..575891)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633031"
FT                   /orf_name="MICPUN_104145"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67266.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199BACA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB2"
FT                   /transl_table=1
FT                   /translation="MESAAVVGRRLRVVRELYSAPNGCRVFRVSDVHAPHQPEYALKQV
FT                   SFGSPEGPRAVMHEAGVFSSLRHDCILRHVASWTSDADVAQLDDDARVLGARRSRMLGE
FT                   RDDSTFSHHGDVIEVPTSARACAVDDVAMLADATRRRHTYLYILMELALATAWDALGFL
FT                   DDEDEAANESGPIVVTTSHVDDATRWRWTISTARALACIHGDNVNLVHRDVNPWNVFVV
FT                   DRVAAGVIRATGGGVAVRGRGYVPLGERLLWGRKGVGGASDLTVSAKSSMFSAPELGSD
FT                   VGGSGGDPEWSSSRPTFRGGAGYGAAADVYSWGMTVLCFFCDDGRDARRTVRAVREASL
FT                   AGQGRGELGWGVGGGGGFGGEGSVGDGMMLPNRWGRRCPFPGTLRDVVARTLRLDPETR
FT                   PTAAEIVKMLLGARN"
FT   CDS_pept        complement(575980..577014)
FT                   /codon_start=1
FT                   /gene_family="HOG000248359" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633032"
FT                   /orf_name="MICPUN_104146"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67476.1"
FT                   /db_xref="HOGENOM:HBG518911"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199BACB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB3"
FT                   /transl_table=1
FT                   /translation="MSAVKKVERLTFPFQTPDPFLFAVYHDDKYPPGDGQMRAPRTGNG
FT                   ADFNPSASYRMYHGERVPGFPQHPHRGFETITATMEGLVDHTDSVGNAGRYGQGDVQWM
FT                   TAGKGIVHGEMFPLVNDDAPNPLRLFQIWLNLPARSKMVDTAFVMHWAEDVQSVTDANA
FT                   GYELVVWAGELNGCAGQKPPPASWAADANNDVAVYFITVHPGGTFTLPPSKIGALSNRY
FT                   AYFFEGDAVAIDAREIPAKSAIEMDASAEAKIAVPASASASASLLVLQGRPIGEPVAQH
FT                   GPFVMNTREEIMQAFSDYQRTQFGGWPWPEDAVVFPKDKGRFALLNGTETRPPNATAGA
FT                   KEEL"
FT   CDS_pept        578037..579164
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633033"
FT                   /gene_name="MEX1"
FT                   /orf_name="MICPUN_113496"
FT                   /product="Chloroplast maltose exporter family "
FT                   /protein_id="ACO67267.1"
FT                   /db_xref="HOGENOM:HBG558455"
FT                   /db_xref="UniParc:UPI000199BB66"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB4"
FT                   /transl_table=1
FT                   /translation="MSLASCATVPFLFLTMPQIVKNTSLIAAGRPDALAAVSWQGQVAG
FT                   LLGNMLLLSYFADKGELSASFIQIVGTCATGALLTQMCLAGHIPVAPFAFAAAAVAAGL
FT                   VLSGFRMLGRIGPVDRDGVPCVGNVQCAVSFDEDDTDGKGGPGATIHGWFLRVSNGLWD
FT                   FYTHATGIVGLAALPQIGLMSLLPPTLAAQCGVYPGCAGAALGTLLIILNYRGKLPPAV
FT                   ASAWGALSGWTATLLFMSMPVAQLASNFANPQTLEGLSILSALLAMTGNALMVPRALFT
FT                   RDVIWLTGSTWGCTLMGWGVMLSLFLGHRADGARYIGPGAFTALTAAFFAYLVGVWLID
FT                   GISALASGNSAGWRLKAWRAWNKGGDREDLISASR"
FT   CDS_pept        join(complement(579911..>580744),
FT                   complement(<579530..579856))
FT                   /codon_start=1
FT                   /gene_family="HOG000030688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633034"
FT                   /orf_name="MICPUN_68455"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67477.1"
FT                   /db_xref="HOGENOM:HBG713769"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013109"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI000199BB67"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB5"
FT                   /transl_table=1
FT                   /translation="AEELMRWLIAPVPLETFMRDIWERRPAYVSRNAHKGYFDGLLSKA
FT                   DIDEWLRAGKMRYQRNVDVTSYKDGVRRTHNLNDDGSGGVDATTGEPGFADADTVWRRF
FT                   EQEGCSLRVLHPQRWRDPLWKTLAALERFWNCSTGCNCYLTPADSQGFSPHYDDIDAFI
FT                   LQLEGKKLWRVYPPRSEAEMLPRYSSPNFGQDDVGEPVLEVILEPGDLLYMPRGTVHQA
FT                   NCVPGDHSLHVTLSTNQFNTWADLLEVAFPAALRQAVAEVPALRRCPPPDYLAHLGLVD
FT                   GEFDAVNPRRDDLIGALVELAQCVMRRLPFDAAADHIGARLMRQRLPPPPSHVSAPVSA
FT                   TGANAAATVTDETRVRITQEEGARLVVEDDAVVVCHPFGNGRLLHME"
FT   CDS_pept        complement(581485..582645)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633035"
FT                   /orf_name="MICPUN_64167"
FT                   /product="Ribosomal protein L18"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO67478.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="UniParc:UPI000199BB68"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB6"
FT                   /transl_table=1
FT                   /translation="MGPRGSRWPTRWGHRGPRATRRGRAVATPSRCDAYFAVSTGVDAV
FT                   RDGIRRDDAVARGGLPNPTNPSLAGWSRVGENPAARRSPGSGPRARRLASRRGVERVHR
FT                   LRRDDDAFRVACDARHGGVVVERAAVGRADSERGLLGFFRAPVHGRQHLISFQPPVAAA
FT                   PTSSASAARRTCSPARLDPRPPRSTPRADLSSAPPPPYSQGIDIEAGGRNKKKSRTAPK
FT                   SENVYLKLLVKLYRFLVRRTDSKVNETILKRLFMSKINRPPLSLSKLAKFAKPGQISAV
FT                   VGTITDDARMFEVPALRVCALRFTETARARIVKAGGECITFDQLALQAPTGENVCLLRG
FT                   PKSHREAVKHFGAPGVPGSHAKPYVRHKGRKFEKARGRRKSRGYKA"
FT   CDS_pept        583138..586416
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633036"
FT                   /orf_name="MICPUN_64168"
FT                   /product="Gamma-tubulin complex"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="ACO67268.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG720887"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniParc:UPI000199BB69"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB7"
FT                   /transl_table=1
FT                   /translation="MTSKSPPDPELTERLRSLVGRLVVDLRIGEGRGAEGLATASVAML
FT                   GKMISPYDVTKVATTQTQRTLTERAPDPAAFRRAYEALKATGAREVDKYLAVVAKIASD
FT                   PDVLAAVTRAPGESAAVTMGGDSFPTTFGTSSGGDATMDDDDDDDGYGVPSPNLEMSAR
FT                   AESAGRSVETTRLGPLGNFSFNTNPLASETDDAADAPLTPGASVGMRTMTQRHSAADDE
FT                   GPVEPDVGSARMRSLHLTTTAPTPPTPTPPRTPTIAEDIRARIAGERPPLREGVDFPAL
FT                   PAWMSTRPYLTGAHLGYDSTAENKSSNANADPVAGKPLDAYTTACQELLVLDDLLYAML
FT                   GAEGRYVRARRVDAATGEPIGARDASSIASSVAEYIGSGGGSGRSHNHHKPPPLAGTAV
FT                   RFVVEPGLESSLAALVENMLPLCSHAAQVADYVETRVNRFEGGLVAHALAAEMQELLSD
FT                   WRTTVVQLEHQRNLGRLSLQSAWFYVQPAVGAMSLLARISRRANALRGASLLNEIHREA
FT                   ATRAGDVAARNLCLRLLRAASAPYAKAVERWVYEGVVDDPYDEFLVIERAHLRKESLAE
FT                   DYNATYWSQRYVLRSEVPAFLGEGLAEKALTTGKYINAMRESRTATATTTESGRFSRRR
FT                   EGGTDGAADTTTTSSSSEFSLPPIPPDGLGRLALGGGASSAGSGTHAARINAAHRHASV
FT                   GLLRAVLGDGDLHGRLRAMKRYFLLDKGDFLVHFTDNAGEELARRAPDISVSRLQSLLE
FT                   LSLKLSTASTDPHNDDLTCSLERQGIIHQLLSIHVTGGAKGYAPADADLDLDENATQMT
FT                   PKEALRLTGFETFALDYNAPWPVSLVLSRRAITKYQLLFRHVFHCKHVERRLCEAWQTH
FT                   QATRAAAAQTAGAGDGGSLGRAYVLSQRMLHFLQNFTYYLMCEVVEPNWHAFETALRDA
FT                   QSVDELIDAHERFLDACMKEGMLFWPRILRRLERIKNVCLKFCGLSETLEQSLPGRGSF
FT                   RENLRAGRLSVAGGEDTGSHRVSASARERVEARHEAAQAIFDACEGDKYASEVARLEGD
FT                   FDAQLRELLEALNGSAHLEPNLASLCARLDFNEFYSFGPGGKYT"
FT   CDS_pept        complement(586498..588759)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633037"
FT                   /orf_name="MICPUN_64169"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67479.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199BB6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB8"
FT                   /transl_table=1
FT                   /translation="MPPSILSGAAARVRATAPTNSVRRRHVSKSGFGKRHDAPTRRAAW
FT                   VRAWPAFPARNVPGGVNAGWRRGDATRARVIDPHPGRGALTAEGEGDDNDERRDRDDED
FT                   DALPRRETETLSAADVQRALASATVTHAAGTADDDADDEDGEDDAWFEHLPYILEFSSP
FT                   IDAVAILDSIDEDIQLAAAAEETAALAEETDADRSTSASDPASSASSQASSQSSSVPSG
FT                   MNPSSSKKASGEGDEFIGYGALFASIANLGLPALVNSCIEPVISSAETACAGKIGVLYL
FT                   AALAPSSSLFAFAAEMCFAVSIVVTNTIAKVAAGESRGLNGGSEEEEAAKQRNTITAAV
FT                   AASFVSGAVLACALAALAGPLLSLMHVPPEVAPIVRTYVAVRALGLPFFAASNAAEGVF
FT                   IGQRDGVTPMVAWTATGAITLGVIVAAAHPSALGLGLPGSAAAISFGQALTAAWFFRGL
FT                   AANGWLAWPEGDGEGGVGEVGTSDAGGSSLGAAAGAPTSQVGRRLAAAALACRALWSRS
FT                   VDVLVESRMLNEIGWMFLGAFSRMGTYAAITASASALGVLPGATHKVALETFWILSFLT
FT                   EPVFTACNALIPRELHAGRWGSARKLRAALIALSVLLGTLLSCAAFLMTQTAVYSDDPA
FT                   VTAALSALTAPLAVALGLSAVAYGVEGTIIGCGEVGYLGRTHARDFLLVLLLLKAHSTF
FT                   PSVAGSGLAGIWWVLAFFQGLRICQHWCHLAMTRPFWEKQADPTTEEAAEADGKALLIA
FT                   "
FT   CDS_pept        <589418..>589957
FT                   /codon_start=1
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633038"
FT                   /orf_name="MICPUN_71824"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO67269.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI000199BB6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHB9"
FT                   /transl_table=1
FT                   /translation="GVAVVVIDSPKTVNAITQVMLLSLAKAFRDLRVDRSVRAAVLTAT
FT                   GRRAFSTGIDLGDAERVFKMDESRLDDDIVHQMELCPFPIIGAVNGVAINAGFELALAC
FT                   DVLLASPRASFRDTHAAFGILPSWGLSQKLPRIVGANVARMTSLTAAPLTATDARRCGL
FT                   VNAIVHEAHDAHDMRDV"
FT   CDS_pept        join(complement(592012..592438),complement(590570..591828))
FT                   /codon_start=1
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633039"
FT                   /orf_name="MICPUN_64171"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ACO67480.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI000199BB6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC0"
FT                   /transl_table=1
FT                   /translation="MMRRAASTLLRQARVAHRAVATTQAAAPLGAAEARGFAPIARGFH
FT                   TSNIAGAGISAQELSSLLEQRISGHYSALDIDEIGRVLSVGDGIARVYGLNKIQAGEMV
FT                   EFASGVKGMALNLENDNVGIVCFGSDTTINEGDIVKRTGAIVDVPVGRGMLGRVVDGLG
FT                   QPIDGKGPLGDVTQQRVEIKAPGIIVRKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDR
FT                   QTGKTAIAIDTIINQKGVNDQGDESKKLYCVYVAVGQKRSTVAQLVKVLQDKGALDYSV
FT                   IVAATASDPAPLQFLAPYSGCAIAEYFRDNGMHSLIIYDDLSKQSVAYRQMSLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAAKMSDEVGAGSMTALPVVETQGGDVSAYIPTNVISITDG
FT                   QIFLETELFFKGIRPAINVGLSVSRVGSAAQMKAMKQVSGSLKLELAQYREVAAFAQFG
FT                   SDLDAATQYLLNRGSRLTEVLKQGQFVPMPIEQQVVVIYAATKGYLDKVAINDIGAFEA
FT                   GLLKEVSPALLETIRTEKVISDSTDAKLKELCEGYTKGFIAAKA"
FT   CDS_pept        593432..607720
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633040"
FT                   /orf_name="MICPUN_104153"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /function="receptor activity"
FT                   /protein_id="ACO67270.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002859"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013091"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="UniParc:UPI000199D589"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC1"
FT                   /transl_table=1
FT                   /translation="MRVALTMVVAVLAVLAEPVLGETQLLTGKTVTTSRNGVDVSAIVD
FT                   GAFSEGSPSAAIFNDNNDNKIEEGAANPWVQIDFGEGNQATIGDVDVYGNLENQQTPFS
FT                   CVMAMLVSQANGLGYVAYQAAKGNGQGDNAEVIAVCGRGLTAGVVTNTPNTGVIVGVSD
FT                   SSCTNDGCLTLDGNGDPDGADTTACTGQSGAKRLILPTDVGYDAGGLPPVDGKFTVDCG
FT                   NKVGRYLYVQLVGLQRQLWVGEIKAVFTAAPATPAPAPVPETPAPAASCAAETQYKSSN
FT                   NKCVDCPSESTSSGADAEFCTCSVNRYAKKESNTWTCEPCRAGQVRGNDAAKVLTTAAR
FT                   VPTADGQTEDGTDCEVYGRCDGGYYLTLDTATSLNYCELCPNGGTSPGSSTSVTQCTCP
FT                   ANHYAEWVTQGNSGSWSCTACKTGQTKAATAIPSTDGTGKETASACSAAETCAANHYLT
FT                   LDADSGKDYCKACPEGTTSPAGGSARACTCGEAGTQYLEDDECKTCPSTSTCPSLSCSA
FT                   LTECTCPANHYVEKSGNSWSCTACKTGQTKDASNVGTDQAATTCSAAETCAANHYLTLD
FT                   ADSGKDYCKACPEGTTSSGGSARACTCGGTQYFEDGECKDCPSTSTCPSLSCSALTECT
FT                   CPANHYVEKSGNSWSCTACKTGQTKDASNVGTDQAATTCSAAETCAANHYLTLDADSGK
FT                   DYCKACPEGTTSSGGSARACTCGGTQYFEDGECKDCPSTSTCPSLSCSALTECTCPANH
FT                   YVEKSGNSWSCTACKTGQTKDASNVGTDQAATTCSAAETCAANHYLTLDADSGKDYCKA
FT                   CPEGTTSSGGSARACTCGGTQYFEDGECKDCPSTSTCPSPPCSALTECTCPANHYVEKS
FT                   GNSWSCTACKTGQTKDASNVGTEEAATTCNAATSCEANHYLTLDDGNGGSNKNYCEACP
FT                   AGSTSSDSSSTTCTCEANKYANNNQCANCGANTFRTGSEVPGANENKNEVCLEKSCAAN
FT                   QYIKDGACTNCADGSTSAGGKVTTCTANCTSGKYWDGDSCETCPGNSAGAGGKATSCTC
FT                   NEKYYAKLTGGTWSCETCPTDSTKIGSVVPHTSGKSDTCVSSCASGKYWDGSACQACPA
FT                   NSNGVGGAETSCTCNNNYRAFVSGAGTWTCEECSGRQGSKIPQPGGESDECVASQACTT
FT                   RQYFDGKAKACKTCPDGSTSEGGTAEFCTCGQNMYAVKSGNSWKCVECTGGGTKPADSK
FT                   VPGSGNGQKESEACSEASSCKENFFLSGGKCETCPANSVSSGGTATDCTCLDDFYAAYS
FT                   SSKGGTYTCNKCTGKSGSAIPRSDKSSDTCDNIETGKSCTARAMVPKNGLSVECPATVE
FT                   HGVSCAVECARGYAVGSPSFSTCNDGKVTLATCEAIVCAEKQHVLYGVCTDCPAGSDNV
FT                   AGDKASGDNTNCECPVNTYRVVVDGVWSCVPCAGALTRAAGDVVPYDATQPDANTQCGA
FT                   DVTCYAGCSACTGVGKTECIECSVGYTLYGTECVSDYPATTSQAVLDEYVEIGLAPRDT
FT                   LTVAEKDLIVASMREVTGRSPELLYYSGKAASGVADPTPPAVDKGGGKSNNGKARRRLL
FT                   AHGEGEGRRRLLAHGNKHTLVVVARFTVPAEQLEEASIGVGVAFGTGELLRNLRTKLGG
FT                   DFGEMTVKSTASRRGACKTQTGGTCTAGTAIVFQARESDQLVEDSKNPCKNNNGGCSKL
FT                   VRCKADPSMSTGVMCGECPTGYTSSDYGITCADVDECAVNNGGCDPRVECINTVGGYKC
FT                   GNCPDGFVTAKSGKCEDIDECKKANGGCDKLTECINSAGGFSCGPCPAGYKGSGDTKCV
FT                   KASGCSVKNGGCDKLTTCTDDGAGGSSCGPCPTGYVGDGASGCVDLDACAEGPCYPGVF
FT                   CKDLKPPAGADGFKCGKCPPGSTGDGIGPSGCSFNPCFIKNGGCDAQVTCTNNNGVAVC
FT                   GACPPGTEKEGGAADGKCINIDSCASNRCYDGPLGKVLCTDLAPPKDGFKCGKCPKGST
FT                   GDGVTCAEENLCATKNPCDPLTTCSNNGKTCSACPAGYKGSGKSGCKPISSCEKNNGGC
FT                   DPSTQCSDDGAGGSSCGTCPSHTNGYFPWVAGSTGTTGCVDFDACADNPCFPGVECRDT
FT                   PAVDAKDPSVVTDDGLKNFTCGKCPDGYMFNGTNAGVGEYGCVVCTMGVNIAATTVVNG
FT                   EVLRGSDTRVIAGRELMNSACSNDAGYTFGWSAARSDGTPVELDPKTTYSNTPQLFLPK
FT                   RSLPPGVSYTLKFTGYVTANPLVSSTAEFSFLVSEADLEAIVQGGNSIVSEGVAVDLDG
FT                   SGSIDPDADPDYEWEYYWLCEDKTAVDAGASDTSCYLEDGSQLELPRTSQAKIEGLKLK
FT                   GAAGPNGRTYTFILEAKKGARRAETTTTVSVIAAAAGATGPPPVASITPFPKNKVNAGE
FT                   PARIKGTVTSVADPSTLKMKWSATRAFVDPAGADQSVDLAAAGFTSSVSLATENLVLSP
FT                   DVLETGYRYKFRLDVEDGNGAAAAFIELEENTPPSGGTLLSVPDSGTALTDTFTISAGA
FT                   WVDTEEPLYYRFVYRVKGTEKWTQLKDFSPEAQCQVSLPGGDVNGKVELAVEVRDSLGA
FT                   VSAPKVIEVTSNWPTTNDEASLKKAADQGINAAEVAMKSGNPEGALNSIGATIGLYANF
FT                   KKQQSRRRLLAANGCVGGGGVNATGEAKERAKARESMLNTTSAAGDAVPASSTFYSTLA
FT                   GTASAVLGDPCEATAAARSSGVNLVAGLINTTGSPDNDLIITGEGAENMLGALSAAVTP
FT                   AEDGDANAGSAQGAATGAARSLMTAQLGPSLPGEKPASVNTTKMSYQAARVSTLGAGNS
FT                   TSSTASAAGSEFAVPGGALALGGSDPVDQLCLSLDYDPHAASASKGNASDPTDIRSAPK
FT                   ASATVSLVLNNATSGGELAVKNLKTPIAFSLRLNDDGADLRSPPCYVTKSTTNFTALQN
FT                   LETKPLQLPTCSFYDEAAGESSTKGCATLPNPIPKGSKVEWLPGVLDGSISLDNSSVDA
FT                   SFLWTFEHLDNSTEDSVLFNCTLVEYRSEDGVRLRRYDGERCQAQNPRNKAMCFWRRDT
FT                   QTFEGCGCVLSSSVRCLCNHATDFSASSAPPKIKPVSIEELLSVSLDDVLNTWKVFAVV
FT                   GGMFGCMSVLACLFERRDGRARRKILHKFIKNPGTTEKMGFSVIKDVWTWSIDVQEMQF
FT                   MFNNLHCPNTRADLERVAGQQVGTDDADEIDAKLLEIADLGKRDFAATDVLRAIERRKA
FT                   AMRRQRRAKEGLPQVPNGMEAADPALVAEIEAKIERELEETHTGIDAWVDKETGKVKYS
FT                   VVDVHTMNWAETFDSSDDDEESPSKQRRSLKDENAKKQGLFGRSMKTMTNIVSPLEKTL
FT                   KQMPGKALDAARKMPGALAGMPSQLQKDIRDMAQGKRRRRKEPELPAYFIGVPSKSEVK
FT                   RLPMPKRNGAMFCSTCGIRYVRFLIAFPIEALNRNLIVWRAKNDAEHVVFLPFSRAVGT
FT                   AMVYAYLDVNNIVGHVEMASRIYDAAQLPWMMPTGVTFPLLVAEFKAMICGNLTSGGWM
FT                   KRSNLWNIVALQNENGSWSATDSLAGALKAASAPQLSPPLPGSDAPVVKAFYNADEVLL
FT                   RCPPELAACAPKLGWTVVDDMWCTIVAMEGCRQNGLSWVLNPWDDLYHEFDILQCGWTW
FT                   VQQQVRGDSQVAKAVLVATERAAECVSAWRESFTATVQALHAQKKAEEAAKKREAAKKR
FT                   PSFLSRWCGFFAAAAMAPVNTVKRLTMELYAFIVWALKLYMAAHMFFRAFLANPTDAFS
FT                   GAERIVMQSSLYLVGLLVTVWFYYNKATQCCVILRQEIGCSSNVLDECDYVPAGAGCAV
FT                   LMGQKELKPAGWVCRAFPDKDNGFHFLTVIAIQIAIMFPVKFSLTRMFTAGGGAILEPH
FT                   WRQAVIAAGMNMMEIYAAWCETFFQLFYDPAGAVQKPEVGQILAKSKGAIMKMLMTCGM
FT                   TYAMTVVGVFFYWMDRLGIYRKKKKRKAKFESVDVIKESIRNTAEDNVKLRLSNSFKMK
FT                   KNLDKYDIGGDDDEPEVEPEAKTQTVAQRKMFTKASAFSGAVAHRDEFTSVMPRDDDDD
FT                   DDDTAGDADAASRNSGDSAGVDHADADPRETAPVAWYVRSMHAAHKDRSGDHRAAIMNA
FT                   PVDVEGDFESLRTTPPSEQVIGASGSGASAAGFPPAPALLHAHDSMDPEQWLRSAVARC
FT                   VEDSHRLNDLADDGDVVECERVASFLASLLDQAAHEAGPRGYGGSREDAAKATALVRAS
FT                   IVSAGGVSACVGVLTVPDRCEGAAPRASPQQVAASAAALALLARITCDYPAGMQELKLD
FT                   HDGFAAVVATIRLHSPRPASRVVADAAAVCVASVADNPRLARNWHDAGALRVFMRYVHE
FT                   ISLAAAEDEDVREGIRSDPAKHDEITGALAAFASLKSREREKDRDANITVGSVDAFYYD
FT                   CVRLLPPHAPVFASHVPAAAAALAATRIAFPGTAVECERALARAGTMHALGNLPLGTLG
FT                   HRSKTILAGALGSEAMDRLLSSGTRDGALSTSASSLAPEPNPRSKRKACDLDSANQSDD
FT                   SEHGSAPDSPSRSGVGSQTPHSARGIRNLWRRAAGREAAAPEKPPGEAAMDAVADILEK
FT                   ARANLSKQADDAKAALAMHTISVQDIEKRRRAYVSKLRWSSIFQQNLGWFCAAFLWFFG
FT                   GYVIIVYGVLIYRFLGPGEEDRYISTWGMAFLINTFGLESLQVVGRKAFFIFVITKFQK
FT                   SFAKAQESLGWYETYTEMCGMHLLVEVGAISQDAAREAAEEDEGGDDVEADDGGGD"
FT   CDS_pept        join(complement(609446..609496),complement(607963..609249))
FT                   /codon_start=1
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633041"
FT                   /orf_name="MICPUN_106515"
FT                   /product="Histone acetyltransferase "
FT                   /function="chromatin binding"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67481.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG631736"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199BB6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC2"
FT                   /transl_table=1
FT                   /translation="MAAAEDTKKDADVKATKAEKEDPKADDGDAKDDKKTADAAKKPPE
FT                   DDVIKKVVDGVGIPLDIGARVQCKWRDGQMYPVRVIERRAGPKGKEAQEEYEYYVHYEQ
FT                   FNRRLDTWVTIAEMDLATAEQDEPGKKRKHEDAHDEEHAEFDPNALREHEEVTKVRNIL
FT                   KVELGRHEMDTWYFSPFPPEYTTCKKLFFCEFTLNFFKRKEQLQRHLRKTEMYHPPGDE
FT                   IYRNESRGKTTAFFEIDGKKEKIFCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCEVDER
FT                   GYHIVGYFSKEKCSEEGYNLACILTLPAYQRKGYGKMLISFSYELSKKEGKVGTPERPL
FT                   SDLGLVSYRGYWTRELLAILKDESRAVMSIKDLSELTMIKTEDIISTLQHLNLLAYQKG
FT                   AYVICAAPELIEKHLKAAGSPGVEVDPTKLIWTPYNAEKEYANFRG"
FT   CDS_pept        join(610008..610106,610258..610331,610463..611414)
FT                   /codon_start=1
FT                   /gene_family="HOG000100149" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633042"
FT                   /orf_name="MICPUN_64174"
FT                   /product="Flagellar protofilament ribbon protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67271.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG558461"
FT                   /db_xref="InterPro:IPR008805"
FT                   /db_xref="UniParc:UPI000199BB6E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC3"
FT                   /transl_table=1
FT                   /translation="MTVIGGAGFSRTKRFDPAERLALIHNAKQRTKGIDVDALNAQVAE
FT                   KAARKAAEAEHDRRYDQMASFYDKKLVALEQERREIQAELNRNVQSFRAEYQRKELRRE
FT                   YDLSDPSALRSEPPARVGDDDARIGASSLQRFDGEDLAAGERRRTQLAQQASWCERQAA
FT                   EKKAAQLAAKAADLAHAETVAAQEEYMNKAAAHHEAARAAFERSVAEENARLAELKARR
FT                   DAEARAIDEHLAAAEATKVESDPMINEDPSAAASAVAPGARVRVDHWKGMNYLQVRSIN
FT                   ETVAAQREELEQRRAREAAEEAATANASERVRRALEQRAEQVEAFKREQRMAVLAAQNT
FT                   QRAEKVERDATARSVLGVNTVEPEYFAQFGTSWR"
FT   CDS_pept        611699..612172
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633043"
FT                   /orf_name="MICPUN_64175"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67272.1"
FT                   /db_xref="UniParc:UPI000199BB6F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC4"
FT                   /transl_table=1
FT                   /translation="MAASIAPTHALVVTARPAAVTRARRAASAVRCDASKDAAGSRLAT
FT                   RRDATFGLGAALVAALAAPAAANAVECTWAIGCMPGTEPGAPPRYNLPGAAYAPAEAAE
FT                   ERFRAKIRAEKEAEETAFAQRMAAQKAAEEQAAAKAAAEAAAKAAAEAAVEAP"
FT   CDS_pept        612433..613404
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633044"
FT                   /orf_name="MICPUN_52045"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67273.1"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199BB70"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC5"
FT                   /transl_table=1
FT                   /translation="MLTRDGTPAPDCLVARVVPVETYPSRTPPLVEVHPVGALIQHRMD
FT                   AALAAMDEEHAASDGDVCVFPFVTRLREMARAWRDEDRPSRRPERDDAAAADDDDDDAP
FT                   GTGTGRGEEAETGDAEWDPVAIDAELASLAMTMTERGARDGTAGTAGDDDATGTDRPGV
FT                   GAWTDESVRRSIVAGPPFTEKKSTFQGFLLSDVTSLEQVDAMLRALQRDSRIARCSHLM
FT                   AAWRIALRGDPRDDPDGCVWAQDHDEDGETGAGRGLSHLLRVTQSADVCVVVARWFGGI
FT                   HLGPARFQLINNCARDMLERCGFVEGKGGGSKGRGKSNNKGG"
FT   CDS_pept        complement(<614179..>615090)
FT                   /codon_start=1
FT                   /gene_family="HOG000200855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633045"
FT                   /orf_name="MICPUN_75615"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO67482.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG609137"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199BB71"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC6"
FT                   /transl_table=1
FT                   /translation="IIKITDDDAAFVLGKGGATKRKIARVSGAKLEIVDLKSAGASSGM
FT                   EGAEIEITGTPAARQRAKDYIGYVLSQRTGPVYIDHTMRRDDLSIVMVPMDCVGYVMGR
FT                   GGQVLRDMENEWGTLMFFAKKKEDEGKVVAANGEKVQEILAIFGTRRSRRGAELKVMSA
FT                   VEHKMPGHFLEGESLRVPLDQPGDGEDDDFDYDVFPFRGDEFSYALGGRGSTRKKIASA
FT                   SNCILEYVGQVAFLAGNERQRRQCRDYLDWLLKQKEGEFHVDVAGRDDVTTVKVPTKSV
FT                   GYVTGHKGEGLRSVEASTRTFCF"
FT   CDS_pept        615721..616953
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633046"
FT                   /orf_name="MICPUN_64178"
FT                   /product="Mitochondrial carrier family "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO67274.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG607669"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199BB72"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC7"
FT                   /transl_table=1
FT                   /translation="MAAPADGVSTRRDGCARLGTAGAGSSRAARERHHRRGIGNLVAET
FT                   SSSSSADAATSPLTHLVAGSIAGGLSRTVAAPLETVRVRLMTGAATAGGSSPSILAMLA
FT                   DISRREGVRALWKGNAAVVARFAPTKGLDFFTFNLYKRALSAVGVGPVRAGDENGDRRG
FT                   GHPSTASRPSRVRGGVSAQRAVAGGLAGATSTALLYPLDNIATRLATSAATGAAMVNGV
FT                   KVVGALGLLRAIGRVVSTEGVSGLYRGFGPAVLGIVPEAAITYGAYDALKEWAAGKGGE
FT                   GECGVLEATACGIVAALAGTAATFPASVVSRRMITGTVPGLDPSVGSSVGGSVGGKRAR
FT                   AASMGLFKAMAAVAEAEGVLGLYRGLGTASVRLVPMAIVSFASYEWVRRTMDAADARAR
FT                   TKEVGIEVDVA"
FT   CDS_pept        complement(617113..619392)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633047"
FT                   /orf_name="MICPUN_64179"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="intra-Golgi vesicle-mediated transport"
FT                   /cellular_component="integral to Golgi membrane "
FT                   /protein_id="ACO67483.1"
FT                   /db_xref="GO:0006891"
FT                   /db_xref="GO:0030173"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniParc:UPI000199BC1B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC8"
FT                   /transl_table=1
FT                   /translation="MASSATDHLSKVNAFVSTAGNFIDSALDQLDDQLESAMGGMSEKV
FT                   GEELREHSLTADAMTRAKATAEAWSALGFAALRDEWRDAATEISAKQRDAKTAGRDLAE
FT                   AAKASKREGAGDAENKALLKAMGAEIKRLTDRVALAETAFFSMLNDLDEAPDPAEALVR
FT                   TTKAAEYVTGAGALRNDLDATKAELAAVREAAQSGANSEAARELRSMKESVKSMVDAAA
FT                   RERTAEVDKRIAEMEIAHETMRAQKDGLERSIAELRARHDAAQSELFELREGKFADLVS
FT                   RETGERDAFVAEAEAARMREAEARSESQRLAHEVARLRERIAAGGAIVSGEPSGGSAVA
FT                   NSLSAAEMDMDAAALRERLRLRDQVVEMLKQDLREREAAHAAEATRLGEITEGLRGAVA
FT                   SGEASIASLTLELESRPTDAGVAQLEARVRTLQALVDSRDLGEGVATEGGGAEGVPTEG
FT                   APTGEDGDDPLSAALRRNRRLADELAHAKRDAENAYAKLEDTAKSKTEAEKRVEERDAT
FT                   IRQMEQHLIAATGGGGAEGAVGPSGAAGAPSVGTPSATPGINADLLPVVIGQRDRYKRR
FT                   VAELEHRVGGLETELDAEKIRAGKVDADNVSLFEKVRYLQAYYAERAPKTPAPSLEIGT
FT                   DVGMGSRSERWRRAARYGCGFDTAGGGFSSGTAPDALPGGDADGAIGRYDERHRATHDP
FT                   YARFQEREAAMSEQRLRLHDRVALRGARAVMRSRVTRTFVVFYLGLMHLYLLYQAAAGC
FT                   PAPAKT"
FT   CDS_pept        619658..622042
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633048"
FT                   /orf_name="MICPUN_64180"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67275.1"
FT                   /db_xref="UniParc:UPI000199BC1C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHC9"
FT                   /transl_table=1
FT                   /translation="MRAPSVTTPLTPSEDLDHRSPTALSAYIQRGARREDAIDGGSVCE
FT                   VSIVASRAPSKGRTPARPPPIGGILRAEAAKDGSVSGRLPRGLIAPAPAPTTTMTCPVM
FT                   RARNEAKARTEARRAERDARRDEREVRIAQLIESEEKTGAALERTRERLRDADLAAERA
FT                   RRERERTERDKDAALARCASALAVVVGDLACLQSSLAEKETRCVELERANATAARVLEE
FT                   TRVTHADALRREIAQKDAVQSALEASRAETAAAIESGARSTLEARTRAERVAEQARLVR
FT                   ERETLDETNRLASRLETTRAELRRECAANEDFVDVVRRHEARALDLTRRLRAAEASADE
FT                   HASLAEGFEGRASDRDRIRNVCDDLRSKLADTNRHRDALADELERARAAAVLADADASR
FT                   RDATSESRIRELESALEARRRDVEASEQNARASRRDELRSQERVKALETALEACEKCKT
FT                   DHEARRCGAVDAECAALSRLDDSERARKSAAAERDAAAKRLVTVERKLADATRTLSARG
FT                   DEVDALNRALRESRRDSAAKDAAVERSERAAKTESENVAASVRALASERDAASSLRRAH
FT                   SNLAARHESTLADVERLRVKVSGAERAAAEAETARVAAEETAAELENAVENLAGVHQSL
FT                   TGTLAVEAEKLAGALARCDALEAEVVEARAGEARAHETLRRVREDLDAEKIATAGLEQQ
FT                   LSESRSNERRLDERCQRLGTLANNLGNECARLTTDGETLETETNRLRSELATVRDASTA
FT                   EASRGKLRERYAEDLRRKLTAAEAALETLRAGVGARLVPMG"
FT   CDS_pept        join(complement(623289..623760),complement(622167..623140))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633049"
FT                   /orf_name="MICPUN_64181"
FT                   /product="RNA pseudouridylate synthase "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO67484.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199BC1D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD0"
FT                   /transl_table=1
FT                   /translation="MAEVARAGAPAAAFSSRPRTVRIAGGGAPSPYPSTSSRPTRCPRR
FT                   RRGLLVPFGCRASTEASSPWPLLDAVEDDPDPSEPPRTTPSSAGAAHWTVSEPMSRDTD
FT                   AASAVASTADVSRELAAELLDVGAVYAECWPEGEGEGKPTRWRRIADRKIVAKGEVIRV
FT                   HKRPRRYRHACWLGADAWRHRVVHEDDAILVVNKPHRLPSMAHESNGVEHCAGCLERSL
FT                   GLSPSTLRVTHRLDSSTSGVLVLGKTATAVREFNDSVAKTPGSKEIVKSYAALVYAKHA
FT                   VPLGLMTHWMYPGPFGPGAFHGRTLRRSRARLVRSSADGERGDDTGGQGTGKRWKRCEL
FT                   RVVSCDRATQSQVDTWRTLFDRELERARKPFDGGADDPLVSGGDSPGGDSPGASVWAVR
FT                   VELVTGRTHQVRAQLAAAGAPLLGDSLYAPMAGYLHDRDDERAAEEAWGRMERGTVPDW
FT                   PVALHAETLRWGDSVFSTSPPWD"
FT   CDS_pept        623992..626766
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633050"
FT                   /orf_name="MICPUN_64182"
FT                   /product="Chloride Carrier/Channel family "
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67276.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG558468"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000199BC1E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD1"
FT                   /transl_table=1
FT                   /translation="MQPGAGENLRRARGAPVRGRGHMGGAGKYIEMDRLDKVVNMEEGS
FT                   RSIHKERAEMLGGAIDTAQADKAHARLKRMAAFDSHDYDPADNDLEEDARRARKRADYK
FT                   AEEQWRWAMSVLIGVVMGFLAFTVDGLIKKFNGWKYGATTSSISPGGAGFGAWLVWVII
FT                   SCLLASVAGGLVSYVEPLAAGSGIPELKTYLNGVHLRGLLRIKTLGAKLGGIAFSIGSG
FT                   LIAGKEGPFVHGGGLVGGGLSAFGSHTLGFRTKKPSHFRNDADKRDFVAIGTAVGVAVA
FT                   FGAPIGGMLFTVEEGASFHSTGMLWRGFLATCTGVLTTHWLDQLDFDAMDFAGAKFGVH
FT                   RDFGLFTDDEANYSRVFWWYFWEVPIFAAIGCMGGLLGAAFVNINVKITMWRQRFIPVS
FT                   DKYRRHAEVIFVCFVTATVLFIMMAASPCKPIPEAYRVAAATDGDGNGVSDELPGGVAK
FT                   FEYGVETRRQIRDQYFRSLFCKADEYSSYGQLFFVPLADSLKLLLHLGEVYEQNGTDEF
FT                   EQHLFTMDALIMYFVFMYALMTWTYGIGAPTGLFVPSLAVGAAGGQIVGRIVRAMVMST
FT                   GSEIVVDLHTYAVVGAAACLGGATRMTISITVLVMETTGSMQLIIPLMLTIFFAKAIGD
FT                   KYSMGIYDTHIKIRGAPFLDEPEHAGVAVDKLKVAEVMADSLVTLRPVMRVRELVEVLT
FT                   NTSHGAFPVTITDVGEGHNAGDPIELHGSITRNILLKMLTHRVSMFDPEEPREVLYENS
FT                   EDRDALLEKLKQIPFKSPGVEMIASTLSRREMELSIDLTHFMQRHPFIVHADARLSRAY
FT                   RLFRTMGLRHMYITPSKPQIIGVVTRKDLVEESAALTLGEKAADLSYEELTETERRASH
FT                   DLPFLPYYTGNPGGVDGGAFSEHAAERVQHRSVGSSGDPFQKVPTSPSQVRDY"
FT   CDS_pept        complement(626845..627705)
FT                   /codon_start=1
FT                   /gene_family="HOG000259047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633051"
FT                   /orf_name="MICPUN_88276"
FT                   /product="Flagellar associated protein "
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67485.1"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="HOGENOM:HBG402947"
FT                   /db_xref="InterPro:IPR022088"
FT                   /db_xref="UniParc:UPI000199BC1F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD2"
FT                   /transl_table=1
FT                   /translation="MGGRGTSARDDDDAKAAYRNPLRKAGRDGVNAPPHNVSSSSSSSS
FT                   TLYDPARFANLRVSPDVKELFGYISRYAPIDVEPPTPLKPFVPDYVPAVGDVDEFIKVP
FT                   RPDGLDDGLGVRVLDEPGPEQSDPASLSLKLRRAIGGGLGGDGGAGGAGGRASAVVGRI
FT                   ERPESKEGAAKLDAWIESVNALHEGDDKSGAQFAYSKNMPDIETVMREFDPEVEEALRN
FT                   SGFPDNLPDMDLKSTIKYMCAILDIPVYEGHMNESLHLMFTAYLHLKNNPYLRAKATTP
FT                   GKGKG"
FT   CDS_pept        complement(628105..628317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633052"
FT                   /orf_name="MICPUN_64184"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67486.1"
FT                   /db_xref="UniParc:UPI000199BC20"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD3"
FT                   /transl_table=1
FT                   /translation="MGDSEFEYSDEEYGNVVNSSLQQAQVRGRVPSAPEPASRAYTEDP
FT                   PPRDFATFRPAHQLRHRRLNRGTPA"
FT   CDS_pept        628476..633518
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633053"
FT                   /orf_name="MICPUN_64185"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67277.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BC21"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD4"
FT                   /transl_table=1
FT                   /translation="MFAAPRRTDAAEAYRRERRSRPASAPAAGPGGPGAQSRKRHTLTN
FT                   NGDAGDADAPVVAAVRVTNRSGAHVAQRDRVSSVAELGVAQLRVRHPDEESSEWLSEWG
FT                   DAPEGPSGFGPSKVRPGWKGGGEAPGPSDGRFRALPARASRPRPVPLAPRVSDEPDSLG
FT                   IAGVEAKLRRWLVTNRRVHEPRRLTLLRMLGRGLASPNGGPGADSGRSFAAQARTHGDE
FT                   YGHGDEENDDADAVVNSTFHPNKTVNGLPVNAKGQPVGLKNASFPDPRYAAIDDDGEPL
FT                   PLEERRRFVPALPPSKRVYHPLCARPGPRVRDGTWDSPIDVPRRLDLNDEPTDDDVNGP
FT                   AATIRRRPVVVMTKTQFHRACALGGVPLSDSDVDDVFRKYGGVNGGAIARDGGVALTLE
FT                   LEKFAEAIVSMPQRALGAKPARALDTSLGATRLSGSAEKSPADKIVYPPCRTGVFAPSD
FT                   WDDRHAGRSARRPEEDLTVEWAYGCSVAGKCGMLAAAPKTWSDAPEKTWAGASEPHGPT
FT                   RDDELDDEWINQGAGGYRGVVWVYACGALGVVFDASAWRQRFFRGHDDEIVSLATHASG
FT                   RWAATGQRSGRAPCACVWEIATGKEVARLRHEPGERAVVAIAFGPGLGDPNVPGGGAAR
FT                   IATIAADSKHTVRVWDWGGGHPGRPKPAVLTRAVGFSGTPPQVFGATWAPDADRFATFG
FT                   VKHVKLWTPANESESSFVSSGSRPQGADAAAAAAAARRRAEAARNAALARGANAAAVEY
FT                   AGRVCVYGTAARVCAREFGVDQLNHLKTCSSSTTPYSRGGSVSTATSSDALCGAFVPGC
FT                   RGRRLVTGHADGKLYVWFDRTCERVVDAHGDFPVRAMTVQMTMRERAANAMAHASLNSN
FT                   DVDGGYDGDNPGLGGRLPGLGVEIITGAHGGLVRRWDVVEDWAIVRAETLGNEAAIPRE
FT                   APRGFRGFGESSEVTGSIPPFGGVQSESRHVRAVAAAGDEIAAVTSAGDLWLLWDGEED
FT                   ALPAVIEEEENDDGTWESGELPPASLPRPLARGQAGAALAVAWHPHWEGVFAIASGSPR
FT                   IVVRDAIAKDVLGTVWACDPTPAKATAIAFSPAPATLDDGFLLAVGTESGEVRLFRLLE
FT                   GRVRGKRQLVGRCVAGAVHRVNGGAITALAFSPDGNMLAAGGHDRCVSLHEVCERPAFP
FT                   DASETGPELPDVELVRRARCKGHSSTITSVDWSGDSCSLRSTCRGYEILHFSSPSGRQA
FT                   VGDFRDAEWREWTSPLGFQVMGIFGEDEFSANKSGGAKSAMRVEGTDVNSVSRAGARNL
FT                   LAVGDDFGRVRLLNYPCVVPGAPANEQLEAHANKVACVRFSPDVGGNKWLVTAGGTDRA
FT                   VVQWRLVNENGDPVGDVGDGDGHENGHENGHETEETLGAARSGDGYEQSPGYEQSPGYE
FT                   QSPEYERSPTKDESGGDGSAMGMSTGGSLHDPLFAQDAEGVGDFDEDEVFGRMDPAAFG
FT                   LPGVGSQTLSTSTRRPADGPEGYRRRKMEEINAQMDQLLRAARPAPPRRERRSLRERRR
FT                   REEEEEERKRREGRSEGTADDADAERRRAMAELTASPPAPRRRAAAAATMPPPLAEERS
FT                   FVPTEERRHPSLDDDDDDGDGTSFESESPDPLAAAPSRAQLLMSGALPPLSEDADRDSS
FT                   ALFEDGALSGTAGGTGRASPPAFPHLAPSSDPLSPPSASDED"
FT   CDS_pept        complement(633737..634384)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633054"
FT                   /orf_name="MICPUN_64186"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67487.1"
FT                   /db_xref="UniParc:UPI000199BC22"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD5"
FT                   /transl_table=1
FT                   /translation="MSRPGGADDVTAGEVYANGIALDVVRGWLGATASDLDWDTFNDAD
FT                   DVDATRPRPERLGLGAKFLSHARATSLGGVSRKLGGAIARSAKRRRTDADGTDSESEDV
FT                   SRKGAGSRGAGGGKKTGAPTTTEAMMIGSGTRSDHARDASDDSDSDEGGRAAAFTKRPA
FT                   KKQRAPAWDPTKDVKCVGNAPGAGASKKARRKAAKRAREAEAAAARGGRSVA"
FT   CDS_pept        634473..635042
FT                   /codon_start=1
FT                   /gene_family="HOG000100150" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633055"
FT                   /orf_name="MICPUN_64187"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67278.1"
FT                   /db_xref="HOGENOM:HBG558628"
FT                   /db_xref="UniParc:UPI000199BC23"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD6"
FT                   /transl_table=1
FT                   /translation="MRACRLPKLGGRASSAPFTSPSVARRAPKFVVTRAVSEKVPAAES
FT                   TSMEDYIRYTDAIRTVRLFVQRQNELDADGCATMLVDDAEAYGAVGRENVRNALRDWFE
FT                   QHPGLRYECHDFEVTVHPASADDDDDDDGEIVSVRFRFERRCDDRERWGGGRETVWLDR
FT                   SCRRVRRVEVEARPKSDEEGRRVPPG"
FT   CDS_pept        635193..636170
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633056"
FT                   /orf_name="MICPUN_64188"
FT                   /product="Predicted protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ACO67279.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199BC24"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD7"
FT                   /transl_table=1
FT                   /translation="MATRPLPSPPPPLAWRSRVTDSPVASTSGARCVPGRRRPVPATTE
FT                   AFHFRDTAANESRGSSSASRAAVMTDTSRGSGASASLRGLAFTSKPENIDPARAAALLG
FT                   RAGDDRLARKLARMLAAKEACVIGAFARVDADETKRPGGRDNGTSDGGLAGIWAMGFDM
FT                   LAGEGNVEGKTLVGFAHAATDGAMVATVDIVVVHPSHRAKGLGRKLVKRLADELRYREI
FT                   FDIGVRAPTDLAGFFAACNFGPDAEGAVLMSLPLEAIGGGEREVSSSSSEEAWVGAETC
FT                   LRTLGEGIDPGRTLKDNGEGLRAMLLGEIDKMERERANRARFPL"
FT   CDS_pept        complement(<636274..>637228)
FT                   /codon_start=1
FT                   /gene_family="HOG000165751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633057"
FT                   /orf_name="MICPUN_70483"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67488.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG327968"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199BC25"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD8"
FT                   /transl_table=1
FT                   /translation="VVAHYWATWCEPCGAMDQLVRQLSSQWTGVAFARVEAEEVDELTE
FT                   RYDVSAVPFFTFHKGAGAPLDKLEGADGKALASKTQQHFGVASSAPRAADGASNGAAPV
FT                   AGTHASDAGPGDLDARLRKLTTQTPVVLFMKGDRDEPRCGFSRKVVEALNDTGVEYSTF
FT                   DILQDEDVRQGLKTFSNWPTYPQLYAGGELLGGCDIVLEMAAGGELKAALEEATAAAMP
FT                   EEDINSRLAKLVKSSEVVLFMKGDRDEPRCGFSRKVVEALNDTGVEYSTFDILQDEDVR
FT                   QGLKTFSNWPTYPQLYAGGELLGGCDIVLEMAAGGEL"
FT   CDS_pept        637472..638752
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633058"
FT                   /orf_name="MICPUN_64190"
FT                   /product="Predicted protein"
FT                   /function="transporter activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67280.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000199BCC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHD9"
FT                   /transl_table=1
FT                   /translation="MDSFVSNPANESHPIFPPAAFATLHFLRSRGADGTARGERDRAVT
FT                   RVDAREMTPTGDLEYTVKTLPASAEEIARCGTLRRRVHEWLASPDRAGKHEDDPELDEI
FT                   LDPSGDAWIRFLRARNGNIDKAFKMMSNHLAWRCDYRPWTITPAEIEHQNVTGKVRMGG
FT                   LDSRDGRPVLVFDDSKENSKDHAMQLRSLVYHVCRVDRACRRNPNLGKYLLFIHLRDFK
FT                   LSKAPGRKQSTNTLSLLQDQFPERLGRAILYKPPTVFAAMLSMVKPFMTEVTRNKIIAV
FT                   TGNVDAGSKNDSKMRGIAGDDWRELTGATMPQSSPEISPGYDHARAWAEVVREHAEEEE
FT                   RRRAWAESRAGRGRSHHEFARSDSVSSMDVSNKAAVVGGPAGGKKKSKLAPEEPGSRRT
FT                   SHDGSVDVFFDAKETIKPVKSKSWFGF"
FT   CDS_pept        complement(638944..646671)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633059"
FT                   /orf_name="MICPUN_104165"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67489.1"
FT                   /db_xref="UniParc:UPI000199BCC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE0"
FT                   /transl_table=1
FT                   /translation="MMQEELEQMELQGGGRSDARLQRDVDDANLRAEAAERRLNDLTSE
FT                   LDVMREQLERAKSDIREEQRRTTEAQSKVKSAEDDVKELSEQLAAERQKVQSRRRDDVT
FT                   DRERAAQRNQEVARYQKENKLLAEENERLNGRLEELMAECVGLSESLVQMDDAAQAWRG
FT                   READVEAAAEGLRRERDKLAAQLETNRMDLEERTHLLQTFEEKFSEEYAKWEKERADLR
FT                   AENAGLRASGGLDVARAYEDGGGVGFAFPAPSPRRRETLNVARDVGGSRSQANPEDPRY
FT                   VEELESEVAELRDLRVLLLEAYDQLERDVGREVDIALKRQAKHHANLEAKVGVQEQALE
FT                   AESKRFRTMDKALHDAQEDLAEAQGRLAQYEAGVYGLSEAMRDLKALRMQVRAADQQVE
FT                   DAVAQSNALGRKVEDLTEETRFLRQQAGIPEDADIDLGGFKLKSKVEAAQLRALNSQLE
FT                   REVADLEEDRRRLRNELRYRAKWQGEHAARLGLSARQLAMLEEYADALRFGNDAVFKED
FT                   LVRYDGSSGSDAEGQQQPAVRYDPAVGIGARAVQELEAANKQLQERLAEALERLQSGGT
FT                   GIDGLMAAMRPTEGQQQQQQQQQQPDYGAAAAAAIAAAVASAGGSQAEAASAAQVAELQ
FT                   QQLARARQQIMRLEDGYHEAMMRSSVQQMPPAMQQQPMSQASQEMSRQEMLAEMTRQQQ
FT                   EMFARMSNQQQQAFQQLSQGQQQLVLGQQGLSQGQQSGVSHSFATEPQPSSMYQMPQPP
FT                   GSPVHPSVAEAIALAEAKGAQALAEANAKAAAAQAAAQAQAAEAQRMMAEMSQQQQEAF
FT                   QRMSQQQQEAFAHMSQQQQQSLLASQTQAVAAAGATTAPVAPATTPPLAAPVPERPTTP
FT                   TKSTFAQTTRHHTATHGTITSPPAVAAPSEPVVPSSMYGDAMRTVERLRGERDALFARV
FT                   SALQAALDAAPGLNAAPVSFNIQAAAGSAPGQQMQPPGANNNPAVAAAAYAEAQRAREE
FT                   CAAADRALAGVVADLAAKEEQLEQMAIDVAKYKQAFADMGATRSALYREHVRAKTAWAE
FT                   ERRQLAERARRAETEAETNAVEAKDAQTLVERLKPGAESGLKEALAAAHSRLAVLQVRE
FT                   VRLSRALETASTAEAQARKDKEEMEIDVQELSRAAQERLAFHERRAAEAELRAARCQRE
FT                   LDLCVPKHEHATLADNHRTLQARFKELLALRADNAVSAAQLRAAKEDASTARAEAEAAV
FT                   LKAQHEKARARELSLALDAVATKEGRDAFSQVEARKEIAEVRAQLDAGKRAAELAARET
FT                   RRVVEARDDLEESVRALETELSRAKAQLHESREAERQHLQKLSRCVSEDKHRAEMEAVV
FT                   AAEEEAARLRSEVIKAENAKAAAETELGKRAATNASRDAELAALRSAVREMERRSDAAA
FT                   ALARANEETVRLKSAAAQLKHEKQVAEAEADRLHGDCLRLHRRLQVQDSRLFGLREDAR
FT                   NLLQAQEAALARAEAALAGCIDAADAEKWERALNDLRKGAARRETLLADAHASVKESAE
FT                   RADKAEFELAILQKYVRTAEARDTSGDEHTDAALREIRSLGEELLQSKLSAARTQRACA
FT                   AAEDRLRFLEARDREREEHVLKIEEATLTKAQAGDVRADDLQRQVRALQRELIEARNPT
FT                   LVDGGEVTKGVTILSEDVPAPRRRANAEALAAVGAAAAVGVQPGAASVETQRMVLQQIE
FT                   AIRALKVRAAEAESKCATFEREVSHAQASAKNAENERDALRRRLEAHIAASAGGLDGGG
FT                   IGAPGSLGEESAVAQVTAVAQSTIARLQELVSEKNAALTRAQTAMADLRTDALKKQAED
FT                   RKTIEELNELLFKQNQREIKSMKEALDFGPRPGGVNGGDAKTLAGKPVAELVALLAERE
FT                   SMIETLTMKFEQQRARHEAAEAQLAERAEVQQGEIARMFEEVDREKSKGPSRVVETLVS
FT                   RLKAQMAEKDKRLAQLKEAIKTLEKKLVEAMQSHASRTIRSSDASRAELEHGRGADDRA
FT                   QKLAAKLKKAQDELAKARERAEVAEADLRLRSSSTRAAAAGASSSVVVRGDHSREDAEA
FT                   AKAANERADELEKRVKVLTAQNAKLNRLLDGEKVPAGGGGSTAPRSPARTSHVENQPPA
FT                   SSKEREDTLARWEEGVKLRKKAEQLAKKLAVRTKENEELERQMAKRDRALQDVTKERNA
FT                   LQTKTQRLTHALEVGSSSGPHGAMRSGPDAAAVKEVVDENEALHREVAALQRTVDVEQA
FT                   AEIARLKRQLASAGQSQVPASSSSRYPSTEAAELAERVRSLEGEVLSRDDAALSLRFEA
FT                   EQASARADRLQRRVDRLFKDLAEGGGGGGGGKVSTGSGKDAAGRHARRVQELEDVVEAL
FT                   KKVVEKQQGELAGLRGQAAAAARGNEHARAAKELRLKVRDLESDMVGLRRVEKEHKELL
FT                   QRSQKLELQVKELKDEIKRGGKGARAAADPEPAATMSPDDQALLVAAQSEAAATSLQLM
FT                   ETREALSFARMESDRLARQLAQRGDGGGDDAAKELRARITAAEVEIRRLQNENGDLRAE
FT                   LDALDPAFFDEVMEMKKAYHEQAEVLGTYEDLLRRYSSQLGVEFTPATRDSR"
FT   CDS_pept        <647922..>649112
FT                   /codon_start=1
FT                   /gene_family="HOG000012826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633060"
FT                   /orf_name="MICPUN_68702"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO67281.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG710841"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BCC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE1"
FT                   /transl_table=1
FT                   /translation="KVVFVGGTGRVGSSAAAALLRQEPGVALVLAGRTESSFTAAVERH
FT                   PTLRSSSCAFAACDCSDPASLEAVIAGADLVVHSAGPFQGGGDQCAVLDAAIATGVPYL
FT                   DVCDDAEYAKACRSKSDAAKSKGVPCVTTGGIYPGVSNLMAAEMIAQNRASGSEGAEVA
FT                   EVEYVLYNYFCAGSGGVGDTILATSYMLCGEDVVCWDKGERVVTRPATQRKVVDFGKKC
FT                   GKREVFLYNLPECASARETWNAETVKARFGTSPGLWNGAMALMANLVPKETLLNKDVAK
FT                   ALATFTAPIVRAVDAVVGERTAMRIDVKLKGGALAGAIYNHPRLSEAVGDATAAFCAAM
FT                   LRGETDPGVWYPEEAGAVKDRARLLEAAAVGCDNYEMNKAAWMLESKPINLGFGIYI"
FT   CDS_pept        join(complement(650375..650409),complement(649254..650208))
FT                   /codon_start=1
FT                   /gene_family="HOG000224154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633061"
FT                   /orf_name="MICPUN_95914"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="ACO67490.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000199BCCA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE2"
FT                   /transl_table=1
FT                   /translation="MTSTSQPWVEKYRPRNINDVAHQEEVVRTLEKALETANMPHMLFY
FT                   GPPGTGKTTCALAICRQLYGPELIKSRVLELNASDERGISVVRNKIKGFASTAVGQGAP
FT                   GYPSPPYKILILDEADSMTNDAQSALRRTMETYSKVTRFFILCNYISRIIEPIASRCAK
FT                   FRFKPLGHEVMGDRLKFIATAEGLTLGEGCYEACSTHSGGDMRKAITLLQSAARLFGTA
FT                   TITGKEITAVAGAVDEDQVAQVVALCKTNQVDGANRIIESILKDGFPGLQIITQFAERV
FT                   VDDEGVSDAVKGKICARIAEADKALVDGADESLQLMAIVSTACVAMKA"
FT   CDS_pept        650574..651656
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633062"
FT                   /orf_name="MICPUN_64194"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67282.1"
FT                   /db_xref="HOGENOM:HBG558476"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="UniParc:UPI000199BCCB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE3"
FT                   /transl_table=1
FT                   /translation="MGDSRPSPSPPDGRARVCLLCTCGLPGAGKSTLARRIAARAVATG
FT                   DVARADVVSFDDVEREVRLETARARGTTRDAARGFDAQAWRDSRKLALARVDALLASDD
FT                   DADASDGVGRGRRLVIADDNFYYASMRYQAHQLARRARAAHVQLYVNVPVELARARNER
FT                   RAANEIVPRVAFDRMANAFEPPDPRKRTFELPTVRTDDADADDDRYDRYDDDDDNRDAH
FT                   DAWGLVWDAWGAPPRLPITEEEREALRMKGMDANARSAVHALDLRSRRALGDAMRRVSS
FT                   VAGGPGRRADASVALNAARKEMLDAVRERSKGKKGRGGEEEAGADEFEALDLASFVMAR
FT                   EDAFAELCEGFGGDGGAGGA"
FT   CDS_pept        652046..653125
FT                   /codon_start=1
FT                   /gene_family="HOG000168001" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633063"
FT                   /orf_name="MICPUN_88410"
FT                   /product="Predicted protein"
FT                   /function="UDP-glucose 4-epimerase activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="galactose metabolic process "
FT                   /protein_id="ACO67283.1"
FT                   /db_xref="GO:0003978"
FT                   /db_xref="GO:0006012"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BCCC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE4"
FT                   /transl_table=1
FT                   /translation="MRQLEDVQLSLAGANGAPFPGHILVTGGAGFIGSHATLRLLEDGY
FT                   AVTIVDNFSRGNRGAIEALRRLAPKHKLRVVDGDLGVQRDLERAFGKHKVDAVIHFAAI
FT                   AYVGESVAQPLAYYRNVTVNTIGLLEAMRRHDVRKLVYSSTCATYGNPDELPITEKTPT
FT                   VPINPYGKSKLYAEDAIRDFAVANKDFDAAILRYFNVFGSDPRGRLGEFPRPELRAMGR
FT                   ISGACFDAALGNIPELVVMGTDFPTRDGTCVRDYVHVADLVDAHLAVLGHVANPPVLYN
FT                   VGTGKGVTVREFVDACKRVTGVDVTVREQQESRPGDYAEVYADVSKIREELGWEARYVD
FT                   LEESLGHAWAWRSAHKAGY"
FT   CDS_pept        join(complement(654542..654641),c
FT                   omplement(<653574..654337))
FT                   /codon_start=1
FT                   /gene_family="HOG000200856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633064"
FT                   /orf_name="MICPUN_68774"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67491.1"
FT                   /db_xref="HOGENOM:HBG314446"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199BCCD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE5"
FT                   /transl_table=1
FT                   /translation="MCWGQGSYGALGLENHGSYSDSPAPIPTGPIDLAKALSIGEYHHC
FT                   VILNDDSLVCWGANSVGQVGVGDTTFRASPTPVTLGSGRTAKAVALGYYYTCAILSDDS
FT                   LSCWGSNNGGQLGVGDTTNRNSPTAVSLGSSTVKAVALGQSHTCAILSDDSLSCWGQNN
FT                   YGQLGVGDTTNRNSPTAVSLGSSTAKAIALGESHTCAILNDDSVKFWGYNYYGQLGIGV
FT                   WMGNENPPSGLSPVDLGSGRTAKKLSVGQHHTFAILDDDSLVGWGINTNYQLGLGDAVS
FT                   KNRPQRV"
FT   CDS_pept        655367..656890
FT                   /codon_start=1
FT                   /gene_family="HOG000230294" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633065"
FT                   /gene_name="CUPC17"
FT                   /orf_name="MICPUN_64197"
FT                   /product="Putative uncharacterized protein CUPC17 "
FT                   /function="ATP binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67284.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG497668"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI000199BCCE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE6"
FT                   /transl_table=1
FT                   /translation="MDDAALEKALLLAVSAGDVESDAFASANGADHKKVVGLLKSLESS
FT                   ELVRSAARDHGALKLAAEAQAYLTQGTPEAQAFAAVPPGAGVPLADFKKLDKTISDIGF
FT                   KQAMQQKWLAMEKGEVPMVVRKADAVEDTARKYLEAINAGDVASVPPKELDALVKKRKL
FT                   VKQETWKTFTIGKGAKFALERKKAAADLTKEMLQDGSWRDAEFKQYNLVPGAGAPPNGG
FT                   CVHPLLKVRQQFREIFLQMGFAEMPTNNFVESGFWNFDTLIQPQMHPARDAHDTFFMKT
FT                   PAVANRAPEDYVQRVRAMHESGGHGSIGHQYSWKRSEADKNILRTHTTAVSARCLHKLA
FT                   QDGFRPAKFFSIDRVFRNEAVDRTHLAEFHQVEGVICDVGLTLGDLIGVLYQFFARLGM
FT                   TQLRFKPAFNPYTEPSMEIFAYHPMLKKWVEVGNSGMFRPEMLIPMGLPEDVNVIAWGL
FT                   SLERPTMIMYGIDNIRDLFGSKMQMSSVKNNPVCRLGMIEQRETVKATE"
FT   CDS_pept        complement(657106..658431)
FT                   /codon_start=1
FT                   /gene_family="HOG000227268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633066"
FT                   /gene_name="CUPC16"
FT                   /orf_name="MICPUN_64198"
FT                   /product="Putative uncharacterized protein CUPC16 "
FT                   /protein_id="ACO67492.1"
FT                   /db_xref="HOGENOM:HBG512970"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniParc:UPI000199BCCF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE7"
FT                   /transl_table=1
FT                   /translation="MNVVSVGCNGKRSFDESSNLQSESLIAVWLSGRTTVTFFRQFGAP
FT                   RIVWHSGTPVFRLKGAELSHTRTHARTHSARANSPPSDSHSDPRSSDALPSSRRPHRSR
FT                   RFPRSDKSHQRRTLAARPGLEMITATASRIATAPASKGLSARRGSKFTAGAAPVAHLRA
FT                   APAASYPARLGAGSRVSDRGSRLVVSANLFQRLGRVIGSYANSLVSAAEDPEKILDQTV
FT                   VEMQEDLVKMRQASAQVVASQKQLENKYKQAQATADDWYRRAELALSKGDEELAREALA
FT                   RKKSYQDNADSMAANLEQQKDAVEKLIANTRFLEAKMAEAKSKKDTLKARAASAKSNQE
FT                   VQNLIAGVSTSSALSAFEKMEEKVMMMESQAEATGMLTAGSDLEDKFKALEGGTVDDEL
FT                   SAMKSKMLGDGGNKGNALPPGRPVSDAIESELEALRKKANDM"
FT   CDS_pept        658512..660809
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633067"
FT                   /orf_name="MICPUN_64199"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67285.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG610118"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199BD59"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE8"
FT                   /transl_table=1
FT                   /translation="MASARAMRRMQGDPLLAAAESAFGGGSDSSDESSDEGETPAPLNA
FT                   FALLGGDDDDDESAEEKEEEPEPVKETTPPPASKKKKKKKQKQRQTPDDDGGDDEGEAV
FT                   EDDGIDEITAALREIGEEMPTPRPDGDASSAADAASISGRDPLMCVDTRRLKAEDELRS
FT                   IFGAKVIHAVETEEGNRGGLGLGGGQQGLAHIGRNPRGRKANQGAKLASTQTRSTLVQP
FT                   KDSWPPLRAKHVGLAMECVGVEGHVKTFRFVRDTAGADADAAYQRAVASHDPNNLHALL
FT                   QYWPWHVDALCALSDVYHYAGEGSKSAELLERALYAMEGAWHPWFVGCVADGTARMDAR
FT                   VVPAGAEGVAEGGADGGAEDASGLFFGTMFKHVQALTRRGCHRAALECSKLALSLDRTD
FT                   PRGFLCCVDYFALRCGEEDWLLDFADSFRSDGSLLSHPSYAYSTALARLGGGRPGRRLR
FT                   AHHDAAGALNGKGGKGGKGNRRVTDRAVRKGPERLSDAHRAEADDALLRALLMHPAAAV
FT                   GALNRMESSAVSGDATWRGVLSHPHFAHARDECGSASLERLYDVFAERHHLLWRPDEAL
FT                   RWLGSACERAVRAVDGPDECTTIDGLTPTDFVAIRGETFPASAHNAYSHLAVEDFSDVV
FT                   KRQLDEENPFMRRPNEPPDQMDFAAELGVDRHALMDAVAEMERELEAMGPDAMERARNM
FT                   GPAEAARFLEAARAAANDRGGGEGGGEGERGRGNPLVEFFRTMFVQDPGDGGDGLARRI
FT                   DRDVVDEAFNPG"
FT   CDS_pept        complement(660939..662201)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633068"
FT                   /gene_name="RSP23"
FT                   /orf_name="MICPUN_98338"
FT                   /product="Flagellar radial spoke nucleoside diphosphate
FT                   kinase RSP23"
FT                   /function="ATP binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /cellular_component="flagellum"
FT                   /protein_id="ACO67493.1"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="GO:0019861"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniParc:UPI000199BD5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHE9"
FT                   /transl_table=1
FT                   /translation="MTATNDEWKGLEKTYAMIKPDAVAAGKVDDILKIAEDAGFVVVRR
FT                   QEQRMDAVRAGEFYAEHKGKPFYANLVGFMSSGPIVACCLAKHNAIKDWRALMGPTNTF
FT                   TAREDAPKSLRAKFGTDGTRNATHGSDSPASAMRELKFFFPNLRLDPIPEGAAAREYVA
FT                   RELQPTLVQALAALAKEKPSANKLEAVKWLADWLRANNPNTPPSYSEAELPLNPDDEAV
FT                   ADGEFFSTVAATADAQDAANVVDALDDLEEMARAATKVQSHFRGHQARRSAAQRRRDAL
FT                   GGGHAETRVAVESHTDVIEMEGDPEELARAAATVQASYRGHRARRDVARMRADADAVAA
FT                   AAVSGSGEAALSFEGTEEEQSAAVKLQSNFRGHMARREVAAERARAEEEVELARAATRV
FT                   QAGFRGHLARKQVAGMKGGDA"
FT   CDS_pept        663021..664151
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633069"
FT                   /orf_name="MICPUN_98339"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="ACO67286.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199BD5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF0"
FT                   /transl_table=1
FT                   /translation="MTSTYWFKDSQELIDYQEGNYGSFEYGRYGNPTTKACEEKIRLLE
FT                   GGEDCLLSSSGMNSAICMLLALVPANGHIVTTTDCYRRTRQFVQTFMPKMGVTCTVLDP
FT                   SDYDGLEKALDEHDCSLYFSESPTNPYLRCVDIERIAKLCKPKGCLVCIDGTFATPVNL
FT                   KALKHGADLVIHSASKYFGGHNDVLAGAIVGDKETVAKVRQFHNILGGVIDPHAAYLVM
FT                   RGIKTLQLRVERHNENAMKLATALEKHPMIEKVHYPGLPSHPDHEVAKKYMNGFGGVVS
FT                   FEVKGDLWATAKFIDNCRLPYIAPSLGGVESLIEQPTVVSYWDQGPERRAEIGIKDNLV
FT                   RMACGIEDYADIEADIIQALDSIKDGVEAPAKATSA"
FT   CDS_pept        join(complement(667175..667305),complement(666906..667008),
FT                   complement(664692..666551))
FT                   /codon_start=1
FT                   /gene_family="HOG000261018" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633070"
FT                   /orf_name="MICPUN_95921"
FT                   /product="Predicted protein"
FT                   /function="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase activity"
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="terpenoid biosynthetic process "
FT                   /protein_id="ACO67494.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016114"
FT                   /db_xref="GO:0046429"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG335271"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniParc:UPI000199BD5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF1"
FT                   /transl_table=1
FT                   /translation="MSVVRAASTEPKIESVAAAVPSDAFLPDGLYCVDNTQTIRRKTRT
FT                   VTIGKVKMGSDHPIVRQTMTTSDTRDVEATVAEVKKCADAGAEMVRITVQGMQEAKACA
FT                   EIKKRLVEDGYDTPLIADIHFAPKVAMMVAECFDKIRVNPGNFADGRKKFEDILYETDE
FT                   EYNAEIEEIEKIFTPLVLKCKERGVAMRIGTNHGSLSARTLSRYGDTPAGMVESAFEFA
FT                   RICRKHDYHNFVFSMKASNPLVMVQAYRLLAHEMYKLGWDYPLHLGVTEAGEGEDGRMK
FT                   SSIGIGALLLDGLGDTIRVSLTEASHLEMEPCTRLRDVGHKAAQEKWGVDKFEEKGRDF
FT                   KDFARRASDLPVQKEDDAIDLRNILHRDGSVLSAVTPAQLASEDPFYRDLGAKLAVGMP
FT                   LRDIATSDSILLTEVPEASDEKAMRSIRRLQEIGVGVVADVAQLAERPVDNAVALVAAK
FT                   DATSAAVPDCAARVAVVFDGTETEEEVKAALGVDPVMALIKCAADVSRLHASRRLFTNI
FT                   LAAGSSVPVIHHIQFTDADVKDDIVIQSGSQVGGLLCDGLGDGVLIEHPTAELDYLRRT
FT                   SFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAAISERTGHLPGVAIAVMGCIVNGP
FT                   GEMADADFGYVGGAPGKIDLYVGKEVVKRGIDNDTACDELIQLIKDHGRWVDKEEEEEA
FT                   VAA"
FT   CDS_pept        join(667780..667881,668159..668251)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633071"
FT                   /orf_name="MICPUN_109501"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67287.1"
FT                   /db_xref="HOGENOM:HBG558479"
FT                   /db_xref="UniParc:UPI000199BD5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF2"
FT                   /transl_table=1
FT                   /translation="MAFTVGAPVRLVVRAAKHVNPKATKHHTKTRPKKHTPSDRNRKKV
FT                   EYPALKPEEIPPLMTVISK"
FT   CDS_pept        668651..671206
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633072"
FT                   /orf_name="MICPUN_64204"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ACO67288.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI000199BD5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF3"
FT                   /transl_table=1
FT                   /translation="MRRALVAAVRFALANAPAPSRDPVAALPRWHRIPPLASSGGTGSF
FT                   SNLPRAERAGWSARRHLATSTCAWRDVARDTRGDGGARRGKPGGGGGGGRGGSGGFGGG
FT                   GGGGRDSDAPSRTRARPSKKPSSSFGGKKKSGAPMALPDRFAALATREAELEGADPPIP
FT                   GDTPGRPDGAGAQSKSKSKSKQRRKEAGGPIEILSGSTIAEVARALKSSAGAVEKALAD
FT                   LGESAASAEEVLSDDLVELLAMELGLEIVVKHDPSTASAKGGAHPATVDPPRRAVVAVM
FT                   GHVDHGKTTLLDTLRSSSVAASEAGGITQHIGAFVVNLSNGGELVFLDTPGHAAFSAMR
FT                   QRGAKCTDVAVLVCAADDGVMPQTREAAAHIQAANCRYVVAITKCDAPGADPSRVRDEL
FT                   IAAGIPLEQSGGDVQCVDVSAVSGQGMEDLEMALFLEAEAMNLRAPTDCDGAGVVLEAR
FT                   KDPSRGAVVTGLLRRGSLEVGACVVAGAQFGRVRKLVGYGGVETDTIGPSEPFELAGLR
FT                   GVPLAGDPIQRVGSEDRARRVARAREARATQARLDALAADAGLDAGTPRAFELEHTHAP
FT                   VGARGKAAVAKMRRKSRLRGGDVDASQLDDDDDDDLLDALDDDDDASGTNRDLCCIVKA
FT                   DVQGTAEAVRDAVLTLGSPAVGVKVVYVGVGPVTESDVSLAAAIGGPILAFNVREPPSG
FT                   IAAQAKRLGVPVVERKVIYHLLDAVGEMLGDRAPERLVESVAGEAEVRAVFDLSGRRGN
FT                   KADVVAGCLVNLGALDGSERFRVMRDGAPAHEGLLECESIRRHKLEVTTVGKGTDCGVS
FT                   LRWGAVEVRVGDVLQCVKMVKKKAGVERVATGGARVLDA"
FT   CDS_pept        complement(671348..671650)
FT                   /codon_start=1
FT                   /gene_family="HOG000029106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633073"
FT                   /orf_name="MICPUN_109502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67495.1"
FT                   /db_xref="HOGENOM:HBG318246"
FT                   /db_xref="UniParc:UPI000199BD5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF4"
FT                   /transl_table=1
FT                   /translation="MSDEGRADTSSMLFSVHKHLQARCADRSAAYLACKKNDQNPAACL
FT                   EEGAKVTGCMLDLLKELKGKCPDTLNKYAACMDYRSNQFTKCRAEQAAFEKECPI"
FT   CDS_pept        671997..674498
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633074"
FT                   /orf_name="MICPUN_64206"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67289.1"
FT                   /db_xref="UniParc:UPI000199BD60"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF5"
FT                   /transl_table=1
FT                   /translation="MGGVLGRPSRGLPDNPRYLPPGRYVRDVRDGDVLVLCSADAPLNL
FT                   TVVPGRHPDDDGAWLGTSNERGENDPEYALVRGASAGAGGLVGSVVVDMRGRWATLRSP
FT                   AAGDRYLLVDELARARDFERLESTGRRGGASSSARGDRNLMGLRFRERRRARRSACWGV
FT                   EHLGEGDRAIVILRNRETPELCLRAVGPHPRTKSAAAVVLADFLREELASQMETRARLL
FT                   ALERSIDVERDVALEKLVAIRREHLAKSRALVHARRREGMLDAEQFLDGLTGVVDALRD
FT                   QVKGASAEPFNAGSGGTRGNARGGNARGARGALGFGIDDDDDDDEEEAAGASPQSDDAA
FT                   SHRAKHRGPNRPSSGRSKPPPTAAPTEGWRVDADHLARVSKCWDLDVVEFRERLRERDI
FT                   DDDAVASLQEAIRESAYEHFVVTGMRRYLLNRDGAGDGWEGGGFGEDSEDEDDAVDDDA
FT                   SMMTGSIVSSPGSRSVVSRISSGDNLAKRAKAEERRERRAARRAALRARIRAGGAAVDF
FT                   RRFKVGSLRDQLERSGVDSGPLAMLVHSLAHAMREGRPKKRRGGFLGRLARNILRGSDS
FT                   SDDDEQTKDKRGDAAAGGRAKKPPSETEDDGDAMDGDSFVRSGETFRTVLAQEKLSTLS
FT                   GFVRAEERVRGEHATTYEHRAPVAAGPGLDAARVRRDALRAAAAAAANAARDLRANPSH
FT                   DPETAAVVNFVGGLSLDDLRQELEGHSLLARGLDECVEALLETEWVGGVDGYVERRGER
FT                   ERALRHITVDAFRKRLERHGLEGSMLELNLVTNALARTLVDEGAARVANAEKRRLSSGA
FT                   ALTNASPRQPKTPRPTRIAGS"
FT   CDS_pept        complement(674625..681224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633075"
FT                   /orf_name="MICPUN_64207"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67496.1"
FT                   /db_xref="UniParc:UPI000199BD61"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF6"
FT                   /transl_table=1
FT                   /translation="MRVGAGMRGWGPRAMLVLILVLAGLDVAAPQHMSAGVENKAGATI
FT                   PSFAISGRDAVVAVHGLNFCPGGPRCENCDFDPPQQLCGFGGGDDGVRFIMRYVDESHV
FT                   ACDVTAGESAKLLGFASASYSQNDGADWTHLDRSDNLATVNWATAPVTRRAIAPFPPAG
FT                   IPVTLQGENMVPDVHVARVGCAFDGGPPADGGDASQLSSTLTRCEPPQTTGRPTVRVAV
FT                   EPLGTRGAGGMDASPPSWTPTPWVIPTRVSTGVGDDFDEGSGSAAAAAEGGGGSVTVEV
FT                   SVWDDARAGDGGGVDADAARERFEASSGALGCRFGTVRVASRPTRSQPRGSGQSGAATS
FT                   EGSVQSGAATSDVPPPIDRALVSHGALECVAPALVAGRTVALAAGATHAELPTRSGLIV
FT                   VGDSSSRSGGSGVAAPGPMTALAGARSSGSATVDGETVVLLVGSFAPSRGLALECGVAG
FT                   RGFEHSSDASSGSSGRSSGSDSGNHGDRLDDSHVDSHRIGYACTPGAIPRGGFHRLAAW
FT                   PASAAVKAGDRWSASPTSWFDGVQSIGVELRVVEEPVVLSHHPVAIAVGGDGHANVPLT
FT                   IVGVNLPGGGSGAGGSYTGGGQTAEDFDARCVGHVGARGERGERVRASVSAVAVTVSSA
FT                   VMICPPFDWVDDHDLGSALAVEVGWNGVPASANPTSSAYTSVEVEILRIPASPNGVAPT
FT                   STSAVGGGVITVAWSEDRPEGDAIFVGATCAFGTVSGIPARMSAMKATETAETETAQKR
FT                   QSGAVVPTCVAPATGAARVGVPVKVAWRSGASRVVGTIDFAPPAVPTPALATDDAGGTV
FT                   VAAAATASYPAAFAANGGSLTSVRTQPWSFGRTQLWSVRCAFFTPERRLVVAYDSARVV
FT                   SSVVATCEAPASAAVGSGGSVALVSGRSAGAGGWDVEAAVVSAISESAKASSVGWIATP
FT                   EVFDVFPRVASVAGGRAITARGRSFGVAERVGVWVGTIGPLRARSIDDDDTAGGSGADR
FT                   AQTNGGDLLEFFAPAGYVRGAMSVAPVSVGATDATRSGIEPGTPGLRYAPAYRCETEES
FT                   CVGVAPGAVAAAASGEITTALLSGVYDGDATVTGHLWTRAGKRRVSLTSLTPFGASGYG
FT                   QSSFTTWRVPAVSGAGWFEVFVELGSGDRASARILAFPPPAASSSGITPGVTPAAGGAV
FT                   VWLAGADMRVLNDGGVDGISNAACVVKYVSGDGSGNVFVGHLRPVSSAIAACETPALPR
FT                   PVPAVSIAAGVVAYDDDGADETEGGKVGDKVGDDVGGRSGGVGRGRVVRGGEAAPVAVA
FT                   LAPVSASSASTPAAVRGAWGGDVIVLSLTRDVYASSPSPSSSSSSSSASSSASSSASDA
FT                   VGGVGWGCRVGTIGPITGQPHHGASAGFDSTGSTGRGVRCVAPGAAPGTYPIILAPLPG
FT                   GFADAGDENQNPPTLAYAPAKASASPRDGSLFVQPSRIVVGSSFVNQKMKVVSGDASLV
FT                   PVAFAAAEATARGFVPSGVRCVVGGASDVVGRLSDSDDAALDALRDALVASCDGAALFG
FT                   GGHLRPGFTVVHVAWVPGVGRNGRNGVADSELVAGGVGGEVMVAERPEASTSRPDATLA
FT                   SGGSVVFVSGANFVDFDVLASGGALSCAFGSGSNGRVAVDVGDGAWVSSALVRCEAPPS
FT                   ADASASSRASLEPVTITTAVPPFSARGIFADQSGPLARSDGNTPDRDPPDGESPAGTDD
FT                   QSAFIARVRSAPSVRAVRPGTVAEGGGDAVVFSLGASLPRHGSGGRCSCQFGTIVRIAT
FT                   SSCWGGEARCVAPAMRPARGVKVGFCSHDPASMACSGVWDGNFLDVAAGSGSAEHAVPS
FT                   TAASSVGGGAVAVGVRVSLHGWGLRRDSVRSGVASSSASALGVAHPTLCAVATAPTLVA
FT                   PVPASATTSSDDRGRVDCVFRSLPPPGFHVVTLHSSLFAGSDETTFGNSGNFGGGSGNF
FT                   DDRVGGGVQMLVRGAPRLRAAYPSRSPAAGGGVLYVSGGDMHGDWSSADFAGDVGRVCA
FT                   FGGVASAAARVVSSALVSCEIPPRPGGEKEDGGETYGDVAAPLSVLTRGADGVHRGSEG
FT                   FEGRDETNDATGPAGSGVSSSSYSNHSLVAGGSLWVEYLADGAGDSTDGFPIDPPRGPL
FT                   GGGTAVTMRLWRVSGGWTFAAGYRGAGCRFGSVQVSARWAGGSDVECVSPGRGLVMAAV
FT                   EASVVADWTTHSFPPPKQEMGRVFYRYVRF"
FT   CDS_pept        complement(682756..683652)
FT                   /codon_start=1
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633076"
FT                   /orf_name="MICPUN_109503"
FT                   /product="Predicted protein"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ACO67497.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR017065"
FT                   /db_xref="UniParc:UPI000199BDFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF7"
FT                   /transl_table=1
FT                   /translation="MSRRSASKLTALAARVASSSSSSPAGGVASSPSGFNRAAAALLAG
FT                   APARRGAPGSSPWGAVGGATRAVSFGALVAPRGGFAQQPHGLHHHRRGIFIQTQTTPNP
FT                   ASLMFMPGKPVYEEGGTKNFANPREGMASPLAKKLFLIDGVTSVFFGQDFVTVTKSEEH
FT                   EWGTLKPEVFAAIMDYYASGEPIITDEAELANAGTAITEDDDEIVAMIKELLETRIRPA
FT                   VAEDGGDIVFKGWNADTGVVTVKMQGACDGCPSSSVTLKSGIENMLRHYVPEVNSVEQE
FT                   VEEGEGMDLLDMATMNR"
FT   CDS_pept        join(683982..684928,685237..685408)
FT                   /codon_start=1
FT                   /gene_family="HOG000261676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633077"
FT                   /orf_name="MICPUN_95929"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67290.1"
FT                   /db_xref="HOGENOM:HBG736541"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199BDFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF8"
FT                   /transl_table=1
FT                   /translation="MDSDDEIEGDPDAPIEDRDAEGTDVVPPSEDAAAVVRTHRGSVYA
FT                   CAWSPTAADCFASGGGDDCAFVHRIGPDASTVTSVALKAHTDTVSSVAFNHDGTLLATG
FT                   GLEGRACIWSVSTGELLRTLEGPGGGLEWVRWHPKGNVLLAGSEDFTAWMWNADNAELM
FT                   QVFAGHSNSVLCGGFSPDGRGVVTGSFDGSLRVWAPRSGECVTLFQGHPFHDGPVTCVD
FT                   FHATTPGLMLTGSEDNTCRLVSGESGKVLGTLAGHTETVECVGLSADFPFAASGAIDAK
FT                   CVVWDLNTSQPRTTLMHDKAVSAIKWIPGTACLYSTSIDGCVRLWDTRTSQCQAAKWGH
FT                   TKGVLDFAASPDFKCLVTASDDHTARVFQMVQ"
FT   CDS_pept        685604..686635
FT                   /codon_start=1
FT                   /gene_family="HOG000168004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633078"
FT                   /orf_name="MICPUN_109504"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO67291.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199BDFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHF9"
FT                   /transl_table=1
FT                   /translation="MDEKGNTLIKAKPRPGVKGINRVLVTGGAGFVGSHLIDYLMARGD
FT                   HVMCLDNFFTGSKENIQHHIGKPNFEVIRHDVVEPILLECDQVYHLACPASPVHYKFNP
FT                   VKTIKTNVIGTLNMLGLAKRVKARFLLTSTSEVYGDPLQHPQTEEYWGNVNPIGERSCY
FT                   DEGKRCAETLAFDYYREHGLEIRVARIFNTYGPRMALDDGRVVSNFVKQAIEGTPMTIY
FT                   GDGTQTRSFQYVSDLVKGLVALMDGDHTGPVNIGNPGEFTMKELADKVREVVNPDATTV
FT                   YKENTADDPGRRKPDITKAKELLGWEPVVPLAEGLQKMVGDFRRRLGKDEDEDGPAAKK
FT                   AKK"
FT   CDS_pept        686833..688497
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633079"
FT                   /orf_name="MICPUN_104180"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67292.1"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI000199BDFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG0"
FT                   /transl_table=1
FT                   /translation="MSDQHGADELRATFQSMGIHLSARWFADCASHLATANPGYRSWDS
FT                   KRKVDEAYLQFLEADMNASGEGCVPPDGLLSLPTEKVFDASNASAGIGNDGGLDVAHRR
FT                   VWRGRFVLQCDEILNVASSFHDRYSEKRAGDDRTLKLSMTDGKQRVVGYEYRPCDSLHV
FT                   LAPAGMKVAVTDAEVGADGFLYLRPENVTVLGGSVPRLEDARRRVVTKWSEPNRPVGGG
FT                   GRDREEAARFAAWNENGVPTPEPRMNEPRPEPAAAPAPVVAHPAIDLAADDDEKEEGEK
FT                   MGEEMGEEDPGRDAAKDVERNRQAEDDLPKTSPPKGTPPGRVRKRRAVYIPDSDDDPTQ
FT                   SGAVPSLPSQRPPAPGPVPVASKTAPSPAPSRGPPPEWATNLARSPPFTYIAAFTLLQR
FT                   RTGPRPAGVAFNGVAVTLHCRCAAVGALEIAADPSGGGKIFRLEVTLDDGTGAVRGELT
FT                   NECVVRLFGGASASTGGTTASAFEASNTEDKARRVEWLRRFLLAFCGRALLRVSMHDDD
FT                   APVSVRRMQGPDDAFGAKDVATLGQRYEKLSASLRPR"
FT   CDS_pept        complement(688651..690036)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633080"
FT                   /orf_name="MICPUN_52058"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67498.1"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199BDFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG1"
FT                   /transl_table=1
FT                   /translation="MAIQSETIRKKLEKEAAKKKEEEEEETKEETTVGTKEERPIVEAI
FT                   AKEEAPDLGMEEARRINAELLEASKAAAARLAALRGTLKETEEELKRSEETQARKAERR
FT                   AAKAEKARILREEEEKKSEEEKSGEPSLADVAAAAEASANLSGWDDDDAAADSWEIAAE
FT                   SEQAAAVAAAASEAARRAEAAVVELEAAAENDRRVVEPEVATAEDAGRSDASASSSRSS
FT                   SSRSSSSRSSSSSSSSSSAASAWGSIGSFFSAALKTVTSLTSPEARAKQAEAERAAGKA
FT                   QLLAAVVSTNIGRDCDLDQLRAVETAVLQLESLNPTKAPMKSSLTKGRWSAVFTSSRQL
FT                   LGLDKKLSLTRQSGPIYWAFDAEEKRAEVSYTWPVKVERASMEVTSEGYKAELEFEQTK
FT                   VFGLFSIGGGKQREYAELEVTYLDLDLMVARGGGNTLYVLVQTNSNYRIGDTTSNNVNK
FT                   QLR"
FT   CDS_pept        complement(<690190..>690966)
FT                   /codon_start=1
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633081"
FT                   /orf_name="MICPUN_71718"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO67499.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG607522"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199BDFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG2"
FT                   /transl_table=1
FT                   /translation="VDGTLLNSSQELTMRTEVAIARAAACGVPVILATGKSRGPWARRL
FT                   LPKLPVPMPGVFIQGLLTCDADGTVLESIELEPDVARDVVEFAKANGASLVAFCGSRIL
FT                   CEARDENTDLVLAYGEPTPEAVGDLRRNMVDAGIAVNKLLLFADEDTNAMPTLRAAAEK
FT                   RFDDRCSITTAVPGMLEFLPKGASKGAAVERLLKRLDIDPRNVLALGDGENDVEMLALA
FT                   GTAVAMAGSGAKVVAAAGGVVGPSNDDNGVAAAIEKY"
FT   CDS_pept        join(complement(695942..696073),complement(693000..695777))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633082"
FT                   /orf_name="MICPUN_106521"
FT                   /product="Det1-like protein"
FT                   /protein_id="ACO67500.1"
FT                   /db_xref="InterPro:IPR019138"
FT                   /db_xref="UniParc:UPI000199BE00"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG3"
FT                   /transl_table=1
FT                   /translation="MEALAGATFNLHHKLRARELTAARPGASTHRSRRFYESVFPTETV
FT                   DHVTVPDDANVMRFTDDGRYLICVSRNQRELVVYRYVGGRGGGSKRAAPPAGRGRTPPA
FT                   EPQAPSGDPAPADDGTGTGTGAGTADDTAGDNDPRRRAEDAFAAYFEHAFSRPLVMDDA
FT                   DLLSKDFALTVLDGDYVIVASSTQPEVRTDGDGEGGHEIADAGAAAAAATNAPNVGAAV
FT                   RPPRPAPDAADAATRGAAAVERAREEGAAARDRLVAAGPTGVGGVDPGGRTVELPASPV
FT                   MQIVAFHLVRLRDGKLCDRVVFRDDYIRLKRAQGLSAVRVSADATLLTVLSLRRQAFHV
FT                   LRCERRRRRNGAGAGGTAGGGSRRRWGAFDGVTQGFGGGEGLVDDGRDGGGDTAGDSAC
FT                   EELAPVSPDEETAGFVVVRPPIGARCEPDDDVPLRAQDAAEARWRERRREAESDADDEG
FT                   DEGDGNIRRETSGTSDRVPMPSGASHPSMGWSDPRSPMYTGLKQKVMTRAFLEARRRDN
FT                   EEWQLYAADAAVLAVEEERLRRNRVPRGFLDQLGWGPGHDSGLHGGGVSSYGHGRAARD
FT                   GAGSDDGEGDGGPGGSQPKEPPAPEPGNYGIAAGKKRKRASSSFSFPVGLPRAGLGVAA
FT                   RLERPRNRHVSAFRSRYWYYAEWMCAWHCGFLDAGHVAVRMGTADDVLAWGRRATNGRG
FT                   GAAGGGDYNRCPATVLVAVVRLSDGAVVHVGDLRGEGGGLLGVESSSDYNYRGDAGEGK
FT                   RANIGGGIGVEWPFGEEPPPAEGTEWARLAPCTASAPRLPATCAVGPARSRTGPGSSGA
FT                   ARFEWPKTPPLPAGHWCASPYLDPALFDFDRRAIAPDERPRGASELSLRFSAPRAAVAR
FT                   VRARVDRDAARQVSDKEPESYGKDGDGDGDDDDAWLNALVGGRGIKSLRFKLPPSAGAA
FT                   ATQRMKRSVSHMFHPVFPFAMSVSHAFMHPQVVSFHFRE"
FT   CDS_pept        complement(696822..697472)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633083"
FT                   /orf_name="MICPUN_109505"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67501.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG558486"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI000199BE01"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG4"
FT                   /transl_table=1
FT                   /translation="MDHHCVWVANCVGAYNYKFFLLFLLYTFVATIFDAVVLLGPFVDF
FT                   FRDLEASSHGGGGGVSNSGGRDQDSGFVEVNDELNGGQQAGRGGGMAAVFVTFVLDVAF
FT                   AASLLGFIIMHANLNLSNMTTIEMYEKKKTLPWRYNVGARKNFEEVFGKNPWLWFLPYH
FT                   STDQLRRLLDISRLSGGTYPEMRSDGLDPAGEPTRAGDSPRGMPPGNTCAKCI"
FT   CDS_pept        698463..699926
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633084"
FT                   /orf_name="MICPUN_104184"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67293.1"
FT                   /db_xref="UniParc:UPI000199BE02"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG5"
FT                   /transl_table=1
FT                   /translation="MEDDWLLPSSADAPRDDAPDPDPDLIRTLEANRAGWLARRCKSAH
FT                   WGIYRLTQSAECPDDKTRGRYAVRCSICGTRYAVDPHVGGSFLKRHVTGKHPGAWTWWS
FT                   ARCAALDLAERTHRAGPRVAAEHGDGDDDDDDDGDGDEKDVATMKRRPPRSSRRSDAGG
FT                   KNPGDKRARIESVQAEASTQLAAAFAERRGVDGANARNANPGSRGANPGGGDVAAGIAA
FT                   MCQDCEPCELRPKAFFVAWSGVMTLAWEGFPPAMASLKRRIARAFPALSPEKPGSRWAK
FT                   TTLGCLKEGARLTPAQLDVLVDLCERFGGKIAATSDREGAEEGAEEGAEGVPTEGVPTE
FT                   GVPTEGGVAEVAASPGCVPVDGLSVVLFQCRSLERVLSEHVVSFRTNGIARNRDRPSRD
FT                   ETAVVDAVLRESSRECLEKYWPLAARDGGREPHYRDDKFGATLVARLRRPPRAVAEFRA
FT                   AVDAALPGMYAWFHDDSLHVTLRGLVDPP"
FT   CDS_pept        complement(700071..701099)
FT                   /codon_start=1
FT                   /gene_family="HOG000200475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633085"
FT                   /orf_name="MICPUN_109506"
FT                   /product="Predicted protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO67502.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="UniParc:UPI000199BE03"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG6"
FT                   /transl_table=1
FT                   /translation="MERRDKPHVFVLQFFGDVRASQASNLREEVTAVLRSAKKSRGDEV
FT                   VLVLNTGGGTVTGYGLAAAQLTRLKDAGIKLTICVEQVAASGGYMMACTADRLVASPFA
FT                   VLGSIGVISEIPNVYERLKKEGVEFQTVTAGKFKRTLTPTKKIEKADVEKSKADIEDVL
FT                   TLFKTFVKQQRPKLVIDEVATGETWFGADALKRDLCDELKTTDDVLLELLAAGREIFSV
FT                   KYRPPQSGPAALLAGGGGGDDDARMGASANGGGGGWGALRAAALGVATFAQAAGGLPGS
FT                   VGLPFSGSYPGSSFGTGEALAVDGADAAGKVMARGGRYLGEEDYVGGGIFSAVDDEDEV
FT                   YF"
FT   CDS_pept        703037..703942
FT                   /codon_start=1
FT                   /gene_family="HOG000238492" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633086"
FT                   /orf_name="MICPUN_64220"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO67294.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG690661"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="UniParc:UPI000199BE04"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG7"
FT                   /transl_table=1
FT                   /translation="MAPASTNPFDTAPLKFEIVQGALVKYSVEEPNGRHPPTAVLIHGI
FT                   LGSRRNLLSFAKRLAQRFPSWQFVLVDLRCHGQTANMPTPPAGANDVTNAAKDVLATLQ
FT                   HLKIYPHSLIGHSFGGKVAMSMVHQFGKQLPRPVQVWVLDTVPGDVWCEAGDHPRDTIA
FT                   YARTIPMPIANRKALVDSLTGAGFTLEGAQWMTTNLTPAPGATAGELTWVFDIEGIVAM
FT                   YQSYEATDLWPMLETQPIGLSVDFVRAERSAFVWADEDVGRIGAYGGRVHYLANSSHWV
FT                   HIDNPDGLLEILAPSFERKK"
FT   CDS_pept        complement(704006..705199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633087"
FT                   /orf_name="MICPUN_64221"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO67503.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="UniParc:UPI000199BE05"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG8"
FT                   /transl_table=1
FT                   /translation="MLGSSTAPERVGKVRVAVVGDTGSGKTSWVHLIRANGPHGGSRGA
FT                   GAASVRDQERTMGCKPEVTMVSFDEVRTTGGANPSRPYFVEMWDVGGHHEWKNLRAAFY
FT                   ADLDGVVLVHDLTRRRTLGRLARWAREIAASASFASQTPAGSETDARDAMVAAVGGKLL
FT                   GDALDGCVVHGFCGLPVPALFVGNKADIVDPSSSRDGEDASTPGEILSALLWRAWVAIA
FT                   TRLRLPKAWRGGANGTPGGHKRSGSFATLLPTTVQELKRVSSGVFGDGGGVGGSWDQPD
FT                   TPPSSASAAHAASLPPPSGGLRCSATRGDVDMTVVEAYFRELIRRRHYTGKAGGTVWAS
FT                   AAGGGTAGGFDLPTPPTTTRGDHGGGAWLRGTGAGTTTQPARAQWMGGDRLDANDLT"
FT   CDS_pept        complement(712088..712636)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633088"
FT                   /orf_name="MICPUN_109507"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67504.1"
FT                   /db_xref="HOGENOM:HBG610229"
FT                   /db_xref="UniParc:UPI000199BE06"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHG9"
FT                   /transl_table=1
FT                   /translation="MTALRARAPIAARTARGVVTAPSTIRAPDASSGQITRRSRVVASA
FT                   GSGEKLGTDKTYNCVVTEDGVIVAKDIPSGVYEVSAWWAGATSGDEDEQPLAPRCDSER
FT                   QRGCEVRCEMTAEGELVCEGLSSGMYRVINASEYDAECEVKDGSFECKTSFDEEPLRLD
FT                   TDDFKAVETEEEHGFRMGG"
FT   CDS_pept        complement(712979..713989)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633089"
FT                   /orf_name="MICPUN_64224"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67505.1"
FT                   /db_xref="UniParc:UPI000199BE07"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH0"
FT                   /transl_table=1
FT                   /translation="MDNPNVEFTRDVAGALKERAEAQSMMAKHASAQREAMQEACLGAL
FT                   RKALPGASAETCLMALETANWDVDRAHAQVKAFMGAAATVAGGGGSGKGRSSRKSKRRR
FT                   RDDSGSDSDSSSASSSSSSSSSRKKSKKSRKSKKSRKEKKGKKEKKGKKGKRDAKKHGK
FT                   EATEPEFGARGFIKETDKYDKEGEFRAWLGEVKKLDVESLQKWEEKELFKEYAEDYNTA
FT                   TLPHEKFYHLEKWSREEAARQAREDPTAAAATAAAERESFNDEEERKREIQLERERRDA
FT                   EYKRETYLRMKSDSGDLENLREQERLKELRKNAYNMGDMETVARVNKILAPDEPT"
FT   CDS_pept        complement(714197..715381)
FT                   /codon_start=1
FT                   /gene_family="HOG000173282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633090"
FT                   /orf_name="MICPUN_88116"
FT                   /product="Predicted protein"
FT                   /function="tRNA (adenine-N1-)-methyltransferase activity "
FT                   /protein_id="ACO67506.1"
FT                   /db_xref="GO:0016429"
FT                   /db_xref="HOGENOM:HBG737548"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="UniParc:UPI000199BE08"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH1"
FT                   /transl_table=1
FT                   /translation="MATRIGHLLHRAPGASTPVPDDDDDGANPRGATDADAAPSTPPHG
FT                   AGRTVQLGDLVVVYEGFNRQKAVTVTEKGCYQNRYGNFHHREWVGKPYGSKVYGKGDAG
FT                   FVWLLAPTPELWTKVLPHRTQILYLPDISLVCHALELKPGSVVLESGTGSGSLTHSLIR
FT                   AVAPTGHVYTFEFNRVRAEAASAEIVDHGLADFCTVTHRDIEANGFPGELEDRCDAAFL
FT                   DLPGPWKCIPSVAKCLRPDGVVCSFSPCIEQVQRCCEALEANGFGDCQTVELLGREYDV
FT                   EARELQRDLALAQPKLSSRWKREAKEKARRKRKHVDGGDGDGDGDGGGDVQLEPKPVVV
FT                   AHPRQEAQHHTGYLTFARLSPLVTGEMIDAARAAGGGGTRRRGGGGYDEDELSE"
FT   CDS_pept        716364..717416
FT                   /codon_start=1
FT                   /gene_family="HOG000201405" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633091"
FT                   /orf_name="MICPUN_98344"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67295.1"
FT                   /db_xref="HOGENOM:HBG560750"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniParc:UPI000199BEA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH2"
FT                   /transl_table=1
FT                   /translation="MRFHPDTLQYWPTVYVNEFWLLRDHHVPLNASVAAANLTLTVAPL
FT                   SLFRWQLYEQMERTFEHQRAMGTQGEGDGDELKRIFLEGNPILLAVTTVVSVFHTVFDM
FT                   LAFKNDIGFWRHNKSMEGLSARTIIFNAGCQLVIFLYLLDNETSWMVLLSSGLGLIIEG
FT                   WKITKAMDVSIKPAFPFLQIKDKFGYTKSDTARHDEVAMRYLSYALYPLVGCYAIYSVI
FT                   YNEHRGWYSFVLNTLVGAVYLFGFITMCPQLYINYKLKSVAHLPWRQMTYKFLNTIIDD
FT                   LFAFVIKMPTMHRLSVFRDDIVFLIFLYQRRIYRVDKTRVNEFGFSGEAPPDAIDEKKE
FT                   DEDKEGKKDK"
FT   CDS_pept        join(complement(721654..722008),complement(720524..720954),
FT                   complement(718214..720049),complement(717491..718060))
FT                   /codon_start=1
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633092"
FT                   /orf_name="MICPUN_95935"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO67507.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199BEA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH3"
FT                   /transl_table=1
FT                   /translation="MNLQSPSPRRMRGQSFSRSPAAATASTARAPARTSSPSRLTCRRR
FT                   RSTSRRISRGSSAGPRTYPRRRRRRMAAGPGCRGARRASWSSAARGRRRRRDPGAGRRP
FT                   CPRRRRRRRSRSSRPSSKRRRTDDPAPTPATTAEIQPARDDDSSQPRDRKEDAPAAEKG
FT                   KDPAADLAAQMRERRERAAAAAAPAPAPAPGAADDDDAPGVSDRRPPGWTLDADEDLAG
FT                   MADEDDDDDETPRPAANKPGTDEDEEDVDPLEAFMAANDSKPANVGLARPPVKRDDGGV
FT                   KGGRAVKKIGLVRRFFDADSDGGDSSESGGGADSDTDGAGSDDDAEWARKQQSRMSKAD
FT                   KLGVADHDSIDYPPFRKNFYIESYEIARMTKAEVKELRAELEGIRCRGKDVPRPIKTWA
FT                   QAGLSNRVMELIRRSGFDKPMPIQCQALPVIMSGRDCIGVAKTGSGKTLSYVLPMLRHV
FT                   KDQRPIESGDGPIGMIMGPTRELVTQIGKDCKKFGRAAGLVAVSVYGGSGVATQIGELK
FT                   RGCEIVACTPGRMIDVLTTGAGRITNLRRVTYMVLDEADRMFDMGFEPQITRIMNNLRP
FT                   DRQTVMFSATFPHAMEALARSALTNPVEIQVGGRSVVNSDIEQIVEMRAEEDRFLRVLE
FT                   LLGEWYERGKIIIFVASQDKCDQVFRDLLRSGYPCLSLHGGKEQSDRECTIADFKSDVC
FT                   NILVATSVAARGLDVSGLRLVVNYDTPNHLEDYVHRVGRTGRAGNKGTAVTFISQEEEK
FT                   FAPDLVKAMTDAKQPVPSDLRLMADEYAKKKKEGLVVGGKSSGFGGSGFKFSREEQDAE
FT                   RRAKKAAALAAGLEVQADDESDSDDEGRFDDDGEPIFQSVGRSGAAAAAAATTAAQAAA
FT                   AEQVALLNAAARAAAAKIGSSLGVTPTAAQGPTQAQVNAANNSQMSLAISQAANSMALV
FT                   TGATTGAARAAAFAAALNAQHAAARSGVFQADGAHFESELEINDFPQQARWKVTHKDTL
FT                   AQISEFTGSAITVKGQYYAPNKPVPPGERKLFLLIEGPSERCIKTAKGKIKEIIEEIIA
FT                   KESLPGGFNTGKYKV"
FT   CDS_pept        complement(723393..724079)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633093"
FT                   /orf_name="MICPUN_104193"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67508.1"
FT                   /db_xref="HOGENOM:HBG558492"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199BEA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH4"
FT                   /transl_table=1
FT                   /translation="MAAAAQHIARLAASRGTSATTASSRAHSAARHPVRLLAKPRSARP
FT                   SAFAADEIGAAGDEEVNLKDVTRKLMDCRKRKAASNAVDLLVSLGRAGIEPDLLASTAC
FT                   LGACVAAGKMDLALKVFEEVFDKRVVEPDEVVFTELIRGYLASSPPSWTRAMNTLDRME
FT                   AFDVVPGALSYNILLAKCADDNELERAEDIVDRMADEGVEPDRFTMEAVKKRRSIRSYA
FT                   KKVLML"
FT   CDS_pept        join(724362..725792,726134..726463)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633094"
FT                   /orf_name="MICPUN_64230"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67296.1"
FT                   /db_xref="UniParc:UPI000199BEA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH5"
FT                   /transl_table=1
FT                   /translation="MAAPAEDPAEAAADRTDVPDSLGGRRTFAPARPGVNVAHGEDALR
FT                   AYLAWDGHARAAHMDPDAFARWLEREVLQYMTANRASLLRARADGVRRLHASTLDPLAH
FT                   ALERAEAEYRGSAEGARIERAMHAVARRRAAVAGIRSFLESTPTTPELAAKQAAASDKL
FT                   EHALASLPAAELELKDAVASSPLWRDVERARDALRAERARTGLASADDDARAASTANGN
FT                   SLVAKGDDYEKTCADVVADAFLAGGLIEGADWGADGDADREREGVGVLLLRNVTLGLHS
FT                   GELDCVLVRVNHSGETESAFVDAIPQDGDGTTGRRTLARRGRTAAAAAVAGDDGDDEKN
FT                   QKNQKNQNRPAVEVLAVFECKRNPDDVARGFHSRQTTLAWLAGDEAAYDPREWANRRHP
FT                   SGHFRRGYHPMKLARWVRGGGGDESPGGSKYGKAVVLTRDSFRGFRRTHRTAEGRGGFY
FT                   LDGVWMVTRPRTMCGLDAKLRAPLMEIAGSHVSAHVVQSRGGSVPSPEDFFLAVDALRR
FT                   ERHASPPSSNGDDPLRAKLRTLHGWLLRAVGEKSAALPNDTRGVLELYLDRGERSARQV
FT                   LLVEEQPNPR"
FT   CDS_pept        727490..740077
FT                   /codon_start=1
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633095"
FT                   /gene_name="DHC2"
FT                   /orf_name="MICPUN_64231"
FT                   /product="Dynein heavy chain"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /protein_id="ACO67297.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199D58A"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH6"
FT                   /transl_table=1
FT                   /translation="MPERLMTRTRGFDRAPGDAPAPGAAFDWVPTAEYEARHFVRPSTA
FT                   EIPTRAPESTPLELFDDPELELKTPEQWLATRTPGGDRCGAVSRYFTGHGQFTWEPCWV
FT                   TGYDESSDTYAIEWRVSPGVTKRVKRLNLIFDAEDPDAFRTRLNSARLLRDRHERALRY
FT                   TRAAEEIFEYENDDLCDAPSFRAKISSACDGCRRNPIKTSTAVPGACDRFWAENLRVYR
FT                   LAHKRSYLDLALRDDNKRARLADIGVEPLDSDNERMNARGCAASPGRHPDAHAIAAEEI
FT                   AALLPDADADFLDAHQRYYANCDVRFETLLDAEPPRPGLLPEDPVTLDDFEKKQRTQLD
FT                   RVSERMRGECVIVAVDILRELERTKRSQAEAAARARLEQRLAKLTPVERSMWMDANGED
FT                   VESNIREEASSALARATMMPRFLKSLTICAKDQVRTVVQNSVASYLRFWSQFAGGDDAV
FT                   ACRGVLHHLPFMKVTLMIKDGEVAYDPPLEKVKDVALNLFDDMVESVRDIPQIRAMLEA
FT                   TSQSETSTSADAGEGDADVVAVSVDFEKVPAPSADEPFVVEARSAIVAIVDENFTGPVA
FT                   LAESYRAFDELMVKPEPTPTPDSEPDLNPSVDGGANADGDADPSAEGEALAPAEAPDVE
FT                   AAPDAAGASSSDAAPKPEGGDGEEEEEEAEPEAEVELTLEDKENEMRRLASLAASVDGN
FT                   SESWLTFRLLGVSCYEIKATLMDEANARRNAMLKELTDEFFRGSTSCRDRYADIANKLR
FT                   MEVTNPEELDRLRRDMEKAFAERDGLQADLDACTALSEALERAFHWPSLDEEVAGVYWE
FT                   AMTWPSVITEIVAECEQRVKELTKKFKKELKADKETLSEDCHSARFEYNEFIRLGDIDA
FT                   VEERLVRVEEIDAHHEALKERQELYASRQEIFGERGSRPKHLAELVKDFEPYANIWKTC
FT                   AEVTRTVPEWIEGPFAALDPEKVSGAVEVWDRSTKKNLKVLDGPPREVGEALLAKIQHF
FT                   QELLPLVVALRNPGLKDRHWAKLSEDLGFAVNGKDPNFTLQKALKLDLVAHIETVEKVS
FT                   ESASKEYSLERTLDKMQKDWTGVVFERKAWRETGSYILNATDEIQILLDDQVVKAMAMK
FT                   ASPYIGPFEDRAKQWEKTLLTIQEVLDSWLKCQNGWLYLEPIFGSDDIMQQMPTEGRKF
FT                   KTVDVQYRKMMEKLKITADVVVVGADEELLNQLQQSNALLDDVNSGLSEYLETKRLAFP
FT                   RFYFLSNDELLEILSETKDPLRVQPFLKKVFEAIHALEFQEDLEATAMISEEGEKVPFK
FT                   NSFNPNSAGGQVEKWLTECEAAQRETVAEVCKHSSEAYATTKRTEWMIQWPGQVVLCIG
FT                   SLYWTSETEEALRTGTMPEYAEKCTAQLMDIVELVRGQLTKLQRKTLSALVVIEVHARD
FT                   VVAQLAKQGVASPDDFEWASQLRYTWDEREETGEAAVMVRMINAAVWYGNEYLGNSSRL
FT                   VITPLTDRCYRTLMGAVHLDVGGAPEGPAGTGKTETTKDLAKAIAMQCVVFNCSDGLDY
FT                   LAMAKFFKGLAASGAWACFDEFNRIDLEVLSVIAQQILTITRAKAAKLELFDFEGTRLP
FT                   LRRTCNVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIGEIILYSFGYLEARDMA
FT                   RKLVATYKLCSEQLSSQSHYDYGMRAVISVLRAAGAVKLKFPNEDESVLMLISLKDVNL
FT                   PKFLAPDIPLFNNILSDLFPGVVLPEPDYDHMRASVMKECAKANLQPTPVFMEKLFQLY
FT                   EMILVRHGLMLVGYSYGAKTCIYQMLAGALNDLKAQNLLDENKVKVVVINPKSIYMGQL
FT                   YGQFDPVSHEWQDGVLAKKFRECAVDTSPDRKWVMFDGPVDAIWIENMNTVLDDNKKLC
FT                   LMSGEIIQMSGTMNMIFEVQDLAVASPATVSRCGMIYVEPSSMGWEPLKDSWMNTLPPL
FT                   IEPHKPRIEELFTWLVKPCMAFVRKNCKELIPTSDINLPVALMNIFDSMIDEFRVELAD
FT                   GEDFDEIMAPKDQKIFVDCVFLFSVVWSIGGTTENEGREKFDFFLRKLVDGKVDPSPER
FT                   TDFDLGPGLEIVPPTEKRVAKAFPKATEGSVYDMHFEKDKFRWTNWLKTVKDEPIREEL
FT                   EFQNIVVTTIDTIRYRYIFDVLATHGKHVLFGGPTGTGKTVYIKQSLDAMDKDKWTNIQ
FT                   STFSAQTNANQIQDIIDNKLDKRKKGVFGPKQGTRAVVFIDDLNMPMLEEYGAQPPIEI
FT                   IRQWLDHGGWYDREELTMRKLVDIQFCAAMGPPGGGRNPVTPRMLRHFNQISICDFDDN
FT                   SLRRVYTAITDWWCRRASVPKDVGLKLPGKLVEATLEIYNTIKRELLPTPMKSHYTYNM
FT                   RDISKVWQGVSMIGEAPQNQLELIRLWSHETLRVFHDRLVNDEDRMWFFSFLKQMVDRH
FT                   TGQKFDKVFAAWDFDKNGTVDIVELRRLMFASFMDGSGAEGKYAEVKDVDALQRLVTEQ
FT                   LVEYNQSGKMRMDLVLFLYAAEHICRISRVIRQNLGNALLVGVGGSGRQSLTRIAAFMA
FT                   EYEVYSIEITKSYTQVEWRDDLKNVLRKAGGEGSPTVFLFNDTQIKMESFLEDINNILN
FT                   TGEVPNMFAKDETAQVIDMVTPRAVKAGVNAGSRADLFQFFVDECRRNLHMVLCFSPVG
FT                   DAFRERLRKFPSLVNCCTIDWFSEWPEDALRSVASQFLKDITMDSDAIRDSTLDMCMQF
FT                   HVDVRHLAEKFLANLGRYNYVTPTSYLELIGTYRRLLNEKRDEVQTMINRYEGGLAQIY
FT                   EAEDSVAVMKTELIDLQPVLERTAVETEEIIKQVNLETVDADKVKASVAKDEAYAAEQA
FT                   ANAEAIKVECETELAAAIPVLESAIAALDTLTKEDITYMKAYKNPPEVVKLVMEAVCIL
FT                   LKVKPAMVKDPKGGVKKIANYWIPTIKLLGDSQFLDKLRSYDKDSIPNKIIKQIKPYVA
FT                   RPEFQPEKVKEVSAAAYGFCCWVRAMEAYDSTVKVVEPKKKKLAQAQEEYEGLMVGLNE
FT                   ARGKLKEVEDKVQALNDKLEAMQNKKAQLEFDYDMCGKKLVRAEKLIGGLGGEKERWKQ
FT                   VAAGLKVDYTNLTGDVLLCAGYIAYLGAFTQPYRDEVLGKWIEQCKAGGIPCSDTFKLI
FT                   TVLGEPVKIQQWAIDGLPNDSFSVDNAIVMNKSRRWPLIIDPQGQANKWIRKMEQPRNL
FT                   VVVKLTDGDFIRKLENAIQFGNPVLLENVGEELDPTLEPLLLKSTFKQGGQMVIRLGDS
FT                   TIEYHQDFRFYITTKYRNPHYLPEISVKVTLVNMMITIDGLVDQVLGIAVAKERPDLEE
FT                   EKARLTTEGAENARQLAEVENKIIEVLGSSEGSILESETAIDVITNAKELSNEINRKQA
FT                   IAKKTEITIDETREGYRPLAVHVAHLFFNVGELCNIEPMYQYSLAWYVNLFNHALEFAP
FT                   RSDDLQKRLDNLIDFFTYSLYKNICRSLFEKDKLLFSFTLAATIFTYKGTLDPGEYRFL
FT                   LTGGLGQKPGADDVPCKWLNKNLWLEMLRLSDLPAFDGFADAFRSNPDAWQHIYDSANP
FT                   ESEALPAPWCDKLDDFQKLIALRTVRPDKLTRAVQIYVDKSMGRRYIEPPPFDLEQCYN
FT                   DSTCFTPLVFILSPGSDPMDSLLKFCAAKDISMETLSLGQGQGPKAEALIAQGVVDGSW
FT                   VVLQNCHLAVSWMTTLDRICEEFVTNTSPPHEDFRLWLTSYPSPHFPVAVLQNGVKMTN
FT                   EPPKGLRANMISSFQNDPISDEDFFEGCARPAEWKKLLVGLAFFHAYVQERRNFGPLGW
FT                   NIPYGFNDPDLKISLRQLRMFLDEAGEDQPLAVPLKTLVYLIGECNYGGRVTDAHDRRC
FT                   LMSILTDEDGGPFHVNIMDDNYRFSPSGLYYAPEEGDHESYIEFFKQMPIAADPEVFGL
FT                   HANADITKDQQETDLMCNSILLTQGNATSGGGKSKEETLAEVAAQIAESIPPVFDLELA
FT                   NYKYPVDYYESMNSVLCQELVRFNRLLEVIHASIGSFQLALKGQIVMTGELDALGNAMF
FT                   DGKIPAMWAKKSYPSLQPLAAYISELVRRLETLQKWIDEGAPPMFWITGFFFTHAFLTG
FT                   VLQNYARKYKLPIDTVVFDFEAMPANHDFTKKPDDGAYCNGMFIEGAKWSDENMTLVES
FT                   DPKVLFTEMPVFWFKPTTQDKRADFPHYLCPIYRTAERRGVLATTGHSSNFVINLTVPS
FT                   DKPQNHWIKRGVAGLLSLSY"
FT   CDS_pept        complement(740176..740880)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633096"
FT                   /orf_name="MICPUN_64232"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67509.1"
FT                   /db_xref="HOGENOM:HBG558494"
FT                   /db_xref="UniParc:UPI000199BEAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH7"
FT                   /transl_table=1
FT                   /translation="MPVAVAVRIPAVGAVAHRPSHRARRCGLASAIAPRPPSSSSVAPR
FT                   PRLGLASPSAQPMVATRASNPDTALLTGADYVPSPMDTSMLTSQLVVLGFTGVMVAYWW
FT                   YVLVPGARVNLAVNKRSGRLRDYLEELKGDDSRKMERFFYQKWLAKVDPETRFLLRDDG
FT                   DEDGGDGDVVKAKTRLSDTEGVTRDVGDESLEDVIRKARRTPKFWSGDNPVLVGTALTV
FT                   GAGVLVGALTGR"
FT   CDS_pept        741902..742897
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633097"
FT                   /orf_name="MICPUN_109509"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67298.1"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="UniParc:UPI000199BEAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH8"
FT                   /transl_table=1
FT                   /translation="MVIAEDGRGFVQRVDRYPQMAVPCDDVNPDTDCEPIGIYSAPRFE
FT                   RGAEDTVTFDAPDLGLPAAMWISPEDGGMWYVDEVELRCSDGSEMAIAAEERRRGAIVS
FT                   YPCDDWVGGTNPDDAALELRPNGFFKMTPEQRTKMREDGLREYGELKFKMLTATGVAVA
FT                   LGCLATASLSGDGAEHGADHLELMRSFASGGGVGLVYLYMLTRSVDTIGPGDSAKPFGL
FT                   MLLDAMTGIASSGPVRLLLLALMGTWGARYVEASTGVGGHPHYGDFFAAVIGFFSYKAG
FT                   VLVAGFSGVDFTAIDADVVVEPVPVRIVEQPRRVPGTAVDRQFKGRPGAR"
FT   CDS_pept        complement(743230..745368)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633098"
FT                   /orf_name="MICPUN_104196"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67510.1"
FT                   /db_xref="UniParc:UPI000199BEAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHH9"
FT                   /transl_table=1
FT                   /translation="MAGGIRAVARMSLRAPRQHGGNVVIAHARPSLRAVASFPQARGGV
FT                   VAVAGSADAPGTAVRAAAAVGAIARRDAAASSGRIAHLAAGIAPRFRSLRCTAPARTAL
FT                   NASSGDDERVNLDLSDDPFEHVALPVDEAAFDAAVDDIIADDDDVDAPAGSTSSAWSYS
FT                   APGDDLPWDAAGAWPEFDALLGKLMAKGYRIEPEGAAGGAAVDASVSTPEWARAVAKSY
FT                   DRESHGESDGEDDELSDPFAHVAKQKGEWDTDDSSDDDLVELSYANKKRLLLEFSRDRE
FT                   DLLRRLSERELYVLADHPLRKDQGNAGGRKVVNAMKRLRARLGMDASYFAGQCAALGGG
FT                   DTMGECTFSDVTRLVHVFADDVAPQFRPDRAAMQSLLRRISALADTEKLPETTEPATVT
FT                   ATVTAKEPRWMERRERRPPVREYEEDRYVRPGAAAGRGRGRGRGGRGFESRGGRGGFDN
FT                   RGARGSYAQRDSRKERYYDDDDGYRPRGRMERDDGYGGYGDRYGDRYGAGRDRAPRGRA
FT                   NRFRDAGDGFYDGGDDGWDTRRSRGGRGGRGFESPRGRGPSSRGRGDRPGMGDRDVDYG
FT                   RRARTKGGFGSDLDGLDLENDGGVGDNFGGDRFGDRYGARGDSFRGERGRAYERYGPRE
FT                   QERRGRAAMGRGRGGGRGRGGGRGRGGFDNRDRGFDSREERGGWDSRGDDRGASGSGER
FT                   DRNRVRMWKPKDSFGEEY"
FT   CDS_pept        746101..747756
FT                   /codon_start=1
FT                   /gene_family="HOG000034027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633099"
FT                   /orf_name="MICPUN_98347"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="ACO67299.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG516369"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="UniParc:UPI000199BEAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI0"
FT                   /transl_table=1
FT                   /translation="MLAIAASPMGVQLHCLDPSDPAPAAVASKHTLGSYQNRDDVIAFA
FT                   KDCDVVTVEIEHIDTKALKELEDMGIDVQPTSRTLSIIQDKYAQKEHFAKAGVPLGDFK
FT                   SVADEAELQAVADDFGFPLMIKSRRMAYDGKGNAVAKTSGDLSDAVAKLGGYDKGLYCE
FT                   KWVPFVRELAVMVVRSKSGEVRAYPVTETVHANNICDVTTTPANIPASVAKEATIAAKA
FT                   AVASLEGAGMFGVEMFHLEDGRILLNEIAPRPHNSGHYTIEACACCQYQNTLRAIMGWP
FT                   LGDTDMRVGGAVMKNILGDGEGDAAMRRMHDVMGAALKVPGANMHWYGKEASKAGRKMG
FT                   HLTVTGKHPTEATARLEQVLTIASGEPDAKPDLPPLVGIIMGSDSDLPTMAAAAETLES
FT                   FGVGVEVTVVSAHRTPERMFEYARSAASRGLRCIIAGAGGAAHLPGMVASMTPLPVIGV
FT                   PVPLKHLDGVDSVHSILQMPKGVPVATVAIGNSTNAGLLAARIVGAYQPEVLVQMEEYQ
FT                   ADMKTVVTDKAEKMETKGWKEYLGGMKGKPESMK"
FT   CDS_pept        complement(747879..749519)
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633100"
FT                   /orf_name="MICPUN_64236"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67511.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI000199BEAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI1"
FT                   /transl_table=1
FT                   /translation="MSSPGGTGWLGKMGGATRPPPAGGAPGAGVEPPTPETQKRVDAAK
FT                   AYIENLYRNQQRSLQQRMERRAAVAGDEELPVEAKQELLQELDEQERKYTRLKRAKLTA
FT                   DDFEPLTIIGRGAFGEVRLVRDRSNGQIYAMKKLKKTEMVRRGQVDHVKAERNLLAEVH
FT                   DEAVVKLYYSFQDDEFLYLVMEYLPGGDMMTLLMRRDTLTEDETRFYIAQTVLALETVH
FT                   SANFIHRDIKPDNLLLDKDGHMKLSDFGLCKPVDQRLLDTLPEIAEEDGTPTPENEEAE
FT                   GTVADPARRQAQLRHWHENRRRLAYSTVGTPDYIAPEVLLKKGYGLECDWWSVGAIMYE
FT                   MLVGYPPFYSDEPMTTCRKIVHWRHHLRFPAEVTLSPEARDLIERLLCDVNQRLGTAGV
FT                   SEIKSHPFFYGIQWDKLYAMHAPYQPEVNGELDTQNFEQFDEDDAFAKKQRANAAASRK
FT                   DLDFIGYTYKNFEVVGEEVQKKKSKAKPSLASIFPGAVTPEPKPAAESESSTPYHTAQF
FT                   HGLAEESEEEEEAAAAAAAAVGRMSVADP"
FT   CDS_pept        join(749887..749955,750203..750787)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633101"
FT                   /orf_name="MICPUN_64237"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67300.1"
FT                   /db_xref="UniParc:UPI000199BEAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI2"
FT                   /transl_table=1
FT                   /translation="MDPDVLVSHLDDFRDVLIKINDDLSHAKSQFERLKRMDVDEQAAF
FT                   VDEHTRGLDATMAAMDALADDACAHFRRGHADAATGLEETEHALRRQASEVSVALLSQD
FT                   GDLKQTRTALDNLREFTRAELRHQREVSEWTVRAAHDFLEDLREDKRKVAAETVGRVGR
FT                   WHAGARTRRLARHRETFGALSAHIERSAETQGAKTLELREVIDRADRRLGIRRR"
FT   CDS_pept        join(<751211..751486,751532..>752053)
FT                   /codon_start=1
FT                   /gene_family="HOG000227962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633102"
FT                   /orf_name="MICPUN_71588"
FT                   /product="Predicted protein"
FT                   /function="rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67301.1"
FT                   /db_xref="GO:0000179"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG319664"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="UniParc:UPI000199BEB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI3"
FT                   /transl_table=1
FT                   /translation="RRWLGQHFLIDHSVILDALDAAAVTDGDRILEIGPGTGNLTVELV
FT                   KAGAVITAVEKDRNLADKLRTQYDGDDAVTVHEADFLKWNVAREFEHRGVYPGDAHRAK
FT                   VVANIPYNITTDILKTLLPMGDTFGDMVFMFQEEVARRLIRQDSGASDYRPMSVRVHYY
FT                   SEPYYIRPVTASCFDPPPNVESCLVGFRPKPRRELPALRGTEKQFFSFVQACFAQKRKM
FT                   LKNNLRAVCDDEVIAAALEDLGRDEKTRAQQLTMDEYVRLFNFV"
FT   CDS_pept        complement(<752458..>752889)
FT                   /codon_start=1
FT                   /gene_family="HOG000200857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633103"
FT                   /orf_name="MICPUN_76893"
FT                   /product="Predicted protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67512.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG328980"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniParc:UPI000199BEB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI4"
FT                   /transl_table=1
FT                   /translation="RRLKRKRPPEGWDLIEESIEDFEQQMKDAVAEEHEGKRKNELTWR
FT                   IHRIHWEKNRFIWDLRYKRKVMGDELYDYLCREKVADQALISKWRKPGYENLCSLLSIQ
FT                   KGDTNFGTASICRVPMASRAPQQQLTPNVKTGCISCVSGD"
FT   CDS_pept        753387..762362
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633104"
FT                   /orf_name="MICPUN_64240"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO67302.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199BF50"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI5"
FT                   /transl_table=1
FT                   /translation="MALQIAALNDPTRGGGRHGSAAARAAARRTTEAEESRLTSKYEHA
FT                   LLFMRDGALEDAERELRSILDHDMMSGPPNHRPVEEYPAPAPKPTRDAEDSDTDDNSEY
FT                   ESEDDTPEMTLTSTMTQVKFLALKNLGRLVADRAERRERELNDSYDDDARQLHLDADFA
FT                   LALRCYAAAVEIDGTDASLWRRLGALAASRRLPHVARYALERGLAIAPTHPLMLEDLAE
FT                   TLLAVGDLDACAHIATLLRKVDPGHARAARMRDDPGGVTPLAKFSRAAKFLSSTSINAD
FT                   DAGDPNTRPAAFAPSSTADEKDHDGAEITLRVAEKSWESVARVLNAAMGSAPPDDYVNE
FT                   DADADLMDVGILRLWRERVPEFKTQWPDMSLRYRNRERDPTTWQGVRFDGPGLGNSDDR
FT                   LIKLVVVGRGEQSTLTAAALEPELGKLDALRHLELRNCALTVAPPSISKLTALTYLDLG
FT                   KNRLTYVPDISELINLQVLILSDNDLMELPKLPIPPDDSDEDTALRSVEISGNPRLAQH
FT                   MTPATVKYLFDHLPRSRKIRVLMAEESQVRARHAHDVESRALVGNVAKALAARGFAGGN
FT                   QPGTQTLPGTTPATAPPANQNLNQNLNQNLNRASSTPMDIDAQGPSTPNRGEDGDGLGF
FT                   DDDDPRAGDTWHSPVDVLDVLGRVVRFVVPASADDENAWKDVEAPTEADWARVSRAHAE
FT                   KVRREREGRERAEAEREAAIETAKQEAEARRVAEEETRRAQAAEEERVRKEEEERAKAE
FT                   AEEEARRREREAAEEAANKPKVVIKYGKEIKLEPARRSRRQIEAEEREALEKIAREEEE
FT                   RLAAERAVAAQIAAERSKWEPMTDVGATLAVKAVGDDGSLVAGAGASCLAMAAAAPMAQ
FT                   NDDDAGTEAAAEKAAAEVSAAAAAAEKAAADARAAEAADSDEAQERDEEEEADVASFLA
FT                   SVSSRNSGAADVAWRLLARVTERWRPSSEGAMRELAATADGQSNDAAGGKNNNNDGGKK
FT                   KGAFGSFGLRHAPRPATLLRLAETFGPGPEGGDPNHKSRMARVHLCLADAATRASVVAA
FT                   AVARARLAARRRRVPAGGQGVLSKAAAAAAAEATEGLPPSHFLDAARTHLSKAVAAAKD
FT                   DDAVFLAEYHFVAGSLAATETGGSITLAEEHLQAAMDCARAAEESGAYAKDTSGHERLT
FT                   VANIFAALADARLHTVVDKADEELAAGNTGELLATLAPLLLETPSLNERSTAASLADAE
FT                   KTDSEQQMVALTSAQRSEALGVLAEAARAEAVKALRGANKPDSIAKADRALAAEVRARG
FT                   ALFYAAAKFLTPESMAEGDVERDPGAITNALPNLIACLRGAVELRGPGALAPDGGVGFN
FT                   RRESIDGLEGEAASRRHEARVAVASFAPVFAKMIAAYYAKKAHHPPGEVPKERRRAKEQ
FT                   VERETAQAAIAEMCADGLAIIQQLISPENDAPSEDAAATAMDTDDANPCPAVPKFAGAP
FT                   DPVAVLELHERLHETLADCRCCCGADGKGAFLRGALPRLTAARRPVATEAARLKAIDDE
FT                   AEAAAAAAREKAAEEARLELEAKKAERKAAREAEREARQAEREARRAAKAEEDKANDSD
FT                   GDDKSEDSADSDSDDEDDGSEATDKVPEDKVPEEATLEELAKMSAAAGGTWQQMAVGGG
FT                   RGGRGGRGRGRGRGRGRGRGRGRGRGRGRGRGRDAAAAEETVEEDAEDDQGGSEGDTPA
FT                   EPLVLGPGFVHYSGDVYVHSSQRPGAVHFDLTFQLYGADKVHYPFRDCDPTGKYKKGVD
FT                   QLLLRSKIAVKRYLEREGERENLTDEQFEEKWTAALAESKTLAEAKAKEDAAKKAAIDA
FT                   EFEAAYAAANPGPLDAAKSPGKLVAPGAKVPKGYTVIAVGGAPGPANAADEPPKPPTRR
FT                   EQVEAILERFDATIAQCCYCLYGVELCDRDKLPRRCRDEGGAANTVSSLDSVEDCAELW
FT                   AYVQPYAEAVHDKPGFAAVLQAVRRAFPPAAAAPREGDPVEAYLAAMPDFGEGAPPVNG
FT                   AQVGGAMFDDDGVSRGAASRDEERSLAMAAVTRAAPGPAPLDEGEEDGDEEDGEGEGGG
FT                   SEGADLDAVAATTDAEGAFTAIVDAAGDAPAAEGAEGAEGAEGAERKRPKKKASDDPAV
FT                   EYAGVHKTLHRFCAAVADVRENDEAFERIAHTFPLVIDLLRACFEPPIDGEPFDDNALT
FT                   LADTVRALNGGEDSRTSGRAKTSLGSGLTAAQAARRQFQLLKADLVHNPARFEGWLALA
FT                   DHVDAVKDLALNDAAKLVTVKDWNEDSEHSSTAHALVRRLQLALRRATCAAVACAPNED
FT                   DRSQGYERQGLAAYEMVQASPPFHDGRRWKLSRDAAWRAALGLARDAFDGAARCAPTEW
FT                   TYRCHGAKVARKIGEPCDELFDRLKATVDAAPGNLEAFYQMHASRIKFLVRLAEGKANG
FT                   TMAQDERRRAMETIASHAFEPETLGYSGGSAKWRAMDPISRWDALWRDAAAAIKAAAKL
FT                   LPAYHKASYRLAWSRLRYPGREDGRLPPDIVPEELNQGGDAAVAAARIALAPLFKVDSN
FT                   AQAAMKDKDACFKYNEQAPRFNIWMWEIDDYNLSVGRGVGGGKRGSYIGSSFRLHTVGV
FT                   NESGRKFVAASRKATRLYLCLCFAAGDLAPLVAAPGYIGDERHKHARSMPDLRALAFAL
FT                   AQRGLVLAASNSEEDSESVRRASELGYWMWVEHAGFSWDELNRDGAREYRLELRLGEED
FT                   PEEPSALIGETFTAKAKAAEEVILKVLTERRMESEFERMALNHVSSLAREGLGGIGCLK
FT                   NMHADLARRVDDAERASRVRTRGGGVPAAPLAQLKTLKPIRAAVFNAIVAATTSVVASF
FT                   APLPQETPDDDDDGELDARREVVDAAVSLRADVERRGAELVRRNSHQTPTDADEDELAN
FT                   AMEVTGSLLVRAVAAATPGAAIPAPGADAARAAVDAAAVKARDVVEAWAESVRVRSRDT
FT                   AVRGGGRGGGRWGGRGRGRGRGRGRGKRTSDAAQLGVGRDERVAKRASIEPGGAP"
FT   CDS_pept        join(<762995..763136,763206..>763660)
FT                   /codon_start=1
FT                   /gene_family="HOG000201520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633105"
FT                   /orf_name="MICPUN_71751"
FT                   /product="Predicted protein"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="ACO67303.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG629833"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI000199BF51"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI6"
FT                   /transl_table=1
FT                   /translation="VFAAFGCHPLSAHEWDADMASMVESAVADENNAVVAVGECGLDYH
FT                   YALRKTQEDVFVAQMKMATELGAPLVIHTREAEADTLRLMRQHLRKDARVHVHCFTSSA
FT                   RLAKALLGEYPNLCLGFTGVCTFKNGGDVREVVRSTPLDRILLETDGPYMAPAPHRGAV
FT                   AHPGHVPHIAKKIAEVKGVRAEEVFAQCRANTRRTY"
FT   CDS_pept        764171..765970
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633106"
FT                   /orf_name="MICPUN_88315"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67304.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199BF52"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI7"
FT                   /transl_table=1
FT                   /translation="MLPFLWPKDRPFIKLCMVLSVFFLLCSKLCNVASPIALKYAVDAV
FT                   VKGEYSTNAILAYGLLRFAGQFFNELKDNAFAYVSTHASRKISLRTFTHVMGLSLRFHI
FT                   NRKTGAVIRACSRGSESFAALLRYVSFQVAPIFLEVALVCVYLWIFYTWYFGIITFLVI
FT                   VAYIAFTVPFTEWRNKFRRQQTDADDVFNQKATDSLLNFETVKLFCAEPHIAHVYDVAL
FT                   AKAQKASLRTTQSLTGLNLGQAVIITVGITLSLALAAKEVQEGNMTVGDFVLVNTYILQ
FT                   LYVPLNFLGTYYRMIKQCMVDVEAMFRLMKENNDVPDEDGAADLALPGRDDARVDFEGV
FT                   KFAYSGGADGRQILRGVSFSVEPGQKVAIVGSSGAGKSTIGKLLYRLYDIQGGAVLING
FT                   QNIAKITQRSVRCAIGIVPQDCVLFNDTIEYNIAFGKLGTSTMGTIEEVKRAAKAAQFS
FT                   KFVDEQCKDGYQTLVGERGLRLSGGEKQRVAIARALLKDPPIMIYDEATSSLDTHTEKE
FT                   IMLSINEAAKGRTNLVIAHRLSTIMDSDCIIVLKDGEVAERGDHPTLYEKSGGLYRTMW
FT                   DSQLQNALSSGESASNMLAAAGN"
FT   CDS_pept        766090..767175
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633538"
FT                   /orf_name="MICPUN_64243"
FT                   /product="Predicted protein"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67305.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199BF53"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI8"
FT                   /transl_table=1
FT                   /translation="MGLYEVDEPILARYQGVWYEGKVVETEPATGATGEARYKIHFQGW
FT                   NSRWDYWEVQSSGDLMADTEENRAKNMGKGKGKGGAKAATTGAKDGAKDAAKDAGKKRP
FT                   SKDDGKKSGSKKAKTSKKAGDAGAEPEAVTAAPDAAPELARLRFNLSTSLKRELIAGWE
FT                   KITREEKLVRLPRSVTVSAVLERFESETRAKARSPEQAEMATEISSGLRAYFDRSLRAV
FT                   LLYAQERTQADVLLTDDARLPSDVYGAEHLLRLFVKLPTLVPLKDMDADATHLLHVRLQ
FT                   DFLRWLQRNAASSFGCGYVGRDADGRPTDEIKEPEKVKEYVAPVVKEKKDKASHGDEKA
FT                   SPDEKATPPAPPAVEPEPVAA"
FT   CDS_pept        complement(767285..768823)
FT                   /codon_start=1
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633539"
FT                   /orf_name="MICPUN_64244"
FT                   /product="Histone acetyltransferase "
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO67513.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG631736"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000199BF54"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHI9"
FT                   /transl_table=1
FT                   /translation="MADDVAAPAPDAEMTDAPAPDGAGGEISTGGDHALNSAPNVGTGD
FT                   GGAPLARAQPAASDATPPKPRVFKIGDKVSALASFDGVHHEATVVDLRRAKGAEGKDED
FT                   AIGPHDVSYYVRYAGMDKRLDAWVAGSNVDVLDPGMTRNLSDPLLGPGSLASPRKDSVN
FT                   LGDGAPHTEGRKVTRNLKRRYNEINNVAGSIEDLAPIDQKLEKEHDEKTKVKNIGCVEF
FT                   GRFEVDAWYFSPYPAEYADCSKLYVCEHCLKYMKHEVTLLKHKARCRMTHPPGRMIYRH
FT                   PRHDEGKPGLAFWEIDGNTHKVYCQNLCLLAKLFLDHKTLYFDVDPFLFYVMTEFDERT
FT                   NKHAVVGYFSKEKWSNEDYNLACILTLPPYQRKGYGSFLIAMSYEISRREGKVGTPERP
FT                   LSDLGQVSYRSFWCREVLQVLHAHKGSISVKDISGVTGFQERDIASALQSLNLLKYWKG
FT                   QHIISATPKIIEEHMRSFDSKRQIAVNQGWFNTQWQPPTFAPPPKPMRGGANRQ"
FT   CDS_pept        769041..770588
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633540"
FT                   /orf_name="MICPUN_64245"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="ACO67306.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI000199BF55"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ0"
FT                   /transl_table=1
FT                   /translation="MARGKRQKVDDGEENALAVFQEGMVRCVVAAKGAKQPGSVPGFCN
FT                   AKMRVNRDVSVLAVAAAAMERNEREPGLPLMKCIDAFTSSGILGLRWCVESAVLSGCDL
FT                   AVTMNDLSKDCAALATHNALANLSDGHSLDPKAVEPWGDSNPIDALKIPGTRCGTTHVT
FT                   VKPAGVALHEQPHDFIHLDPFGSAAPHLDASMSRAPHLGVVAVTATDTAALWGIYPAVA
FT                   RRHYGAELEVGDGEAQNNNLGGAAGQARRPPWFRELGVRVLLGAMARAAARHDRGIVPL
FT                   SCLASDHFVQVCVRVQRGAAAADRSCSDDAIGAFWHCDVCDLTACGGGRCVTGGGGEVG
FT                   GSIPGGGGGGRPCAHARSLGPGWLGPIGDVDFLRRMERLAEKSTALARDRREAFASSGA
FT                   SPRGGAPGGVYEGAEGVHPRTLKLIRRLIEEVRGPPLFRNVSRYTGGGVDPPPMDLVVD
FT                   ALRDAGYVGSSRTHFDAAGVRTDASPEELRRIVGEVAARRVGERSRRASEREGSPGE"
FT   CDS_pept        complement(770665..773682)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633541"
FT                   /orf_name="MICPUN_64246"
FT                   /product="Nucleobase:Cation symporter-1 family "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO67514.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI000199BF56"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ1"
FT                   /transl_table=1
FT                   /translation="MFAVSTTGVMAPVARAWHAWRARGYGAKPKARAPSIVALPAALGR
FT                   SKPSIPRPAMTRVEKQSAFPRGPHPPASVSFFDEDPAWDAVVAAETQASNENTPNDARD
FT                   GAALAMSDDFVASQPLEYERSIAVFVCLAVAAVVLSVPFGFVRWNLSTLAPLVWWQLGL
FT                   STALGTAAAGPLVYACTLPAIRSRVNFPVMARASFGVRGAKIADAGRGILGLVLFTLVT
FT                   LAGGEALLGAASALANNGVLYDGVFADPDSLLGLFERLVAYLAFWGVQCAALVLARPDK
FT                   RLMWCARGGSALVAFHFCRAAHAGFREALALDLPLASLPREFWTHAMLTAGVWFTLAAI
FT                   LPDYARKCVNGDGYLKAQAFWLPVLAGCASVAALGVVGESSPIACLLTVTAACLVTNAT
FT                   TTSVGAVATVRAWRPQGARRAAFSVAALALIAAPLAPTWQQVIASASWAAGIGSLLVAP
FT                   AIGVVLAEYWVTSKRRIDAEALYRRSDAEGRYWYQGGVGTRAVAAAAVGAAPNLYALAS
FT                   GVASSLASTGQARLNLYIVNSEYSSLVGMALAAVTYLASYAAFPAIPRWLESAQPLQQF
FT                   TMCLEQTAALALATVAFVASIPRKAATKYVEVQAERKARAEATAEAEAKAERVSDLLAP
FT                   KARDPETASKISRAMRTVDAGSIGRKVQARLDAQEAEERKKLDEVMKKPDVVQAKKEMD
FT                   KARKEATDAVAQYEEATKMSFGADRDLALKEARRLVEASYQLKVKCEMHFESLVYKYMD
FT                   KIIRDADAPPAEKERAMVAAVNTIKAEARAAAEAAKEALKEAAEAAKKRREEEEERKRE
FT                   FEAEMKKAKEAEAKAKAEAAAKAKAEAEAKAKAEAEAKAKAEAEAKAKAEAEAKAKADA
FT                   AAAKKAEEERKKNQAEVEAKARARAEASEKAKAEAAAKAKAEEEEAAKREAENVAKMRA
FT                   ERDAAKAEAAKAAEELAAKLASAPPTDPELPDASAATAMATGGETNGALGVLVLLAAVM
FT                   VFVVAALMGGSDGFNV"
FT   CDS_pept        774299..774679
FT                   /codon_start=1
FT                   /gene_family="HOG000264763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633542"
FT                   /gene_name="CUPC21"
FT                   /orf_name="MICPUN_64247"
FT                   /product="Putative uncharacterized protein CUPC21 "
FT                   /protein_id="ACO67307.1"
FT                   /db_xref="UniParc:UPI000199BF57"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ2"
FT                   /transl_table=1
FT                   /translation="MHACGTTVASLSLSARAAARAKLSKVSARHITARSPARRARTRLG
FT                   VVPRSTPKEEIEMDPDANIEPCLVGWSDQDENGVDVYCCEQPGGGVVCKTINPVDQQEC
FT                   EVVEDEKGDLTVACDDDEVPKR"
FT   CDS_pept        complement(774877..775785)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633543"
FT                   /orf_name="MICPUN_113341"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO67515.1"
FT                   /db_xref="UniParc:UPI000199BFF3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ3"
FT                   /transl_table=1
FT                   /translation="MTATQTVAVPSAPGMKAREPSFTLDSDDDDGDTVERESLDDDDDD
FT                   DGTKGATVDQFELDRGMPGLRVATRREDPPASVESKPFWEHDFASEYDFAKAQYAKAAE
FT                   EAVSPKALTAGHTHASIGKSGLRVDPKEAERWRRAARERAQVVTEVAAAASKRVADFWG
FT                   SIAGRSGAQREEPSNSTERKQRWTEMRGVGDIGDGDVGDEKSAPGDGAGTDPEAPTGDP
FT                   SFGGRDRSPRAPKDDVFTMNPALVAAEDRCAAAEAATRRAEEKIEALTEQLSDARRECE
FT                   ALRAALADVDPAHRLVDESND"
FT   CDS_pept        775947..776882
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633544"
FT                   /orf_name="MICPUN_52068"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67308.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199BFF4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ4"
FT                   /transl_table=1
FT                   /translation="MTWGFGQEYDDCLCGGVPAVWPHSPRWPTDAVAHSRVLTALELHH
FT                   PELGRMFSSVSFILDNYKKQRMMDVAWVHFNHLKDKYHADGILRTIPEWVELMCVPTGW
FT                   DGEPLLKSGREGPDPVQARSLKCSAYDFAAVYKDHLALAPNAYSISRRSLQRKCDYCKK
FT                   PTTGECAVCGEACCSRECMLKLGRSHRSECEMVYENGGSLASLLTLFEMRDALTPDEFK
FT                   AATGGFFNPIGGARGSDSREGKKGASRVAVEGWNKFCGRPGCKKDSCAMKCSKCRVIYY
FT                   CGRECQTKDWKAHKRVCAQMANGKVKPSES"
FT   CDS_pept        join(complement(779620..780411),complement(776947..779526))
FT                   /codon_start=1
FT                   /gene_family="HOG000265273" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633545"
FT                   /orf_name="MICPUN_95940"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO67516.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG412575"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000199BFF5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ5"
FT                   /transl_table=1
FT                   /translation="MEPAAVESLLDEELPAHDEITRGVLPNGLRYVVLPNKVPSDRFEA
FT                   HLEMHVGSVDEREDEQGLAHLVEHVTFLGSKKRDAWLGSGTRGNAYTDFHHTVFHVHSP
FT                   TYNKDSIYMLPNVLDILYDVAFNPQMLETRVQKEKKAVLAEAQMMNTIEYRVDCQLLQH
FT                   LHWDNNLGCRFPIGKLDQVASWDASKVRAFHDRWYFPANATLYVVGDFHADVPGVVEMI
FT                   EKAFGDAAPAVEIDEATGEPTSDPPVMRQRHAVRPPVKHAYGESGVQLFQHEHLSHVSF
FT                   NIFSKLPVLPLRHMGDLHRTVNQRIVLLVLQSRIQSRYAELDHEHYKRCELDHSDSARE
FT                   GCTVSTVTVTCEPLHWKYALQIAVEEARRLQQCGLTPGELQRFKGAMMRDSEQLAQQAG
FT                   FVPSLENLDFVMEHDALGHVVMDQVQGHEALVRLDDVIRLEGVNEVARELLGFFAEYGK
FT                   GPDEKDPLGGLTTAIVACVPSTTTDAEGTEVPFTMTEEEVKEVLSADYGEIEAMEDVYV
FT                   PDELLSDEEVATLMEERKPAIVSATIDEATGVHQRVLSNGVRVNYRVTNNEPGSGFLRL
FT                   VIPGGRTAEPVSAGPGGIGAAAVGFRTLQEVGSIGQWTRKQVELITMQNLVMFEVEPEA
FT                   EYLFLDAAFAVKGGLRTTLEIIHLLTSQPVWDGNALERVKDIYRMFELNTQRNLELLTH
FT                   DKVNHAVFGDRRLMDPSREELSKLTLDGVVAAVEAQLKSGPLEVNIAGDFDPAEMDEMI
FT                   VKFLGTAAPGGALTPQIDVEPLPLTPLTLKEVPAKDEQRAQRLWLRDSDERACAVLAGP
FT                   GPKMWAPMRNPPLPPPPEPTGEDDDETLTAQNPFVGPDGVRYHPQDPVNASAALKQNPF
FT                   AAQSIRRANPLATFVAGMLLTEVIGGRLFTTVRDALGLTYDCNFQLAFGLQNSDATTYR
FT                   LVVTSTPAKIDDALDAALRVLRGFKSQRISVREVERARMTLLTRHETELKTNAYWVDLM
FT                   QYTALGDVLAPAKDVSCISDLPAMYEAATVDDLYEVYAQLGLGDGEIFTCVTVAGDTDP
FT                   AIARKKAEEDAAKSAAQAMANALGGAGGAGSVDPSAAAAAAMEAMRQAMAANAGFATEA
FT                   LKAMKGPKKDDGIDRV"
FT   CDS_pept        781601..782686
FT                   /codon_start=1
FT                   /gene_family="HOG000191265" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633546"
FT                   /gene_name="FBPASE_4"
FT                   /orf_name="MICPUN_96739"
FT                   /product="Fructose-1,6-bisphosphatase "
FT                   /function="fructose 1,6-bisphosphate 1-phosphatase activity"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO67309.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="GO:0042132"
FT                   /db_xref="HOGENOM:HBG731261"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="UniParc:UPI000199BFF6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ6"
FT                   /transl_table=1
FT                   /translation="MRRVASSHSIDDYGEDLDSFVTLSSFILTATEVCPSLAAKGHIKK
FT                   EEETDLCILLQSIATSCKYIQNCVRKLGLANLSGKNGGTTNVQGEQQMKLDVIAHDVFT
FT                   RGLDESKRCTMLISEEEEEAIMCTSSPNGRYVCVFDPLDGSSNIDCCVSVGSIFGVYRA
FT                   NALGKGDVNDVLRPGKEMVAAGYCMYGSACTMVLTVGGNVRGFTLDPSLGEFVLTHPKI
FT                   KCPPSGATYSVNEGNSRYWGGGMRRYVDHVKYHKEKPHALRYIGSMVADVHRTLLYGGT
FT                   FSYPGDSKSPNGKLRLLYECFPMAYIMERAGGAASDGTQRILDVCCTGIHQRHPIHMGS
FT                   EEDVEEIDRFYREAAADPDAR"
FT   CDS_pept        join(complement(783529..783849),complement(782944..783396))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633547"
FT                   /orf_name="MICPUN_104208"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67517.1"
FT                   /db_xref="UniParc:UPI000199BFF7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ7"
FT                   /transl_table=1
FT                   /translation="MAGLALAPMASRASKTCIKAAAIFPVAFLYHLTALASLPVQVSLA
FT                   TARTIAGVKGRGVDELFASFFTPRGTPGSVEDVQLIEGLRERHGAAMAAVKEQLDDSET
FT                   RYKAVYEKLRESERMRLKMQNRLAHAQEDLRAARGEPASPHSPGSSFRSGKDADADYDH
FT                   DKYPMYATTVLMCIALWYFYDLPDANVFDRKMAMIYAPVTWLLVIPAKHPALNKLLILF
FT                   NLVFFGYLLHILVQWRRESAAISATAPSAAMTFAG"
FT   CDS_pept        join(complement(785069..785124),complement(784471..784912))
FT                   /codon_start=1
FT                   /gene_family="HOG000012593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633548"
FT                   /orf_name="MICPUN_109513"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67518.1"
FT                   /db_xref="HOGENOM:HBG558506"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniParc:UPI000199BFF8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ8"
FT                   /transl_table=1
FT                   /translation="MLSFLFRVYTFFLGFLYPAYASYKAIESDAKNDDTQWLTYWVVYS
FT                   VLMIAESFADYSVFWIPGYRFAKCGFIFWLASPRFKGALMLYDKCIRETLKKAEPIIDS
FT                   VSAQLAKGDLSAVQKELAPATELLQKYGSEAFEKGMTAAAGAAKLAQEELAKANANAPK
FT                   KD"
FT   CDS_pept        785570..786142
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633549"
FT                   /orf_name="MICPUN_64254"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67310.1"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniParc:UPI000199BFF9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHJ9"
FT                   /transl_table=1
FT                   /translation="MAGRARTGICTGTPSSHGRRLAVRVRASEESDTATEVAPKVVDAP
FT                   PKSKPGVGKPPINPLFLAAGDFAAAVLITLVARGVAGEDVISAGTVAAIPPFVVGWVGA
FT                   GYLAGDYDADSPNAALWGDAPRAMTTGALTWFSGSAFAILLRNAEGSMMLQAPVINEQV
FT                   EFAGALGLICAFRAAVAIAKPGASDKI"
FT   CDS_pept        786484..787554
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633550"
FT                   /orf_name="MICPUN_64255"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO67311.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000199BFFA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK0"
FT                   /transl_table=1
FT                   /translation="MDDEIDFGDILPAPGGAANDHDDVLGAPEYHADPPSEERDPGGDR
FT                   DGAAPKRVLVKIARRVGDDRSRAPSRDRGDRGSGGKKTVRVVVRRDRRSRSRSPPPSSG
FT                   SRRLEERLEVPPKGKGKRPRDDGPASKEKRQKMELANAFCLICGAIGSHYTEGCPDRTH
FT                   KERGKCMICGEAHAIRDCPQKKESIKEKRKMSREDRSHRKEEDGEEGEVPKHSTDVVEK
FT                   NHRGAFCALCGAIDSHHIEKCPDRTHKKEPGKCMICGEAHALRDCPQKKVNPNKKEGRA
FT                   HPRKRERSGKRIVSEKTSGGTKQERSPSPSPDGESKKGGRYAAYLEGGDRARSPDNKPA
FT                   GWARGGDDGEVVVLDE"
FT   CDS_pept        complement(787616..788257)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633551"
FT                   /orf_name="MICPUN_104211"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67519.1"
FT                   /db_xref="HOGENOM:HBG608803"
FT                   /db_xref="UniParc:UPI000199BFFB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK1"
FT                   /transl_table=1
FT                   /translation="MQAITASSSIARARFAAPHKAERASVSRPAATGGGVAARRVGSNQ
FT                   SSIALQATATAALSAISAPTAAFAAAMSPLQPIADVAGDVFAETGIGPALCVAGTLWVG
FT                   YIVFTGTRTIKALKEELTEMGYDVEEFNRIGELKAIKRAVEDGTVDSIFDKVWYSRAAM
FT                   AAGSGSIVDVQKVQAYWKGKGITVKTLADLDKVTAYMIKKYGKDEKMGMM"
FT   CDS_pept        788553..789443
FT                   /codon_start=1
FT                   /gene_family="HOG000200636" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633552"
FT                   /orf_name="MICPUN_109515"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO67312.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG316888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI000199BFFC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK2"
FT                   /transl_table=1
FT                   /translation="MNAPAGVKAEAAAATDAAPSLVISNLNYAYPMGEKIIKDFSLTLP
FT                   PGSRCLLSGANGAGKTTLLQVLAGKTMVPTEDVRVIGRPPFHDTELTCSGDLAYLGAQW
FT                   RRNVGSAGSVPLAGDISAGKMIFGVEGIDKNRRADLIDILDIDVDWNMMRVSDGQRRRV
FT                   QICMGLLKPFKVLLCDEITVDLDILGRLDLLNFLKQECEQRGATVVYATHIFDGMEPWM
FT                   THIAFTSDGKLVHGGKKEDVGDLKGVRHLLSTVYDWLVVDRNDRKEREKLEKANPKPKS
FT                   SLESRFGSRHMAYYR"
FT   CDS_pept        join(complement(790990..791121),complement(789870..790685))
FT                   /codon_start=1
FT                   /gene_family="HOG000226413" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22633553"
FT                   /orf_name="MICPUN_64258"
FT                   /product="Triosephosphate isomerase "
FT                   /function="triose-phosphate isomerase activity "
FT                   /protein_id="ACO67520.1"
FT                   /db_xref="GO:0004807"
FT                   /db_xref="HOGENOM:HBG708281"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniParc:UPI000199BFFD"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK3"
FT                   /transl_table=1
FT                   /translation="MSIVSCAATAAVPAAAPRFAGLRRVAGPAALNRDVEQPSAVTLQV
FT                   SGRSNSRASRRCVATMAGTGRFVVGGNWKCNGNTASIQKLVQDLNAGEITADVEVICAP
FT                   PMIYLPRVQSTLDRKYQLSAQNCWVGEGGAFTGEVAAEMLADNNIPWVILGHSERRALL
FT                   GESDEFIGQKVAYAISKGLSVMACIGETLEERERGDTLNVCRRQLQAIVNCISPADWAK
FT                   VVIAYEPVWAIGTGKVATPVEAQETHAGIRKYMAEAVSPAVASAVRIQYGGSVNAGNCE
FT                   ELARCEDIDGFLVGGASLDGAAFVTICNSARFNN"
FT   CDS_pept        join(791627..791739,791870..792515)
FT                   /codon_start=1
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633554"
FT                   /orf_name="MICPUN_109516"
FT                   /product="Predicted protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO67313.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="UniParc:UPI000199BFFE"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK4"
FT                   /transl_table=1
FT                   /translation="MSAATQYRAAQVRTATSGRKTAALSAARAPTRAVRANGARTSVVT
FT                   GATYTGHADLTPRTYPLVGNPAPDFTAEAVHDQEFVDVKLSDYRGKYVVLFFYPLDFTF
FT                   VCPTEITAFSDRYEEFAELNTEILGCSVDSHFSHLAWIQTDRNAGGLGDIEYPLVSDLK
FT                   REISKAYDVLSEEGVALRGLFIIDKEGIIQHSTVNNLAFGRSVDETLRVLQALQYVQEN
FT                   PDEVCPAGWKPGDATMKPDPEGSKEYFATI"
FT   CDS_pept        complement(792749..794287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633555"
FT                   /orf_name="MICPUN_52080"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67521.1"
FT                   /db_xref="UniParc:UPI000199BFFF"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK5"
FT                   /transl_table=1
FT                   /translation="MPPDARLAHARAFFDLDPATAVDAFVADDELDPARLATEVFERLF
FT                   VAGLDESTDPRGAVAVGAARYLTHAVARGRGKVSIVDRRVHDLALRAFCRVYPADPSVL
FT                   IGYVRDGAGTDWKTGEPLYDCAVATDLCERVGAVEVVICVHCDRGDHDAALALAMATSD
FT                   DLALAKSVLDRAGRRSRSRFGASRRDIWRKIAAGVVARGFGAKVTEADVVEAADALRKY
FT                   EETFGTRGGGEGADGDGDVEEEERTDPKLVEEEERTDPKLGTSRRAAEAYAVSRACAAS
FT                   SSYGDPSVRKRVVDRIVSLVEESDGELGVDDVLPLFPDFRVLDEWRDAVLNDLAARDGR
FT                   VDAHVAAAAEARAKIDAAKRTLEELRTREAVIGWDEPCARCGGSVSSPPFSFHSFASEG
FT                   NDPDDVDERCDLPKLYVFPCGMCFHATCLLESAVPRLGRRRRAEATALMDAIDVPLTFG
FT                   LREMRRRLREKDGKAREGVVGDGGPEREGADAVARLDEILRERCPFCGEVEFSG"
FT   CDS_pept        796857..797384
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633556"
FT                   /orf_name="MICPUN_109517"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67314.1"
FT                   /db_xref="UniParc:UPI000199C000"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK6"
FT                   /transl_table=1
FT                   /translation="MQKTGTSAIYKAVSTPGTLKELHNAEFEDGICRQCHPILTPIPAP
FT                   FCCTAFEMWNRRAYTRVYENRLEHNRPLITWPCNDCMHDWVSVGYFDKGAKFVPWVRPT
FT                   ACTPFHTCCVVELHGEVAATARKGWQNNCLFPCYRTFVPGLKDAQAFCDAANAAQATAL
FT                   AAVYNPAVQKMG"
FT   CDS_pept        complement(797510..799180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633557"
FT                   /orf_name="MICPUN_52083"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67522.1"
FT                   /db_xref="UniParc:UPI000199C001"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK7"
FT                   /transl_table=1
FT                   /translation="MIRGLSSHASGRRRFLFSYFCKIVYVFYARRARRRQASSVQLYRH
FT                   LVRGPQEAVPRESHRAHRQDTDQGDDDQERRGHRRRGHPAEVLSLSRGGVAPALGHPPP
FT                   RRRRLRRLTPSAELERAHRLVVARDRDVDGGPNLRLDVELGNFSRFGRFDPGVRRRGSP
FT                   RRHPRRRRREDQPRRGDVLRRSHAVGVRRQTRASQLGEVRRDASLGRRSPEQARQLPRE
FT                   PPTPVVRVLPGPPRLDDDAAEIVEPETPPPTLGGVVVVGRGAVQRGPRECRDPLEHVRL
FT                   DDQPVVVAAAPVVREEVGGSLHHVDADDVPRGVADPRVFHRPRVDHSPNTIGARFDRGA
FT                   HRLAGPRRRAPDAKDHRRARIAKDGGRVEQRVELVGRRRVDARRGWGRVRHRGYHRDDV
FT                   LRAKDAHLRVNTGGLGVRAPVGISQPRGARAVVDDQNRARRLRGGGREARREDARGERP
FT                   TREIMTRVSRSEKHRSAGRVRRRPMPRSCLRRTVDLSVVVFPMDFVFSCPLPARSHPRR
FT                   ARFFIFFLGGGWGCPRVQSRREIRRVGNRGGRRNQRMSI"
FT   CDS_pept        join(complement(799466..800199),complement(799180..799429))
FT                   /codon_start=1
FT                   /gene_family="HOG000264332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633558"
FT                   /orf_name="MICPUN_104216"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67523.1"
FT                   /db_xref="HOGENOM:HBG608423"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="UniParc:UPI000199C002"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK8"
FT                   /transl_table=1
FT                   /translation="MAAGVVPASVTAYASSRLRFLGARLERARRRERVRACARFQPRTG
FT                   ERSSRVPRVFADAGSGSDVPASGSSKLPSQKIPPLYVKRTVRSSTVRHPGTIVVMGDVD
FT                   AESSVIAGGDVFVWGSLRGSVIAGQGGDYKAKVSALDMRPSSLQIGSVKGNVKRGADGD
FT                   PVLKASGVPETATVEPTSRQRLLVQPASAAAAELSRRADVGLAKSQRVTSAAVRRAAYF
FT                   TGIYIAAAGVALMVAPDPVFSLLVFGVLCVAFGVYYFGTAYGDGKGLGARAFYLSTVVG
FT                   RVFIFASFLFMVACGLFKEPGLLILGVINLLGALAMMFALSKKKTA"
FT   CDS_pept        join(800334..800443,800574..808478,808514..808547)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633559"
FT                   /orf_name="MICPUN_64264"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67315.1"
FT                   /db_xref="UniParc:UPI000199C0A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHK9"
FT                   /transl_table=1
FT                   /translation="MAQPRGGGASALEHVSHVLACLVHRHSFFEDEEPPPRLRTGAVPE
FT                   DVMRRVRRLDAESVKGELARLRRWLPSFVADGDRPVSWGEIADSLAEALDALPQDAASA
FT                   RAYARRFSVLVLSDAVNNPPVPEPEVGSYYERAGLRSRHAALLLVASTEGGDASAAAAL
FT                   ATLVAAGHVVPAAAALLAGLRGVDAWDGRAALLSVAAGWRWAGTDHGDEARGDEARDAV
FT                   GRCVRFVLDEMADEATRGTQRRTVAGSLSAMLWSLWESQGSDRTLDAMFPTLEELGELA
FT                   TVWKEKANAAAESARLLQAVVALMRRWRGETPLPDPPTEGVEIRGKNKDKKDKKAEPHE
FT                   QEEEKVEEVDEETKELRRRLEKEARFRRELKAALLSGIDGAKDDAKAAAIESVSEHFEA
FT                   AATDTLASELQRSKRDETVRALLVRVVGVGGAKGPPAALWGKVGRALKAASVVCPGATL
FT                   DVVDDMLRASGASKGEQKKEEKKTPEKKSSSWFGGSKSSKSTDAPKASKAVPGAGSSNS
FT                   RILALRFIAWAIEAVQDVPQDVGLEDSDFESDPSTTVAKALTVELWNRAGAFASSVAVA
FT                   MTPPSGVGKTKGKFVDGELPDRIAYIAREVPPDAPTGDQVEVMLTALRCTPLCLAAPAG
FT                   TFGEKEATDHVIDIIAAGMGCGERDVEAAARRALRRHCDALSSKSLRRAVQLTLRAAEE
FT                   AMEGSTDPTEWACRFKTAAAIVAEASRRTADDLYFDAVVEGIEARKEESAVSSQTDDKD
FT                   ATTGEGGPSSGTSPTEDVSVGDDESDSESMSPAVSAALSAAAAVGPRAASAILLATAHP
FT                   DPAVHAAAAELLAATEDLVDAAALAADSEGHGASAGEDGEDALASRLGGGLLRWLSSEA
FT                   SVGPETRSRAVAMLGGWRDDERVTGWIQKTPLSAAADEGVRRAAHRLFTARVIDYKPPS
FT                   ASATSGGSGGAAPSVHAYDMWKGHVAIYCAAARPRYYDSTQRSGDPKDDDDADDEGAKK
FT                   TIKKKKETVNVEDAVDAAVAEDEEEETGEKNFDDDEKFDDLEACFDSEQVLRWAWTRCA
FT                   AAAEASAELGENKDDEARLRKEVMIDALAAAAPPCLSALVASLAKDTTAIAQGVLPMPK
FT                   DEKELRSRTLPALNRASAGLVILRRLADRIIERDLPRSEAILSRVWAAADVWLEPLSAV
FT                   TDEALAPTFDQTDACASASNEAAALLKLRHSHAPPAEMDATDAAAKGLAHSLPSKQASV
FT                   RWYEFVATVLEAVDVVVDKQISKKRADLVIKRVARASRWMCLIDAKGDAKIEEAAKKSE
FT                   SVASATCVKLLLQRPDTIWNAAAASLKQAAAASAREGERPGAAPTIQLLEIVVTAAMSR
FT                   RGTSPENDGVVIAAALASLGLSPSLSASAAAYRGLRDFAGQRIPKEAAAAAVTAADAAA
FT                   EAKSPGDVILSLEARRGAVIAATRELLATDPTRTSAVSLGIKALADALGTTVDEKEAWT
FT                   EAATATEPEFGKSRNACIKLAATSLTWVVEALATVSQNPVDAKTASALAQAALACARVA
FT                   VSSGIRSAKEGSSSAGVPDTSRLWERVGNAISVINTERYDSELRTAAASAIAVADTLVD
FT                   ACEESLEVTAMATVYLLRSPSGLDIGAKLVSIAASGEGWDSTHAVASNRSAAAMRLAAS
FT                   SAACPVASITFASQLPSLVAAATSQRENSKAARALLEALQIRDTNMNGVVESLARRYPE
FT                   GRLACRRVLAKGAIRAADVAAGDDNRAKLSPAACASVASSLRLLVATVNPPRMNPSAKP
FT                   HRAFPLERLADYAARCHRLFALGLMSGEKGLVTAVAAADALATIAQRFAAGGASRESHH
FT                   ANVVTTASVSAAIAALSSTSIECICAGLRLAAACGLAMPALTSAATAALPPNVAPAVGV
FT                   AFDDGEFSFDQPKSSGESDSSSAAAAIFSRLVLRKMPDIAEKPAHGRALDVARATLAAL
FT                   AGEAPAENPLAAVVVLSMTLRSWPSLHATPDVKTAANAARYLRSLDYQALDSIATALSL
FT                   LGDKKYAEERKLDFSEGKSPGIVKASPSRPGAALAAATAAAQALATTPGKGLAKSKPSV
FT                   GRPSGGIWSTQTPTTADKVASRVPDEDDLAAKKRQTTDGNSLAALSARRLEFFESICDG
FT                   LAEIKLASSTWERSLHFLADTCSSDAKLDIRVAAADLMRALLKSRAKSEGRGKWNPRAL
FT                   SIAGSAMTQTVDDPAMAMACVALSSAADASPPKKRKDKSPIKTPVPPDKNQLGHNQVID
FT                   SVLHGGVVDDEGSDVELDDCVVEERDGDDEANDETARLRSPVVSGAQERRLSEWSRRSL
FT                   LSVTAATQELMKQVTANRLHDEADDGSGSDEEDVTKGSANDPFEEFVPPDESRSTGTPA
FT                   KPSIASMFTTPTKAKSPFGKFPLGNLGSAIVASRWRVKAGLGGATPVTTRDERRKARQK
FT                   QLRDGAPPSYVDNDTRSPVAWPGSLNALGLKTPEQLAHDAAVAEAARIAEETAKAEAEA
FT                   AAKAAEEAAQAEAIAVAKAAEHAAQAAVEVAKAEAEAAAMAEKAAEEVPEAEKAEVKNV
FT                   EAETVEVKNVKAEKSAEVEAEQVAAMVAAVKIEDTGEPSSNPTKPKTDEAVLQVERAAL
FT                   PPPPVDLGRETIAAEEEVLRAAEQELYGALPPLPSSSVAGEELSSLVEFGESLIGEGTG
FT                   IEDPAEAASGVDDEPDDGQHGVTSGVADDEIGGGGIRGGRG"
FT   CDS_pept        complement(808777..809928)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633560"
FT                   /orf_name="MICPUN_64265"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /protein_id="ACO67524.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniParc:UPI000199C0A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL0"
FT                   /transl_table=1
FT                   /translation="MPVLDKLQMWGIDTERMRTGRKDPNRPTAGRRIEVQDERVPVVED
FT                   AEPSTTASTVPATSVAEGDAAAALPPTTTTRSARVAELLARQEDEHWPVQGSDEWLLAR
FT                   ARIVSASEASAALGIDNFRTPERLIRDKLARLDSLENVSAAVLAASRDETRASYVAAVQ
FT                   AEKDLGWRAKGKAGKGAKKKAKRRKNSVGGKRFAGSTEPSKRSQSGAGPRPMPPPVVHG
FT                   NTYEPVAREHYAAREGRIVHEFGLKIHDELPWLGATPDGITDDGKILEVKCPYSRPVLP
FT                   NVRCKEHYPQLQVLMQVYNLDSCDFVQFKPAGVGMGHAGVMNEDRPLYLMETVARDDNW
FT                   WRVNQPRLLAFHRQLEAALAERDERIQRLSEAFDSVELAIDEA"
FT   CDS_pept        810200..811327
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633561"
FT                   /orf_name="MICPUN_64266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67316.1"
FT                   /db_xref="UniParc:UPI000199C0A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL1"
FT                   /transl_table=1
FT                   /translation="MRTPLLRVTLLAAFIAAASADRSLNWAQALEFVDAAPVARPPPPP
FT                   PTTPRDVLRNLALSWLGSWLRDNAFSVAAQSGASSSSPFLSSSFWQTFAAPFLQERLGI
FT                   VSAMSGQPKLEPVNLSQLPGFETSSEESTFVQKLLGDDYPVGELIRTDPGFADRLCDSA
FT                   FLRGVSGSGYDVTEVNDAWNNASPLRAEGVLPMGCTRGCVIGGGWVEQLARIYGIGRTL
FT                   TTSSWRGKCFSDEIVPEPIDRNSTGPYQPGSKVTNRIKLNYGLTLNNLFGLNEPVNTLF
FT                   PGRVYVGQSLASPSETAMIVDYSDHDHEFSPFRDEIREIYPGVYLGKMYALPGASLWDG
FT                   AIALSSDEPTFAIHFILFKQPGQSLAQAYRNAVKR"
FT   CDS_pept        complement(811433..812476)
FT                   /codon_start=1
FT                   /gene_family="HOG000232963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633562"
FT                   /orf_name="MICPUN_64267"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO67525.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG634917"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="UniParc:UPI000199C0A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL2"
FT                   /transl_table=1
FT                   /translation="MAATNLAARSAGLRAPPRVTRGSRSTRHTVVTVRAAARGEFASFF
FT                   PDEVTALEEPAAVEMAKKARQVSVAVPGRDKPVMTSCVSSPAPKGGEDVSPFVLIHGFD
FT                   SSCLEYRRLFPLLTERAEAHAVDLLGWGFTDAGDAGIGDYSPEAKRAHLYAFWKQEIGR
FT                   PITLVGASLGGAASIDFATAHPECVERLVLVDAQGFIEGLGPMGMFPRPIALAGVNILK
FT                   SRPLRNTANQMAYCDRGTFATEDAMRVGQLHTFQPQWADATLSFMKSDGYKVAKRVREI
FT                   TQKTLVMWGRQDNILDPAYAERFAEEIPDSKLVWVEQCGHVAHLEQPKFMAQTLFDFAG
FT                   VEAKVAA"
FT   CDS_pept        join(complement(814131..>814224),
FT                   complement(<813075..813928))
FT                   /codon_start=1
FT                   /gene_family="HOG000241297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633563"
FT                   /orf_name="MICPUN_69406"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO67526.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745150"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199C0A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL3"
FT                   /transl_table=1
FT                   /translation="VEAAEPAKKDTTQTLKVSLYIFGWYFLNAIFAIMNKKTLAVFPYP
FT                   WILSWIQIAVGAVFMLIMWKLRIFKPPEGGFTKDMFKALIPTSFYHMVAHVSACASYKF
FT                   GSVSFMQVVKAGEPAIAVLLLSMFFGRKYSWRVWLTLIPIVGGVAVGSTTEINFSMAAF
FT                   LCAMTSNVTSALRAATSKDLQADTGLKGINLYGGIAIVSGIMLLPLSLLVEGSQMGAAF
FT                   AAAPALMTAKGTLLFGIWNAGFMAYLIIGSMFYHLYNQTAYQALGELTPLSHSVANTVK
FT                   RVVIILASVAVFKNPITPLGQVSAAIAILGTFIYS"
FT   CDS_pept        815084..817102
FT                   /codon_start=1
FT                   /gene_family="HOG000100060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633564"
FT                   /orf_name="MICPUN_104221"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67317.1"
FT                   /db_xref="HOGENOM:HBG558516"
FT                   /db_xref="UniParc:UPI000199C0A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL4"
FT                   /transl_table=1
FT                   /translation="MTQRTYRIDNRASAASSRTPLARTVTVTLIALTLLARPASAKWLG
FT                   GTTTATGKTVGESRQGNTRIVQETGGTPVATQIAYDTGSSNPPEAHVVLQDHSVILVPT
FT                   EKRRAEGYKPSYWGKPTSVFASINWGHSSGEFAIAQAATMLYGDKDIGDEALTGAAAMR
FT                   SQMAYGYVSYHVRNGASSTLGENQFFVTAGSHYMLNGCPNYKPGETSESKNYVCPRVSI
FT                   NPGDFKFSILGLLSGTQINSGHASSYGNYAASTSPHYRDMANYKSLVMTSTLDISNVGT
FT                   AGTSRAAWVSFANGTKVNFTDITPDMDLAGCKMHIVNTASTTGEKEIIISFAQTYSTGK
FT                   FTRSYDAMVAEFGACAPTCAAGDGTGGCSGSCFINAMRDLTGFGDSPESYPMNTGLAAK
FT                   KMGKGGLSASDARITGNPNHPSLAAAQETPATATKDLQGLAGAPTLAVSEVRAVKITMR
FT                   KHGGCEGRPAKPVAADPSGELGISWPGAPVDCPSFYLASLCDPTNPSLCMWNTEFLGAY
FT                   KGIPAEDLSFCKAGDMNCFLIDIHLALELDDGTRTVLGSPENDSVRGWQKGTFFMYDPE
FT                   VSDDPNKPFPPGYNANLKPGTSVIDGPPQRGADVKAADDDTFMFGLTLLVFAAICAGIV
FT                   LLIAVLVCCVVLSKRRARIKVSAEISTKPAGKDVEKA"
FT   CDS_pept        complement(817266..819443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633565"
FT                   /orf_name="MICPUN_64270"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO67527.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199C0AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL5"
FT                   /transl_table=1
FT                   /translation="MSGLVLLLAVFNTLVVRTSGNDLVGPGAMSTYSGGGGRRRPTSYV
FT                   RVKDPAVGFFVAGSSEEGLNGLYGRTDKAPPGASASDVEISYRHLDTGWFMALRRQRTG
FT                   DPEWVFVDPTGHERLVNSEYTLIPGSGQKWRHAPAKGKSGWFSRFGRRGNGDGGEGEKG
FT                   GEGGDREGSKKPNTDETRVEASKAATTDTYHELPWQLIAIMGEDMLKQLAGHKRYHDGL
FT                   VRAALNCKPPDPEPGFRGSLDLVPPPESVEAASTPDADMALEDGELEEAAAKYAAALAK
FT                   LPSAEDEDERDGWTRAVLGLRRARALRKLRVFDGAARQIEEVRASHPRYADMLFESALL
FT                   WLDKGEPTAATEAFLDLACVDRSYGELREWLVRTRVREKRASIWDDEKRKIAAEKAGER
FT                   RRLNLISLGATRFCVAWRQTGGCDPVNGAREPEKDLPCVEPVSAGSSGVCECAAPSTLL
FT                   DLIESALAHSFARVHIDPSTARVNATRASPMTCSHDGGIKCAVECERAWRDGLRNVVEW
FT                   TERLEAEARKTDYAADGAEEATGAMRMALDRMRRWERGEAVDDAVDANEDARANVLRDF
FT                   LNRARSGSDALQQAASFATSSDGWSDHYAVLSLPSDFTESELRGSYRKISLRVHPDKPG
FT                   GSMVDFQRVAEAYTVLSDDAKRASYDSGEDVPHKAVDGELTTVWDEVLEKHFPEIWGFK
FT                   PFGDPYERKREYERRMGFSGDAQSRSAHDEF"
FT   CDS_pept        819963..821528
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633566"
FT                   /orf_name="MICPUN_104223"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67318.1"
FT                   /db_xref="UniParc:UPI000199C0AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL6"
FT                   /transl_table=1
FT                   /translation="MEVYAVTREFQEWGKGIYNRLPTPIRNGLKAAGVCHFLVVVRDGP
FT                   GGDLYSFDFGPVGGDVTGALSGGVAGFPEVAPSQLCFDDVVPGSLPMRRSQSTPALFKE
FT                   APEEEADEPVEILAKEAKDPAAAAATDGSSSAGAKSRRRRPLGRREKKWVVGEIREHKI
FT                   DELPEGTHFLGTTEMTLDDIRDFNATRNKMYALHDNDCRHYMNELCERLVPELGKYGRG
FT                   GVASKLAWDATWGRLRSGRPEIHLLPIQAMADLRNQPALERIKTASMASVIFSLGMRAL
FT                   PIVFKPVLPLATAVSNAAPARRLVTTAAGAVAGVSSEVPIVREALYAGNVAMESLSGVA
FT                   NGLVRGTTSLVHATSGLFFSSSPSTGLAAASAVGGASLGAESAMGPLGFASAGGATEAI
FT                   AAGVAAGRRGVRVRSAAVSAARATRNVATKAVTGLKRFASTPIRPPAAKVTRRLSSSSS
FT                   TSSLSSRRSSFSISGSEADLVSLAADHSAAVAARARRLPRLPSFGNLPLFRRSSSVGAN
FT                   LASR"
FT   CDS_pept        complement(<821750..>822574)
FT                   /codon_start=1
FT                   /gene_family="HOG000243167" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633567"
FT                   /orf_name="MICPUN_69373"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO67528.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniParc:UPI000199C0AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL7"
FT                   /transl_table=1
FT                   /translation="GWLADVSDVKLGDVLGQGSSGVTTKGKWKGQPVAAKRVNVSGKSR
FT                   AVSFLREVRVLARLRHPHVLPFYAACLKPPDHCLLLTDYCTGGTLKEWLYPRDGSNPPS
FT                   TRRRLRIGFQIARGMRYLESLGIMHRDLKPSNVFLTHPGKGARAVIADFGLARPVPNPE
FT                   SESVLTGETGTYVYMAPEVIRHEKYTGAADVYSFGVLLNELASGLVPYSNAHYTPVQVA
FT                   FGVADRSLRPELASGVDPGLVAVIVSSWSQDQTERPTFVAVTDALDAMAQQLV"
FT   CDS_pept        join(823286..823927,823973..824482)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633568"
FT                   /orf_name="MICPUN_88004"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO67319.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG558520"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199C14E"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL8"
FT                   /transl_table=1
FT                   /translation="MPASPDSPGTTVACATLSGGPDPVAFRFGLLADIQYTDVDDRCNH
FT                   TGTQWRRYRNSLAVARNAIDYFNQSDLSFVLHNGDIIDHQCAFDFAKDEFKPKAEGLEQ
FT                   LGRVMRILSGSQCKDWMFTIGNHELYNFTASELREGVTPEGCTLPFKCANDEGSFFFSR
FT                   TPAPGWRVVVLNSYDVSIYSKGREQGLDVDALELLRKHNANVDKWVSDNPEGLEGLGNR
FT                   WVPFNGGVGEEQLEWLKGQLSEAEANDERVIVFSHLLVHPETTANGSGRTLIWNYQDVL
FT                   DAVEDERWGKNVAAVVSGHQHEGGLYTNDNGTHFVVMESPMLAEPGQPGPFCVVEASSG
FT                   GLRMIGYGKGPNSKIFGAEEGEQYPPAEPMVKDLPLAPVEAKA"
FT   CDS_pept        complement(824726..>825136)
FT                   /codon_start=1
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633569"
FT                   /orf_name="MICPUN_88212"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO67529.1"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000199C14F"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHL9"
FT                   /transl_table=1
FT                   /translation="FWGPEARFGKLPGVVSTRVGYTGGKTENPTYGTVCGGDGHTEALK
FT                   VEFDPRVISYDDLLNAFWEEHNPSGYKPKAQYKSAIWPTSESQKEKALASRAAIEAKYG
FT                   SVHTDIEDEQPWWDAEEYHQKYFDKMSGRQWM"
FT   CDS_pept        complement(825534..826709)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633570"
FT                   /orf_name="MICPUN_64275"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67530.1"
FT                   /db_xref="UniParc:UPI000199C150"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM0"
FT                   /transl_table=1
FT                   /translation="MFGPPKRSHAKTDRDVESLLSQARGGMRAGGRTERQKNLSSLRQR
FT                   LESIEDASKGDSRLNALLRRLELAEENTEMNGRRPDDKTRPFGGRVRRGSRSSSDEDRE
FT                   STELTSDESDSSTPAPSPPRRRPASAVKVPGKENASELLSASRARGMEASLRRLRAELD
FT                   QERKNGERMRAELVELRSAQRKASARGGAAQLASARESEGMRRLQNELDGVKRALVTER
FT                   KRNAAPKVDTGATAVGVRIRRELDAERKARLTAERALRETRAECARAWEQVKSAEEDAA
FT                   RAAATARKRGEEKSSLERELEIAYERCSRAESLGRDLRREGAALASDAEVVSRANEALD
FT                   ERCATLNSRVEEMERELEELRPLEREVASLREWKKSQASDLKEAMEVLGHV"
FT   CDS_pept        join(826920..827162,827276..827557)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633571"
FT                   /orf_name="MICPUN_64276"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67320.1"
FT                   /db_xref="UniParc:UPI000199C151"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM1"
FT                   /transl_table=1
FT                   /translation="MRPTSAARDRGGLDPSSHYTSSSIQGALRGAQQSGSSAAGTGPPG
FT                   LLLVLMLVAVALPAVSFFAMHARMLDRQEVLSNNYATTMVELTALRKEVGEMRAIEQEL
FT                   KEARSELMLARLSLKNAATKLGKTGSEAVHSKRGLLDAEPAEGDEGNARNWDASRRELH
FT                   EAMWTQQVNRR"
FT   CDS_pept        join(complement(828274..828443),complement(827656..828136))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633572"
FT                   /orf_name="MICPUN_64277"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67531.1"
FT                   /db_xref="HOGENOM:HBG558523"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199C152"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM2"
FT                   /transl_table=1
FT                   /translation="MKTADVPRRAMTMVQPGPNHDNRPKAYSVYNDQPGTGKTGMYEIP
FT                   PNNYPFYSEEEKYKPQHGIDGGFLSEWEPLYEASTVKADADKLKAFQSGVPVGSKYEPT
FT                   GTKSWAPVFENAERKLLNKYKDKGGEELDMLVVSDLHRHEEYGGPFWIKVPSTARVREV
FT                   RLVISEKCGILPGLQRMSYAGKQMEDAERKLEHYGVKYWNKKFPDWPLYIRRY"
FT   CDS_pept        complement(<829543..830202)
FT                   /codon_start=1
FT                   /gene_family="HOG000231513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633573"
FT                   /orf_name="MICPUN_88051"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67532.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199C153"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM3"
FT                   /transl_table=1
FT                   /translation="MHNDHQLEQARAPRTQNTALHLAAAQGSLQILKLLIPVYTQHAFG
FT                   ARKNLNSQNANRDTPLLFACARGHAGAAAMLIKAGASVDFFNDDKMTPLIAAASSGHHT
FT                   CVELLLRHGAEKTTDAEDAFGRRALHFAAATGNVESVKLLLDTGADVFARDRNGNLPRD
FT                   AAMEVQGGNNACLGLLDDAMREREDASSAATRDLLVSSGNEAGSEAEFTASIKGSSS"
FT   CDS_pept        831239..831991
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22633574"
FT                   /orf_name="MICPUN_88344"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO67321.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199C154"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM4"
FT                   /transl_table=1
FT                   /translation="MVDERVEELELYSLGLCAVPAEVWRLSALRKLNLRGNQLTSVPAE
FT                   IWQLTSLERLDLNNNQLTSVPEEIGLLTSLRELVLYGNQLTRLPAKIWQLTSLRKLFLD
FT                   QNQLTRLPAKIGQLRSLKELSLYHNGLTRLPAKIGKLTSLKTLHLSRNQLTSVPAEIRQ
FT                   LTSLQELSLGGNLLTSVPAEIGQLTSLRVLYLFDNKLTSVPAEIEQLTSLKELWLFNNK
FT                   LTSLPAAIRELRAMGCNVDLDDNVTVDE"
XX
SQ   Sequence 832468 BP; 141128 A; 275761 C; 275255 G; 140324 T; 0 other;
     cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta        60
     aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc       120
     ctaaacccta aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa       180
     accctaaacc ctaaacccta aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc       240
     taaaccctaa accctaaacc ctaaacccta aaccctaaac cctaaaccct aaaccctaaa       300
     ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac cctaaaccct       360
     aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac       420
     cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaaccctt       480
     cgtaccttgg tactaatttt gtgtaataat ttagtcattc gttgcgctga ttgcttggag       540
     tcgtcgctct cgcaaagacg ggcgcgcgtg ttcaagtgga acaggcgtcg ggaggtgcgc       600
     gcgccgcgag aagtgcgcaa ccgagcatca gtgcccaccg cgctttgctt agtgcgtgag       660
     gcacgatggc gtcgatgttg acgcgcggtg cgtctcgcct ctcccgtcat cgacacaagg       720
     gctggatgag cgctttcggg aggtcagccc ttcgcgggtt cgccgccacg agcgacgacg       780
     cgaaacccga tggaggaggt tgcgagccca cgttcaaggg cgcctactgc gagtccgtcg       840
     ccgtggagct cgggaccgag cgcacgccag tgagagtagg gttcgagacc ggaagggtgg       900
     cacgactcac agacggcgcg atcgtggcga gcatgggaga ctcgagggtg atttgcgcgg       960
     cggtgtgctc gcgcgatgag aacccggacg cggggttctt ccctctgcaa gtggattacc      1020
     gtgaaagaca tagcgcgttc ggtaagatcc caccgacgtt cacgcggcgc gagggtgctc      1080
     cgaaggaccg tgaggtgctc gccatgcgcg tcgtggatcg agcgattcgc cctctgttcc      1140
     ccaagtcctt ctccagggac accagtgtgc aggcaatcgt tctggccacg gaccagtcgc      1200
     aggatccagc cgtgctcgcg gtgaacggcg cttccgcagc gctgtctgtg tcgtccatac      1260
     cctggaatgg tcctgtgggg gccgtgcgtg tttccgtgtt gggcgacggc aacgagataa      1320
     ttctgaaccc ctccgacaag gacgtcgagg ccagcaagct tacgctgttt tacgccggaa      1380
     acgaaaatcg cactctgatg atcgaggcgc aagccggcac cgcagacgaa ggcggcgttc      1440
     ccgagtccgt cgtggcgagt gcgctacgag ccgcgcacga ggcggcgaag gttttgatcg      1500
     agccccaacg caggctgcag cgcgcgatcg gcaaggaaaa gctggatcca gtgcagcaaa      1560
     ccccagaaca ggcaaagtta agacacgacg tgtttgaccg ctcgagcgaa aaacttcgcg      1620
     ctctgtacaa ggaggagatt cagtgcaagc acacgcgcgg gaagagaatg gcggaactta      1680
     aggatgagat cgtaaactcg atgacagagg aagggatgtc gttcaccaac aacgacgtcg      1740
     aacaagcttt cttttgggta agttcacgcg tgatgcggga catgatcttt gaggacaaga      1800
     agagagtgga cgggcgcggg attcgcgagc tgcgccaact cggtgcggag tcaaacgtat      1860
     tgccggtggt acatggatct tccatcttcg agcgtgggaa cacccaggcg ttggcgactg      1920
     tgacaattgg caaattgatt gatgcacaga agcttgacgc gcccgtcggt ccagataacc      1980
     gacgcatgat gctgcactat tcgttccctt cgttctccat caacgagacc ccgaggcgcg      2040
     gaggtttatc acgacgcgag attggtcacg gcgcgctggc cgaaaagtct ctcgctggta      2100
     taatcccagc ggcgaaggaa tggccgtttg cggttcgcat aaacgcagag acgatggaga      2160
     gcaacgggag ctcctccatg gcagcagttt gttccggctc tttggcgctg atggacgcgg      2220
     gcgtgcccat caaagaacat gtcggtgcca tatctgttgg tctggttatg gatgaggacg      2280
     agcagacggg caaggtgacg cgttatgagc tgctgtcgga tatcatgggc ttggaggatg      2340
     tgctcgggga tatggacttt aagattgcgg gaacgcgcgg tgggatcacg ggaatccaac      2400
     tcgactgcaa gcccgcaggg atcccactcg acattctgat cgaggctatg gacgtcgcgt      2460
     ccatcgcaag aagcgcggtg atcgacgaga tggatcgtgc catttccaag cccaggagca      2520
     gggacgactc cgaggacggc gcacagttta ccacggttcg catggaccgc agcctgattg      2580
     gtcgcctgat aggccccaag ggcgatacta tccgcgaact ggagcgaact acgggcgcaa      2640
     aggtgagcat ccacgaagaa gacgacgctg gagttgatga ccagtgcacc ctaggtatct      2700
     tcgcgggcac caggcccggg ttggacgcgg cgcttgagaa gattcagttg attgcttggg      2760
     tgccaaaaga gggtgatgtt gtgaaggcca aggtggtcaa tcagctcgcg tatggatggt      2820
     ttttgaggtt gccgaacgag caggacgggc ttttacacgc cagcgaatac ttgcacacga      2880
     ggaaggttga tccgatgaag gacaatattt ttcaaatcgg tgaagaggtg ttggtgaaaa      2940
     taaaagacgt gagcgacggg cgggtcggtc tcagcgtcaa ggcgctctcg ccggcgccag      3000
     agggaaccga ggtcgggcgg agaggatcgc gtgcgggtgc gggatttgag aggaacgagg      3060
     acgggtcgct caagcgcccg ctgcgccgcc tcaaggattg atgtccactg tcgttggatt      3120
     tcataattga atcaattttt gtctgcctcg acccacttgt cgagcggccc cgggttttcc      3180
     tcctctccca tcacgaggtc gaagaacaac cgtttcttgt ttttcatcac cgcgtcgaaa      3240
     acctgagcca tcatcctcgc cgcgacgggg ttctgacgcg cgtcctttgc gtccgccgcg      3300
     tacgccggag ctccactgcc ggacaccacc ctgtaatggt cgtcatccgc cctccgagcc      3360
     accgtcatcc ttccaccacc aagctccagc tcgacgtctt gcagagacgt cgagtcacct      3420
     tttgtccagc gccagccgtc gttgggattg ggcagggacc agtctccgcc ctggggatcc      3480
     ctcgcgagct tggcgatttt gagatcctcc ggatcgatct ttgccagcag ttcttcctcc      3540
     tcctttttcc gcgcgcgcgc ctcggcttcc gccctcgcga gctgcgcggc cctctcctcc      3600
     gccgccctgg cctcctcctc acgtcgcgcg cgttcgagct ccttctctct cttttcgcgc      3660
     tcaatctcct ccggatcctc caggatgccc ggctttttgt cccagctatc gtccgactgg      3720
     tacccgtcat ccttcgtttt ccccgtcttt ccctcgggcg cagcctcgcc ggcttccttc      3780
     tcctcggcga agatggggag aggcaggtcc agcgtcggct tctcgtcgtc ggtgttcttc      3840
     ttcttctttc cacccttgga tttcgggggc tcggacctca ccctcgggtc gaccacatcc      3900
     tgcttctccg tcgggatctc aaccgggacc ttcggctcct taaccggaaa cttccccgcc      3960
     gtcctcgcct tcttcccttg gtcgccatcc tcacccgctt tcccctcgtc ccgccccctc      4020
     ttgccgccac cctgcttctc ggtggcggcg gcatccttcg agctgtcatc ggctactccg      4080
     cgcaacgcgg ccatgctgac gtctccaacc agcttgtcct catcaagtcc agctcgcaga      4140
     gcctttattt gtgcatcgaa cttcccctcc ctgatcatgc ggcggatccg atcgtcgatg      4200
     tcctcggtgt aacatgcgct cggcttgaag ttcggataga gatccaggtt cgatccattc      4260
     cctgcggccg gcgccgaggg tttcgccggg ggaggcggca tagccttggc cgccgcgtcg      4320
     gcagtcttcg cgcccatccg ttcgagccga gcctctttca acgtgatcca tttcccgttc      4380
     gagccgcgtt tcaccttgac gtcgtctttg aaccatccct tcatactcca ttcgtctaaa      4440
     ttgctccacg ggtaagggcc ttgcacattt tgctgcagtc gcgaggaggg tggctaggtc      4500
     agccgtcgcg gaaaaacaaa cttcgcgttg ggatcctcga atttaggcgg cctcggacga      4560
     tgtgtcggcg gggcgtcgga gaacgcctta gcgcagttaa actcacctcc aagtcctcat      4620
     agtagtactc gtcgacagca tcactgtggg tcgccatcgt cctcacccgc gccagtcgag      4680
     ggtgacaacg cggccgtgag ttgtggttta ccctagtaga gcttcagatc atcagggacc      4740
     atctcaggcg ggtcgcgaga aaattttcag caggtgacca cattcagggc gcgcgggaga      4800
     tggtgctctc ggtgtggcgg gccgcgaccc tagcgcgggg ttgcaccctg gcgttcatga      4860
     tcgcctttga tctcatcgtc gacgattacg acacctccgg ctcgttgtca cccggcccag      4920
     gtccgcggga cccgtcgtct tccgcgctat gtcgacgagc ggagggattg gtgacctggg      4980
     actcggtgta cttcgcgcgc gtcgcgacga acggttacga gtacgagcag acgcacgcgt      5040
     tcttcccctt gctcccgtgg ctcatgcgag cgctgtcgcc tttgttcggt ggtgggtcgt      5100
     gcggggtcgc ggtatcgggc ctcgcggttt cgaacgcagc gcacgtcgcc tccgcggtgg      5160
     cgctggagcg actcggcacc tcgatcctcg acgacgaggt gctggcgcgt gccgcggcta      5220
     tgctctacgc gttcaatccc gccgcggtgt tccacagcgc gatatacacc gagccgctgt      5280
     tcgcattcct atctttcacc gggtgcctgc tgctggcgag gacgaggaag aacgccgcgt      5340
     gcgtcgcgtt cgctctcgcg tctctcgcgc gttcgaacgg ggttctcaac ctgattcacc      5400
     tggcgttcga cttttggcgc tcggcgctcg cgccggcgct gagacagatg cgacggcttt      5460
     ggggagagga agaagagggc ggtggggatg ttaacggcca cgagagcgcg gttgcgaggg      5520
     tgaagaggcg aaaacgagtg gcttgggcca aaggtctggc gacggcgtcg tttgtgtttt      5580
     tggctcgctg cgtgtcggtt ttggcgccga cgctatggtt tcaatggatg gggtaccgca      5640
     ctttctgcct cggcggagga gacccgaacg ggtactacgc tgcgaaccct aggccgtggt      5700
     gcgcgtcgtg gaggccgttc ccgaacgtat acgccttcgt gcaggatcac tactggaacg      5760
     tcgggctctt ccgctattac tcgccgaaac agctgccaaa ctttctgttg gcactgccgg      5820
     cgttgggggc gagtgtgcac gcggctcgtg cgtacgtcaa gggcgcggac gaggacgcga      5880
     cgtggacgag aaaggagcct cttcgaccgt tcatgtttca gtggtgcgtc atggccctcg      5940
     ccgcggcggc tgtgatgcac gtccaggtgg cgacgcgttt cctctccgtc agccccgcgg      6000
     tgtactggta cctggcgaag gtcggcgcaa acgagggtgc ggggacgaga aagatacgaa      6060
     ggatcgtcag cacgtactgc gtggtgttcg ggctcgtcgg caccctgatg ttcccgacct      6120
     tctacccgtg gacgtgacgt gtaatgcgcg ctcattcacg ctttgactag cagctagttt      6180
     tgaccaacaa caagattggc ctactcgacc atggcgtcat cccggctctc cgcggcggcg      6240
     acggcttcct ccaccgcctc cttcagcccg gccggtgccc ctcccatcgc ctcctccgcc      6300
     ttctttgtcc actccctcag gtcattcagc ctctccctct tctgcttcgc ctgctcggtc      6360
     agcgcgtgct ccagcgtcga cctcgcctga cacggtcgca ccgcgttcaa aaggtggtga      6420
     atattgttca tcaacaggga gatctcctca accctgcgct ggtactggct cggggcttgc      6480
     accatgttgg ccgcgagcac ggtaaaacgt gtgagaagat ccttgttcag ccgtttgagc      6540
     tcctcgcgta tgtctggaga gtccgcatgg ggcgagcgag tgagcggaac gcgacgaggg      6600
     tggagcggat ggttttggat ttcgggggcg ttgggatctc tcgcgcacct ccgtcagtcg      6660
     tgtacagctt cgcactgtgc agcacatcct ccaccttctc ggtctgttca tcatcgcggg      6720
     gagaacgtca ttgggcgcgt cggtgtggac cgtggggcgg agggaacgga gaacgggttg      6780
     ggagcagacg gaaggaagat tagggcaccc cggctctacc gtgtgcgtcg ccccgaaggc      6840
     cgtgtactgc ccgacggcag gcgggggagg accggggggc ggctcctccc tggcgggatc      6900
     gtatagcttg tagaagctgg gaggcggagg gtacggcata acgttcgtcg ccgccgccct      6960
     cgacctcccc gcgcgctcac tcactctgcg gaagacgtca agagctgctt tttctgtcgt      7020
     tccttgtcga gtttgttcgg tcgccgccgg agggccggga ggctgtgccc gttctgaggg      7080
     gctcgacacg ggtgttcacg agcggggttt cgaggcgggg tgatcactag agagtaatac      7140
     ggcaagtcat cggttaatat tcgcgaataa ggcgccgtgc tatgatagcg gcgcgtgccc      7200
     ttcctcgcgg cgcgcgcctt cccaggccca accctcgaaa ccatcatcat cgatccacgt      7260
     tcttcgcctc cgggtacttc ttggccatct cctccctgac cgcccttacc aggtgtttga      7320
     tcctgtagct catcttggtg ttctcctcct ccagcatctc aatcttcgcc ttatcctcct      7380
     ccgcctgcct tatcatcgcg gccctctcca cgcgcgactt gcccagctcc actcgaagag      7440
     ccaccagctg gtcgtagaac ttcttcttga actcatcccc ggccgccgcg tccccggcgg      7500
     gcgcggccgg cacggtcgcg ccctcggata tcttcaactc gagggcggcg atgcggcgct      7560
     ccgcctcctc cgcgcgagcc tcgaaagttg cgacgtcgac gtccatgccg acggtgtttc      7620
     tcctggagag atctccgtgc gcgtcttctt gtggggcatt tcttgtgagc ggccggagct      7680
     tgctgctggc tggggcgtga aattttctgg gacgtttttc cgaggtgccg atatctcgga      7740
     cgttccaaca acctcttcgg acctcacaac gtagcgcgcc ccgcacgatg cgcgtatcgc      7800
     tactgagcgt gatcgcggtc ctcgccgcgg cggtcctccc cgaccgaggc gccaccgcgc      7860
     ttcgcgtcgc gttcgtcgcc gacaccggta tcggcaacga caaccccggt gtgtggacag      7920
     actggcaagg caacaagcaa gggtactaca agttgaacgg ggtcgactgc ctcgacttcg      7980
     ccggcgagcc ctgcgccctt tactcccgcg cgcgtgatgt tctcactgcg gcgaaggaca      8040
     acggcgcgga actgattgtc cacgcgggag acatggacta cgagagcgcc ccgaggatgt      8100
     ggaggtactt cgtggacgag acgatacgca accagggtat ggacttcctc gccgtcaaag      8160
     gaaaccacga cgccgacggg tgggacggag tacagaattt atggagcggt aaccccgaag      8220
     gatacgccgc gcagctgagg ggcaccgtcc ccgcgcgcgc gaactgccgc gggtcatacg      8280
     gcgaggacat ggtttgcgac tacggaccag tcgcgtttgt gctcagttca gtcggcgtcg      8340
     aggaagccgg cgagggctca gacaccaacc gacgccacta cgagttcctc gagcgggcac      8400
     tctccggttc tgacgccagg tggaaggtgt gcgtctggca tatgaacatg gaggacatgc      8460
     aggtcagcta caaaggagac agcactggat ggggcgcgta cgagatttgc cgcaaacacg      8520
     gagccttcat cgtcaccggt cacgcgcaca cgtactcgcg cacgaaacaa atggccaggt      8580
     tcggcaccaa gcaatggagc cacaccaaga agtatcttcg agtatctgga aacgacgact      8640
     cgcgcatcca ccttcatcct ggagaagaag atggcacgag cgcggttgcc gtggttggct      8700
     tcggtggcta caagaacgag gcgatgctcc gcggcggcaa acactgggcc aaggtgtact      8760
     cgacctcttg cctcgacggc gatcccgttt gcgagcaagc ttcggacgat gagaagttcg      8820
     gtgcgcttct atgcgacttt cccgacgacc ctggctcgtc cgagactgag tgctggacgg      8880
     tgaccaccgt tcgtccgggc gcgtcgaatc gccaaaagcg ccgatcatac cgcaacccaa      8940
     aggacaggtt ctggctcatc gcgggcgagg acccggatgc gggcgaaggg cggaccgcga      9000
     atacgtactc cacgatgtcg agcggtaacc aacgctcctt cgacgggagt ctagaccgca      9060
     gcgaatgctt cgacgttcag ccgcaagacc acgagtgcat cctgcaaaaa cgctggggca      9120
     agtgcgacga ctggtggctc aagaacggcg gatactgcgc caagacctgc gggcggtgcg      9180
     tggagctgct cgaggtgaaa gaatacgagg attacatcga agaaaaggac gacgacgacg      9240
     aaacgaacga ggcgcaggtc cccgcgtcga aaggcgtcgc ggctgagacc ccggacgagt      9300
     ccgactacat gaacatggac gaagtcgact tctacgccat cgccgaggac gtcctcgagg      9360
     gccgcgggtg actgatgtac cggagaaaga cacgacgagc gcgttcagag aaagcggcga      9420
     gctcatcatt acaagtaacg ccaaactcca agtcgtgttc gtgccgctaa aactcttctt      9480
     cgttttgttt ttttcacggg ggatacatca gcctctcacc aagtcatcgc cgcgcgcgca      9540
     aggcgcagga ctcgtcagtc ggaacagctc ggtcgctcgc tcgtttcatc atctgggaag      9600
     ggatttagta ctcctcgtcc tcgccgtcgc cctcagcgga ctcggcgccg acctcctcgt      9660
     agtccttctc gagggcggcg agatcctcgc gagcctcgga gaactcgccc tcctccatac      9720
     cctcaccgac gtaccagtgg acgaaggcac gcttggcgta catgaggtcg aacttgtggt      9780
     cgaggcggga gaacacctcc gcgatggcgg tggagttgga gatcatgcag acggcgcgct      9840
     gcaccttggc gaggtcaccg ccggggacga cggtgggggg ctggtagttg ataccgcact      9900
     tgaagccggt ggggcaccag tcgacgaact ggatggtgcg cttggtcttg atggtggcga      9960
     cagcggcgtt gacgtccttg gggacgacgt caccacggta catgaggcag cacgccatgt     10020
     acttgccgtg gcgggggtcg cacttggcca tcatggaggc gggctcgtac gcggagttgg     10080
     tgatctccgc gacggagagc tgctcgtggt acgccttctc cgcggagatc acgggggcgt     10140
     aggaggagag catgaagtgg atgcgagggt agggcaccag gttggtctgg aactcggtga     10200
     tatcaacgtt gagcgcaccg tcgaagcgga gggacgcggt gagggaagag atcacctggc     10260
     cgacgaggcg gttgaggttg gtgtaggtgg ggcgctcgat gtcgagggac ctgcggcaga     10320
     tgtcgtagat ggcctcgttg tcaagcatga cggcgacgtc ggtgtgctcg aggagggagt     10380
     gggtggagag cacggagttg tagggctcga cgaccgcggt ggacacctgg ggggaggggt     10440
     agatggtgaa gccgagcttg gacttcttgc cgtagtcaac ggagaggcgc tcgaggagga     10500
     gggagccgag accggagccg gtaccaccgc cgacggcgtt gaagaccatg aagccctgga     10560
     gaccggtgca gttgtccgcg agcttgcgga tgcggtcgag gcagaggtcg acgatctcct     10620
     tgccgatggt gtagtgacca cgggcgaagt tgttcgcggc gtcctccttg ccggagatga     10680
     gctgctcggg gtggaagagc tggcggtagg tgccggtgcg gacctcgtcg atcacggtgg     10740
     gctcgagatc gaggaagacg gcgcggggga cgtgcttgcc agcaccagtc tcggagaaga     10800
     aggtgttgaa agcgtcgtcg ccgccaccga tggtcttgtc ggagggcatc tggccgctgc     10860
     ggaacagagg ttgggagggg agagattgtg gtcagtcaac gtgtttgaaa agtcgcaatt     10920
     ttcccgagaa ttcggccgtg gaggagggcc cggtcgggcg ggtcagagag ccgcgaagac     10980
     gtccgcgacc agcagatctg aacacacgca cgtgccgtgg gtgatcgaga ccgccgccgc     11040
     gccgatcgcg ccattccgcg accctccaga ccgggtcctc cgggtttcca taataggaaa     11100
     atttatagtc gttcccccgt ttgggctgga gacttactca ggctggatgc cgtgctcgag     11160
     gcagtaaagc tcccagcacg cgttaccggt ctggataccg gcctggccga tgtggatgga     11220
     gataacctca cgcattgttg aagaagagtt ggaaagtggt gtttcgaaag agcgctgtga     11280
     tgacgctgtg cttacgaagt gaccgccggg atcccatcgc agcgggggat ctctaaaatt     11340
     ctgctggcgc tcctcatttt tggaatctgg acgcgcgtgt tgcgagaact ctcataaatc     11400
     gaccgcagaa aaaacgcgag cagctgggct tgtaacacca tctcggtcgg ccctcgcgga     11460
     aaggacgcca ctgttggggc gcgaccggcg atggaacggt cgatccgcgc cggagcaatg     11520
     ggtggcgcca cgactgcgac atccgcgtcg gagaaatccg cgctgctcct gaatccacgc     11580
     gcggccgccg ctcacgccgc gctcaaggag caggcgaaaa aaaatcggat gctcctggcg     11640
     ggcgcggcgt cgatcttcct cttggtcttc gcgctcatcg ccgcgacgtc ccctgcccgc     11700
     acgcttcgag ctctgatcgg tctcggcgaa gcgccagttg gatacttcca tcgtaatcct     11760
     cacctctcgg tgaatcgctt gggagacggc gagcccgcgc ggctgcaccc gccaaacgac     11820
     gctcgagcag gcatggatgc cgagcactac caggcgcttc gcgccgcgct gaccacgaag     11880
     gacgtcaggg agacgatacc ggagcagtgc cgcgagcaga ccgtctggcc gaccgagacg     11940
     aaccccaagg ggtcggagat cgtcatcttc agggcgcagc atcccacgaa gggccgccgc     12000
     gagtgcgacg cgacgcggtg caaccacgcc cagtacgctg ccctccacgg gtacaggttc     12060
     ttcgagcacg tcgtcgagga ggacctcaac cccaacgagg cgtaccgaaa ggactccacg     12120
     gcgcctgagg tgttctacat gcgctacgcc gcgctcatcg aggcgttcag gatgtctgac     12180
     aagtcgaccg atgcgcggtg gttcatgatg gtggactgcg acgtgatcat cacggatctt     12240
     cagcgctcgg tggaggatct catcgattcg gcgaccggcg cggcgcccaa gaacggtccg     12300
     cagctggagt acatcgtggc gagggatccg ctgtgggcga gccttcgcga ggggggatgg     12360
     agcgccaact tcatgcacaa cgacgtgatg caggtgaacg gcggtgtgca gctcgcgcgc     12420
     aagtctcggt ggatgacgga ttttttcgag cgggtgttcg agtgcgaccc cgcgaagacc     12480
     gtccccgcga cggagcagag gttttacatg gaggagagca gcgggttctg gcagcacgtg     12540
     ctcggtgacc agatatgtct cacgtacctc ctcgccacga ccctgccggg tctgcatccg     12600
     acgcagttta tggagcgcgc gccggacaag actgtgccgt cgctgactcg gttcggcccc     12660
     gccgcggtgg tttcgcagag ggtcatgaac gcgttcgact gcgccggtgc cgagaagagc     12720
     tgtcatgacc gcggtccgct gaccgccgat gatcttctcg ttcgtccgga atggtaccgg     12780
     cccggggact ggatgattca ctacgccgga cagcacggga gcccggagag catccgggat     12840
     atgcaccgca tgagcaagca ggcgagggaa actctggcga acgcgggcgg ggcggacgcg     12900
     aaagcgacct acccgctgag caggtgggat acggaggagc aggaggagaa agtatccaac     12960
     tcgttctcgc tgggtgagga tgaggaaccc gattcactga cagagtcgcc gcggaagtta     13020
     cccacgcaca cgcagctggt gaaggattac gtcacgccgt cgatgatgaa cggggagtcg     13080
     caaaactcgg gactctgttc ggcatcgctt tcggtgtgcc cccagtgtgt ctgcgtccgg     13140
     atgtacaacg acggcaagga ggctgagatt atcgatggac cgcagtctgg ctcctttgtt     13200
     cgtggcggca gtgttaggga tgagcgcatg tatccgtaca ggtcactcgc ggaactgatc     13260
     cagtacgcgt ccaagacgtc gatgctgtac gcggtccgta cgatgttgac gcaggctggg     13320
     cagtacctca actgtccttc cgcgaatgtc atgttcttcc ccgcagatca gagcataatc     13380
     tcgccgcagg tgcagaaggc gttgaagagc agcggaacgc cgctgctgat gcacgagacg     13440
     tcttctccct cgctggacgc aatctggatg ccggatttca tctggatgcg cagcaagggg     13500
     ttcaccgaca actcattcgg ggacgtcgag atcgtggatg tgagcctgat ggatgagcct     13560
     ggacacaagc ctgatgccac cgcgtcactc gcctttgcac ctggaaagtc gttgcacgtc     13620
     cttcctccga gcgcttcaat gatggagatt gcgtgggcgt gggagagaaa gattcctaag     13680
     gtcttttggc gcggctccag cctcgccgac acccacgagg gcgtgggtcc caccgcgttc     13740
     gtcggagcca ttgcgaacgt ccacgacgcc atcgccgact cctgccgcag ggtgccgcgg     13800
     gtgcagctcg cgatgagatc agagaacgtg cccggcggta tccccgggct ggacgctgcg     13860
     ctgtcgtcgc tggacgtcga cggtaactgc aacgcggacg atctgcgagc cctcaatctg     13920
     acgctggacg ttcagggtgc cgggtatgag cccgcatggg agcagcaccg tggtgtgatt     13980
     gacatcgcgg gtgccggctc acacagcgat aggtacttga ggctggcgtc cacctcggtc     14040
     gtcatcatcc ttgagacaaa aatgcgggga tggtattcgc acaagctcaa gccgtgggtg     14100
     cattacgtgc cggcgacgcc cgacgatctg catgagcgca tcgcgtgggt gctcgacgac     14160
     gcgaataggg acgaacagca tcggatgatc cacgaggcaa actcgctggt gcgttcgatg     14220
     actttcgacg tggaggccgc gaggatcggg aaggcggtga gccgcatgac ttgcaagccc     14280
     gagttaggaa gattcacttc ggtttaggcc agtggggagg aaacaaagtt ggtcaacact     14340
     tcaaagttga cccggccagc cggccatctt tttcaattat ctttccattt tttcacatca     14400
     aaactacgac gcgagcacaa ctctcagcct ctcatcgatc gctttcatcg ccctcgagat     14460
     cacttccttt ttgcctttcc gaaacttcac cgcgagcgcg aggttctcct tctctaacgc     14520
     atcgccgact cctgaaagtt ccgccaactc tgctgtcaac tcttccaact ttgtttcgtc     14580
     ctctttcagc gtcgtaggga agttaccaag cgcgagggcg agcgcagcct gtgcggttcg     14640
     cagcgcgtat gcctcttttg tgcggtcaag ggtcgactct aacagcgccc cgtgccgaag     14700
     cggctgcaac gcttcgccgc ttccaccgct gctgaaatcc tccggacccg aagcgtacag     14760
     gactctgata cccgcgagca gccgcgcatc caccggttgc ctctcatcgc gcgtcaccag     14820
     cacttccgga tcgtcgtcca gaccgagctc cgatagcatg gcgctctgcc acggttctgt     14880
     acctgccgca aacggcactt gagccaaccc cgccacctca cgagccgcct cgaggtagct     14940
     gacgtcccat cgaagactcg cggtgtcgtg tttgttgatt ccctgaggca caaagccgta     15000
     gtcgagcagg aaatgatcgt tgctcaggtt tccgtagttg agcgtgacct catctcccgc     15060
     gcgaagaggc cgcgaggcga ccatctcgat cgcccccggc ccctcaccca tcgctgctct     15120
     cacctctgcg ctcgcttcaa aggaatggtt ggcgacgtca atcagaggta acatcgcggc     15180
     gggtttcccc tcccccgcga cacggaacgc gcggctggat gcgcacgcga aagcccaacc     15240
     cagcgcgtcc gcgccaacac tgtaaccgtt gaacgggaca ctctcagtct ccccgttctt     15300
     accagccgtg acgttcttca gcggacccga ggagtaatcg atgaggaatc gagatctgcg     15360
     cttgacctgc acaaccagcg gcagatactg cagggcatcg acagcttccg ggccaaagaa     15420
     cagcggcaga cctctgtgca tggctggaag taagctaatg tactgaaaga atggcgactt     15480
     gccacccaag gcacgttcgt gtaagagcgc gaggcccaga cgtacgctcc acagctcgtc     15540
     tggaatttgg gcgatgagtt ccttgaggta gagcggcgtg tccggttcgc ggtctagttc     15600
     cgcggtcgcc tggtccgaag aggacgtcga ttcccggtct tgcaaggagt acgtcatctg     15660
     taggaccctc ggtaggagta tgaggcgctc gccgacatcg acgtccctcg aagcagtgag     15720
     accccagccg atgctcggcg tctgcaccat cgagatgccg ctcgttgtcc cgccgtaggc     15780
     ttcgaaccaa cgctggaacg agctcagcat ggcgttctga agcgcggact cttggtccga     15840
     agcggacgaa gagagggtcc tagcgaagga tcgcccatct tcgcgccaga acgcgcggtg     15900
     agcgacaccg caccgccgcg ccagcgacgc gagcatcgcg cgcatcgcgg gacgaaggac     15960
     tgtgttttcc acgtcttgca gtgcaggtta aaaaaattac tttctcatca gtccggctcg     16020
     cgccacagcc gcggcggtcc gtcgacgcac caccttcatc ggcggcagct cctcccactc     16080
     actctcgccc ccttggtcca cccttctcct gaacgccgcc cccgtccaac gccccgccgt     16140
     gctacccccg atgaggtaga cccagccgtc gaaagcgcac atggcgaaac cgtaccactc     16200
     cgggagtggc agcccgcaca ccctctcgta cgtgtccgcg tccgggtcgt acctccacag     16260
     cgccccagcc tcgcccaccc gcgggtcctt acccccgcgt ttcgtcgact tgttcccctc     16320
     gggattatca gcgccccacg tggcgacgta cacgtactgc gtccccttcc cctcatcgga     16380
     tccgtccacg cacgcgcacg cgcatgcgcc aatgggtagc ggacgaatgg ccctccactc     16440
     gttcgacgtc ggatcgtacg cctcggcgcc cgcgatgggc cccccatgat cgccgatccg     16500
     acccccaaag acgaagagtc ggccgtcggg aaggcccgcc gcgccgtgta gcttgcgcgg     16560
     cgtgatcagc ggcgccaggc tccgccacgt cgtcgacgtc gggtccgtcc tcaggtccaa     16620
     aaaatctacg gcgcccgtgc acgagttgcc gtcggcccat cctccgatcg cgcagacgcc     16680
     ccaatccccg gtgttacacg cgctcaacgc gtgcctcgcc tccgcgacca cacccgcggg     16740
     tacccacgcg gtggacgcgt ggtcggcgac cgcgtggagc gcctccgccg tggcgaggtt     16800
     cgacttgatc cctccgccgg cgacggcgta cacgacgccg ttcgccgccg cgaggccgtg     16860
     gctgccgcgg gggtcggcga tgtgcggccc tcgctcccac tgcttccgtc gcagggagta     16920
     cctctcggtg acgcccacgg tctggccgcg gttacgtccc cccgcgacgt acacgtacac     16980
     gtcctcgggt tgcgcgaggg aaactttcgc caacccttca tcgattccgt ttgccaaccc     17040
     gtcgacaacc ccgtttgcca acccgtcgac aaccccgttc gccgttccgt ttgccacccc     17100
     gtttgcggtt ccgtcgttcg ggtcacgcac gggcgcggcg gcgggcgcca ggccgtcatc     17160
     cacgaccgcc gactggtgcg ccttgaccgc gtgttcgcac tcccacgccc tgtggccgtg     17220
     ctccccgcac cagtggcagt gctcgtgatc gaacatgcac atgccaaact tctcgcggcg     17280
     aatgcaccca tccgcggagt agttgtggaa gcggcaaatc tccacgtccc cgcgcacgaa     17340
     ccgcgggggg tacttcagag gatacctggc gaacagatcc gacgcgggcc gcgcgctccg     17400
     ggcgacgtgc gcccgtttaa acgcggacct ggccctgacg ttgccaacct cccgctcgca     17460
     cgtttttcgc caaaaaacgg gcgacgcgct cgaggcggtg acggcgacgg cgtcgcgcca     17520
     cctcgaatcg gagcttccac aatcggtgtc gcagtcgtcc accccgttcg cgccgccgtt     17580
     tgatcgctcg cgttccggga cggtgaacct cgtgatcgtc gtcgccccac gcagaccctc     17640
     gaagggcacc tccgcgtcgg ccatggcgtc gtgcagcgcc tcgcacttga cgacgatgaa     17700
     cgagggcgcc gcgcttttgg cgaccgccgg gaggagcctg acgagggctt cggcggcgcg     17760
     aacgccccca atgtcgacga atacgttgac ggatccctcg atctccctgg cgagaagcgc     17820
     cgggtcctcg agcgcgtcga ggcgctcgaa acgcaagccg ggtctcgccg cgctcgactg     17880
     gtccacgaaa tgtttcgata cgtctattcc cagcaccgcg tcctcgcccg cggcttcggc     17940
     catgagcgcg gtggcgtcgc cgtacgcgct gcctatgtcg actgtcctct ccccgggcct     18000
     gggcacgcac agagccaggc gcctgtacgc cttcgtggag cggcacacga gcactttagg     18060
     ccgatcgctt tcgtgaagcc tcgccgccgc cgcggtaggg cccgagccga aggttggacg     18120
     ttcgccgagc ggctcctcgt gcacgcggaa aaactcgtac cgcgagaggg ctaccgtcgc     18180
     ggcgtccacc gcgcgctcag ccgccgcatc agagccgcct tccatgtcac cccccggcgc     18240
     ccacgaccct tcgcctccca cgcgcttccc aaagtgcacg cccccgccct ttcctggtcg     18300
     cgctttttca catccagtca cgtcggatgc gggagctttt ttcgaccctc cgccggcgcg     18360
     cgcatcttat ccagttgggg ctgcgcgcgc gcgacctcga cgcgatggtt ctcaagacca     18420
     gggtcaccga gttgctcaag atcgagcacc ccatcatcca ggggggcatg caccacgtcg     18480
     ggtacgccac cctcgcggcg gcggtgtcca acgcgggcgg gctcggcacc gtcaccgccc     18540
     tgacccagcg cacgccggag ctcctccggg acgagatccg cgcgtgcaag gctctgctga     18600
     agcccggtaa gccgttcgcg gtgaacttta cgcttctgcc gagcctcgcg ccgcccgact     18660
     acggcgccta cgcccaggtg atcgtcgacg agggcgtgcc ggtggtggag acggcgggca     18720
     gaaatccggg caagtggatc gccttcttca agaagcacgg cgtcacggtg gtgcacaagt     18780
     gcgtcgccat caagcacgcg ctcaccgcgc agaggctcgg cgccgactgc atatccatgg     18840
     acgggttcga gtgcgcgggt cacccgggcg aggacgacgt gggcaacctc gtgctgctgg     18900
     ccaaggcgag gacggcactg acgatcccgt acgtggcgtc ggggggcgtc ggcaccggag     18960
     agcagctcgc cgcgtgcctc gcgctgggcg ccgacggcgt gaacatgggc acgaggttca     19020
     tggccacgaa ggaggcgccg gttcacgacg gcatcaaaac ggcgctggtc aaggcggacg     19080
     agaggagcac cacgctggtg atgaagtcgg ttggcaacac cgagcgggtg tataaaaacg     19140
     acgtggcgcg gcgggtgcag gagattgaac gggaaaatcc gggaaagatc gaggccatac     19200
     ggcacctggt cagcggggag aactacagga agagctttca ggagagcggc gaccccgaca     19260
     gcagcgtttg gtcgtgcggg gtggtcatgg gcctcatcga cgacgtcccc acgtgcgagg     19320
     agctgatact aaggatggtg gcagacgcgg agcgggtcat cacaaaaagg ttaccctcca     19380
     tggtgggtgg gcggagtggc gggctgtggt ccatggtggc cggacggagc aggctgtgac     19440
     gatgaacgag cagcgcggat cgatttgata taaatacaac tcgaacgtcc catctctccg     19500
     ccttcggcct ataagcagtt tttgcaagag tcaaaccctt tttttaaacc cctcctcctc     19560
     tcctcctcct tcgctttgaa caacctcctc gcttcacaga ctcctgatga tgctctccgt     19620
     cgactcgtcc gtgttgagca gctcgaacct gtgcgagttg agcgtcacgg tcgcgccgac     19680
     gtaaaagtcc ctcgccacgt aaggcgccct cgccccgggt ttcctcaccg gctcgagcgt     19740
     gcgctccaga aacttaccgc cgattatgcc gctgttggac atgggtggct cgtagacgct     19800
     gatggtcccg tcgaccaggt agaaggtcac gatgaacctc cgttcatcgt tggggggaac     19860
     cagcccgggc ccagcgaacg ccgcgttgaa cctgagctcc ttgccaaagt tctgctcaaa     19920
     gtgcctcagg ttggggggcg cgcgcttcgg cacgagcgag tggcagttgc ggagggagtc     19980
     cgtctcggag ccgaaaccgt tgtacggggg gtcgacgtgc acgtgcttca ccgcgccatc     20040
     gttcaagggc ttgggcgcca tctcgaggat cgtccgaccg agcgtcttga cgtagtacgc     20100
     tcgcgtgaaa tcatcgcagt cgtgaaccgt caggttacgg ccgtaaacgc ccacgggctg     20160
     gcccatcacg atgtcggcgg gcttgaggaa cgtcctggtc ttctcgccgg ggggaccgac     20220
     gtcgaacgcg ccgcccgccg ggagcttgct gcgcgcgagc atcttgggga aaggatcgcg     20280
     gcccggagcc tcctcctcga gaacctccac ggtaccgtcc gcgaggaagt agttgagggt     20340
     gtagtgcacg ataccctgga cgctgtcgtc ccacgagcac ttgaacgaga ggacgtcctt     20400
     ggtgaacggg tcaatcgcgg gttcggcgat ttgattggac gacgcggatg acgcgccgat     20460
     gacaacctcg acgggatctg tctcgaacac ccttttgccg ccgacgccgc gaacgcccat     20520
     gccgatggta ccgagcacgc cgggtccctc gtcgacgagg gtgtcgggga agggaacgtc     20580
     ggccgcgatc gtgaggccct ctttgcggag gaactcgcgg gtgtacgcgt cgcagcacac     20640
     gacgttgtac tcgcggccgt agattgcgac ggtggatcca atctgaaagt cggcgatggc     20700
     gaggggttcg ccggacgcgc ccaccgcggc gtggcgcttc aggatgcggc cctggacgat     20760
     gccgctgttg tccgtcttgt gttcgtgcac gtccacggtg ccgtcctcga ggtggaacct     20820
     gatgacgcac ctcctaatgc ggtctcggcc gtcgagcgcc ttctcgacga aatacgcgcc     20880
     gtaggagagg gattgaccgt cgtacgctac ccacgcgggg gtggcgctgc cctcgccgag     20940
     cttcatgtca ccgagggcgg cgaccgcggg ggcaccgggc gggggcgcgg gaccgttctg     21000
     cgggtcaacc gcgacggacc ccttgacgtg atcggcgagc gtggtcttct tgtcagtcag     21060
     cgggcgcccc tgcgtggcga gcttctcgtc gccggccatg cgagcggtga tggggcgcgc     21120
     ggggtgggat tgatcgggaa ggccggtgac gaagatgccg ccgccggcgt agttgagggt     21180
     ctgggggagc ttcctcgcct gcgtctgttc aaccggggcg gacgaatcac gtcagagaat     21240
     gcggaacatc gggggaaaca aaatctcagc catcgcgggc agggcgacgg gcggttcgga     21300
     ggtcggaacc agggtttgcg cgcgggaact caccccgggg agcgtcaggc tgtaccccgg     21360
     aagcaggggg atgttctcgt cgttacccat ggggcacgtg aggcgcgttg tgatgggccg     21420
     agcttttcgt ggcgcgaaaa acgcatttcg ggaggaacac ccgtataaat gactcaagaa     21480
     aatagaccgt cgttagtgct attggagcgc agcgctgtca gtgttgcgag cggaaggttg     21540
     tggaaagcgt agcgtcgcgc agagtagcag atcgggacgc cacgaagccg acacgatgcc     21600
     agggttcgac tacagcaagt gggacaacct cgagttgtcc gacgacgagg atcatcaccc     21660
     cggcgcgcag ttcatcgagg cgaacacgct gcgtcgcatc aagcgggagg cgcacgagaa     21720
     caaagagaag gagcgcgccg agaagatcga gtcgctggag aagcagatcc gcaagaacga     21780
     gcgcaagatc aaggagctct cggagggtga gaacgcggcc gccaacgagg ccgagatcgc     21840
     caagctcaga tcggcgagcg cgacgttcca gtccgaggtg gacaccgaga ggcgccagaa     21900
     gaagttcaac gccgaggagg ccgtgaggga tgcgtggtcg cactcgctcg tgggcgccgc     21960
     gtgcaagccc gacgcgggac cggagaagct ggactacgag gccttcgcca agaagtacgg     22020
     cgaccagctc gacgcgctgg cggtcaagga cttcggctcc ggatacgagg agatggggga     22080
     ctacttcagg gacaactcgc acctcctcac cgagcacgcc atgggctaca tgctcttgaa     22140
     gtgcctctac atggagatgg agggcaacac gctcggcatg aggcggggcg cacgcgcggg     22200
     atacgccctc aagtccatcg tcgacttcgc cgaggccagc aagaggtcca tgagggacgc     22260
     cgcccccgcc ttcttcggac gcatgagcga cccggaggtg gccaaggagt acgagaagat     22320
     gtacgaagac tacgtggaca agctcaagaa acgcgcggtg gacaagaaaa aggaggaaga     22380
     tgcggctgcg gcggaggagg ccacgcgcag gctgcagctc aagggggacg acaaagccct     22440
     cgaggaactg ccgcgggagg aacggttggg ccccgggggt ctggacccgg ttgaggtgtt     22500
     tgagtcgctg ccgaaggaga tgcaggacgc gttcgagagc ggcagcgtgg aggcccttcg     22560
     cgagtacgtc aacgggcttc ccttggagga tgcgaagcac cacatgaaga ggatggtgga     22620
     cagcgggctt tgggtgcccg ccccagggga ggaaccgggt ctcgcgctgc agtgaatgcg     22680
     catcggatga gggctgcgtt ttgatacaac gaagttatgg aacagaattt acgtttgcct     22740
     cctcgtatga tggttcacgg tccaggcgcg ggaagcctgc gcatgaacca ctcgatctct     22800
     tccgagtacg tcgacgcctc cgggtccgtc tcgcccgttt cctcgttgac ctcgtcgtac     22860
     aggacgatgg ggtccatgac gcgcaggtcg taggtcgggg tcgtcctgaa ctgggtgaga     22920
     aagtcgtcag actcggtgtt ggactccccg atgggctcgc catcctcgct caccgtctcg     22980
     cccttgttgt tgacgtaact cctgcgcgca tccaccaaca cgagcttggg ttcggtcgcg     23040
     tcgcggtcgt ggaacacctc gcggacgtag atccgaccca agcccacgcg agtcgccgcg     23100
     gcgtacaccg ccgcggctcg gtcgctggga taaacgacgt gcatcgccgg atcatttccg     23160
     ggctgcacgt ccgccgtcaa gggcttcagc agcttctctc cggcggcgaa gaactcgtcc     23220
     agacccgcgg tggtctcgta gtgcgccagg cgcttctcgt tgcgtatggg cttcgtccct     23280
     ctcttgatgt cctccttcgg gaagtagggc gggttgcaca cgacggcgtc gcacttaccc     23340
     atccagtcgc cgggtttcgc gtccgcgccc gcccaccgct cgtggttgaa cgcggacttg     23400
     accgcgagct ccacgccgac cgcgtcgcca tccacgctga gcgacacctc gacgtgttgt     23460
     cgttcgtcgt cctcctcctc ctctacctcg tcctccacga tgtcctccgt ctttgagttc     23520
     gaactttgag ttccaaacga ccctgcggat acgtccccga ggcacacggt gacaccctcg     23580
     ccgacgccgt tcagcgccgc gttccgcgcg caccgcctcg cgagtccaac ctgcctctcc     23640
     accagcagaa cgttcggccc ttgcgcgtcc ttggcgaacc cgcccctcgc cgcgagcgac     23700
     aggcccacga ctcccgcgcc ggcgcccaag tcggctatcc tcggcggctt taaaaccttc     23760
     ttacgaccga acagcccgcc cgccttggtc tccaccccgt gccacgaaat ctgcccggcg     23820
     acgtgtgcgg cgagcacgag cgagtcggag ttgcacctgt accccttcct cgcctgcagc     23880
     agcaggagcc tgtgcttgaa cgcgacgtcc aaggtttcat ccggcgcggg cgcgacggag     23940
     gcgtcgggga cgtgcctcgg gtcgagctcg tcgctgcgcc agccctcgga cctctcgctg     24000
     agggacgacg tcagcgcgcg ctcgaggata tcgcactgat ggatgaccat gcgtcgcagc     24060
     gtcgacgtca ccgctcctcc cacgtccggc atctcggaga gggagccgaa cgaggtgatc     24120
     ttgaagacgc ctcggcgcat cctgatgaac gcgcgaagag cctccggggt gaccttcgag     24180
     cccttgcgca gcggtccctt cgcgtttgag ccgctatcca cggccatctc gtccgcgtcg     24240
     tcctcgacgt cgacgggctc ctgcgtcgac accgccggtc tcacgcgaac ggaacgggcg     24300
     cgccaatttg ctgcggataa tttgctcggc aacccccgga ggacgggggc gcgtgcgacg     24360
     gttaccacgg cgcgcatggg cacgggacgc gctggcgcgc gcaaactggc gcgtcctatg     24420
     caaactggcg cgaaactgga catggccagg ctcagtccgc tcctgggacc gtgcctagac     24480
     gactggttgc cgaggaactt tcccgtttta aataaacggt tttccaaccc ctggatcgtg     24540
     cggacattgc agatcggtcg gtttccttgc tggcagccga tcgacgtcat caggcagtcg     24600
     gggttatttt tttagagctg atgatggggc ttctcgcaag ccccgccagg cgggaagccc     24660
     gcaggtttcg agcaatatcc taagcgtttt tattgacacg gcgcaaccag acgtcatcgc     24720
     aacacgtcgc accctctaat aaagaatcac agcgagcccc ggccgcgcgg ccccgcggac     24780
     ccgacaccac aaacccaaaa ccctctctct ttgttcgcgc cgcgctccca tccctcgtcg     24840
     ccttcgcgga caaatcccag atggagccgt ttacgccgtg aggaggccct tgctgcggcg     24900
     aaggtcctgc ttgtacttgg acatgcggga cttccgcctc gcgccggtgt tcttgtgaag     24960
     cacccccttg gcaatagcct tgtccaccgc cttggtcgcc tccgagatga gcttctcgag     25020
     gtcgccaatc tcctcttcgg agcacgcctc ctgcgcgccg agcgcggtcg ccttgaggaa     25080
     aaccttcttc atgcgggtgg tgatctcgct cttcctcatc ttgttgtaga ggcgctcgtt     25140
     gcgggactgc agcgaaaggg atgagaggcg ggcataggtc agccaccgag tggggaaaaa     25200
     atcgtcaccc gagcggccag ggaaaaaggt tttagggtct cggtttttcg ccgcgacgtg     25260
     tcgcgccggc gtccgacgac gcgacgcagc ggcgacgcgc gggagctgaa cacgcgaacc     25320
     ctaagataca cactcgaggg actcgtccgg cacgcgccgc cgatacgcga cgccgagagg     25380
     tcgacgccgc ccgtttccgg gcgcggaggg tggggtggca cgcacctgaa tcgtgcgagc     25440
     ctttttgttc tgcttcgcct cgacggtgaa aaccgcgcgg gaggcggaga cgcgagccgc     25500
     gggggcgggc acgaaggcgg cgacggcctt cttgaagccg aggccggcgg ccttggcggg     25560
     cgccgcgatg gaaagggacg agaaagcgtt gacgagcgcc attgtgccgg tacaatgaag     25620
     caaagcgctt tccggggctc tcagtttgga taaagctggc tccgtcggat gaccgcaaca     25680
     gcttcgatac cagtaaagtt caggctatgg atccccaacg cggcgaaatg aggctctcaa     25740
     gcgtcgccgc acactcgtga agtcctcata cacgtcgacg catagtgcca gagtctctcg     25800
     cgcgtccccg atgatgcgtc agaacgcgct cgccctcggc cgacgcgccg ccgcggcctc     25860
     taaggttgcg gccgcgggcc tcgccgagtc cgcgctcgtc ggttccgccg cccgcgcgcc     25920
     gatgcacgcc cgcggaatcg cgtccaaggt catcgccgcc gagttcgttg cgccctccgc     25980
     gtcgcgcttc ctggcgggcg cggccgcgtt cggcggtctc ttcgcggcgt ccgcgacgat     26040
     ggcgaccgcc gtgaacctcg tggacgtcga gacgctgccc caggccaagg ctgccgttcc     26100
     caaggtgcgc cgcttgaccc gtcgatcgcg acgtcatctt gcccctatgt atcccaccaa     26160
     aatatctcac ccacccccga tccccccgtc cgtctcgcgc gacaggagaa gctgccgttc     26220
     agcaaggtga cgctgtacca gtacgacgtg tgcccctttt gcaacaaggt gaaggcgtac     26280
     ttggactacc gcggcattcc ctacgacgtc gtggaggtca accccctgac caagtcggag     26340
     atcaagttca gcaaggagta ccgcaaggtt cccatcgtga tggtggacga cgagcagctc     26400
     aacgactcgg cccacatcat cgccacgctc gacgagagac tgggcaagat cgcgcccccc     26460
     gggttcatcg ggggcaaggc catgaccgag aaggaggaga agtgggccaa gtgggtggac     26520
     gcctggttcg tgcacgtcat caccccaaac atctaccgca cgtgggccga ggctttcaag     26580
     tcgtttgact acatcaccga gcggggtaag tttggctggg tggagcgtca gagcgttcga     26640
     ctctccggcg ccgtctccat gtacctcatc agccagaacg tgctgaagaa gaggcacggc     26700
     atcgaggacg agaggctgga gctttacaag gcgctggagg actggatgga gaacggcgtg     26760
     ggcggcgcgg cgttttgcgg aggcgacgtg ccaaacgtgg cggatatcag cgtattcggc     26820
     gtgctcaggg cggtgaagac cttcgagacg ttcgacgacg ccctggcaaa cgtcaagagc     26880
     gtggagggct ggtacaggag gatggagaag gaggttggag aggcgaccag gaccgacggc     26940
     atcgccaact gagccgcaac tgtgctgttg taattctttt ttgatgagtc ccacaaaata     27000
     attcccccca aaccaaaaaa tactggcacc cccctccagc ttctccccga cctcctcaga     27060
     accccccgcg ccccgtcaag ctggcttcca actttttcta ccctccgccc gccatgtcgt     27120
     ctcccgcgga ggaggcgcag gtgcgcgagg cgacgcgccg gatcattcag ggcttggacc     27180
     tcgagacgac gaaggagaag caaatcgtcg agatggtcga ggcgcagctc gggatcttgc     27240
     tcggcgacga cgaggcgctg atgcggtgcc tgcaggagga gatcgagaag tttctgctcg     27300
     acgataccgc caagatctca cccgggaaga cgaagaggat aacccccaag agccaggcgg     27360
     gtaagcgccg acgctcgctc gtcaagttcg aggacgacga cgacaacgag gatctcgacg     27420
     acggagactg ggaccacacc caggaggacg aagacgagga tttcgacgag gacgacgcgg     27480
     cgcccaagaa gcgcagggac gacatgaacg ccgcgaggga gaagtggagc gagcccgcgc     27540
     cggctccgag cgacaccgtg ccgctcacct tggcggtggc ccccgcgtcg gcggcacccg     27600
     gagcgccagt ccccgaggac aagctcctcg cggcgctcac gctcaagggc gacgacggcg     27660
     ccaccgccaa ggaactcgcg ggcttcctca agatgggcaa gtccgaggtt aacaaggccc     27720
     tgtacaggtt gcagtcgtcc ggtagggtga ggagcgacgg cgccggcggt ggcgcgccga     27780
     cgtggagggt cggctcgtct tccgcccctc ccgccggcgc acccgcgtct gccccagcgc     27840
     ccgccgcgcc tcccgtcggc gcctccgcgg ctcctcctcc tcctcctccc gtcgcgcccc     27900
     agagccaggg cgcgggcgcg gtggagggtc agatatgcgc cctgtcccgc gcgaggcgat     27960
     gcacggtgag tgactttcgg ggcaaaaagt acgtcggtct tcgagagtac tacgaaaagg     28020
     acggcgtttg gctccccggg aagaagggta tcagcctccc gtacgagcag tggagccagc     28080
     tgcggagcaa gattggggag gtgaaccaga ggatcgcgga tttcggcgcc aaaaagccga     28140
     tatccgacgc gacggtgtgc gtcctcggca gggatcggcg ggtgacggtt gacattttca     28200
     acggctcggt gatgatcggt atcagggaat tttacgagaa ggacggcgcc aagctgccgg     28260
     gaaagaaggg aatctccctg tcgaaggatc agtgggagct ggtgaccaga cacgaggact     28320
     tgatcgaggc tgcgtgcggt gggcagtgag cgcgtgtgcg actcgtcgat ctcaagtttg     28380
     attcaaatct caagtttgat tcacgtattc gtacctcgtc cgtttgatgc cttggctggg     28440
     ggaggaattg gaactgaaga gcacctcacc ttttccttct tccaagagag cgacaagagc     28500
     gcataaacat gtgttcgcag ttgctgtgaa cagatgttgt gtctgaagga aaaggtgagg     28560
     tgatcaacta accctcaagt tccaattcct cccccgtcat tttttcagct cagccttgtc     28620
     agcgcgggtc cgcctcgccg tcggacggct cgacgatccc gggcggcggt tcgatccagc     28680
     ttccgatgga ctggcgggag ttgtccacgg gcacgcgctc gagcgggtag tactccccgt     28740
     cgtccccgac gtccatcatc tcgcgctcca tggcgacgac tttcgcgtcc gcgtcggtgt     28800
     cgtactggac ccgctcccag acggcgtagt cctcgccagc cacggcgagg gaccactcgg     28860
     gctccttcgg gatgagctcc acgggcatct cgtacctcgg tcctagcttg accgtcagcc     28920
     tgtgtcccac ctttgccacg tagatgtcgt tttcggccat ctggatctta acaggcgcgt     28980
     cggcgcacac gcagcacctc ttgcgaaggt cgatcaggag cctgatcacg ccggagagca     29040
     ccgggtcgtc gccccacagg tgcggaccga acacgcacgg tatccccggg tgggtcagga     29100
     cgtaggcgta cccgagggcg atcctgtcgg gagggaacgg ccagtggttc tggggcgcgc     29160
     cggtgtcgtg gttgtccacg aacgtgacgg ccctacttgg aatccatccg gagaggcccg     29220
     gaggtctcga cgccgggtcc ctgagccggt aaaactcgac gtgagtcacc gcgcgctgca     29280
     ggattccttt cgtgggaaag tcgaagagcg cgcacgtgcc gtgcgtggcg gcgagccact     29340
     ccacgagctt gcccctgggt ccgtcctggt tgtagttgag gtgggagccc tcccacgcga     29400
     ggtcgaccca attttccccc tttaaaaaaa aacacgtcat tctaattgcc catacaaaaa     29460
     tgaaaataaa ctcaccacgc aaaagtcccc tcgcgacgtc gtctccttga cgtactcctc     29520
     ggtgtactcc ggcgcgtacc cgcggacgaa atcgaacctg aacccgccga acccgacgtc     29580
     ccagcgtagc cacctgagcc atcgcttcag ggtggcgcgc agctcgtcgt tggcgtggtc     29640
     caggtccggc gcggcgtcgt agttatcgcc cgagtcctcg tggccgctcc cgtggaacgc     29700
     cgggtcgttg caggtgatca tgtgccggcc ccagtgcacg gcggtgcccg tgtggtccac     29760
     ctcgtcgctg tacacgttgt acaccccctc cggcccgatc tcgtccgcgg tgcggtggtt     29820
     gatgacgacg tcgcacacgg gcatgattcc agcctcgcga agcgacgcgt tgagagccac     29880
     gagttcgttt tggtcgccgt actcgctcga atccaagttc cacaggtgcc tggggaggta     29940
     cccctcgggt gagacggagt gcgacggtgg gggcagccag aggtgtgtca ccccggtggc     30000
     ggcgatgtcg gggaccatgc gcgtgagttg acgccaccac ccgcggtcgg gcgtcttgga     30060
     ggagacccag tcgaaccctt gcgccaggac gacgcctcgg tacccgtcgt ctaaattggc     30120
     aacctcttta aggagggact cggggactat gtcgtcgagc ggggcgttgg gtgcgtcgtg     30180
     gagcgcgagc acctcctgcg cgtcgtaggt cgccggggcg tagttctcac cgcgctgcgc     30240
     ggcgaggttt ggatcgtacc cgtacctgca gagagcgatg agagcgcgta aacatacgtt     30300
     cgcagttgct gtgaacagat gcgtaacatt acctgcagac gcactttttg gcgtcggctg     30360
     actttggcgt gtgccggcgc ctgcccgcgt gatccgccgg gtggccggtg aagacctcgt     30420
     acctcttcct cgcctcctcg tacatgtccg tcgtgggaag cggcggcgcg ggctcggcgg     30480
     tcgccggccg cggcccgtcg gtggtctcgt tccacccctt cagtccttcc tcgttcttct     30540
     ccaccgccgc gggctttccc tgcgcggcgg ctcggtcggc ggcggcgcgc ttcgcgccct     30600
     cgtacttggc gtagtgtatc gccgcgtcgt cctgcacctt ctcgatgtcg cccgcgaggc     30660
     gctcccacgc gaggtcgaaa gcggcgctcg gcctttcgaa cgcgcttccg gcggtcgggt     30720
     cgtggtcgga gcgctccagg gcctcgtcga agctcgagct cgagccctcc tggccccgac     30780
     gacggacgcg ctcggcgaag gtgtcgcgcg gagagtctcg cgcgggttcg ggagtatcga     30840
     catcgcggcc gacgtcgcgt cgaagcagct cggtcggatc gccgccgccg cgctcgactt     30900
     cctcgatgat ggcctcggct cgctcgtcga ggtccccgcg ggtcgtgtcg ccgtcggttt     30960
     cctcggcgcg agcgggcgcg agccggggag ggggcgcgac gcgaacgacg cgggagcggc     31020
     ggcgcgcgat gagaacgacg ccgcgcgcac gaccgcgcga gggcccgaag gtggatcgcg     31080
     aggatacgag cgcggtggcg agcatgccgg ggcacgggcg cgttgctttg tgagccacga     31140
     cttcttctcg gacggtgagg aaaacacgag acaggaacaa cttcatccac aacttcacca     31200
     aaaagcgagc tatcataagg ttctcaggcc acctcgatgc agtccgcctg caacctcccg     31260
     cacatcgtcg gttccccgat cgtcgcctca gacagtccca ccaggtccgc cttgtacgtc     31320
     ttggtgacct tgaagctcag cttaccgtcg ctcagcacgt ggccgctctt gctgcccctg     31380
     gcgtgtttca cctctgcgaa cagtttcccc tttggtatgt gatacccacc ctcggccacc     31440
     tcgatcctgt tgcagtcgaa ggagaggagc atgtacggat acaggggctc ctcgaacagg     31500
     ccccagatcc acagcccagc cttgcgctcg ttcggatcct gcgtaaacgg aacgtcgcgt     31560
     cagttttttg gcaaacgcgt cgcgggaacg gttttcgcga ctgcggcggg gtgggtcgac     31620
     gcacctcggc cagggtccac ctgtggaaac cagcctgcac gaacgccagt tcttgatcat     31680
     cctcaatctc gatagacccc tgcggcggtt catatccctc gtcgacgacg aacctggccc     31740
     tgacggtgat ggtcctatcc ggcgtcgtgg cgtcggcatc cttgccggag aagagctcca     31800
     gcctgagtcg ccacagggac ttggagtcta tgctcggcgt gcccgcctcg ggcttgccgt     31860
     tgtcctcctt ggatgcggcg cggacgcgaa acgaccggcg tgcccgcgac cggcgtgttc     31920
     gcgacaccat cgcgccgccg gttcgagcgg acgccaccct ggcggtgccg atcggtgccg     31980
     tcgccatctt atctgtccac gtgatgaacc tcgccgcgcg tctcctgggc tcaagcgatg     32040
     gactcgacac tatctattcg ggcggaatgc actgtggtac cacgcggacg accagcggcg     32100
     aggctcgtgc cggtcctcgc gcgctcgagt gtggatctct cggcgatcgt tttagcgact     32160
     attttatcca ggtcagcaca ctctggctgg ctggcggcga aaggaggtgg aagacttttc     32220
     ggctgcgaag gatggacgtc gcggcagaga acgagctcta tcgtcgcatg actcatcact     32280
     acgtcatcat atgtctacgg cggctctcat cgcctgttgc tgtagaggtc gcggagcacc     32340
     ttatcgatcc tctcaacctc cccgcggaac tcaaactcgg gggacgagga ccggccctct     32400
     ccgtccctcg gaggcgtgtt cctcgccagc gtcaccagcc tgtccatggg cgacccaagc     32460
     ccgtctttct cctccgggga gtagaacccg acgagttcgg tggcgtcgtc cctcagggcc     32520
     gtgggcgcga tcggggtggt acgttcctcc gggtcttgag gcgagttcag agcctccctc     32580
     acctccttcg gcagctcctc gaattccggc atgggctccg gcgttcccag cggattgatc     32640
     gccccggggg acggtttggg agccgcgtcg gggctcagat ccgcggcagg cggctccggc     32700
     ctcgtctcgt ccgcctcgga ctccgaggag ctcagctcgt agtcggcgct gtctccgtcg     32760
     tcgccgtcgt cgatccgagc cgaaccgtcg tccacgtccc aacgcacccg cgcccggtga     32820
     gtcaccgccc ggtgagtcac cgcccggtga gtcaccgccc cggcccccga cgccggcgcc     32880
     gatacccgcc tccgccccga cccgacctcc cgcgtcggaa ccaacacccg cctccccccg     32940
     ccggctttca tcgccaaggc tccgaccgac ctggcgatct tgcgcggagt gttggcgtcg     33000
     gcgccgaagg cggcgatgga atcggtgatg tccgacaacg cctgcgagtg tcgagccaat     33060
     cggctggacc ccggcggcgc ctcccgcgcc ccgcgacgct cccaccttgc gtgcgactcg     33120
     gcgtcgtcat cgggagaggt ggcgacgtcc ttctcggcgg tgacgtcctc ggcggcgacg     33180
     tcctccttgg cggtgacgtt ctcggcggcg acgtcctcgg cggcggcctt ctcggacgcc     33240
     ccatcatgtt tcgtcccttc gttctcgccg ccttcgttcc ggtgtctcct ccgtcgcgct     33300
     cgagccaggg gactcggggt gagtggtacc ccgccgaggc cgttcgccct cgcgacgtcc     33360
     acggcgcgct ggtgtcgcac aacccctcga agcgccctcg cggtgaacgc gcgctccctg     33420
     ttacgccgac ccgccagcgc gagcgccgcc cactccgcca gcagccgcga cgccagtctc     33480
     cgggcccagt gccccagcgc gcgaaggttt tcatccctga cgacgacgta ccaccgctcg     33540
     atgagacgct tgcgacgctg atcgtccgcg atgcggcgaa tccacgcgtc gcgcttgacc     33600
     agcctcgtca tcgccgccaa caccgtctcg gagaactcgc gcctccgcgt gagcgacgcc     33660
     cagcagttga gaatcctgca cgcgacgtca tccgccctct ccgcctttcg cgaccggacg     33720
     agctcctcga gccgttccct cgcgcggatc gcgactcgcc aaccgagcat cgcggtcttc     33780
     accgcgcggt acccgtcgtg cctctgggct gcggccaaat cgctccactc cttgaccacc     33840
     cgcctcttca accgggtctc gcgccaccgg ttcgcggaag attcaatcgc gacggcgctc     33900
     cactccctca gcgccgccgc cgccgtcccc cggcgcttac ccgaatacgc caggtccgcc     33960
     atgaccctcg cgcccgcctt ctgcgcgcac aagtcgcgcc agtgcgtgaa ccccgcctgc     34020
     cacttacgat gcgtccaccc gaagagcgcc ttcgtggcga cggccacctt cttcctgtcc     34080
     agatcagcgc cgcgccgcgc ttttaccctc cacttggacg cgcacgccct cgccagcctc     34140
     gccgtcgccg ccgtttgccg ccacgctcgg agtcggtgac gcgtcatccg cgagatcgcc     34200
     ttgcgcgcgt gcttgtcctc catgagcgcc ctccgctcag cctcggcgtg ggcagccttg     34260
     gccgccgcct gcgccatcat cctcgccgcg tccgtcaccg cattgggcga cgcgctctcg     34320
     tccagcgcgc gaatcaccgc ggcaatctcc cgtacccttc ggtcgctttg acccaggttt     34380
     gtcgtcgtcc ctaaaccctg ggtgtcgtcg tcgaaggatg cgtccataca cgtccccgcg     34440
     ccgcctgcgt cgtcctcggg gtccacagac gcgtccaacc cgtcgcctcg cgtcgccgcg     34500
     acgtatcgag cccgcggcga tttggcctcc agacgacgaa gccgacgggc gtcgacgagc     34560
     accgtcgcgg cgagcgccga cttacgcctg gcggcagagc gttcggacag cgccctggcc     34620
     tttgcggccc tcgtcgcggc cgtgccgtac cgcgccgggg acggcgtgaa ccgggtcggg     34680
     tccctgtgtc cgacgggttt ccgacatgcg tccgacaggt ttcgcatgcg cgacggcggc     34740
     gacgacgcga cgtcgaaggc gacccgacgt ccgcccgatc ggtttccgga tacgttcgat     34800
     cggtcgggtc ccgatcgggt ggacgtcgcg ggggagaagg ccggcgcgac cgtctccatg     34860
     aactccgcag ccatcacctc gtccccgtcc gacctgatcc tgtccaccag cgacaacgta     34920
     ccccctattg ggggcggcag cttggagggc tcgaaccgcg ggtgcctcct cctcggtaaa     34980
     aactcgggcg tctgacgctt cgccggcgag gacccgggtt tgttcggctc gggcgtcggc     35040
     tcgggcgttg gctcggggtg gacccgtggc atcgccgcgg atatcctcat cggcgcgggc     35100
     gcgggcgtct ccgtcgggtc ctccgccggt tccgatggaa cgctccggac tgctccggac     35160
     cgctccggag tcccaaggtc aaccgcctcg ggggaaccgt caaacagaaa cgccgacggc     35220
     gtcgggccgg acgaaccgtt gccgccgtcc cgcccggaac cgttcccgcc cagaaccgtt     35280
     cccgccgttc gcgtcgatac cggcgtcgga gagggcgcct ccgggtctgg agatttcggg     35340
     aacggctgcc cggtgacgcg ctcgtaaaac tccgtgtggc tctccgactg gtgactggtc     35400
     gccgagccgg gggtccgcgc gcgcgcccgg gcgacaccgc cgggggacgg cgacggtcgc     35460
     acgtacgtgg acctgaaccc cgcgaacgcc ggcgacgtac ccgacgcgtc accagtcgcg     35520
     ggtcggtcat catcggtcac cgcattaaac cgccccgacc cgctcggggt ggcgacgatt     35580
     ggcgtgttgg gaaaccgtcc cccgtcgtcg tccctgctcg cgtcttcctc ggcccgctcc     35640
     ggcgagctct cgcccgcgga tacgtcgcag aggatgctgg tgtcctccgg gggcgggccc     35700
     tgcgacgggc tggtcacgcg cgagaggagc acgggcatga cgcggtacct cctccccgga     35760
     gatgcggtcc tctccacgtc cgcgccgggg tgcgcggtcg ggggcaggaa caccgatgag     35820
     gtgtatccct cgcgcttgag gatggcacgc ggggcttccg ggttcttcgg tgacgccctg     35880
     gcgctggcca gcacgtcagc gacgcgcttg ctcgcgccgt cgccccgggg atgcgccgac     35940
     tcgtacaccc cccacgcgtc gccgcgggga cggggcgcct cgatccgacg aagcctctgt     36000
     cgctccacct gcgctctgta agcggcgccg cctccgccct ttggtacgcc cttgagcgca     36060
     tctgacttgg gcggggggtc cggttcgtcg cgccgcttcc ccaacgaggc atcgcgcagc     36120
     ctacgtcgca gcatcgggct ccgtcggcgc gatgtacctt ccgggtgctg cttttttcaa     36180
     tgcgtgccgt ccaccatggc tgacgcgtat cctgcgcggc ccgggagatg cgcactacgc     36240
     caacgacggt cccgcccgcc tctcgtgtat cgggtacctc ggacgcgcga ccttctcgcg     36300
     caccctcggc tccctatcag aactggcgag gcggtcgacc cgatggttca tttaaacctc     36360
     cgagggaaca gctcgcaacg gctaaaacgc aaaagagtca tcctcaacgc caaaatcaag     36420
     ttttacttca ccgccgtcgc gcgcatcacc ttcccttcgg cttcttaggc cccaagccga     36480
     ccacctggaa acccttcccg ctcaccttcc tcacctcagg gaagctcatg ttgttcccct     36540
     tcttcgcccc cttcttcttg ctcgccttca ccaccagcgc gcggcggcac acgaagacgt     36600
     tctcgccatc cttctcgtgc ttcttgtgat ccgccgcctt gaactcctcc ggagatagga     36660
     tggtcgcctt gccctcgatg gactggatcg ggttggcgtt cacggtggtg cacaggaaca     36720
     cctcgttggg cgcgcacttc atctccttcc acgtcccccc gtcgaccatg ttcttgacgt     36780
     ctccggctcg ttcgagccac acgcagtcca cgtactgccc cgagtcgtct gcgaagacgc     36840
     tgtcgatttg cgccaggtac atgtcctcgc tcgggtcgcc cggcatggcg tacacgcagt     36900
     cgcccgtgtt gtagacgagc ctgtggatct taccagcctt gttgatgatc gtctggaatc     36960
     cgtcgtagta cgtcctgttg cggtagacgc cccctttccg aggggcgccg atgaacttga     37020
     tcttcgaggt gatgttcccc gggtccacgt ccaggatttc ctcctccgac tcggactccg     37080
     actgcggctg gggcgtcggt gcgcgcgccg ccgccttggg ctcggagggt ttcgaagcct     37140
     tggccttggc cttggccttg ggccccggct ttcgcgactc ggccggcgcc gtctttcgcc     37200
     tcttcttgtc gccccccatc ttgctgacgc gatcttcgtg ctcgtcgttc gtgtccccca     37260
     ggtggtgctt gccccggccg cggccgcccg cgggtttctc ttccctccac gcgaccacgt     37320
     cgtccacgag gtcgcggccg aggcgcgggt cgggatcgaa ctccgcgctg acaccgcact     37380
     cgacgcgacg ggggaggggc cagccgatca tctcgtagaa tccgctcgtc accttgaagt     37440
     gctgcttggc ctgcgagagc gcggtcttga ccatatcggg gttgatcttc ttgccgtcaa     37500
     acgccgtggc gatccaatcg ttcgcggggg gcacctgcgc ggcggcgatc acgtccgcgg     37560
     ctgggatacg atgggggacg ggcgggtgag tcgtggtggc gggaaaactt cgtttgaacg     37620
     aggggcgctt ttcgtcgggg tctcacgtgt gatgccgttg ccgtcgttca tgatgaggcg     37680
     ggaggcgatg acgacgagca cgtcggtctt ggggtccccg ggggtggcgc agagcttggc     37740
     catcgccccc ttgagcttgg ccatcgccga tgggcccgcg gctccgacca gacccatgtc     37800
     gctgcgcact tcttctgatg aggcgaacaa actctcgcga gacgcgattg gtatccgatt     37860
     ccaaaatcga cagccagacg gaaagctaac gactgctcgc ccggttcccc accccctcaa     37920
     agcagcaccc tctcccactc gttcgtcccg tccgtcgtcc gtcgcagctc ccacgtgggc     37980
     cagtagtgca ggtccagctt caccgtgagc accttgggcc gaccgttcag ggcgatgagc     38040
     ttgagccgaa caaacgcgcc atcctccagc gccttcgtcg cctcgacgaa cgagtccagc     38100
     gtcggcgtcg gagttccgtt gacgctcgcc acccaattga gcgcgtacag cccgtacctc     38160
     tgcgcggggg atccgtggta ccaccggctg atgaacacgt ccaggtgcgc gcccgtcgcc     38220
     gggtccgtcg gccgaaaccc gagctccgcg acgggcctgt gcgtgggctg aagctgcgcc     38280
     ccggcccagt gcagcagacg accggtgccc gcgcacaact cctccgacag ctcgcacgtc     38340
     acgtccacca cctcgccctt cctcaggacc cttaggggca gcggcgcgcc ggtcttacac     38400
     acccggaccg cgcgctcgac gccgcgaaag gacaccacgg gttcgccccc cgcggccaac     38460
     accacgtcgc cgcctttcaa cgcctttgaa gcgccggtgt cggcgacgac gctggcgacg     38520
     gtgagcgcct gcctgcgaac cgggtccgcg cgcatcaatc gctcgaccca cgcgtttggt     38580
     acgccgtggt cgctcgcctt tgcgagctgg agcacgtcga attcggcgtc caggagccgg     38640
     acggaacccg cgcccctctt gcccttttcg cgccagcgga gcacctcgtc cctggcgtcg     38700
     atgaccggcg ccaccggtaa accacgcacc atgtctcgaa cctccccgtt cacgggcttg     38760
     gcgtacgacg cccacagcgc caccatgcga gactcaaagt cggtcaacac tccaccgaag     38820
     ttgtacccaa agtccatgtc cagcgtgatg acctcctcgt tgacggcgcg aaaccgggga     38880
     atgtcggcgg atggaatcgc cgccaccgac gtggcatccg tcaccgccga cacccgcgcc     38940
     atcggtctca gctgcgcgga cagacccacg agtaccacct cgtcgccgcg ggttggcagg     39000
     gccgaatcgg gaggggcgaa cgcgatgggt ctgatcgatt cccgcgcgcg cctcgggagc     39060
     gccccggcgt cgtatgacac gacggcgaag ttgtgcgtcg ggtggaggta ctccaccttg     39120
     ccgccaatct cgcacggaaa cgcggcgaag gagacgagga tgtcgcaaga cgcgatggga     39180
     accgtgttcc ggtccaccac cacgagcccg aggccggtgt tcgggtcgtg gtggatcacc     39240
     gcgccggaac cttcgaacga tcgggagtac acgccgtcgg ctagcgcgac ggtggcgatg     39300
     tccacctgga cgatgcacag gctcggttcc accgccctgg cgacgccctc cgcgcgggtg     39360
     ccgttcgacc cgctcgtcgt cgaccccgct tcgacgacgg gtacatcggc cgggtcgtcg     39420
     tcgtcgtccc cttccttgtc gtccccctcc ctcgagtcgc cggaagcttt ccggcgcttc     39480
     ttggcgtctg gctcgatcgt ccctttgtcc ggtatcgtca ggagggtccg ctcccaccgg     39540
     ccggtgcgcc agctccgatc gtaaaacgcc ggcggcgggt accaccggct gttgaagtgg     39600
     agcagacccg tcttcgtcct gtgccgctcc gcgtggacaa agtactgcag acgcactcgc     39660
     gatccctctt cgagccgggc gtaggcgtta gcgaacgcgt ccaggtctgg ggtggggacg     39720
     ttgttcaggg acgtgatgat ggcgtgcttg gacagacccg ccaatcccag cacgtacccg     39780
     ggctccgcca cgtacaccga acccaccggg agctggaagt tcctagcctg ctggtagctc     39840
     agcgcgtgca cgacgccgcc gcaaacttcg agaaaccgcg acggggtgac gtcgtgcaag     39900
     ttcccgggcg tgattcgcag aaccacctcc tcgcccccgc gctccaccac aacctccagc     39960
     gtcgtgcaca cgttatcgtc gagcgttgcc tccagcgtca cgaagttggt cacgaattcg     40020
     ccccttattt tcacgagcac gtccccgact tccagcgccc cctcgcccgg tcccccgggc     40080
     gttgtatcct ccaccaccag cgcgcccgtc ccgcccgtcc catccgcggc gccgccctgc     40140
     gccgccctca gcgcagcctc cgtgtccacc ctgaggccca gcctgcggca ctcgtcgaaa     40200
     cccttgtacg cgaacgtcgt ctgcagcgta cccctcggga tgtccacgga gagccactcc     40260
     tcggcgccgg gggttaggtt caaagggttc aaagggttca aagggttcaa agggtctcgg     40320
     cctccgtctt ggccgccgtt tcgctccgtc tcgctcgggc acgcgtccct cagtaggttc     40380
     aaagccctca aaacacggtg caggggcagg taatacgccg ccgttccttt cgtcttgctc     40440
     ccggcgttga gcccgacggc tcggcccctc gcgtcgatga ccggtgatcc gctgctcccg     40500
     cccttggtgc cggacgcggc ttgaaggtaa aaggtgttga agtcgttgta ccccttgccc     40560
     gagtacttgg gtgcgtccct gtccagcctg gccaacgtgg cggacaggat cgagagcttc     40620
     tcgcccgagt cgttgcccac cacgcgaacc tccaggccga cctgcgccgc ctcgggcgcg     40680
     aggggcacct cggcgatgtc gtggaacctt aagagctctg ggtcgaagcg gaagaaggcg     40740
     aagtcgtgaa ccgggtcgca gtacagcgcg cggaggggta cctcctcacg gttctggaac     40800
     accgcctccg cgaccacggg ccccggtcgg aggacgtgcc ggttggtgag gatcagcccc     40860
     cgcgcggcgt cgacgacgaa gccggtggcg taggcggatc ccgcggactc cgtatcgaag     40920
     gagcgcacgc cggtcgtctt gatgaccacg accgcgcggc tcacgcgttt gaccgtcgcc     40980
     tgccactgcg cgctgtcgtt gatcggcgcg gcgtcatcct cgccgacgtc tccctcgtcg     41040
     acggcgctgt cgggaaggtc agccatgagc gatccgcgtc gagattgccg ggtggggcgc     41100
     cggggcgggc gggggctcgc tccggatctc gcggatgccg ccgggcgcgc ggggcgaaga     41160
     ctgaggcgat ccaatgaacc ccgcgccgtc gtgttcacgg ccggcaaggc gatgcccccg     41220
     ggcatgaagg aagtgggggc ctgaccaccc ctccggaaat cgtttgccct ttgtccacgc     41280
     agcacgaagt tttggagttg gagctgcaga gcgcgcgaca aaaggtttcc aacaacctcg     41340
     acgactacaa cctcaatact gatacctacg cgccaatccc tgctccgtcg ttccgtcccc     41400
     tcccccctcg aacgctccgg gtatgagtat gtcgtgcatg ggatacgccc gacgcaccag     41460
     cgccctgacg agctcggggt ccacccgcgg cacctccgcg ccgccgttgt cgccgccgcc     41520
     cccgtttcgc agcacgatga gcaaactcgc ctcgtcctcg tcgtcaatct cggcgctctc     41580
     gctgatctcg cccccgcgga agcacatctg accgcccccc aacagcctca gcgacgcccc     41640
     gatccgccca gcctccgcct cgcacgccgc gtcgagccga gcgtggtcgt tcaccgtggg     41700
     cgcgcctccg ccccccgtcg gcgagaatcg cagcaccgtg tgccgaccgc cggacttggt     41760
     cggcaggttc atctccacca cgcgaaaggc gaaggacctg ttggtggtgg gaacgagcgg     41820
     catctcgcgg tcgtccgtca tggccacgct gggcggaggg gcgggggaat cgggcgactc     41880
     gacgttgggc tcgtcgcacc accgctcgac caggtacctc gccagcgcgt gtcgccccgg     41940
     aagcgcaatc tcgcccacgg gaatctccct cccgcccccc tccctcgggt ccacgtgctt     42000
     accaagctgc gccctgagcc aatccctgtg gaaccagcgc gcgtccctga gctcggcgat     42060
     gtcgagcgtg ggggttggcg ggaagctcac ctcgcaagat ggcgcatatt cctcgctcgg     42120
     cgtattcatc gaacgggtgt cgcacacggc gtccgagacg gtgaccctct tcggcgccac     42180
     ctccgccctg aaccccacca tgagctggca cgggaacggc cacggctggg acgtgacgta     42240
     ccgcaccgtg ctcggatcga tcaccacccc gctctcctcc agcacctctc gcgccaccgc     42300
     ctgctccagg ctctcgctct gatcgacgaa accggcgagg cacgagtaaa acccccgggg     42360
     ccacttgctg ttcctgccca gcagggcgta gtctccgcag gtgcacaggg tgagcaccgc     42420
     gggcatgagg gtcgggtagt agggcgcgcg gcagtccgag tcggcgcact gcgccttgtg     42480
     cccggacttg acaatcttca cgggggatcc gcacttttgg caaaacctgg tgtttcgctg     42540
     ccacctgagg agcgatgcgg ccgccgcgag gagcccggcg tccttgcgag acatctccgg     42600
     acccaccgac ttggcatcct tcgcgacgat cgcctcgtcc acggcccccc gcccgacccg     42660
     gccgatcacc gccgggttcc tcgccaccgc ttctcggacg agggactcgc atcgcttcac     42720
     ctccgccgcg aacaccggcg ctccgtcctc ctccctgaac cccaagaagg acagcctctc     42780
     gaaagcgagc gggtcctcgt cgccctcgtc gccctcgccc tcgccgtcgg ccgagcgccg     42840
     cacgtccctc agtcgtacct ccgctggggc gaatcgtacc ccagggcggg agccgtcttc     42900
     gtccacggcc acgaccagcg cgcgtcccgc gacgaaggga agcaggatgg cccttcgatc     42960
     ccgagaagcc gcgaggatcg cctcggtgtc agcgcggagc tccgacgccc tgtcggcgtc     43020
     ggagagggcg aagaacggca ccccgtcgcc cccgtcgaag accgccgcgc gagccgcgaa     43080
     gttttcggca cgccgcgccc cgaaccgacg tgtggtcgaa cacgaaaccg ccgacgggcg     43140
     aggatcgacg gacgcgcggg gaacccggcg cgcgatatct ctcgcgcgtg acggcgcggg     43200
     agcgcgcgtc gacgacgccg cggctaaagc ctgcatcttc ccgcctcggg tcgccggctg     43260
     tggcggccgc ggaaccgtca tcttgctcat cttatcacaa aggcggctgg aaaatacagc     43320
     attcaaccaa aaaatcagtg cgcgacaacc tcaaacgccc tgtcgtcgtc gctgtcctcg     43380
     tcctcgtcct cgtcctcgct ctcgtcctcg tccatcgcct gcacgccgcc ggtcccgggt     43440
     atcgccgtcg cgtcgtcccc gtccccgtcc ccgtccctgg cgcgcttgcg actcggaacc     43500
     gtctcaacct cggagtcgtc agagcccgaa ccgtcggcat cctcctcctc ctcctcttcc     43560
     tcctcctcat cgtcgtcgtc gtcatcgccg tcgtcgtcgt cgtcatcgtc gtcgtcgtca     43620
     tcgtcgtcgt cgtcatcgtc gtcgtcgtcg tcgtcgtcga tacccgccgc gttgaaatcc     43680
     tcgtcctctt cgtcgctgtc ctcgtccgag tcgacgtcat cgagcatgtc cgccgcgccg     43740
     ccgccggctg tgcccccgtc ctcgtccccg tcctcgtcct cgccgcccgc ctcgctgcac     43800
     cgcttggcca ggtaccgctg cacctcctcg agctcctcgc ggctcacgtt cgcgaactcg     43860
     tgcggcggct cgcccccctc cggtgtgact ttcaggtcga aggtgccgct tccgccatcc     43920
     gcgcgttgca gctgcaggtc cgcaacgtcc tcccacggga gccacagcgc gggcctctcc     43980
     gcgaacgcca acccgtcgtc gaacatgaac aggtgcccct ggttgaactt gtggttggcc     44040
     ttgacgcacc cgcgaccgcc gacgccggcg aagacccgat ccgtcttggg caccgcgcag     44100
     cgcttgccgt cggcgcacaa accgaagaat aactcgacga gcgcggccat cgcgttcgcc     44160
     gggttcggcg ccccggtcga accgggcggc tggtctcgca gacgcgcctc gtaaacgtcg     44220
     cggcccgggc aagggccgtt ggcgtccagg aactgaaccg tcgcgggcgc gtccttaccg     44280
     cggacctgcg cgaggagcgt tcgcatcttt tgcttccccg cgacgagggc gtggttcgga     44340
     tcgatggcga ccatgaggtg ggtggtgttg ttgctgtcgc cgacgtccag gcgcattgcg     44400
     cgtcggacgt gctgaggtcg caccgcgtac gccgtgactc ccttgggcgt gcgctgctcc     44460
     aggacgcacc gcccgtcgcc gagcagcttg cactcgaact ttccccgcgg tgtgctgaac     44520
     gagatcggcg tcgaggactt gcacaccacg tcgctctcct tgtagtccac ggccggaacc     44580
     gcgggacccg caccgttggc ggtgggcttg gcgactccgt tggcggtggg cttggccgcg     44640
     agcgcggcgg cgaccgggat gagctgcgag gcggtcgcgg agatcggcac cgtcgagctg     44700
     ccgccgctcg ccgcctgctt cagcgccgcg acgaccgccg cgagggacgc gcacgcggcg     44760
     ggatcggcgg cgatcgcaac ctcgagcgcg gcgagttcct tggagtccaa cgacatctcg     44820
     accggcgccc tctgttgtgt ggcgtcgccg gagcgtcgcg tgtcggtttt ttaaaatcgg     44880
     cccaaggcgg aggcaggtct gccagagagc cccggatcat cggcgtctag tcgtggaacc     44940
     ttttgcagag tgtaccgtga gagagattat ataatgaaaa caacttgtgg tgctaatgta     45000
     ccgcgcgcgg cgagggaagg cggggcgcga ctgtcgcgtc ccgcgccccc gtcctccccg     45060
     aactcctcgc gccgagcgac gcctcctctc atcactcggt ggcttttccg tcgaggaaag     45120
     cggagagaaa cttgctctgc ggcttacccg atttcgacct ccggttgatg gcgttgctct     45180
     ccggggcgac gtacttggtg atgaggtgat gcctctggaa gtggtgcgcc agcacggtca     45240
     ccagctcctg gttagccttg aagagcatga cgtcgatgac acgatggtcg tccgtgcggt     45300
     gcctgcgcca ctcgtttgcg agctgagacc ggaacttagc tgtcgtggtc acctcctcca     45360
     ggaagaactc gcgcatggcc cacggcacct ggcggcacac ctgcgaacgc gacgggggaa     45420
     aaaaaggagg gaacctcggg gtcagcgctg gggtccgggg tgacgcggat cccgcgaggg     45480
     cgccgcgtgg ggggcctttg gctagaaaat aatccgggtt gggtggcgag ggtttcgtcc     45540
     gctcggggcg acgggggcgc gatcgtcgcg ggggtcggtc actcacgtcg cggaaaaact     45600
     gcctcgatcg cgccttggcc tccgtcaggt ccgcggaaaa cacgggagcg cccgcgggtt     45660
     tgctcaggag gtcgctcctg gcgagcctgg cgagcgacga gcgcagcgcc atttcccctc     45720
     tctgccctct cccctcgctg tgtcaccctc cggcttgtcg acgggagggg tcgctcggtc     45780
     gcttcgccga gcccgccgcg cgtgggtttc gctccctcgg cgcggtaagg acgcctctgg     45840
     atgtggcgac ccgggggttt cacgcgacga tgcgactcgg ccgctacgcc tgctcggctc     45900
     cgtgtgaccg cgcccccggg ggattttatt ggctggtcca ccaagacgat ctcatcggtg     45960
     cggttcgaca tcagcagcga tcaggggagc tctggggtgc ggagaggacg ggcgcgctca     46020
     cacgcagcgt cgcacgtccg gtgccgcccg agcacgcgcg gacaccatga gtcagggatg     46080
     ggctcagcag ccgcagcagg tgcgacgata ccccgagcgc ccgatacccg cccccgcatc     46140
     ccggtgcccg cgggtcgcac taacacttaa ccgttgttgt tcccgttcgc gacctaaatc     46200
     ctcctcgcct ccccgtcccg acccagggct acggcgggcc agccggcgag tactacagcc     46260
     cgaacccgac gcccatgccc gcgtataatc ccgcggccgg tcccgggcag gacgtgcact     46320
     accgcggcgg cggggcgggc gccaacgcgg gtccgatggg cgggccgggc ggcgggatgg     46380
     acggcttcgg catcccgggt ggcatcccga tctcgccaaa gtccctcgcg cgggtgggtt     46440
     tcggcgcgta cggggacaag gtcctcggcg ccggccaggc gtactacgcc aagtacttcg     46500
     gcggcggcgc ggcgaggtac tacttcgacg tcaccgaggc gtacgtgtgg aacaagctca     46560
     agctggtggc gtgcccgttt cttcacaagg gatcgtgggc gaggatcccc gagcaggtgg     46620
     ccggcggctt gacgttcaag cccccgagga acgacatcaa cgccccggac ctgtacatac     46680
     ccctgatggg cttctggtcg tacgtcctcg cggcgtcgac gctgcaggtg cggcgcgggg     46740
     agttcacgcc cgagggtgtc gccgttcacg cgagctgggg cgccgccctc tgggcggctg     46800
     aggcggtgtt cgtgtgggcg gcgctgagga gcctgtcgtc gtcgcacaac cacatcagcg     46860
     cgccgatgat ggacctcgcg gcgtacaccg ggtacgcgtt cgtcctcgtc gccgcggcgc     46920
     tggcgacgaa gatcctcaac ctcccgggct ggacgcacct cctctctggc ggatggggcg     46980
     ctctcgcgtc cgcggtgttc atggtgaaga cgaccaagcg gatcatcttc agcgaggcga     47040
     ggtcgcacgg gttcgacgga aacaggcaca actacgtgct gctgatgctg gcggggctgc     47100
     agttcccgct gcacttctgg ctgggcagcg tataggtgag accctcgaga ctgctcgcgg     47160
     tttttatctc gcggtttttt tttcgtctcg gtttttggtc ctctcggttg cgcccgcggg     47220
     gggttaagaa gcacgggcgc tgagagctca ccggcgcctg cggcgatact gccccccgaa     47280
     atcagacagg attatgtttc ttgagcgatg gcaaaacgac ggccactcgc ttgtaaaagg     47340
     cggtccgaca tttcacccga cgttttcact cgcctcgcgc tcgacggctg acgagatcca     47400
     accgcattcg caggcgcgcg atccagacga cgcatcgtga gttagcattg gtggtcgaat     47460
     cacgagtcaa aacgcagcct actggaccgt ctcaagcctt gaccttcttc ttcgatttct     47520
     tccccctgac ctcctcaccc gccctcttag ccttctccgc ctttttcgcc ttctccgcct     47580
     tcttggcctt cgccgcctcc gccgctcgcc tctcctccgc gcgctcccgc gcctggatcg     47640
     acatcctcct cagcctggcc acctctgcgc gcagacccac gttgacgcca aactccctcg     47700
     tctcgcagaa gtgcctgcga agggtctggg ccaatcgatc gcgttcatcg gccggagttc     47760
     tctccgccgc gattattctc gcgagttcgt cccccggcgt cagcacgttc gcctcgcccc     47820
     cccggctcgt ctggcggtcc agcaccgacg tcctcgccct cttacccacc tttgggggcg     47880
     ggatggcggg cctaaagtcc ccccgcgtcg tggagtgaag cctcgcgagc tccgcggggg     47940
     cgtgactgcc cagcgcgggg ggcaccgcgc ccgcgagcgg catcctcgcc acctcatccg     48000
     ccgccgccgc caccgccggg tggtagtggt gcctcagcag cgccaggtcc cacagcaccg     48060
     ccgcgagccc caccgcggac tccgggtcgt cgacggcagg gttgaacacg ccggtgccca     48120
     cgcgctcgtt ctcgagcaga caccgggtgc ggggatacgc ggcgaggagc tgccgcgaaa     48180
     ccccgagcgc ccccacggct tcccccggtt cggcgcagag cgcggcgccc gcgagcctct     48240
     tggcgaacgc cgcgacgcgt ccctggtcga cgtgggagta tcccccgagg aagcgctgga     48300
     gggcgcggat gcgcagggtg ccgcggtcgg cggaagatga accgtcacaa gatgagccgt     48360
     cgcgcttgtc ggagcccccc catcccgacg aaccggacga gggttggccc agcatggcgt     48420
     acagctgtcg gtgaaactcg ccggtgtcaa cctgcagcgc ctcgccgtgg ccgctgagga     48480
     cctcgcacgc ggtgagtaga catcgcgcct tctgctccgt gctcaacgcg tcgcccgcga     48540
     ggagctggcg gaacacctcc atgagatccg ccatgaacgt cacgctgatg aggtgcgtga     48600
     acttgccgag gcccaccagc gccggggtca tgagcggcaa cccgcgagcc gggttggcgc     48660
     cggcggcgtt cttgagaacc ctgaaataca tctcgaacgt cgcctccagc atccgggact     48720
     gcatcttctt cttctgcgcg ttgtccatgc gccccgacgc ctcgcccatg tcccgctcga     48780
     gctgagcctc gaggtcctcc tcctccgagt ccgagtcgtc gcggtgaccg aaggacttca     48840
     tgcgctcctt ctcagccttt cgcttctcct tctccgcgcg agccttgcgg atcatctccc     48900
     gctcgtccgc gcgtttcttc ctgttttgct tcctggagag aacctccggg gctttctgcg     48960
     cctccagcgc gaggataccc tcgtcgaacc taatctcgag gaaaggcgac agcgccgccg     49020
     ggtggcagca gcacctgttc tgcttcacca gctgcgccac catgtgaagc gcctcgaggg     49080
     tggtgtcgcc ctgcatgtcc gccttgatgg cgttggcgat ggagccggcg acggcgtcgg     49140
     ccgcggcgct gtccacgtgg ctcaggtggg gcacgagcgc cgacaggacg tcggtgcggt     49200
     agttgaagtg cggcagcgat tccagcaaga cgcacaggca cctgagcgcg gtggccgagt     49260
     ccggtccgcc cttcccgcgc tgcgaccggc tcttcccctt gcccccgccg caccgcacca     49320
     gcactcggac gaagtttccg tacgtcttca gcagccccgc ctcgaagtcc cgcagcttct     49380
     gcgtctcctt gctcaccttc atcgccagct ccttcggcgt gggcggtcgg atccggtacc     49440
     ccgggcacac gtctttaaac acgagcacca tggagagcgc cgcgaggcgc gcgatttgcc     49500
     cgtccctgtc ctcgcacagc ttgcacacct ccctcaggtc cgcccacttg ccctccgggt     49560
     cctccatgac cccttggcac gtcgcgccga ctcgagcctt gaccgactcg cggcgctcat     49620
     ccgcggacat ctcctcctcg agcgcggcgg cggctctcgc ctggctcagt ctcgcgcgcg     49680
     ccgcggggtc catgtcgtcc tcggagtcgc cgtcgtcgcc ctcgtcgtcg ccctcgtcgt     49740
     cgtcgtcgcc ctcgccgtcc ttcttcttgt cccaccactt gtcggtggtt agcttttgcc     49800
     ggtactcagt cttgcccagc tcgttggcga gttgctcggc tttccgagcc ttcttcccct     49860
     tcttggcgcc cgcttcggac gcgtcgagtg ccttggactc cttctcgtgc ctgtcccact     49920
     cctccctggc cttcttgagc gcggcgcgcg cggcgggggt gatgttgtgc atgttatcgt     49980
     ccacccccgc gccctcgatg ggcgccggcg cggtgggcgc gtggatcacg gtgccgtcca     50040
     accgcttgac cgggagcgcg agcgtcttcg gggcgtcgtc ctcgccgttc tcggcgcggg     50100
     aagccaccgt tcgcggcgcg cgctcgtatt ccgcggtgac gtcgtcctca tccggcccct     50160
     tcttccttcg cttcgtggtc gccacgcgga tgccctcgac ttcgagcctc tcgccgaaaa     50220
     aggcgccgta gccgcgatgg gacttgacga aggcgacgtc gtcgtcgtcg gggacgagct     50280
     cgtcgtcgcc atcgcccggg gcggccaggg gaagctcccc cttgctcctc ttattcctct     50340
     ttcccatcgc gcctcgtctc ggagccgcgt gcgccgggtt ctgaagtggc ggcggcggcg     50400
     gcggtttttc agcggttttt tcagcggcgg tggcgctccc gtctgatgcg gacaccagag     50460
     cagcgagtcg tcagaggcac ggggcgggca ccgatggcgg aagggagcga cgatcccttc     50520
     cccgagggcc tcctcgccca cgcggagctt cagctccggc gggcgtacga acactcggcg     50580
     ttcgagcgcg cgcgggaggt tgccgaccgc accggcggcg gcggcgccgc gtccacctcc     50640
     gatggccccg ccgacgtcgc ggcgttggac cctccgtcgc caaatgacgg catcgtcgcc     50700
     gcgctcgacg cgctccgtcg gatcgccgtc gagtccgcgg cgcgcgccgg cgcgcacgcg     50760
     aacgagggca aggatgacgc cgccgacgcc aaacgtcgac gaaagggcga ggcggggacg     50820
     gcggaggcgg gcgggagcga cggcgggggg gacgcgacga ggcgcgggag acatcgccat     50880
     ctcgccaaga gcgcccccgc gaggttcaac cgcgacgtgc gctccctgac gaccgcactg     50940
     cgcggggact ggaccactgc gtacgagctg atcgtggcga ggacgatcga cgcgtcgcgc     51000
     gcggtggcgc gagcggagtc gcacgcggcg cgcagcgcgt ggaggagaga aaccatcgtc     51060
     tcgcgacacc gcgagctccg agcgacggtg gcggcgagtg ggagtcgccc accgcccggt     51120
     gagtcaccgc ccggtgagtc accgccggtg agcgacgcgg acgcgcgttg gcgactcgcc     51180
     gtctcctccg gggggctcga ggcgtacgcg gaggctgcgg aggaggtggg taaccgcgcg     51240
     tgggtggtgg acgcccttcg atggtgcgcg gggacggcga tggatttcat cctcggcggc     51300
     ggcgcggaat ccttcgccgt caggtccgcg cgtcgatcgc actacgagag tttaggaacg     51360
     aggatgtcgg acgaggagga ggcgacgatg cgcgcggcgc tgcgcgatcg atggcatcga     51420
     agggcgccgg tgcgcggtga ctcaccggtc ggcggtgact cactcacggg tgataaaccg     51480
     acgctgatcg acgtcgggtc gtgctgggac tacttccgtc ggcacgagga cgtcttcgac     51540
     gtgctcgcgc tcgacctcga gcccaggcgc ccgaccgtgc tccgctgcga ctttctgaac     51600
     gtgcggatcg gcgaccccgg gctggaggat gctgacgtgg acgctggcgt ggacgctgac     51660
     gtggacggtg cgctgcgttt cctgccgcgg aacgcggcgg gcgcggtggt gatgtctctg     51720
     gtgttatcgt acgtgccgac gccgaggcaa cgcggggaga tggtgcgtcg cgcgagggag     51780
     gttttgatgg acgacggccg cggcgtgctc ctgatcgtga ccccgcactc caccgataaa     51840
     ggtcactgcg cgcacaaggc tcttcccgtg ctgaaggagt ggagagcgtc gatcgagtcg     51900
     atgggctttg agcgggtcaa gtacgagcgg gctcgaagcg tgcactgcct cgcgttcagg     51960
     accgtcgggg agggaccggg gacgaaaaag gcgggcgagg cgccgcccgt gcgcatagcc     52020
     ttcgatggac cggactggga gaccaagtcg tgattcatca cagtttatgt atgatggagt     52080
     agccggctcg cgagtcgacg ctaaaaaacg ccgctaaaaa acgcctctca cttatgcggc     52140
     gtgttctgcg cgcttcgagc cctgtaccgc gctcctccct ccttgaactt ggccgccgcc     52200
     tcgatcacca gcatccccac gtcctgcttc tcccctcgca gcgccctcgc cgcgaacacc     52260
     gacgcggacg acggcatgag cgagatgtcc tccagccgcc tctcctccgc cgggtcagcc     52320
     gccgggccgg agccgcccgc gcccggggtg ggcggcacct cggacgccca cggcctgtgc     52380
     ggcaacgggg acggcggcgg cggcgtgaac gcgaacatct tacgcttctc gaccggcgga     52440
     ggcggcggcg tgggagcgtc gtccgagtcg accgccaccc cgcccttgat ggagtccagc     52500
     tttcgctcca gcgtcgccag ccgcgactcc acggactcgg ctacccgccc ggggtagaac     52560
     ccgatgtcgc tctcgtgaaa ctcgcccccg gccgtcatcg agttcctcgg ggtcagaaac     52620
     gtccgcccgg ttctcgccgc gaggatgacg tccgcggcgt ccctgaaggg cattcgggtc     52680
     acctggcaca gttccagcgc cgacatcacc gtcaggtgcc ggcgctcaat cttcagcgcc     52740
     gtgagcgaac ttatgtggcg atgcatgttg atgttgacga ggagatccac gaggtcccgc     52800
     gcgcccggag tggacgtctg ctgcttgagc gtgatggttc gaacgagctg cctggtcctg     52860
     cggccgcgga acagcttctg cgccaccaga gcgccccgcc acagcctctt gaagtattcg     52920
     gggttctccc tgcgaaggag cttgagcctg tgagactccg ccagcgacgc gagcccggcg     52980
     ccgtgaaccc cgaggaggcg gttcatcgcc gtgaccccgc cctcagtgct cacgctgctt     53040
     cgcaccgccc tggcgtagtg gatgatcgcc tccctgaata tgatcctgac caccatccgc     53100
     ctcatgtttc gagccaccct cgggaactcg ttgacaacct gaaggagcga gtcgcgctcg     53160
     aggcacagga cgacgcagtg cgaaagcgtt atcgcgggtg cgcacgcgtt ggcgaggccc     53220
     accgcggtgg tcttgtatat cctctccacc ccgagcaagg cgcccgtctc ctgtatcact     53280
     ccccggtgcg ccacgaggcc cttctccact atgaacaggc agtctcgctt catcgggttg     53340
     gccatgaggt cctcgtgcgg cgacagcacc aggctcgaca ggtgcgccga gagcagcccg     53400
     ggtaaccgct tcgggcagtc cctgaagatg ggcatggcgt gcacccaccg cccgaacacc     53460
     tcctccgcga cgtccagcct gagcgagtcc gacatcaggt gcatcacgtt ggaccactcc     53520
     accatcgcgc gcgagttgcg acggaaccga aagtaatccc tcagctttat ccgcaggtcc     53580
     tgggtcaacc ctttttcccg catgaacctg ttcagctcgt ccatctgccg gtagaacatg     53640
     ttgctggact cgtccacgtt ggtgatgacg gagcagacgc tgcccagcag gtacgcgtac     53700
     acggctcccc ccatgaacgt cgccgccacc gaatagattc gctcggcgtt ggtctcgggg     53760
     acgacgtcgc cgtaacccag ggtgctgagc gtcgccaccg cccagtacac cgacgctatg     53820
     tacagcgagc ccttgtccac gggacgtatc gtgccgtcgg gctccacgtt cttctcgtac     53880
     acgttgaagt actccgtcgt ccagttgacc cttcggtcct cggacatggc gacgaggtaa     53940
     aacaaacacg ccatccagtg cgccaggaag aggataccga gggagaactt gtgcagcgag     54000
     agcgcggcgt agttgatctc ccggttcgcc tcgaaccgcc ggaacacccg gcccacgcgc     54060
     acgatccgaa gcagtttcgc cagtcggaga agccgcacca gcctcagaaa tttcaacctc     54120
     gccgcctcct ccgtctcgac ggcgtaggct atgagatcgt agggcacgac ggcgaagaaa     54180
     tcgatgggga accagccgta caggtacgtc caaacgatct tccgatggtc cgccacgagc     54240
     ttgttgtccg gggtgtagta cggcaggaaa aacgtcactg cgatgtccgc aataaacgcc     54300
     gcgtccacaa ccctgttgac ccaaaacagc ggatcgctca gcacgtcgga ccagttcacg     54360
     ccgaccgagt cgtccgagtc ccagtcctgg tgaaacgcga tctcgtacgg cgtccacacc     54420
     gcggtgtaca gcagacacac ccccacgaac acgtcccacc tgaacatgaa atcaccgcgc     54480
     gggttgaaca ggtagggcgt ccggctctcc agccccagcg ccgccgcgtc cctggcgtcc     54540
     aggttatcgt tatccctcac ctgcgtcgcc cacgacggcc tgtccacggc gtcacccgtc     54600
     atcagcgaga agggcttgag ctgggtcgcc gcgtccatcg ccgtgttggt cgtcgcgccg     54660
     gagacgtatc gatcgccctt tggcgattta cgagtcgact cgggcaccgg atggaaaaca     54720
     tcgcggggat cgatcgagtt cgagcgtaac ggtttagtaa cggacgacgc cgcgtgggcg     54780
     tgggtgctcg cgcgcaatcc cgcccactcg tcggggcccc gctgatccgc gtagtcctcg     54840
     tcgacgcgta ggtcccgttg gctcgtcggt ctgtgcgcgc cgccgtgcac gaatcctccc     54900
     gcaaactgct cgggggtttc cctcatcggc gtgttcgtct gaccgacgtc tcccttggcg     54960
     cgcatccggg tcggcgcggg ggtcgtcgct tcgtcgtcgc ctgctcctcg cggggaccgc     55020
     gcgtggcgat aatcgaacga ggatgagccc atgaaggggt tcccgccctt ggtgtgctcc     55080
     tcgtttggga agtaatccgc gaggtccgcg tcggacggat cgcccagctc cctgggaagc     55140
     tccgagtttc cgcgcgtcag accggccgtt tcccgcatga tgttcacggc atcgtcgatg     55200
     ggcgccagtg gaaatccgtc ggcgtcgcct aaggggtgct tggactccgc ctgtcgcttg     55260
     aacccgccgc gcattgggct cacgggcggc gagtcgaatc cctgtacgcc cttgacttcg     55320
     gcggacgctt gcatcacgga caaccgcgac gccgtgccct gaccctgcct catgatggac     55380
     tgcgacgacc tatcgttgga cttggagtca tcgcgacccc ccatgctgcc catacgagcc     55440
     ttcatggtgc ccgtcgattc cccgatacac cgctccgcga ctcgccgtgt ggaccgaaca     55500
     tttgaaatct cttcgcgctg acaaaaatca cgcggtaacg gtcgggcgaa ccgatgaact     55560
     ctctcgtcgt cggataggat cggaggggac ggcgggcgtc taagtgtctg aagtgttatg     55620
     cacaatgtaa tcctcgcgcg cagctcgctc acgcgtcgac gtccatggac acgtcgatcg     55680
     aatcctcgaa gagcgggttg gatcccttca tctcgaaccc cgccggggtg gtggtgggag     55740
     ccgggttgac gacgacgggt tcgttttcct tgtccaactc gtctccgtcg gtcgcggcga     55800
     caatcttcgc ctccatcacc ggcttgaccg cagcctccgc cgcggtcaca gccttcctcg     55860
     ccgctcgcgc cgcctcgttg agcctggcca cctccgccgc cgccgccgcg agcgccgccg     55920
     cgttgtcgac ggcgggcagc acgcccccgc cgacgccccc tctcttcccg agcgacggca     55980
     tgggcgcggg cgccgggggc gcgggtttgg ccgccgccgc cgcagcctgc gcggcgtctc     56040
     ccatgccagc ctcacccctg gccacgaccc agtccaccag cctgcagatg ccgaggagcc     56100
     tcctgccgac cgaacccgcg ggtacccggt cgatggccga ttccatcgcc ttcggcgagg     56160
     gcaaaacggg acccaccccc gcgtgcgcga cggagatcct cggtcgcaac gcgcccctcg     56220
     ggtaggcgcc gttcgccatc gtaagcgcga ggtccacctt tctctccatg gtaaagtccg     56280
     tgaaggacat ctcgaggtcc ccgcccgccg tgcaccgcac gcgcgtgatt cggggaaacg     56340
     cgcttcggca ctcctcggct tcgtccaaaa cctcctcggc gcggcgcaac ctggggacga     56400
     ctcgctggag caccgcggcg agatccccgc cgcacgcctc ggcggaggtt tcgttccacg     56460
     cccacggcgc gccggcgacc gccgcggcga acgcgcatcc accccgcggg gtcacgccgc     56520
     tgttctccgc caatgtcacc cgcccggcgc cggtgccgac gtcgacgttg acgcggaata     56580
     accgacccac gcgaagcgtc agctcgcacc cgccggcgcc ggagagcccc tccaaacgcc     56640
     acggcgccac gcggttgagc accgcgagct cctcgccgat ggcacgcgcc gcctccccgg     56700
     ccgcgcgcat gcgctcggcg gcggcggcgc gcgccgaggc gccgccgtcg gcacgagccg     56760
     cgctcgccgt ctccacatcc tccgaactca tcctcgcctc ttccagtttg gcggccgctc     56820
     ttgcaacctc cgcgccaatc tcgccacccc tgcgctggag ccgctcgatg gcgccgttag     56880
     cggcggtgag gtcggactcg agcttgcgga tgtgcgccct gcgctcggcg agggcgagta     56940
     ggacgccgcg gcgggtggac aagccggcga cgcggcgagc gtcgacgtcg gccagcgtgg     57000
     caatcttttt gcgcaaaaac tcctccctgg cgtcggcggc gatgagcgcc tccctggcca     57060
     cctcgcgcga gtgctccacg ctggacgccg tcctctccag cgctgccctg gcgtgcgcga     57120
     gcgagtccgc gacggcgcgt tcggtgatga gcctgtggcc ggtgtgctca tccttcgcgg     57180
     cgagttggca ctcttttttc aaagccttac ccgcgcgttg aagcgcgtcg acgtgaccgg     57240
     ggtcgtcgga cgccgcgagg cgcaccaacg gcggctgcgc agcctcgacg tccaccttca     57300
     acctgtcgac atcccgcgcg tactgcgaga gggcgtcgga catgtgctcg tggagcgggt     57360
     cgagagcctc gatcatcggc gccgtgaggc agacgagctt gagactttcc gtcaccgtcg     57420
     tcggcggcgg cgcggtggcg agcgactcca tcgcgagaga ctttcggcgc aggttcttgg     57480
     cgtccatgaa ggacacctcg cacgcgtgca gaaacgactc gagatccacg ggcctcgcgt     57540
     tctcgagcaa gccgctgggc accgggggca gatccgcggg taacccgagc agcctcgtgt     57600
     cgttgacagt cttggctccg tggagggcgt cgcgctgcgc cgcgccgggg gtgaagctgt     57660
     tcttggacgc ggacccgaac gccggcgtcg gggtcccgga cgctccggca ccgaacgtgg     57720
     gaggaggcgc ccgggcggac ttacccccgg tggtggcgcc gccggcgatg ttcagcatcg     57780
     cggatggggt aaacgcggtc gggagggctc cgcccagccg cggcaggggc gagggctgaa     57840
     tctgcgacca caggttcttg cccacgctgc caaagttcac cgtcgcgtta ccgtgcgccc     57900
     gagccttgag cttggccatc atctcgagcg tctccggccc gggggtgaat ccgtcggagg     57960
     attcgtccag cccggcggca tccgccgggg tcgcggcgac gacgtcgccg cctggcgtca     58020
     cccccgaggg catattcatc accgagggca cgggcgccgt caccggctcc tcgcctcctc     58080
     ctcctcgcgc ggcgtgctgc tcgccgatcg tggacgtcgt gggcttcgtg tcccaggtgt     58140
     ccgccgtgat attcgtgggc gcggtgatgt tcgaccgtgc aatcctggtg gtatcccccg     58200
     cggtgtcaaa ggtgccgacg gtggcggcgt cggagggggg ctgcggcgcg tcgccgtgcg     58260
     cgccatcctt catcttgaga agcatgcgca tggtgtcgtc gcccgcggtg tcgaagccgc     58320
     tgctgtgtgt gtgcgcggtc accttggtca tcatcgtctg tccgtctgat tcggtaaggg     58380
     gtttgtccca ggtgtcggag gaacgggcgg agacgccgtt catctcgacg gagtctgcgg     58440
     ctacgtcggc gccgggtgga atctcaaagg aatccgagag gttgaggtcg acgtcatcct     58500
     tcttcggctc gtcgccccgt cccgtggggt tgaacacggc ggcggtgacg gtcggcgtgc     58560
     tgcccgaggg gttaccgccg tagacaaagt cgaaggtgtt ggtgcccatg acgttcttac     58620
     cgcggccgtc gaggtccacc gtcatcgtag cctcgccgag catctgcgtg gcgttgggca     58680
     gggcaaacgg cgctcggctc ttgcgacgat ccgccgggtg cgcgataccc tgcacgccct     58740
     ggatccccat ggtcatgcgc ctgttcccgg gaggcacggg cgccatcgac ttgcgaccgg     58800
     gtttggggtt aacgagcgcg gcggtgacgg tgacgtcggc ggagggagcg cccccttccg     58860
     cgtgtttgcc cccccaagcg tcgtgcgcgc ccccttccag cgcgcgcgtg aacccgaatc     58920
     cgctgtcggc ggtcggggtg ggcgcgccct ggctgaacgc gaccgtggcg gtgggggtcg     58980
     gagcgccgcc gttcccaaac tgaaccgtgg cggtgggcgt cggcgccgcc gtcatcggaa     59040
     gcaccgcggt gaacccgagg tccatggcga cggtggcgtc agccgccacg gcaccctcga     59100
     cggcaccctc gacggcaccc tcgacggcac cctcgacggc accctcgacg gcaccctcga     59160
     cggcatcctc cgccgctccc tcgccgctgt gcctcgcctg atccctggcc acctgcgcgg     59220
     cgaggtcggc ggcgagcccc gcggcgacgt cttcggtgac ggtgcccatg ggcaaccccc     59280
     caaccgcggg ggacgcgtcc gagctggtac cgctcgcgac cgagatgttc atcgtccgcg     59340
     tatcgttgcc gcccgtcgtt aaagccacgc tggcgtccag gtcgtcctcg tccgcgagcg     59400
     ccgtgagcga gggaacgccc gcggtcacgt cgccgaaggc gcccccgtgc tgattctcct     59460
     tgaggccctg gagcatcatc atcgtgtgct cacccgccgt ggcgaaatcg tcggtgggct     59520
     cagacccagc ctccgcgggg ttcgcctcgg cgtcctcgtc gtccgccgcg agatccgaga     59580
     gcctgggaac ctccgtggtg atgcccgcgg gcgcgacgcc ctcgagcgag gtgagccccg     59640
     aggtaaacgt gaagttctcg gtgccgggct tgtcctccgt ctcggaatct tccccgccac     59700
     cacccgccag ccccgcgggc gattccgtcg cgcccgccct gtgcgcaaac agctgaccgg     59760
     gatccatggt gaccctcctg ggcaggtgct tcgtgaggtc gagcgactgc ggggtgcgcg     59820
     cgttgggcgt gggcgcgccg gtggactccg ccgcgggggt gccgagggta aagtccgact     59880
     gacccgtgcc cggggcgacg tgcgcgccaa agctgctctc cctgcgtcgg ccggcgccgc     59940
     ccgcgctcgc cgagccgccc ggggtgctct tctccgcgct agcaaacacg ccgggggtca     60000
     gggatgacgt gatcgccgcg tcggaactga cgccgccaac cgagggcgag tcgctcacgc     60060
     cgaaagcggc gaacggatct acccggccgc cggtgagcgc cgcggtgatg ttcccctgat     60120
     tgacgacgta tccggtgggc gtctgcgccg agtgcgacgg ggataaaccc accacggagg     60180
     gcgcggggga cgcgacggag gagggcgcgg tcgggggctt cggggagggc gcggccgaag     60240
     gcgccgcggg cggcgggcac gtggccagtg acgccggagc cttgggcacg gggggaacct     60300
     caggcgccct cgtcgccgac gtcttctccg cctcagcctt tgcggccatc gccgcctgct     60360
     gcgtcggatc tgggaacgcc ttgtcctcgt cgccgtcgtc cttcatgaac tcgcgcacgg     60420
     actccagcgc ggtgtccacg gcgaaggaca cgcgcctgtt catcgattgc ttgcgcctct     60480
     tcttggctcc agccgcggcg gccgcgcctg ggctggccat cttggacacg tcgctcagga     60540
     tggagcggcg gcggcgtttg aggatctgcg cgcggggaga tggggaaagg gatatcgaac     60600
     gcgtcagcgt tgggaacgtg ggaggatggt aatcggggtc atcgagcgac gcatcggggg     60660
     gggatcgcga cgaatccggt aatctggcac gcaccgagct cggggttggc tcggcgttgt     60720
     tctccttgtg ctccgtccgc tgcggcgtcg cggcctgctt gcccgggctc tgcgcgacgg     60780
     gcgaaggggc gacgttgttg gcgttcggag cctcgaccga cgccgcgcgc ggcgatcgac     60840
     gcgtgggcgc tccccccgcc atcgcttccg tcgggtccaa cgctacgggt cgattgactc     60900
     tgtgtttttc gctgtgcaaa cgcccggcga gggtgtcgcc ctagggtctg tcgcgaccga     60960
     gggcgcgctc acgtatccgc gaacgaaccg acggtgttcg atactccact cgcacgcgtg     61020
     cgctcgcggc gtcgccgtca gcgctcgcgg tagaatggac gttcaaatga gagtcgttgt     61080
     attttttctg tcaccgggcg gttttgaagc cgctttgttc ccctctgcaa aattcggccg     61140
     attttctgac tgttttgcag tcacgaaccc ctcgaaattg gggtaatttt tccacctccg     61200
     cagcttcgtg tctcactgcg gcgcatacga ttttcgagcc tgttttttgg gtcgtgaaac     61260
     ggtcaaaccc atccgtcgtc cacgaccgat cagacctctc ggcccggacg aagccagcgc     61320
     gtctggttgg agctctcgac agccgcagat tttcagccac tccagccgtc ggcggcggtc     61380
     gcgccgacga gcggggtcga ataccatggc gaagggcaag agcaacccga agacgctcga     61440
     gcatgtgaag cgcatgacga agcagatgcg cagcgagcag gcggaggcgc aggcgctcga     61500
     ggctgcgacg caagccgcgc aggctgtcga tcgcaagcgc tccaagaaca agaaggggcg     61560
     ccgcggagac gtctcctccg acgacgacga gaacgacgac ccatcggcga cgcaggcggc     61620
     ggccgcggcg aacggaggca agaagggcac gggctcgcag tccaaggtcc aggtcgccgg     61680
     cttcggcatc ggttgcaggg gcaccggcaa cgagaaggcg cgcaagctga gggaggagca     61740
     cgacgagaag atccgtcgga agaaggccgc gaagaaggcc gccgtggacg agacccgcca     61800
     caaccccgac cgcgccaatc acctcgccga ggacgacgac gagctgtcat ggagggtgcg     61860
     gaaccagacg gtcaacaaga aggccaacag gaagaagaag aagggcggca ggatcgacga     61920
     cgacgacgac gacgaagatg aggtcaccct cgggtcgacc ctccccgagg gcgccggcga     61980
     cgccgacgag gacgcacccg aggatatcga cgggggcgag gagagcggcg gtgggggcag     62040
     cggtggaggc gtgaacatgc gcgcgctgct catgggcgac gacgacgagg acgacgagga     62100
     cgacgaggac gaggaggacg aggacgagga gcagaggcgg tccgagtcgg catcggccga     62160
     gctcctcgac gacctcctcc cggacgtctc cgagcttcgc atcgtcgagg acctgacgga     62220
     ggaggaggtc ctcgtggagg acgtcgacga gaacgaggag gacggggagg acgaggagga     62280
     cgatgacgag ctcggtccgc ttcccggcga ggatggggag gaggctctgg aaaatgactc     62340
     ggaacacgac tcggaatggg aaacggacga cgacgacgag aacgcgccct tcgaacctcg     62400
     gccgtgcgag tccctcttcg acggcgcgga gctcgacacg gtgcacgata acgtggagta     62460
     catgcgcagg acgcacgggt tcgtgttccc gtaccgaggt aacctcaagg atcccgaggg     62520
     catcatcggg tacctccagc ggaagattta cagggggcgc cagtgcgtgt tttgcggtcg     62580
     aaagtttggc agcctcgagg gcgtccgcgg gcacatgcga gacaagggcc acgccaagat     62640
     ccgtttcgaa ccccccgagg tgttcaaggc gtcagtcgcc gccgcgcgcg gtctcacgcc     62700
     cgaggaaatc gaggacataa actacgtccc cgagtactct gagttttacg atttttccga     62760
     aaacgctcag gcgctggtgg acgccgccgc gtttgagacg ttcgacaagg gcgggctcga     62820
     gctggtgctc aagagcggca agcagttagg gcacaggtcg tacaggaggt actaccgcca     62880
     gaagtttcga aacgattacg tcgccaaggg gagcaagagc gacgagcggc ggggcggggc     62940
     ggtggcggtg gcgacgaggg tggcgagaaa agagacgcag cgaaagcaca acgagatcgc     63000
     ggtcaggtcc atgcgcctcg cgaaggctgg ggcgtccaag gcgctggcgg cgcagtacgg     63060
     caccaaggcg cagttcgccg ataacaaggc tcggcgcgcg atcgtgcacc actggggcgc     63120
     gggcgggggc gggagccact accacaccgc ggggagcaag cagtttcaga agggcgttcg     63180
     catcaaaggg gtcatctcgc gacactcgaa gcagggcgcc aagatgcagg ctgcgagggt     63240
     tcagaaggct cggaacaagg cgaacagagg gacggcatcc gtcgcggtgc tccggtcggg     63300
     atctcgcaag ggctagtcac gcgattcttt tgtcattgtc acacacaaac gaacgtcggc     63360
     acgagcttct cgccttctcg ccttctcgtg atgagacccg agagatttct tttcgccaga     63420
     aggaggctcg acgtcgcacg cgtgccgacg gcgccatggg cgtttcggct ccggacgcgc     63480
     ccgcgaccga ggggtggacg cgcgatgctc ccgtcgagga gtggcgcgcg tacgtccgcg     63540
     ccgcgtacgc gtccaacccc ggccagtgcc ccctcgacgt gaacgtcgat aacatctaca     63600
     gtttcaatca gggatccatg tccttcatcg agcaggacct gcgtgtgctg cccgaggcca     63660
     tggcgcgcca ggcgcttgac gcgatggatc gcgtggcgct gagggatgct ttcgatcttc     63720
     gacggaacgt ggtcaacctg aagaaggtgc tcctgcacag ctggcacacg tcggagccgc     63780
     tcgagaagga gctcaggcgg atgagcacgt tctggcgcgg ggacatgagc tgggtcaacg     63840
     ggttcgtgga cgtcgcgagg tacagggagg tgtgcgtggc tcacacgcgg tgcaaaggcg     63900
     cggcgcacgc cgtgttcgac ggacgcgtga tgaccaaggc gatatgctgc gtcccgaggc     63960
     accccgagct cccgaggccg gcgaagctct cggggttacc ccgaaccatg acgacgcact     64020
     cgtggttgga ccaggcgctg gacacgctcg cggagatgga cgaggagacg acggagggtg     64080
     ccgacgaggg tgccgactcc ccgccgccgt ccgcgcgagg cgtcggaagg agggggaccg     64140
     ggtcggcggc tgccaaaaac gcggcgggcg aaccgagcga cgtgagacgc caactcgacg     64200
     ccttcctcac cgacgcgacg tcgtcgccgc acggcccact ccgcgactgg cccaaacaca     64260
     tccttcagta cgtggagctg gtcctcgtcg cgaggggcgg ggcgaaggcg ctatccgtgc     64320
     gggcggagac ggggaggtac gcgagccgcc tcagggaaac gtcggttcgt tttgaggagg     64380
     cgttggcggc gcttcgcgaa cgcgtcagga ccgtcgagga cgtgctcagg gacgaatgcg     64440
     gggtggtgct cccgagcggt gagtcaccga ccgggaggtt cgtgtccagg gacgacgtgg     64500
     acgatcgcgc ggtggacgcc cttcgcgtcg cgatgcgcag ggataagacg ctgaacctgt     64560
     tggaggggtg cgctccggcg acggcggagc tctctcgatg ggtgcacgag atttgcgcca     64620
     agccggcgca acggctgttc gtcgcgggcg acggcgggac ggggacaaac gccgactttg     64680
     tcccacccgg gttcgctttg ggggaactca tcggcgcaaa cgcaaaggcg gtgacggcgc     64740
     ggtggggacc ggagcttcga cgcgtcatcg aaaccgcgtg tggcccaaac ggcgcgtggc     64800
     cgccgacgga gccgctgacg tacgtcacgg gcaaagtacg gtgcaaggag tgcgggggtt     64860
     tcttcgggac gctgtggatc ggcgcggggg aacgctgctt caggtgcgag gaagggatgc     64920
     gggcgcgcgg ggagtgcccc gtaagtgcga ggtgccgcgc gtcgaaggta cgaacgtttt     64980
     gtccgcacgc ccaacggtgc atcgcgtgcg agcgatggag ctgcgtggaa tgcggcgtcg     65040
     tgtgcggcga cggggaggac gtggcggcgt tggtggagca aatcgacccg cacgtcgtgt     65100
     tcatcgactt tgaccgcacg ctgtgcacca ccaagagcgg tgccagcccg gcgcggggat     65160
     cgcaccggct ggacgctgag ctgtggaacg tggtgaccgg ccttcaggac gtccgcgtgg     65220
     tgacgagaaa ctcgcacgtg gacgacatca gggcgttcat ggcccgacac cggggcggcg     65280
     gcggctgtgg tctcagcggg tcgacgccgt cgtcgtcgtt tgacgggatt ccccccgtgc     65340
     accacgtggg taagggcgtc agcaagggga gggttattcg cgaggtgctg gcggaaaagg     65400
     cggcgcagtc ggcggggcga cttgcggagg agtcgacggg cgtcggaggc ggaggggtgc     65460
     gagcggtgtt cgtggacgac agcgcggcgg agctgctcga tccggaggtt tcgagcgtgc     65520
     cggggctgac caaggtcctg ttcagtcgcg tgctcgcgtg agtgatccca agtctcaagt     65580
     gaaatgagtc tccgttacgg gcgacgcgga aaagttgggc accctcgttt cgatgaagca     65640
     agccgtttga aatatcccgc gggcgagacc tccttccggc gcaaaccaac gcgcgcggac     65700
     atgtccctcg cgtcggcatc ggcgcccggc gcgtcgctcg cgccgtcggg acgtcgcgct     65760
     cttcgcggcg ggcgagctcc ctcgcgcgtc gtcccgtccg cgttcggctt cggccgctcc     65820
     aaccacgcgc agtccctcac gctcgagcag atcgaggcgg agatccggag cgccccgccg     65880
     agcacctcgc cggcgtccac gtcccggctc tccctcgcgg acgccgtgtg gaaggtatcg     65940
     ctggacaatc cgctttccct tcgagaccgc gcggcgtgcg ccatcgccgc ggaggcggtc     66000
     caggcgctgt gcgagactgg cctggacggc gcgtcgctcg cggtgacgct gggcatccgc     66060
     gaggcgatga tcgccaacgg cttcggcgac tcggtgcgcg cggtggccgg gtacgtctcc     66120
     gtcgggggtt acgccagggc gcacgcgtgg ctcgagatcg acggcagggt gctggacgtc     66180
     gcgggcgagg gcctggcgct gtgcgaggcg gccagacgcc tcggcgtcga ttactccgac     66240
     gcgatcgcaa tggcgaaagc cttcgggccg gacgcgcttc gattcggcgg acacgaaccg     66300
     aacgcgagac gcccgctgct cgtgctcaac atgtcggtgc ccacgggggg cacgtcaacg     66360
     gcgctggcgc ggccgggtct gacgatgcgc gcgccgccgg cgaacgtccc ggggtgccaa     66420
     gacgccgaga agacgagagc aaagtttgcg gcggtgttgt ccgagccgag gacgcggctg     66480
     tccgataggg tgcgcgagat gcccgaggag gtggcggacg tgtttcacag ggtggcgagc     66540
     acgcggctgg acctggtcgg ggacgagagg cagcgcgcgg cgaggctggc ggcggggggg     66600
     gcgcagtgac ggcgactcgg gtgtcggtgg actactcata tttttacatg attttttctc     66660
     gacggatgac ggggccgtcc ccatcgtaac ttttacacag cgtggatgcg accgacgcgc     66720
     gtggacgcgg cgatcgatcg aagccgccgc cgccgttccg ttcacgcgaa cgaagcctcg     66780
     cagcgctcct ccgacgccga cgcgcatccg agggcggttt tccagtcggt ggcatctttc     66840
     cacggaccga attcgatggc gtcgttggcg ttgttcatct cgggcatgtg gccgtacccc     66900
     tgcacgtccc cgggggccat gttgttggcc ctgaacgtcc cgttcggcag cctccgcccc     66960
     agcttcttgg tccagtggcg gttgtaaagg ttgaacccgc ccttgagcag gacgagattt     67020
     ttgtacccga gttgttccag cgcctccagc gcggcgaccg cgcgctgccg cccgtcgctg     67080
     cagctgacga ttatcttggc gtcctccttg ttcgggaacg cggtgatgac ggcctcctcg     67140
     aacccgcggt tgcgggtctt gtttgcgaac accttcccgc cagcctcgcc atcgaagcgg     67200
     taccccgtgg ttttcacaat cggaatgtgg ctcgaacctt gttcggaccc gacaccacga     67260
     tcgtctcgaa caccccgccg atcgtccccg ggggcgggtt cgggaaatcg ccgaagaact     67320
     caatctcgtg ctcgtccctg acgtccaaca cgtcgtaccc gtggtcccag aggacgcggg     67380
     actgctccac gtcagcgacg cactccgtcc cggaggcgaa catttccaag acgctcttgt     67440
     cgaagagcgg gtcgccgtac tctggcacca ttccgatgcg ttcggtctcg ggcagcgcgc     67500
     gagcggggat cgggcggcgg ctaaggggac gcgcgcgcgg cgcggcgcgg ggatacgggc     67560
     acggggaggt cagcagggcg ctcatctcga gtggaggagt gatgtatgac acataaatcg     67620
     agcgaagata agaaactgac ggggacgtgc gttacgactc ggtaatctta gctcggcgct     67680
     gcggcgagga aaatttacat gacaacgcag cacgctttct tcttgggctc ctcgtcctcg     67740
     tcctcgacca tgatgacctt ggggccgtca tcgacatcct catattttgc gaccccgttc     67800
     gtcgtcgtcg tcctcgacgc cgccgcccca gcctcctcct cctcctcctt cttctttttc     67860
     ttcttcttgt tcttcttctc cttcgcgagc cgccgttttt ccttctcctc cctctccttc     67920
     ttctccttcg cctccctttc ttctctttcc gcgtttgccc tcgcccacgc ctccgcctgc     67980
     tccttctcct tgagcaccct ctcggcctcg tcagcttccg cctgctcgat cttccagatc     68040
     tcctccttct ccttcacgag ctcctcgagc gactcgatgg ccgggtcctt gagcctcttc     68100
     tccagctccg cgatctgagc ctcgaggccc ttgacgatgt tgcatccgcc cggtttgagc     68160
     cgtttgtcgt actcgccctt cgcggtcttc gccgtcttga tctttcgctc gatctccctc     68220
     ttggcgtcgc cggatgcctc cgccgaggtc tcctcgtaga cgccgatcat gttccgaagc     68280
     ttgtccgatt ccgaccgata cgtctcaatc ttttcgtcaa tcatccgccg cgcctcctcc     68340
     ttctccttga tcagcgtccc ctgcttggcg ttgagcgccc tgagcgcggc gtcgtactcg     68400
     aacctggcgg ctttcgcctc gttgatctcc ttcttggcgt ccgcgcgtga gttggcggcg     68460
     tccgcctgcg cccttcgaag ctcctgtcga gcgttctcag cctccttgag ctccttctcc     68520
     ctcgccgcga gctgctcgac gagtttgcgc tcgagcgcag cctccgcgtc gaagatgtcc     68580
     tgcgcgaact tcgccttgcg gtcctcgtac gccttcttag ccctggcggc gaagtcagct     68640
     ccgttcatgg ccagtctggc gatcttacaa acctcggaaa gcgtctgctt ctcccgcgcc     68700
     cgggtcttct cgtcccggtt ctccggggga acgtaggtac ccttcgcggc gccaaccttg     68760
     aggcactcgc ggagcaccgt ctccccgaac agcgagctga ccaactcctg cgactcctcg     68820
     tcgtcgtcga cggcggcgcc gagggagacg agcgcctctt tggactcgcg agttttctta     68880
     tctctgccgc acaggtgatg gtatgcgaca accgggagca aaccggcttc ccgcacggtc     68940
     cacccgttgt ccgagtttcc agccgtgtat gcgtagacga acgcgatgca cacctgcgcc     69000
     atcttggact ccgccggcgc cgactgaaac accgaccgaa cgttcgtcaa gacgttctcc     69060
     tcggcgagct ccgactgacc ccagtactcg gtatcaatcg cgatgttggt cagcgacgat     69120
     acgcacatct gcgccaggtg gacgctctcg ggagattctt cgatggcgca ctcgtcgatg     69180
     atgtgcttca gcttgtatat cacgcccgcg gtggtgagca tccgtttggc gtccttgtag     69240
     tccctcgcca tgtgcatgac ggcggtgacg gcggcttggg tcagcttcgg gttctctggg     69300
     tttgagatca tctccaccac cctcggcagg acgccggtca ccgcgacggc ctcgtcgacc     69360
     tcgtcgttgt cctccgcgag gatggtcacc gcatcgagcg cgatcgcggt gaggggatcg     69420
     ttgggcgggc ggcccatcaa tcgcatcatg gcgggcacgc cgcccgactc catgaaggcg     69480
     atcttgttgg ggacgttttc atcgcagagg tggttcaccg tcagcgcggc gtgcttcagg     69540
     aatagacccc cgtcgggtct ctccaacatc gccctcagcg cctcaaaccc ccccgtgcac     69600
     ttatcccgaa atatgtcctt gatctccggg tccacggaga ccagggagag cacctgcacc     69660
     gccctgtgcg cggtgggttg gtctgggccg agcttgatca tctccaccag cttttgcacc     69720
     ccttcgctgt cctcgacgac gtcgtgcacc ggcccggtgt actggatggg cccggtgcag     69780
     cagttgatga ggagcatgac cgcgcggtcg tggatctcgc gtcgcagcgt gaggtcgagg     69840
     agcgtgcacg cgggcgcgac gcacccggcg tcggcgatct ccttcctgtt ctttttcgac     69900
     ctggacaggt tgatgaggca ctggagggtg ttgatcacca cctgctcgag ctcctgcatc     69960
     cgggcctcgg aggacatcat ggacagcgcg ccgtccgagc gcacgtcgtc gtcgttatta     70020
     ccgtcctcgt cgatggcatc gagcgacgat cgcttatcga gcgaagagcg cttcgggctg     70080
     cccggcgcgt cgtcgccgaa gcgcagcccg atgaacgtgg cgaggatgcg cccaagccac     70140
     gggcaggcgt cctccctggc gacggcgagg cgtgtctcct cgtcgtcctt gtcgccggtc     70200
     atcaccgtga gctcctcggt cgcctccatc catactgtcg gagtttaaag ggtgagggat     70260
     ggtcagagca ggtggcctcg cgggcgggga tttgggagtc cgactctgtg gccccgtttt     70320
     gagattctcg aggaaggtcg ggggaggggg acgcgcgccg gtgggaacac tcacggtcct     70380
     cgtcccgcag cttctcgatg catgctttga tatcatcctc ggagggcgcc atcgcggggt     70440
     actcgcgctg gacccgacac cacgacgcgg cgcgctcgcg ggcgcaaaga gtggctcgac     70500
     cgacaggaat attggcgcca tatccagcct ggcctgccgt gtctcttcga acttcagcgc     70560
     accgatcaat ttcgccacag gcaactcgcg caggtgggca gcggaccccg ggcggtgaag     70620
     agatggcgtc cgatttcgag agacagcgcg ccaccgccga ggtacgcccg ctgccgcgct     70680
     ccgacccccg gcgcggacca ccccggatac atcgtccccc ccccaccccc ccgcgcatcg     70740
     ctcgagcctc caaactccaa acctaagaaa tcttgcgcga tcgacccgcg aatcgatcgt     70800
     gccccgtccc acctccgcga cccgcgtcgt cgcccgcccc gtgacccgaa cctcccagcc     70860
     cgtctgaccc gtctttcgtt tcgctccctc tcgaccagga ccgactcggg gcgatcgtgc     70920
     gcgcccccgg cgacgtcgcc gccctcgcgc gtacatccct cgacggcgcg gtcggctcgc     70980
     tgaggctcga cgacgccggc gcgccggtcg accccctcag cgcggacgac aagaccctcc     71040
     tcgagcacgc gctgtgccgc gtcatgttcg ggctgatcga ggaggcctcc gcgcgcgcca     71100
     ccgcggtcat gtcccacgtc gcgtccagcg cgaacgcgaa gaagggcgcg acggacaaga     71160
     gggctcactt aggtacgaat gcgagcgacg agccctccat gccgcggctg ctggacctcg     71220
     cgctgacgct gagcgagacg ggcgtcgtcg aacccgcgtg cgtgtttaac gcgctggaac     71280
     agctggtgga gacgtgcacg atcgcggact gcgaggacgt gttcacgtgg gtggaggcgc     71340
     ggcggggacg gctgagcgcg gatgcgctgt ggcgacgggg caagctggtg atgctccgca     71400
     cgtgcaacga gctgcagaga cggctgagca agacggcgga cacggtgctc cgcggcaggg     71460
     ttctgctcct gttgtcgtcg ctgtacccgc tgtccgagcg gtcggcgctg aacctgggcg     71520
     ggaactataa cgcggggaac accaccgagc tggatgagct ggacgccgac actgcagaag     71580
     cgacggatgc aaacgcaaag gcggaagggg tcgtcgtgga ccgcgccttc tacgaaacgt     71640
     tctggagcct ccagaagttc ttctccaacc cccccgccgc gctcgagccc gccgccgggt     71700
     ggaaaacctt ctgtgtatcc cttcggttgg tgctggacaa cttcgagacg caccggcttg     71760
     ataagatgtc gtcgggggga gttacacccg gagttaaacc ctcggtcccg tcgggcgcga     71820
     catacgtcga agccggcatc gacgccggga ccaagtacct caccgccgcg cccctgctgc     71880
     accttcagct gagggacccc gcgttccgac ggcactttct cgtgcagtgc gcagttttcc     71940
     tgggtttttg cacgtccccg ctgtacaagg gtgtcgacgc cgcggacgcg agggacgcga     72000
     agaagcgcgt gatggaggct attcgccaaa ccccgccgca cggcgaggag ttcgccgccg     72060
     ccgtcgccct ggcgctgcgc cgcgaggagg gttgggtgct gtggaagcgc gataactgca     72120
     aggacttcga gcgcgagccc gaggcgcccc ggccaccgcc gcccgccccc ccggtgatgc     72180
     gacgacgact aagacctggc gccgcggctc cggcggttcc ccccgagaag cgcgtcaggc     72240
     tcggtaaccc cgagctggac cggctgtgga acctcagcga ggacaacgtc agcgcgctcg     72300
     gggataagag ggacgcggcg cccaccgcgg aggtgtacct gcaaaacgtc gtcgacgaca     72360
     tggaccccga ggctcaaatc gaggaaacgt acaagagcaa aaacgacaag acgtacgtgt     72420
     ggaaggctct gcgactcatc gccaaggcgg acatgggcgc gttccagcgg ctgggcgcgg     72480
     aggacatgga aacggtggtg cccgcgatgc tgggcgtgga gcccccgggg agaccgacgg     72540
     ggacggatgc ggatgggggg acggatggtg ggggggacgg ggagggcggg ccagcggcga     72600
     tggagacgga tgggggcggg gacgcgtcga aggaggcgaa cgagcccgag gcggaggagg     72660
     gcggggaagc cgacggggag gaggacgaag ccgacgggga ggaggaagcc gacggggagg     72720
     aggaggagga gggggaggag gagggggagg gggaggagga cgagtagtag tcgccgatga     72780
     tgatatcaaa acttttagcg gcgctccagt tttccgacgt cgagcgcggc gcgtcacttt     72840
     ctaaacgtct tcctcctcgt tcaaccccgc ctccgcgtcc gcctccccgt ctgtttcctc     72900
     gtcctgctct agcgacggtt cctcccccag cgacggctcc tccccgtccc cgtccccgtc     72960
     ccccccacgc gccgcctccg ccgcgagcgc cctgagcgtc tccttcgggc tccgcaccgg     73020
     gtcgtctacc cacgggaaca tccagaggtt tcccgggtcc ccggacgggt cgtgtgcccg     73080
     gagaaagtcg ttgttgacca ggaatcgaaa cacctggagc agccgcgacc tgtccgcgcg     73140
     aacctcccgg gcgaggagtt tcctcagcag cgtttgactc ccggcagcgg cgtttgacga     73200
     cgaagccttc gccttcttat ccttcttcgc cttctcccgg gcggactcgt cgtgcgcgaa     73260
     cgcgcaccgg cggcccgatt tgcaccgccc gcgaaggaag aacctgcacg gcgtcgcgtt     73320
     cgtggcggca ttcgtcggag aaattgtcgg acacgtctcg gcacccgtcg acgccccggc     73380
     tcggtttccc ccggcgtccc ccgcgtggac aaagtcgcac gcgtcgcccc tgcggcactt     73440
     accgagctgc cagtacctgc acggcctcgt cccttgcctt ccgcccgcgc cgcccgcgtc     73500
     tctcctctgg cgcttcgccg gcgccgaatc gtcgcccccc gccccgggat ccctcccgcc     73560
     gccgcgacct tttccttttc gattccctcc cccgcccgcc gccgccgccg ccgccgaccc     73620
     cgccgcttct tcgtctcccg cgcctcctcc gacgtcgccg atctcctccg acgcctcgaa     73680
     gtgcccgagc tccctctgcc tcgcgaggat ctccctgagc gcggcgcgac gcgcggcggc     73740
     ggcggcggac gaggaggact cgtcatcgtc tcgcgacagc tgcccccgcg cggctcgttc     73800
     ctccgcttcc gctcgccttc gttccacgac ggcgttggag ggccagttct tggcgcgctc     73860
     ttccctgtac cgccgcacgt cctcgggcaa cgaggcgacg tccacctgtt tcaccgccgg     73920
     gatctcgtcc acggtgggga acgtgactcc cttctcccgt ttgaacgcgg gcgcggattc     73980
     ggatcgcggt tgggcgggaa cggaatccga gggtggggcg gcggtctcgt cggcgtcggg     74040
     tcggggctgc gaggggtggt cggcgggctt gcccccccgg cccctgttct tgccgcggcg     74100
     gtgggcgttc ctcttgccgc cgggtgggtt cgtcgagggc gaggagggcg ccgggtgaac     74160
     gtcggaggcg ggcgggggcg gcggcggggg cggcggtccg ccgcccacgg tgccgaacca     74220
     ctgctgctgc gtgggctgcg tgggctgctg gggcggcggc tggggcggct ggccgtagtg     74280
     ttgctgcatc tgcgccgccc aacccgcggc cgcgggcgcg ccccacgcgc cctgcggcac     74340
     cgccatcatc acctgcccct gcgccatcat catcggcacg gtgcccccgc cgtggggcgt     74400
     ccactgctgc tgctgctgcc cggggtactg caccacgggc acgtacatca tctggtacgc     74460
     gcccgcgggg gttcgcgcgt ggggatggct tccctgtccg tgagggccgt ggggcgggaa     74520
     ccccgcgccc tgcggtggat tcatgacgcc tcccccgacg cgccccgcag tgcgggggcg     74580
     attacgacaa cattgcggtt cgttgttaaa gaatcgccgc ccgattcccc gtcgccactc     74640
     ctcgaggcga ccgcgcgccg gagttcagcg atgcgcaggt ctcccgcgcg gtcgacgctg     74700
     ggcctgtgcc tctcgctcgc gtgcctagcg ctggtgtggc acgcgctcac cctcgcgggc     74760
     tggctcacct cgcgcgtcac cgccgcgcgg ggctacctcc gcgacgtcgg ggacctcacc     74820
     gatctcgcgg agcgccccgg gatccgggag gcggtgcgtt cggtcgtggc gtctggggcg     74880
     ctcgcgcggc tggagaggga cgtggtcggc aggcttcacg tcgtggacga cgagacgatg     74940
     tccgtcggcg tggacgtgag ccacagcggc gaggcgacgt gggtctaccg gcggtaccag     75000
     caggcgctcc gatcgtcgtc gtcgcccggg aagagggacg ggaacaagtc ggcacgattg     75060
     gaccccggct tcgcgcccct cgtcgtcgac gtcggcgcca acgacggctt cctcagctcc     75120
     aattcctaca acctcgcgcg ttgggggttc tccaccgtac tcgtcgaacc caatcccgcc     75180
     atgctcgccc tcgccagaga ggcgcaggag ccgatgatcg atccctacca cgagggggtt     75240
     cagcgcggct gttacgtcaa cgcggggatg gcgggggtgg aggcggcgac gacgatgaaa     75300
     ctgaaggtgg gcggggacgt cgtggcgatg gaatcgtcgc tcgtggacgt cggcggcgcg     75360
     agcggcggcg gcggcgtggg caagaacggg cggggcgacg actcgaggga gcaaaagttg     75420
     gcgcagctgc gaggcggcgg ggcttggggc ggggacgtca tcgaggtcga cgtgcttccc     75480
     gcgtccgagg tggcgaagcg gtgcgacgtc cccaaggact tcgcgctcct ctctgtggac     75540
     gcggagggcg tgggagacgc cgtgctccgg gagtggatcg tcgcggggca caagcctcga     75600
     tggatccttt acgagtcaat gcacaacccg accccttttg acgtcaccaa ggagtggctc     75660
     gagggcaagg ggtggaggta cgtccggaag atcgggtgga accacgcgtt cgagcttgag     75720
     gagctcagcg cgcggctcag gccggtgcca taaaggacgt ttgacgacag cgagagcatc     75780
     agccggggac ggctttgcgc agccgggcag ttggatagac tagagaaata atgtgtgatt     75840
     cccacgtcag aaacgggcgc ggggttttgg tcaacgtttt cagcgtcgtc cgcagatgct     75900
     cgcgcacatg ggctgcggcg tctcacgtcc agacccgtat ccgatgccga cgaagcccgc     75960
     gccgccgccc gtttccgacg ggcaccccgg cgagagacac gcgttcaggc gccggcacgt     76020
     cccgtcgtcg tcgtcgtcgc cgcacgcctc gttcgactcg gagacgtcgt tccagtcgtg     76080
     cgtctcgttc atctcggacg agctcctcga gacctcccag gtcccgtccc cgacggcgcc     76140
     cgcgacgcgc gtgggcatcg gcgagagcgc gtcgccgagg acgcccgatc ggcggccgat     76200
     gacggcgtcg cggctgccga cgcgcccggc gcccccggcg cgggcgcggt tcggagcgcg     76260
     agccgaggtg cgattcatga cgacgtccga gaaaacggcc ggcgggtgga cgctggtggc     76320
     gtccgcctcc ggtgggggcg tatccgccgc gtttgagtcc gaccgcgatc gaccctccgc     76380
     gctgcgcggc gtggacctcg tcgccctgcg cgacgccctc cgggtcgagt cgatggagtg     76440
     caccgacggg aaggtgtcca tcgcgcggct caacgcgtgc ctccacaggt gagaggattt     76500
     tcgccaaatg atatgataca tgccctcaag tgcacaaaca gtatctctct tatcggctat     76560
     ttacggttaa cattcacctt tttgtcgcgc aggatcgtcc cgcccgcgtc gcgcgcttcg     76620
     gccgccacgg tgtcctcgct cttcgccgcc gtcgactctg aaggcaccgg cgccgtcgac     76680
     gtcgcggacc tgatcgccgc cgcctcggcg ctgtgcgcgt cgccgacgga cccgacggcg     76740
     cgtatgcgcg tcgccttcga cgcgtgctgc gacgacgacg acgtccaaag ccaaagccaa     76800
     agccaaagcc aaagccaaag ccaaagccaa agccaaagcc aaagccaaag ccaaagccaa     76860
     agccaaagcc aaagccaaag ccaaagccaa gacgcgcgac cgcgcgtcct ctcgaagcgc     76920
     cggcttcgga ccatgcttcg cggcgccgtc gtcgcggcgg cggcggcggt gtttgcgcac     76980
     gcgcccctca accccgggtc cgacgagaac gacgaaaacg tcgacccgaa cggggacgca     77040
     aacgggggcg gcgggcaaag ccaaagccaa aaccaaaacc aaaaccaaaa ccaaaacgtc     77100
     gtgacgctga cgtgcgccgg gggcggtcgc gtcgtcgcgc cgaggctgac gtcgtcatcc     77160
     ggtgcaacgt cgaccgcgtt tcgaacggcg acgtcgatcg aatcgtacgc ggacgcgctg     77220
     gtggacgatc tgttcgccac gcacgacacg gactgggtcg gggcggtgac gtggaacgac     77280
     gcgagggagt acgcgctcgg gtgcgcgttt ctcagggcgt ggttcgggtt ggaccgaatc     77340
     attcggtgaa ggttttttgg acgaacgtcg agtctcgtct ctcgtgtaaa atgaacgtct     77400
     cttgtgtaaa agaagtttgg aaggtaccct cgccacggga cgagtgactc ataactcata     77460
     gagagacgtc gaacggtcag tcgtagatgg gtacgggccc gcccatgccg acgcaaaatt     77520
     ccgcagggtc gttgtacctc ttgttcctgt tcagcgcgtc gatcgcggac atctcgtcag     77580
     cggtgagcgt ccagccgaac acgtcgatgt tctcgtcgag cctcccaacc tttgtcgtct     77640
     tgggaatcgc ggaggttccc cgctgcaccg cccaccggag cagcacctgc ccaggggacg     77700
     tcccgtgcgc ctgcgccgcg gctttgacgc acgcctcgtt gatcgcgccc tccgttcgct     77760
     tcgtccagcc catctcgacg taccccgcgc tgcccagcgg cgagaaggcg gtgacgtgca     77820
     cttggtgcaa ccgcgcgtag tccaccaggt gcttctggga gaggtacggg tgcgactcga     77880
     tctgcagcac cgccggttta actctggacg tggcgagcag gtcggtgagc agggacacgt     77940
     tgaagttgca gacgccgatg ttcttgacga ggccctcgtc cacgagctgc tccatggcgc     78000
     gccaggtctc ggcgatcggc acagggtcgt ggaccatgac ccggtcggcg ggatcggacg     78060
     cgtccgggtc gtgcacccac tcgggggggt accgcgtctc gaacgggaca aacttgaggg     78120
     agattgggaa gtgcacgagg tagaggtcga ggtactcgag gccgaggtcg tccaaggttc     78180
     ggaggcacgc gtcccgcacg tgttcctgac ggtggtaggt gttccacagc ttgctcgtca     78240
     cccaaaggtc gtcgcgggag atggtcgggt cctccgtcag cgcggctctg atgccggcgc     78300
     caacctcgcg ctcgttgccg tagtcgcacg cgcagtcgag gtgcctccac cccttccgga     78360
     tggccgtctc cacgagcgcc ggcgtctgct ccctggggat tttccaggtc ccgagaccga     78420
     ggaggggcat gcgcgaaccc gtgcgaagga tcgcgcgctc ggctacgccg ggattgggcg     78480
     cgttgtggcc cgtgggcttg gagcccaatt tatcgggcgg ggtcatcacc gcgcgtatcg     78540
     tcgcggaggt cccaccacga cgcgacgggc gacggtcgag ggcgagcctg ttcgtgagct     78600
     gagggccgat gcgcgcggcg gtggcggaca tggcgcccga caagatggcg ctggtccgca     78660
     gcgacatgag gcaaatatct ctccccctcc gagagcccga cgtttcggag atcgactcgg     78720
     gtcagaaaaa gcgcaatgct gactcacttt tctcacccaa aaagtatctc ggttcgggcg     78780
     cgaggggcgc gcactttgcc actcgcgcgc gtcgtcacca ccgcacgcgc ccgtggaccc     78840
     gtggacccgc cgacgcgacc cgagcgacct atacgaccga ccgaaatggt gcgtcatccc     78900
     gcatccgaac cccgcgcgcc tctccccgac cgcgaccgcg tgcgccgccc cccgagttcc     78960
     ggaacgattt tcgctaacaa caagggtcag caacccaaga aacacggcgt ttcgtccccg     79020
     aattgaccta gtcgtcgctc ctccaatcct ccgcctccgc gcgcgcaggg cttcgaaggg     79080
     ccgatcccag actacgattc ccccaccccc ggtggcgctt tcgagcagtt gctcaagcag     79140
     tacgacgaca gcggcggcct cgacgttctc gacgacgaga gctcgtcggg cgccatgaac     79200
     aacatcatat gcgtgtcatt ccccttgccc gaggcgcggt cgaggttgct ggacgatctc     79260
     tccggcacct acgatttccc cgtcgccctc gagccttgca cgcaggaggt cgccaacgac     79320
     accatcgcgg ccctccactg ggcgcaggac tcgagcgaga ccatcgaacg gcacctgtgc     79380
     cgctacggcg ccctgctcct ccgaggcttc ccaatcaaaa ccccgcaaga ctttgccaac     79440
     ctcaccgagg cgctcgggtg gccgaacttt ggctacgagg cgtcgggcgg caacgccgtg     79500
     cgcaggaacg tcgtcggcga ccgcgtgttc accgcgaacg agtccccgcc ggataaggtg     79560
     atacccttcc accacgagct ggcgcagacg acgaggtacc cgcatcgggt ggcgtttttt     79620
     tgcgagaatc ccgccatgcg gggcggagcc acgcccctcc tcgactccgg caacgcgtac     79680
     gcccgtctgc gcagcgagtt ccccgagggg ctcgccgagc tccagaagaa aggcgtgcgt     79740
     tacacgcgcg tgatgaccgt ggacgacagg tgagtttatt tttaaccttc gcgtcggatc     79800
     gcgtcggaaa ttagacaccc aactgaacaa ctcgcgtttt gttcacaggc cgcactctgc     79860
     catcggccgc ggatggtccg acaccttcgg cgtctccacc ccgcaggagc tcgaggcgaa     79920
     gctcgcgtcg agcggggata agctcgagtg gctcggggtg tccctgtcgc acctcggcgt     79980
     cgacggcgac aggtaccccg tccgccacta cactgacgta cgtcccgccg tgctcgtcga     80040
     cccgagcgac ccggagcgaa gaccacggtt ttttaaccaa attctcgccg cgcacgcggg     80100
     atggagagac gagctcaacg cgccgggcgc gtccgtcgtc ctcggcgacg gcaccccgat     80160
     gcgtcaggac atgctggacg ccatggaacg catcttccgc gaggagagcg tggcggtgca     80220
     gtggagagcg ggcgacgtca tgctcatcaa caacctgcag gtgatgcacg cgagggagac     80280
     gttcgtggac ggggaggcgc cgcggcgggt gctcgcgtcg ctgggccgcg atccggcgcc     80340
     ggtgatggag gaacgcctgg cgaactcact cggcgagcag cacggcgtcg ggtcgaacaa     80400
     gcaaggccgc aagtacgcgt ggcaggcgac cggcggggat cggaggacgc acggaccgcc     80460
     cgcgctccgc gagtccaaga cgcgagccaa ggtgattcgc ggcaacccgg gcatcagagc     80520
     cgtttcagag ccgtttcaga gccgtttcag agccgccgcg aggggttcct cccgcgcgtc     80580
     ggcgtcgctc agggccttcg tcgctcgccc ggcggtgctc ttcgcgagat gatgagaccg     80640
     atcgagcggc gacgacgaac gggtcagcgg cgaaacacgg gtcagtcatg acgttcatga     80700
     cgcggatggg agtaaacgaa tcaaagctca tcgagcgggg tttcctatga ttatttagcg     80760
     acgacgacgt cttcttcgtc ggcgagcgaa ttgtaactga gcggtgcagc aagtcttttc     80820
     atcacatcac aattgtacga taatcaagtg tcgtgccttt ccgtgcatcg tccgttcgtc     80880
     gctatcaaca tacgtagatc ggctcttttc ctcgcgtcgc gtcctcctcg tccctcgttc     80940
     acctcttctt ctggctgact ccctgcgcgt gcaccacctc gccgcccagc ggcgcgcgca     81000
     tggtgttgac gaacctcgtg tacgtccgga acatgttcgg tcccatctga cgcccgcccc     81060
     ccgttcgacc ctcgccgccg aagttctcgc cagcctcggc gccggacgtg ccgtagttga     81120
     ggttcacgat cccgacccgt aacgcgctcg ccaccgtctc gaagacgtcc tcgtcgccgg     81180
     tgaagacgcc ggcggagagc ccgtgtccgc cgcggttgat atcgttcacc acgtccggta     81240
     actggccgga cctgtaccgc acgaggtgga gcaccggtga gaagagctcg gcggcggtcg     81300
     gcgggtggtt aaatcccggg gcgcggaaca gcgtcggctc gacaaaatta ccgccgagcg     81360
     cgcggccgcc gcatacgaga atcgaccctt ccgcgatgca tccgtccacg cctcgtttaa     81420
     accttcccac cgcgtccgcg tggaacaccg ggccgacgtt cacgccgggc gtgaacgggt     81480
     ccccgatgcg aagctcctgc ttgtacccag ccacgagaag cctctcgaag tagttgtaca     81540
     cgtcgtcgtg cacgtacgcg accctggtgg acgtgcaccg ctggcccgcc gtgcccgtcg     81600
     cgccgaacaa caccgactcg accgcctgcg cgacgtcggc gtcggcgtgc acgatgaccg     81660
     cgttgttacc ccccaactcg aggagggtcc gaacgcccaa gcggcgtgtg ccctcagacg     81720
     cgagcgattt gagaagtgcc tcgcccatcg cctcgccgcc ggtgcactcc cacatcgcga     81780
     acctgccgtc gcgccacatc cgtcgcgtca acgcctcgtc gtcgcccgcg tcgacgcacg     81840
     tcacgagccc ggagaagccg ccgttggttc ggagcacgtc gtcgatgacc tcggtcagcg     81900
     ccatcgcgca cagagtcgct tttggatgcg gcttcctgta aacaaaaaaa tcacgtcatt     81960
     cagtcgaatt gcccatacgg aaacaaaata aactcaccac acgacgccgt tacccgtcgc     82020
     caacgccgga agcgcccccc acgcgaacgg cgcgtacgga aagttgaacg cggtggtctt     82080
     cccgacgata ccgatgggta aggcgcgttc ctcgccgtac cagccgagcg actttcgcgt     82140
     ttggtcgcgc gactcgtacc ggcgaatggg atgtgcgaga gatccgccgc attcgtcgcg     82200
     acgctcgccg atggcggcgg cgacttccgc aatctcctgc agctccccta aggactcgct     82260
     cggcactttg cccacctcca gcgtcaggag gttaccgagg tgcgtcgagt ttttcgcgat     82320
     ggcgtccgcg atggccagga cgatacgcac gcgttcgtct ccggggactt tcgcccatct     82380
     cgcctgcacc ttttgggcgc gaaggatcgc ggcgtcgacg tggggccagg cggcgacgtg     82440
     gatggatgag aggcgggcgt tcgtggtggg atcgaacacg tcgcgcctcg tgccttcggg     82500
     tgcgaacacg gagacgtcgg ggaggaccgg gcggagcggt cgttccctgc ggcggtcgtc     82560
     gaggtccagc gcacggagcg tgtccctcga tatcttttcc cgcgagttgg cgcgcgcgag     82620
     cgccaactcg gggtggccgc ccaccaccgc gtagacgggc tcgtcggtgt cggcgttaga     82680
     aaaggtgcgg cggggtaccg cgacgacgtt cgactcgttg gcacctccgc cgtgggatat     82740
     ccgagtccgg ggcagccacg cgggctgcgg gttatcgtgc acttcaagcg ccggcggtgc     82800
     ggcgtcgcgt gcgcgaggtg tcagtttctt tttcttggga cccgcggcat tgaccacgag     82860
     tcgcgcgggg ccgcggagac cgcgggttcg cggcgcggag ggacgcgcga gcgggggcgg     82920
     gcgcgtgcgg agcatccttt cgcgcgtgtg ttcggaaact gcgttgggaa actggaggcg     82980
     cgggtgcggt gccaagcgcg tggggcgtcg gcgaatgacg tttggggaaa ttcaccgaaa     83040
     gtccacgtcg gctttttttt gggtccacgt cggatttctc ggcaaccccc gcgcgatttt     83100
     tgtttccccc tcttctcagg aacgacggtt tgttttcgtc cgctttccgc tcgtgggtgt     83160
     ttcgcgcgca aagaatctcc aatttgagat cttgctgact tggagaagac gcggcgcccc     83220
     tttttcggcg aagcattgcg cccctcgaga cgggacgaac gaccgcacaa cgcgcgacgc     83280
     aacgacgcga cgagaccgca tcgagcgtcg aaagcccaat ctcttcgacg agcacccccc     83340
     gagcgccgcc gcgagtgaat ccgcggcccg tgagatactc ggcaacccca ccgcggaagc     83400
     gcgacgaaga aaaaaataac gcaaaagtaa aacgcaaaaa tgctcgcgtc gacctcgacc     83460
     ccccgccgcg cgaccgctcc gcgcgggttc gggtttccgg acgtgacgtc gcgtaaccgc     83520
     gcgttctcaa cctttgggac gcgtcgccct cgcctcgcga gcgccaggac cttccgcgtc     83580
     gccgccaaat cgtcgagacc cagcctccgc ggcgcagcga acggggccga gaacgaaagc     83640
     tccgggaccc tcgacgccga gaatgggtac tggcgcgtcg aggccgcgag cgtccagcgc     83700
     gcgcgcggca ccctgcggag gatatccgag ttcgccggcg agcgcacgac cgacggcata     83760
     ggtgcgcgcg aacccccccg ccgacgccgc gccgccgcgg taacacccga cagccgcgcc     83820
     agtctgacta ggatcttccg agctaacacc gagccaacac cgataccgcc ggtccccccc     83880
     cttcgcccgc tcaccgcccg cccccccctc gagacgcagg cgacgcgcac ctcgcggccg     83940
     cgctcgcccg tgaccacgac ctcatccgcg ccatcgacga cgccggagcc ctccacgacc     84000
     gcctcatcca ctcgcagggg ctctgcggcg gaaggtgcta cgccactctc ctcgcgctgg     84060
     acgaggattc cctccgcgcg agactcacca aggacgtgct caacttttac cccgaggatg     84120
     gcacgcaacc cttcgtgccc ctcgccgcgc gcggtccctg gatcgtcacc gcgcacggcg     84180
     ccgtggtgta cgacgccggc ggctacggca tgaccggctt cgggcactcg cccgacgact     84240
     tactcgacgc cgtgggtcgg cccgaggtga tggccaacgt catgactggg tcattcgcgc     84300
     aggcggatct cacgcacgcg ctgcgccgcg agattggacg caactggcga ggcgccaata     84360
     ggggccgaat gatggtgacg aacgagaagg acgccgagga cgacgacgcc gcgtggacga     84420
     accagctgga acacccgtac gcatccttcg cgtgcctcaa cagcggcagc gaagccgtga     84480
     cgctggcgct tcgagtcacc gacgttcgcg cgaggacgga gatcgacgtc aagggcaaga     84540
     cgccggtgtt catcgccctg aaggggtcgt tccacggccg gacgaacagg gcggggacgg     84600
     tgtcgcacgc gacgcacggc ctctacgccg aggagctcgc gtcgtttcgt cccgggaatt     84660
     ggagggaacc ttccaagtcc aagggcgcct tcgacgtcga cgactttttc cgcgccgaga     84720
     cccaaacctc caaagacgag ttcactgccg aagatgccga cgacgagtgc gactccgact     84780
     ttgctcaccc cttctacgac agctggaagg actgctggca gcacaagcgc cgtaaggacg     84840
     acgtcgaggc gcttcgaggc gccggtcggg acgcgaacca acgcgagggc ttcgataccg     84900
     acgagtcgtt ccaaccgccc ccgtgcctct tcgtcgaacc caacgacgtc caaacgctcg     84960
     tgaacacctt cgacgcgtgc gaccgcgcgg ggctgttcgt ggaggcgatg atcctcgagc     85020
     cgtgcatggg ggagggagac ccggggcgga tgatcacgag ggagttttac gacgaggcgc     85080
     ggcggctcac gaaggcgcgc gggacgttcc tggtgagtgt attttactct ttgtgtgggc     85140
     ttttcgaatg acgtggtttt ttttacaaac aggtggtgga ctccgtgcaa gccgggcttc     85200
     gcgccaccgg cgacctgtcg ctggtggact ggccgcggtt cgccagctgc gaaccgcccg     85260
     actttgaggt cttctccaag gctctgaacg gcgggcagtt cccgctctcc gtcgtcgcct     85320
     tctccgaacg agcgcgagac gcgtacaaga cggtgaggtt attttcacct tcgaagacta     85380
     ttttcgtaag ggcaattaga atgacgtgat gtgttttgtt gatagggaat ctacggcaac     85440
     acgatgacgt ttaacccccg agccgcgagg gtgggaaccg cggcgcttcg agccatgacg     85500
     cccgcgcgcc gcgccaacgt ggtcgagcgc gggaaagagc tgctgtcggc gctggaagac     85560
     ctcgtgcgca ggtgagttca ttgtagttta atctttgtat gggcaaatcg actgacgtgg     85620
     tttttcaaaa caggtacccg tcccacctgg accgcgccgc cgggtccggt ctcctcgccg     85680
     cggtgcactg cgcgccgtcc gtgcgcgtga cgggcgacgg cggcctcgag gagcggtgcc     85740
     gccgcgcggg gctcaacgcc gtgcacgggg gcgaaaacgc gcttcgtttc acgccgtggt     85800
     tcgacatgtc caccgaagag gttcgcctcc tcgcgaacgt cgtcgaggaa gccctgctgg     85860
     gttggatgcg cgataacggg gaggggaacg acggggttga cgtcgcgaaa ccgcgagatt     85920
     ccttctccac ggcggcgtac gcgagcgcgt acggtttcgg ttccacgaaa accccgaagg     85980
     aggctcggtt cgccaagttt gacaaagcca agtttgaccc gccggatatc gagctcaagg     86040
     cgaaaaacta cgacggcacg ctccgcgact ccgcgaagac gcgcgtcgcg cgacgcgtca     86100
     tcgacgcggc ggtgggcaag tacctcgcga ggaaccccaa ggtgagggcg gtcgcgtcgt     86160
     cggtgcgagc ggcggcggcg gcgtcgtcct cctccgaagg ggttaagttc accggtacct     86220
     acgccccgag cgacggcgac tgcgaaggtc tcccgctcga ccacgtcgcg tttcgcacgt     86280
     tcgcactgcc gaacatgggc atcgacgccg tcgccgggct cttcacgtcc ctcgggtacg     86340
     tcgaggcgag cgatccggga aagctcggcg acgggccgat gcgatttccc gagaagaagg     86400
     ttagcgccag gtggttccgg ccccccgacg cgacgccgcc gctgcccaga attttcatct     86460
     ccgagctgga cgtctccgac ctgtccaacg ccgcgagggc gacgatcgag gcgtacgtcg     86520
     gcggcacggg cgacggcgag cacggcatgc tcttcagcac gcagtccgcg tccgcggcgc     86580
     ttccgtacga caccaggcga ggcgcgcgga agaaggagaa gaagaagagc aaggttcggt     86640
     accccggcgc ctttgccgat ccggactttc acaaggacac gttcgagtgc gtcctggacc     86700
     tcatcgagga cgtctacgcc acggcgggag accacgcggc gggagtggcg tcgcacatgt     86760
     gctgcgacgg ctgggacacc ccgtgggacg tgcggggcat cgccaaagcc gactttgacc     86820
     tcttgacgaa cgaatccgaa tacgccgcgt ggacgctcgt gaacggtgag tttattttca     86880
     ttttcgtatg ggcaattaaa atgacgtggc tttttaaaac agggtacgcc gtgaaccacg     86940
     tcgccatcgc cgcgcacagg ctcccgctcg agtccggcat cggcgacctc cgttccctca     87000
     acgcgttcct ccagggcgac gtccccgccg ccaggctcgt cccagtcact ccgcccggtg     87060
     actcaccggg ccccggtgac tcaccggcgg tgagcgactc ggaggatgac gcggagaagg     87120
     ccgtgatccg ccgggaaatc ggcggctacg gcgagatacc cgaggagcgg tgcttcagcg     87180
     aacgatggga aaagttcggc gaggacgggc tctacaggtt catcgtcgac ccggtggcct     87240
     gcccgacgag tggcggcccg cccaacgagt ggaacgactt cgaggacgag gacgatcaaa     87300
     cggtggatca aaccgagccc ggctccgggg tggacgcctt cacccgcgta tcccccgacg     87360
     gcggcttgct ccagtcgtca atctccgccg acgtgcgttt ggtgaaactg ttcgacgagc     87420
     gcgtgggttc gctcgtggag tgcgccgtgc ccggggggta cctcgagatt gtccagaggc     87480
     gtccactcga tccgaacgcg atttcggcca acgtcccggc gcagagcctc ggggactcgg     87540
     cgcttcgaga cgggttccac gagggcaacg cgaacggaat cttcgagtcg acgtttcgcg     87600
     caaacacgca cccgcgggcc aaaggggctg ccgacgcggg taaaggagga ggtggcgagg     87660
     ttggtaaagg ggctaagagc tccgcggtgt cgtggtccct gcgcagggtg aggagcgcgg     87720
     aaaaagagag ggacacgttc ttcgtcgacg cggattgcga cccgagcgac gaggagtgcc     87780
     actacgcgtt ctgagaaccg acgtgggtgc cgactttcac tcttccctga ccatgaaccg     87840
     acgcgtcaac gcgtcgcctg ctgttttgac gatgtctgca tcacgtatga taatgacaat     87900
     ctacacccta cgatgaacca acctttccaa agccgttcga cgaaaccaac ctcaataata     87960
     gcgcgtctca cgactccgcg atctccgtcc gtcgcgcctc cgactccgga tccctctcga     88020
     gcaccctcca caccacctcc gccgccgctc cctgcgcgac ggcgaccgtc atcggcccga     88080
     agaacggcac ggcgagggcc aaactgaacg gaaccccgaa gcacgtcagc gccaccgcgt     88140
     tgccccacac caccctctcc tgcgcctcga aatcgagccc cgccttgtca aagtacggat     88200
     ccagcagctc ccacgtcagc gagtacgcgg cgagcgcggc ggcgagcgcg cccgcgatga     88260
     acggtccggc gacgggcacg agggagacgc cgacgccgat cgggacggcg acgcccgcga     88320
     gagtcgcgag ggattgcgcc ctcgccgccg cgacgcccag ggaccgcaag ccgaggccgt     88380
     cggaggcttc gagctgcgcg acgcgggcgg tgcgcgacgc cgcgagggtc gacggggtgg     88440
     cggacgagga ggtcggtgac tcaccggtcg gtgactcacc ggtcggtgac tcgcccggcg     88500
     gcggcgcctt gagcgcgtcg aagaggatct tctcgcccag cagcggcagg agttgctgga     88560
     ccaccgcgat ggccacgagc ggggatacga ggagccacgc gccgtccacg gcgacgagcg     88620
     cgacgcgctc gacgagcgtc cacagcgcgc cggcgtcctc cccggggttg agccatcgcc     88680
     cggtgagggt ggtgccgccg acgtcgagcg cgacggcgac gacgagggtg gcgccggtca     88740
     tcgggcccca gacctgcgac gggttggtca ccgccgtctt ggcccccacg agcgcgcact     88800
     ggaaccccac gccgatggat tccgggaacg gcgtcgggtc cctcagtcgg tggcgcttga     88860
     acgggtcctt cgtttcgtcg cccttaccga agaacgcgcg aggcgcgatc ggtgttgttg     88920
     ttaaacgtcc cggcgttccc ggcccacgac gggtggcgcc gccggggccg agagccgcgg     88980
     ctcgggcatc gcgcgggagg ccgcgccggc gcgcaacgcc cgcccgtcgc gatccgagga     89040
     cggcggcgtc cgcgaccgac ggggcgagga gcgccatccg gcgccgtgag ctgtgctgac     89100
     gaggacgggt gccgaacgcg tcgcgggttc tttggatcgg ctcatcagat ttttggttaa     89160
     ccgcaaacga gcccaatttc ttactgtttg catgtgcaag ttttccgggg cgcgtcgcac     89220
     atgcaaacag tcaggatttg cgcccagcca gagaagcccg gaaaaagatt gaggtgttac     89280
     acaatcttct cccctcgctt gtcgtcggct ccctcacaca gccggggcaa ccgcgcatcg     89340
     ttccaccgcc cgttcacccg ccgcgcgcag aggcgcgtgc accgagcgtc gactcgcgcg     89400
     ccccgttcga gtcgtgcgta aggcccgtcg agtcgcgcca agggcgagct cgccgagacc     89460
     gggtcgtcta acttttacac ggagaagagt gcaaatccga tgggggtcgc gtcgcgaggg     89520
     cacggagagc aagcgccgct gctcgccaac cgcggcggcg acgcgtccgc ttccgcttcc     89580
     gacagcgaga cgccgcgggg tgggggcagg tcgtccagga gcggcggcgg cggcggcggc     89640
     ggcgcgaccg cggtgtgctt ctcggtgtcc atgatattcg ccgggttcat cgtgctcatc     89700
     gtcggggcct actccagctc gatatacggg ttcatcaccg gcgcgttcgt cgacggcgtg     89760
     accgcggggg cgacgtacca tccgtcaacc gagcaggtga ccatacagga cagggcggcg     89820
     gtcgtggcgg tcacgatggc gggcggctcc gaggattacg aggatctcga cgacctgtcg     89880
     cactcgccca agacgccgct cgacgctcag atggagggcg agggcttctc caaaggctac     89940
     cgcgagcact accacctgca ggacaaggac caccagcagt acaccgggag cgccacgccg     90000
     tggaaggaag acaccggcgg agcgggcgcg gagtagagaa acggccgagg aggcgcgtgt     90060
     ttgccctgta aaagtgcatg ttttttgttt taaagtcgtc gtcgtcaatc gctcggcttg     90120
     atcaccacgg acaggtgacc gaacgacacg gcccccgggc tggacccgac gaacaccgcg     90180
     ggcttcccgc cgtactcatc gcacacctcc gccaccgcgc gttcggcgtc gtcggtatcg     90240
     gcggtcagcg cgcacacgac gccgccgctg ccgccgcccg tgatcttcgc gccgaagaca     90300
     ccgcgatctc tcccgcgctc ttccaacaga cgcaccaact tgtccgtggc gtcggaaccc     90360
     aaaccgcacg ccccgtacga ttcgtgcgac tgatacatgt agttacccac ctgcgtcgcc     90420
     acgagttcgg agatggcgtc gtcgtcggcc acctcggcga gccagtcgcg aattaatgta     90480
     actcgtctgt gttccatcac cgggtgcgac ccgcagacgg ccacgtcgta ggtgacgcgt     90540
     tcgtcgatgg acgtgacgtc gtcgccgtgc ccctcagggt acatcacgag gaagttctcc     90600
     ccgctgagac gcttaggcag cgccccgttg agcgacatca cctccaacca ccgggggtcc     90660
     accgaggtgg cgaggtgatc gattcccttc tccggccacg tctgcttcaa gtgttccctg     90720
     aacataaacg ccgcgcacct aaccctgccg taatcgctct ccccgtcgtt gctgtgcctc     90780
     acgccgctgt cgatgcccca caacttgcac ccgcgaggta tccggacgtg cccgagcacc     90840
     gcgttgttcg aacagaggag cgcgagcagg cgcgattctc ggcccagcga agccgtcatc     90900
     tggtccatga tcccgcatgg cgcgcccgcg acggcgttct cgcacagctg gcagagcgcc     90960
     gcgagctccg cgccgccctc gtcgccgtcg aagggaacgt tcgcaaggac ggcgagcgcg     91020
     cgcatggacg ccacctcgca cgcggcggac gacgacacgc ccttcccctc gggcaccgcc     91080
     gaacgcacga acatcgagac gctttgcccc tgaaacctcg cgcccttctc cttggccagc     91140
     acgagcgcgg tcccggcgac gtacgccgcc caccgtgtct ttggatccct cgcgaaccac     91200
     tcgcgcgcgg cgtcgtaggt cagcgacagt aagtcgtcca tcgcgcacgt gaacgtctcg     91260
     gcgcgatcgt tcgcgtcggt gctcgacccg gggaggatcg gggagacgac ggtgagggtc     91320
     gcgcgcccgc gcggggcagc gcgggtctgc gccgcgacgt ggcacgcctc cgcgatgggc     91380
     atctgcagca cgagcgagcc ggagtagtcc gcgatgccgc ccatgaagtc cagccgcccg     91440
     ggcgcgcggg tcaccgtcgc ggggagcgca aagtcgaacg cgctcgcggt ggttttggag     91500
     atctcgtcgc tcccgccatc ttcggctctc gcgcgaagct cgcggatgaa ctccgcggtg     91560
     tcatcgcgga gcggggactc cgacgacgcg gatgcatcgt cgacgatccg cgcgcctcga     91620
     agatcggtcg gggacgccat cgacgtgagg tctacgcgtc tgctatgcga tcaacaacac     91680
     tgccagcggg ttccgccctc taaaactaaa cttacaaaaa gagtcgagtc cggcgccggt     91740
     acgtctaccg ccccaccggc gcggttctcg tcccctgcgg cggcttgtac acgtacggat     91800
     cgtcgtccac cacccgcctg ttgttgtact tcacgtcgta ccactcggcg gcggcgcttc     91860
     ccagcaggca ggtcagcgtc aaggcctggg cgtatatgcg gctgtgaatc accttcacgg     91920
     acggcgagag gctcgtctgc gtggcgttgt acgccatgga cgcgcccatg ccggtgagcc     91980
     acaccccgcc gatggcccgc agcttgtgct cgcggcacca ctccgcgatc gcgcccagca     92040
     tcccggtccc tccaccctcg ggcgcgccga tctgtgcggc gacacccggt cacgtgtcat     92100
     cacgtccgct cttgcttccg gactcgcgaa atcacacgcg ctacactgag aatacatcac     92160
     aactctatgc agccctcgca accccgccgt gagtagtgcg acgcattccc tctcacgccc     92220
     tccgcgcatc cccgtcccgt ccccgcccgt ccccaccacc cccaccaccc acccgttcat     92280
     cccacatcct cgcgagcgcc ccggggtgcg acgcgatcca cgacaagatc gccgcgtcca     92340
     ccgcgcacgc gacgttgacg tagagcagct gtgaataaaa aaccacgtcg tcgtcagtct     92400
     aattgaccat acaaagatag gaaaagatta aaataaactc acctgctttg acacggggac     92460
     aaacgcgaag ttcgccgtct gcacgggggc ccagaacgcg gtgtcgacga cgagcccgga     92520
     gaggaaatcc gacccgacgg aggctctggc gcggctgagg gcggcgcgta aggtcccgcc     92580
     ggtcctttcg cgtccccccg ccttaagagt acccttcgcc tcttccccgc gcgtcttctc     92640
     gccccttttc tcggctcttc ctttcgacgg cgacggtttc ctccctcctc ctcctcctct     92700
     cgcggcgtcg tcgtccgggg aggcgcctcg ggggaaggac cagaacccgc tccacccgag     92760
     gaaacacgcg aggtgcgcgg ggccgaacac gcacaggtcg aaggcgagct tcgccgcgac     92820
     catcgcggcg cccccgtatg ggatgaacct ttcgcagaaa acgaccaggg cgccctcgta     92880
     ccacaggtgg ccgacggggc ccaagacgac ggctccgtac gcggcgttgc tggcgagcct     92940
     tcgcgtgtcg atgctcgtcc gtttctcgag cttctggcac gtcagatcgc cgatggacca     93000
     gagcacggtg gactgcgcgg aagctttcgg gatccctctc gccaagtccg agagccccgc     93060
     gcggaatctc ccgcgcttgc ccaacgacgc ggcgggttgg cgcggggggg ggttcggagc     93120
     tccgatgggg agcgacgacg ccatatcggt cggtcgcggg gaggatcggg tgcctcgccg     93180
     ggcctgaaca gtgtccgccg cacccgaaag cgcgtgcaac agataaagtt tgaggcgtgg     93240
     gtttccgacg gcacggcttt tctcgaccgt tacctcataa aaatgcgcgg agacctcgtt     93300
     ctccattttt tgtatggctg aacaggcaga gacgggtgca tttggatgca aatgcgtcgg     93360
     gagatcttcg cccgtatcga aaagtcgtac gatcaaacag ttatgaccgg gttcgttttg     93420
     gctgcattca gtgttaatcc aaaaaccaaa aaccaaaaat tctcggcgac agctggggtt     93480
     cgtttgaaat gtcgtctccg ccgacggggt ctggcgcaca gcgccgcggc acgatggagc     93540
     cgcccgcgat caccccgtcc ccgcggggaa tcctgcgacc gagcggcagc ttcaagaagc     93600
     ggcagctgga gaggctcagg ctcgaggaag cggaggaagc ggaggcggcc gcggtccaac     93660
     cccggccccg ggtgggtcag cgcctgttcg ccggcgacga cgacgaacga ccgtgcccgt     93720
     ggcggcgcgc ggagggtcgg agcgtcgacg acgacgccgc ggcgcgcgag gcggtcgagg     93780
     cgcgcgcggc gtcgtcggga cgggcgaggg atcgacgcga ggcgcgggag cgcgacgagc     93840
     ccggcgacga gaacgcgacg gggtgggggt cccatttgaa aatctcggac gttgacgacc     93900
     ctcgcgcgcg ggacgacggc ttccgcgtcg ggcgcgccgc cctgagcctc aaggcggagg     93960
     ttcgcgaggt ggacgccctc gtcgatgcgc tcaggggaat gtgcgacggg gcgtccgaat     94020
     ccgacggcga cggcccgggg ttctcggacg aggtgaacga ggttgacgag tccgacgcat     94080
     ccttcaggag cgcagaggag gaacccgcgg ggggggaaga cgacgacgac gacgacgagg     94140
     aagaagacgg gtgcggcgga gcgaggtgga gccccgatac cgtcctccgc cccgacggcc     94200
     tcttcgacga atcgccgtcc ccgaccgccg accacgcgct caggcggcag agctcggtca     94260
     ccttcgacga cgatcgcatc accgtgcacg acatcgggtc cgtcaaggac ctgcgccggg     94320
     agaagcggac gtccatcgcg ggcgcgatcc tcgagtgggt caaggctgac gtcaggggat     94380
     tcgtggaggg ggtggtagga agggggcgac ggagggacag cgcggaggag gctgagagcg     94440
     ccaaggcgac gcgtaaatcg ctaagagagt cgaggcgaaa catgtacgtc aacgtggata     94500
     acgcagcgta cgggtactgc ggcgacctcg gggacccgga ctttaccttt gtttaattgc     94560
     cataagacgt agtgagttaa ctaactcgac ttagaatacg atgcgctcga gccgatcgtc     94620
     gcgcgtcccc cgtccgtcac tccatcacgg tgaagttggc cgcgccgtgc tcgaccaaca     94680
     gctcgacgca agcctcgtag tccccgcccc gggcgcggtc cgccgcggtc cgcccgtccc     94740
     aatccctcgc gctcacgtcc gcgccgtttt ccagtagcac gcgcaggcac ttgaccttac     94800
     ccatgaacgc ggcgtcgtgc agcggggtgg agaacacgct cccggtgttc acccccgcgc     94860
     ccctggccaa cagaagtttt aacgcttcaa ccttgccgcc cgccgccgcg agctgcgtcg     94920
     ggaccacgcc ccgcacgtcc gcgcgcgtcg ggtcggcacc cgcgtccagg agcgccgcga     94980
     cgatcttcgc cgcgtcgtcg tggtcgaggg cgacggcggc ggcgaggggc gtgacgccgt     95040
     cgtcgtccgc cgcgttcacg tcgcaccgcg cctcgaccag cgcccgaacg catcgggagt     95100
     gaccgcccag caccgcgcgc atcagagcgc tgcgaccccc ttcaccgacc ttatcccgat     95160
     ccccacccgc gtcgagtaac gcctcgaggc attcgtcttg tcccgtcgac gccgcgtagc     95220
     tcaccgcgct gtcgcccttg acgtccccga cgtccggtga acccgacgcc cccagcagcg     95280
     aatggaggca tcgcaccgcg ccgatctcgg cggcgaagga gactggggtc cgtcccgatg     95340
     ggtcctgcgc gttggggtcc gcgccccggg agacgagatc ggcgaccaga gactcgtccg     95400
     aggcgaggac cgcctcgacg aggaggcgct cgtccggcgt catgtgcggc gagcgacgag     95460
     ggtgggcgct aactgaaatg agttaaagtt tccggagtca tcagttcggg gcgcgccgac     95520
     ctcatggcga tgaagacgac gatctggcgg ccgaacgtga gagtgacgct cgacgagtat     95580
     ggggaagtcg aggacacgga gcgaggtgga gaggaggtga cgaagaaggg cacgaagcgg     95640
     aagagagccc ctcccacgaa ggggccgtgc gagcacgggg tgaagtatcg gtcgaactgc     95700
     aaggtgtgca gcgcttgtcc gcacgggcgt cagcgctctg tatgcaagga gtgcggcggg     95760
     gcatcaatct gcgagcacgg tcgtatgcgc tctcggtgca aggagtgcgg tgggggctca     95820
     atctgcgagc acggtcgtcg gcgctctacg tgcaaggagt gcggtggggc atcaatctgc     95880
     gagcacggtg gtcgtatgcg ctctcaatgc aaggagtgcg gcgggggtgg aatctgcgag     95940
     cacggtcgtc gccgctctcg gtgcaaggag tgcggcgggt ctgaaatctg cgagcacggt     96000
     cgtcgccgct ctcggtgcaa ggactgtcga ggcgaacgtc tgtaatcaaa cacgcttcca     96060
     cgacaaaggc ccgctggtat aatgaagtca agcgcgcgtt gatttctgtg atgtatttta     96120
     caaaggcgcc ggtatcgcct acatgaactc cctgtccggg aagagcgccg gggcgatgag     96180
     gctccacgtg tacaaacccg cggtcaccca cacgctgcac attttcaccc acacgctcgc     96240
     ccacccgacg tccaccctct ccgccccctt gtagtcgtcc cgcccccacc ccgtcatcag     96300
     catcgccaaa aacatcgacg ccagcgcaaa gatgaagtga aaaaacgagt agctgtagct     96360
     caccggaccg ctcgggtagg acgccgcgcc gccgacgtcg tcttcgctgt ccgcatcacc     96420
     ggcgtcggca tccgtcccgc cgcccatctc ggcgccggag agcgccgcgt agtccccgtc     96480
     gccgtcgccg aggttgaccc ctccgaaaaa gtcgctgctc ccggctctca ccgcgctgta     96540
     cgcgacggac gcgagcgtca acaccgtgct ggcaacctcc gacgccttcc cgtccccggc     96600
     gtacgcgcct ctcgggttac acctgtactc cgtgggctcc gacgcgagcg cggagtagca     96660
     caggtagacg cagtacgacg tcaccaccgc ggatggcagc agcgatccct ctttggcgat     96720
     tgggtgcgtg gacagcgcgg agaagaacac gcacggcacg agcgacgtgg ttatgagcca     96780
     cgcgttgcgt ccgcagtcca atcccttggg cgcgtaccac tggtacatga acacgacgag     96840
     tgtgatgctt ccggcgtaca gcgctatggt tgaaacgagg agtccgacga cccacccgac     96900
     gtgctctcgc gccacccagg tttcgttcca gagaaaggcg aaatcgagga ggatgaccat     96960
     ctggacgacg aggaagacgc cgctgccgag cctggcgagc cacgcgtacg cgtcgatgaa     97020
     cccgtcgggg aggaggaagg ggacgatgac gcagagcgcc cacgcggcga gcttgagggt     97080
     ccaggagccg tggtgtatgt gccggtccct cgggtcggat ctggtcttgc agtcgacgag     97140
     catcgcgctg aggccgccga agaacatgaa gttgccgagg gagacgcggt acacggcgct     97200
     ctgcccgaac cactcgtcgc tgggttgcat gccgggcaca acccctatcc acgggatctc     97260
     catcatcatg ggctttgcgt agtcccgcat gacgaccgct atgcccattc ccaggccgaa     97320
     gatcaccgtg tacacggcgc gcgcggagat ggagctgacc gccttgccca acgagccgca     97380
     gcacgagcac gtggcggtca tgcacgcgct gccgatgcag taagcggcgc aggcctgcat     97440
     ttttaagtcc gaaccccgtg caacccggcg cctgctcgag tgcccccaac gaccaatttc     97500
     agggctgacg tggacgcgac gcgacgttca aaacttcttt ggtggctaaa aaccgagtcg     97560
     acggcggcga tgaatacaca tcgtgtgctt gcttgcgtgc tgattgagtg aaacgtaaag     97620
     gatatgaaac tcgcaccaac tcccacgcgc ggcggtcact tctcgccgcg cgcctccgcc     97680
     gcgacgcgcg cggcccaagc cttgatctcc tcgggcgaca tggctcccag cttctcctcc     97740
     cggttgcccc cggcagccgc cttgaccgcg gcagcctccc tctccctctc cgcctccgcc     97800
     tgcgcagcct tggcctccgc ggcgacccgc gccgcccacg ccttgacgtc ctcgggaacg     97860
     cactcctccg gctgcgcgac gccgccgccg atggcggcgt cggagcatcg ctcccgcgct     97920
     gcgggagagg gctggtcgaa gtgcccactc gggacgtcgc cgcgggccag gaccagcttc     97980
     atctcctggg agtgggtcat catggcgccc tggatgtcct cgttggacgc gccgtccgtg     98040
     gcgtcgagcc actcgagggt ggcgacgggc tttccggtgc tggggtccgg ggtgaggacg     98100
     acgtaggtgg tggcgaggat gacgtcgccg atcttgatct tcttgtgcgc ggtgcccccg     98160
     ggtttgcaca cgcggacgtg gaggaggccg tcggatctgt cctggccgag catgaggccg     98220
     gtcatgttca cgccgcggga gcagtcgacg gagacctcga ggacgtcgaa ctggccttcg     98280
     acgcccttga acttgccgaa gaatccctcg tcctcgtcag cctcctcgac ggcttcctcg     98340
     tcgacgacgg cggggggttc ctcctcgacg gcctcttcga cggcgacctc ctcgacggcg     98400
     gcggcggcgg ctgcggcgag gtcgatggac tcctcgggaa gtcggtaatc gtcgtcgtcc     98460
     tcctcgtcct cctcgacctc cggcctcgcc tccgtcgact cctcgacggc ggcggcgacc     98520
     agggtgggct cctcctcagc cgcgggctcc tgctcgacgg catcctcgcc cacccactcc     98580
     tccgcgggga cgatgatatc cgggtagatg gcgccccacg cgtccctgac gctgtcctcc     98640
     accggcacga ccttcttgcc gaccaggccg ccccagatgc cccgcggcgt gttgtccttg     98700
     gccatctcct tcttcttctt ggcgccattc ttcggcttct cctcctgttc cacgtggtac     98760
     agcagcctgt tccagcacga gcggatgtcc ttggcggggg acgtgggcac gagctgcgcc     98820
     cacgcgctgc ggatggcctt gtcgcgcttg accacgtacc cgcggcaggt tctcacgttc     98880
     atctcctcgc cgtgcgtgag gagcatcgtg agggtgtgct cgggtccgtg cgcggtggcg     98940
     tcgtgccacc tgagctcctc ggtgaactcg ccgtcctcgt cctccacgtt gacgagcagc     99000
     gagcatccga ggaggacgtc cccgggcttg accacccccg cggcggtgcc gccgggtcgg     99060
     atcttggcga cgacgaggag gccgtcgggt cccttctcga acacgagtcc cgtcgcgttg     99120
     gcgccaccct cggcgtcgag ggtgacgtcg aagacgagct ccttctttgt ttgtgaagcg     99180
     tccttgtcgt cgtacttgtc catgcccgag cgcgcggcgc gttcctcggc cagcgccggg     99240
     tcccgcgagc gcgactgcgg gaccgcgccg aatgagtact ggacgatgcc ggacttggtc     99300
     tcggatatca tgacgcgcgc cgccgtctcg gtgcgggtca ccgcgttggt gtcggcgttg     99360
     gtgctcgtgg acaccgcgac gattcccctc gatcgaagcg gtgcgacgcg tcggtgatgc     99420
     gcgcgccgcg aacgggcgag gggcgacggc gcggtcgccc gggtgaggag agcggaggcg     99480
     caggcacgat tggccatctc gagtccgcgc ttttgtgaac gaacgggcga gagttttggg     99540
     tttggcgcgt gggagccgcg gagggcgact gcgagggctt cgcgaggctt tgtcgcggtt     99600
     cgtgctgcga ccgtcgagcg tgggctcgag gcgagtcggc ttcgctgctc ggactgggcc     99660
     ggggaggggc gttgtgaccg ccgcgtccga agcgacggct cggcaaaaag atgacttggc     99720
     acggacggga ccgtccgtgc cgaggcgatt tgggagaggt gccgaatcgc acgttttcca     99780
     tggtccaaat cgtacgagcc caaatcgtac gaaatcccag tctgccaaaa gtgtcaaaat     99840
     ccgcttcgga tcaataaaag ttaacggtca tctgcccgat ggagctgctc acgtggcatc     99900
     tccgagggcc cctttcgcgc cgcgcccacg gggcgggcat gcggggcggc gacctcatcc     99960
     gcgaggtctt cggcagcgaa agcgacagcg acgatgccga tgagctcaac cgccccggcc    100020
     cgtccccgcc ctcgccgctg atgcgacccg gatgcgtcgt ggagaccccc gccggagcgg    100080
     acgcgtgcgt cgggatgttc gtcgcgaggg aggcgctggg tgaagacgcg cggcggtggc    100140
     tcctggacag catacgcgcc gacgacctcg tggatttccc agacgatgaa ccatcgacga    100200
     cggcgtccga tcggtgcgca cccaccggcg gcgcgcgcaa ccaggcgatg cggttcggca    100260
     gggatcacct tccgcggtgg gcgctcgcgc tcgccgacgc cgtcgccaag ctcgcgacga    100320
     gaagacccgg cgactcccaa ggcgaacacg acgtcgcgtc ggcggaccat acggacgacg    100380
     acgacgacga cgacgacgcc gccgtcttcc cccgcgaggt gctggcccgc gcgcgcacgg    100440
     catccggcgt cttcaatcag atgatcgtca accagtacgc gcctggcgag gggttgacgc    100500
     cgcacgtcga cctcgaagca ttcgccgacg gcgtcgcggt ggtatcgctg cgatcgacgg    100560
     tcgtgatgga catgtacccg ccgggattcg aacccgggac gtcccacgtc cccaccaact    100620
     cgaacacggt gccggtgtgg ctgaggcccg gggacgtgtt gttcctcagt cgagcggcga    100680
     ggtgggaatg ggcgcacggc atcgcggcgc gcgacgcaga tcccgcggag ggcgagacga    100740
     ggtccgaagg cggcgctgtc gtgagacgcg ggtgcaggac gagcgtgacg cttcgcgcga    100800
     tgcgcgagga cggccacgag ctgagggtgc ccgcgtgacg gtcggttcgt ttaggaggcg    100860
     taggcgtggg cagatcccgg tagaggttgt cggttgacac gtaacactta agagttttag    100920
     cagcagcacg gaccagccaa aatttctgtt gccaaaaacc tggcttcccg agggtttggt    100980
     cagacctctt cgcgcgcacg ggcacgccgg catgtccacc ttcagcgcgc tccgatgcgg    101040
     cgtccgcgtc gaccgatcag cccaaacccc tttcctcgga ctccggcccg gcgcgacgag    101100
     gagaagggtc gcgggttggc gcgaggactc accgctcgcg ccccccgacg gagcctccaa    101160
     gaagaaatcg aagcgcgaca agcgcaaggg cgccgcgacg cccagggtcg aggggggcgg    101220
     taagggcgag gtggacggcg ccgagctcag caccatcgac ctcggccagg gtaagtccgc    101280
     ggcgctgtac gtaccgacca acgtggcgga ggtggagggc gccgtgagcg cggagggtgt    101340
     caagcagctc ctggacatgt acaaggattc cctctacggc gccggcgacg tggtgtggcc    101400
     cgcgtcgatc gccctgagcc gactcatcgc gcactgcccg tccctcgtca aaggcaaggc    101460
     cgtgctcgag atcggcagcg ggctcgggct ctgcgggtgc gtcgcggcgg cggcgggcgc    101520
     gagccgggtg gtgatgacag acatcgacgg ggacatgctc agactcgccg ctgcgtctgc    101580
     tgacgctaac ggatccgcta acgtcgagac catgacgctg gactggggcc agagagagtc    101640
     gtggcccaaa ggcgagttcg acgtcgtcat cgcggcggac gtgctgtacg acggggacgc    101700
     ggcggcggcg gtggcggggg tggcggggag atgccttcgc gggggcggtg ttgggtcgat    101760
     ggcgattgtg tgcgacccgg cgcagcggac ccaccggggg actttcgcgg aggaggcgcg    101820
     gggggttgac ctggatgtgg tggacgcgga ctttccgggg cacccggaca tgcggctgct    101880
     gcaggcgacc agggtggagc tgaccgcggg ggcgtgaggg agagggagat tagctgggta    101940
     ggctcgtagc ttgggaaact tggaactgtc gtcacagatc ttggcaaatc ctgagcactg    102000
     gctttatcta tggatagtct atccacatcc cgacctgcta cgggcagccg acccccgcgc    102060
     cggacacgtc acgacgatga tggcgtcgca caccgcgggt ttattcatga gcgcgcgggt    102120
     ctcaatccgc gcccggcggc tgaacggccg cgcccccaac cccgcgccgg tgcgccggag    102180
     cgcggtcgtg atcgaggcgg ccaaaggtag gaacgctaaa ctggcgggtc gcaacaagaa    102240
     ggctcagtcg atcgaggaca acaagtggcg cgagggaatg gaggcggcgg cggccgagcg    102300
     cgccgacaaa aagaaggcgg agcccaagca gtcgggcctc aagtacagca agcggggcaa    102360
     ggtgtcgtcc cagcccggtc aggtttccaa ggcggcgttg aagcgaatga agctcgatct    102420
     cgaggagaag aaagccaacg acgcggtgtc ggccgagcgg atggaggaga agcgggcgca    102480
     gtaccaagcc gcgtccgcca agggcatccc gcaggtggtc accgacagga tgctcaagcg    102540
     aatcaccatc ttcagcggcg tgcccctcct cctgggtttc agcaccggcc cgctgttcta    102600
     cctgggtaag acggtggcgc acttcgacct ggcgccgtgg cagttcttct tcgcgtccac    102660
     cgcgacgttc ggagccgcgc tcgtcggcat cacctacggc gtgctgagcg cgtcttggga    102720
     gcccgggcgg gagggaagct tctggggcgt caccgaggtc aaggcgaata taccgatcct    102780
     ctggcagacc atactgggca aggctggagg aaacatcgag acgcaatggg aagacgagtg    102840
     ggacgacggg agatgaggga cggtgacgac atagacgacg atgacactcg atgcgatgtc    102900
     gctaatcttc agttgtctaa taacaatcac gcgtctaaaa cggcagttcc gtcacccgag    102960
     gacgtctgcg agccaactcg aagcctccgc ctttttctcg cgtgcctccg cctcctcagt    103020
     ctcctcctct tcctcgcgca cccgctcgac ggcctcctcc atcgcgggcc cgtcggacca    103080
     gaggtcctcc atcgcccgcc gttccatggc cgcctcctgc tcccgaatct cccgctctcg    103140
     agcgtcctcc tcatcccgca gctcctcctc catgcgtgcc ctgttcttgg ccgcccaatc    103200
     gtcctccttc ggaagcacgc cgtttagtat gaaatcgacg acgtcgtccg ccgtcttgga    103260
     cgcgtcctcg gagagctcgt ccagcgcggg cgccatcccc cgcgccagcg tcatcgccag    103320
     atccccggga ttcgacgagt taaccggtag atcctgcacg tggtacgcga tggtcttctc    103380
     cacctttcga gccttcccgt acgacttgtc gttggaggag aaacgcactg gcacgacgtc    103440
     tgttgacgcg ttcgagccgc cgtccagcgc gccgaccgac gccacggcct tgtccacgtc    103500
     gcgccagtcc ccgcccgagc ccaggacgcg ggacgcggtt tcgtccttcc ttttggcgtg    103560
     ttcggacctc cgtctgaccg ttcgaccgtt ttcgcgatcc tcccccgtcg gcggcggcgg    103620
     cgacgcgatc tcgtacgccc cgccaatctc cccgaagtaa tcgaagcacc gcagggtacc    103680
     cgcgcggcac aaacccttct gccactccgt cgtcgcgacg tacgggtggt cacgcaagag    103740
     caaaggcagt cgcgcgagga atcgagcgga gacgacgtaa aacttccatc ggaacctcgc    103800
     cgtgcccctg tccaaaaaca ggacgtccca ccccttgtcc cacccagggt cgtccccggg    103860
     gtcgtccccg gggacccttc catccctaag gaccgtcccc gggtgccgac ttttcatccc    103920
     cggggagccc ccccgcagga gctgacgtgc caccgccggg gccatcgcga tgggcggtag    103980
     cttcggatcg ccgggatcgt cggcgtccac caccgccagc gcggggactc cgtcttcccg    104040
     gcgcgcgtcg agccacgcgc cgaggtggcc gagcgaggac gccgcgaccc tctgcctccc    104100
     cctcgcgacc gccaggggaa ggtccggatg gtcgggcgcg tcgaacgcca gaaagtcgag    104160
     gcgcgtgccg ggcagcaagt cggatgttct cgcggtgagc tcggcgtacc ctcctcccat    104220
     cggccaccga tcgggatcgg ggagctccaa cgggacgacg acggcgccgc tctcctcgtg    104280
     gtaccgtcgc cacgtgtcgc tcacgacgtc caaggtgtcg cgctccggcc agtccctcgg    104340
     gttgaccagg acgcggacgg tgggcggggc gccagccccg aagaggtcga cgcggaggtt    104400
     ggacaggacg tccacgagga gcgacgcggg ggcggtggac gcgacgaggg cgacgaggag    104460
     cgcggcgagg acgacgccga ggacgatccg cgcgcgcgac ggggacccat ggttagacga    104520
     gatcctcgcc gtgcggcgaa gtatcagcgg cgcgtgctcg ccggcatcgg ccatggtcga    104580
     ccccggcgcc cgctctcctc ctcgcttggg cgtggtggtg ctagcgcctg cgagatctcg    104640
     ttttactcat cgcacccgcg cgctcaactt cgagcgacct aatcacgcca cgagcgacgc    104700
     tcctccattc gttcagcaca agacggagcg aggcgctcgc gcgggcgttg cgacggtcgc    104760
     cggcgccctg actcggtgcc gggcagcacg cgaggtgccg ccatcataaa ttacgcgggg    104820
     gttacaccga tttttcctcg aacagaaagg acggttggcg agaaacgcag aaacgctttt    104880
     actacactgc gagcggcgcg ttccacttgg cgtcgagggt cttacccccg gactccacct    104940
     cactttccca cgcgtcgtac ccctccaccg tcacgcgata ccccgcgccg tccgacgaga    105000
     cttcacccgc gcggctggcc atcctctgag aattcgtcac gaccaccacc ccgccgtaca    105060
     catcccccac gtccagctcc gttcccgcgt caaccttcgc cgcgaggggc tgcagcaaca    105120
     gacccatcgt ctccttcggg tcgccgaagg tgaggagacg tgagcccggc ggggacttgg    105180
     gcgcgtaccc gttctcgtcc agcggcgcac ggcccaccat accgaacgtc tcgacgtagt    105240
     aacgctccgt cgccttgacg tccgcgacgt tgacggcgac gagctcggcg gaatctcgcc    105300
     tcgccgcgac tctcgctcgc accgcgtatc cgctcggcga tcgaacgtcg aagtagccga    105360
     agccgtagac gagctcgccg ccggactcgt atatgcggct cacccggatg ccgtaaggga    105420
     ccgccacgga gacgtagtcg aggccgttgc ccaggtttcg cttaccgccc gagggggtgg    105480
     aagatgcttc gcgaagctcg acgccggctt tgccgccgtc gtccgcagtt aaagtctcct    105540
     ggccgtaggc gaacacaacg catcggcctc ctccctgctg accctccacg tctttcctct    105600
     cgcgcgtgac cctcatgccc atggcgttct tccagaagta aacctcgtcg tcgaacaggt    105660
     ccttatcgac ggtcagcacg atccgctgca ggtacccggc gtcgcccgaa gaaacctttg    105720
     gcctcagcct gtcgagatac gtcgcgttgg cctgcactcg ctccagttgg ttctcgaaga    105780
     aggtcctctg gccgagcagg gattcgttgc tcgggtccgc ctcgatggcg gcctcggtgt    105840
     cggcgaggag gtcctcgagc tgcttgagga tctcgccggc ggacgcgggc gcgcccgcgg    105900
     acgcggcgcc tgcggagaga ggaacgacgg gcgcgagtga gcacctcgga ataatctgga    105960
     tttaccctaa ccccgacgaa cgctcgcgac ggtgggcgcg gggaaaggcg gggacgaaac    106020
     gtccgtttcg gaactggacg caccggcgag cgcgacgaca gcggagagga tcgcgttcct    106080
     gcgggacggc gtgacggggg atgagtcgtc gtcgtcgtcg tcgcccgatc cggttgttgg    106140
     gacgatcgga cgatgacgac gacgcccccg aacgtgggcg tcggcgacgg aggctcggca    106200
     tctccccgcg gcgcgacgat tccggcgtcc ggtcgccggc ggcacggcac gcgtcgcgag    106260
     gttcgatgcg agcgtcgcgg gggacatcct cgtgactcac cgaatcggcg cgcgctgcgc    106320
     tgtgagccct gacccgccgg gagactgatc tcgcttttgg atagtgctaa agccacgtca    106380
     ttatctggga acaacgacgc cacttaccat ggcgcctaag aaggccccag ccaagaagaa    106440
     ggcgaccgcc gtcaagggcg gcgtcgccaa gaagcccgcc gccaaggccg agcccgaggc    106500
     aaccgccgag atccccaagg gcggcgtcct catagaggcg tgcaagtcct gaaacgcgtt    106560
     caagactcga gccgcgaaga tcgagtccgc tgtgaaggcc aagggcgcta aggtgtccat    106620
     caaccccgtg aagcccggca agggcaactt cgtcgtcaag acggagaaga agaccgtgat    106680
     ttccctcatc gggctcgcca ggcccttccc caagctcaag gcgctggaca tggacaaggt    106740
     gtgcgaagac gtcctcgctg cgctttaaaa caattcgggt cgagaggagc gtcggttagc    106800
     aggggctcgg accgtgcgat gagggggagg ccacgtgaag gcgccggggt aaagttgcgg    106860
     gcgataagag ccccaacccc gcgcgacccg aaacccgcct cccggctctc tcgcgcgtcc    106920
     agagccccgc gacccgacgc gagctagctt gctacgaagg tggtagagaa actcacctcc    106980
     cacttgcttg agcgggtcag gcgaacactt ttctccactc ctccacctcc tccccgggta    107040
     gccccgcccc gtcccctccc ttcgcgagca tcaccaccgc cctcgcgcgt cgcgccgcgg    107100
     acctccacgc gctcatcgcg ctcctcgcgc cggacccgct caccggcgcg gcctcaatcg    107160
     ccggctcccc ggcggctgcg atggtcgcct ccacgtccag ctccacccgc gccactcccc    107220
     cccgcttggc gcgaaccccg cgagggccct cggcgaggag cctcgcgagg tacccctgcg    107280
     tcgccgccgc ggccgcgcgt ggaccgatga cggagctaac gcgcgggtcc aacgatccga    107340
     gcgcctttcg aagcggcgcc agtatctgtt cgcgaacggc gtccgccgcg ggcgacgtcg    107400
     agtgactcgg gtccccattc gccgactttg actttgccga ctttaccgat gcggagcctt    107460
     tacctcccca cgtccccttg ggcgcggacg cccacgcgtc gtcgagggat ttggcgatcg    107520
     cgtttgaagc ggcgtcgatc gcgcagccga gcgccagacg cgttcgccgc gtgaaggttg    107580
     agacggaggt caagactctc tcgcttcccg gagcgacgcg tcggctcgat tgatgacgac    107640
     cacgcgcctg atcgatgaac cccgattgaa cccccgacgc cgcctcatcg tcatcctcgt    107700
     cttcctccgt tcgcgcgacg cgctcgatga cggcggcggc gcgcgcgagg gcgtcgtgga    107760
     cgcgggcggc gtcggacgcg acgacgcaga ggttggtcac ctgcgaacaa aaaaaaacac    107820
     ggcgtcagtc gaattgccca tacgaaaata aaaaaaataa acgcaccgtc cgggaccccg    107880
     gccacagccg cggctggtgc gtcacccagt tggcgacgac gccggacgtc ctgtccagca    107940
     actcgacgag gaggaagagc gcgtcggtgc cgagaggcga ttgagccccg agggctgacg    108000
     cggcggcggc gacggaatcg atcgccttaa ctgccgactc ggcccatgga gacattcccc    108060
     cttcgattcg atacgtccca tcccccgaag acgtcccatc tttcccatcc ctcgcggggg    108120
     gtaccgaggc gggtttgccg tcgcgaagct cgcgtcccat cttcgcgtgc gacgccgccc    108180
     acgcgccgta cgcgccggcg aaccaactcg cgccgtgcgt caacgcctca cacccgattg    108240
     accgattgac ccgattggcc gcacaccctt tacctgtacc gtctccttta cccagccgcc    108300
     gtacgtttgg agtcgaactt tgtgtcagtt tggaccctcg cgcaccctcg cgtacgtacc    108360
     tcggcgaacg cgacgcctcc gcggaggaac gcgttggcga tcgaatcgat ccaaccgcga    108420
     ttgattccag attgatgtaa tcgcccgccg ccccgagggc atcctccgcg acggctctcg    108480
     cgcgcgacgc gtgctccgtc cggtcggaac cgagcgccgc gagcctcgac gcgagcgacg    108540
     cggcgagcgt ggcgcacgcg cgtcgcgggt ccatcgcggc gttcgtcggg tccgtgtccg    108600
     ggcgcgtcgt cgtcgtcgtc gccgcgagcg cgctcagtga tgcggaaacc tcccggagcc    108660
     tcgtcgcgca cctctcggtg gcggcgtggt cgctcgcatc gctcctcgcg gcgtcggcta    108720
     cggcgtccca cgcgagcgac gcggcgtcca gcgccgcgag ctcgtccgtg cgcgcgcaaa    108780
     ggtccgcggc ggtggccacg agacgctccg catccgacga cgcgggctcc gacgcatcgt    108840
     catcctcacg gtttccggga cggtccggct tgcgggttct cggcgcgggg aattctccgt    108900
     cgcccgcgcc cgtcgccgcg agggcggcga gctggtgcag gtgatcgagg gcgcgaaccc    108960
     tcgcgtcgag ctcagcgagc tgcggggacg ggtaaggcgg ttgggacgtc aggtgcgggc    109020
     cctcccggag ggtgacgggc tttggctcga tttcgtggga ggtgccgaag ggtcgcggtg    109080
     tggggtgcgt acctcgagtc ctcggggtgt cagccgagcg cacgtcgccc cgcctcgacc    109140
     ctccgggtag gagatgagct cccatcgcgc cgcggggggc atcgcgcggc gcggtgtgcg    109200
     atacccgtcg caccacgagg tgaccgttac tgaaatccct tctcctcgga cgggacggta    109260
     tagacggcac cggaaacttt ggcgacctga cgcgaggggg gcagcgtcgg ggtcccgaca    109320
     gaacacgaga ggccgggcgc cgcgggtccc ggagacgtcg acggcgatga gcgacgacga    109380
     tgaagtcacg gaagaggtcc tggctcgcct ctcgcgcgag atggccgaga ctgtccgcgt    109440
     cagcctgcgc cagggggaac cagaagctgt tgttgacgct ccgcaaattg cgggcgaaga    109500
     cgacgccccg gggccccgca cctccgccgt gtcgtggagc tcccgcgaga acccggacga    109560
     cgacgacatc atgatctccg cgctggtgag cgccatggcg aagggccgcg agatatcggc    109620
     gagcctgggc ggcggcaccg acccagtgcg cgtcacggtc aacctcgacg cgccggaacc    109680
     caccaacccg tccggctcga ggtcatcctc cgttcaacgc gagcgcgtcg ggttcggctc    109740
     gtccgcgccg cgcgtcaccg cgccgaaggt tccctccgac gcggacgtca ccggcccggg    109800
     cctcgcctac gccaacgtcg aaaacctcag ccgcgtcgcg cgcccgaacg ccccgggagc    109860
     tcgatggggt aagccaccgc ccaggcgacc cgcgctggcc gaatcgctcg cgccgtcgtc    109920
     gacgcgccgc gccgccgccc acgccgtatc cgccgtcacc ggcgccgcca tcggcaccgg    109980
     gggcgtcgcg gaggccatcg cggacctcga gtgggtggtc agaggggagg caggtgggag    110040
     ttcgcagccc gcgttggttt cgccggaacg gctcgacgtc gcgaggcgta agccgagggc    110100
     gacgacgttt tcgaaagccg ggctcgtacc ggtgactcac cgggcggtga ctcaccaagc    110160
     ggtgactcac cgggcggtgg aggaggacct cggggcgcga acgcaccggg agctgcccca    110220
     atacgacgag aggttcaggg ccgtggagaa aactccggga aggttggcga agttttcctc    110280
     gcttccgacg ggccgagacg cggccgggga cgagtccacg tcgtcgtcgg aagggacggg    110340
     atcggagtgg gacggactgg acgacgacgc ggacgcgtgg tggaacgcac cgttcggcac    110400
     cctaaccttc gcggaggggc tcaaacgcac cccgcggaag gtgaagaaac gcacaaccgt    110460
     tcgggcggcg ggggatgaaa aggaaaacgc ggcggggaca aagaggagga ccaagacggc    110520
     ggcgttcgcg tcacccgcga acaaacccgg gccgtccaaa ccgcacgaac cgacgaaggg    110580
     cgcgacgcgc ggcgataagg cgcgccaacc gccccggccc gggagcatgc tggaccccgt    110640
     cgcgctcgcc cgcgcgctcg acgtgacgag agccaaaccg agcggcgcta ggggcgtgac    110700
     caaatgggcg ccgccggctg tgtccctccc gtcgccggcg ggatcggtcg cctcgatcga    110760
     atcgacggag agcgacgact ggcacggacg aaacatacgc agggatttaa ggcgcagggc    110820
     gagcgccgaa cgcgcggcga tcgcgaagac gacggcggcg gataccgaca tgaacgccgt    110880
     gcggccgaga aacgtgacgg gcgtgaccaa gtggggcaag ccgccgccgg cgccggatga    110940
     gcgaagagcg acctcgaagg aaaaggtcaa gtctgcgaag ggtttcaagg cgcgcgagtc    111000
     gtacgaaaac gcggcgaggg accacaagct gggacgcgtg accgcggcgg ggttacccct    111060
     cgacgttcag ctcgcggcag gcctgcagct tcgaccgacc gagcccaaac cgtatgaccc    111120
     ggacggcgat gctcatacga atgaaaacct gccgccgctt cccgacgacg ccgctgtgcg    111180
     caaacgcgtg ccggggtaca ccttcccgaa acccaaaccc ctggacgaag atttggacga    111240
     attcgcaaag ctaaagaagg cgaggcggaa ggaggagttg gagactccgg gcccgggtca    111300
     ctacgcgaac cataccccga gggtggagac ccgtccaaag gctcccgcga tatcgttcgg    111360
     agaccacccc atcgtccccg tcgaggttcg ccagtcgatg aagatcgacc tcgcggactt    111420
     ccacccgtcc gacctggacc ccgtcgccgc gtggcataag ctgaggggaa ccgagcccaa    111480
     ggggtttgcg acgttctgga agcatccgga gaagaaatcg cacatcgacg aggtcatcga    111540
     aaaagttgaa cgcgtcgagg cggagcgcca cgcgggtcgg atcgaacacg cggtcagcaa    111600
     ggcgcttcgc cagtcgcgga cgaaagactg gaagacgagc gatgacatcg gcgccctcgg    111660
     cgacgcaatc gcggcggcgg cggctcgagt cgacgaggag gggtcgccgg atgccaacag    111720
     gtcgctcgtg gagaggcgcg tcgacgtcgg cggcgcgtgg gcccgcgcgg gtgccaataa    111780
     accacccgcg gacgggctgg cggaagaaga gtacgccttc gactacgacg cagccatcgc    111840
     ggaggaggct gaacgacgac gggaccccgt gggcgcttgg aaaacgtccg tggctccgtc    111900
     caaaccggtg ttttcgttcc cgaagggtcc cagcggccgc gaggacgtcg agtcggagct    111960
     cgaaccgtgg ccggtgctcg gcatcggcga gccgtggtcc gagcgcaggg tcgagggcgg    112020
     cgcgctgcct ttcgagctca tgctcggccg ttccgacgcc tacgcggata ggttaaaggc    112080
     gcgggaggct gaggagaatc gaaagatttt cccggggtcg tacaacgtcg tcgccgcgct    112140
     cgactacctc cgccggcaaa cccccgccgc gatattcaaa ctcgcggccg acaggtggag    112200
     ggcgcacggc cgcgcgcgac gactcgtgcg cgcgcgaaac ctgctgggcg cggacgtcgc    112260
     ggggtacatg gcggaggaat gggacgacga cgaacgggac gaggacgagg gcccggcgat    112320
     gctcggcgac gaggctcgag ccgccgcgga tgcggtcatg cgaccccgcg ctcccgcgtg    112380
     ggagttccta ccgctgcgcg tgaccgtcgc gaaggccaac gtcgtgaccg ggatgaagcc    112440
     cggggacaga ccggagctgg acgtgaagct cacgctcgtt cgcaggcgcc agccgggcgc    112500
     gacaaagttt ggatccggaa cccccaccgg cggttccaaa aagtcaagcg cgcgaacgag    112560
     ggacgaagcc aacgccgcgc gacgcggccc gggcgcatac cggctccgat acggccagac    112620
     cgagcgtcgc gcgccgcgcg ccgtgatggg tacatccggt ctcggagaca acgcgatcat    112680
     ggaggacgac gaggatgcgt acgcggaggg ttcggtgttg gacatcgacc ccgcggccgc    112740
     gtttgccgcc gccgtcgcgc gaaggaaggg caccgccgtg gacatgtcac ggatgcccca    112800
     cccgcgggtg gacgacgccg aacgcgcgcg tcgacgcgag gaactcgacc tcgcggagtt    112860
     gacggaccgt cccgaggtgg aaacgacgcc gctcaaggcg ttccgggcac cggacggccg    112920
     cgggggatgg agcgccctga tggacgtctc gcccgcggcg tcccggcgtc ggcgactggc    112980
     cgaggagcgc cgtgcgaaga tggagggcat ctccgagggc atctccggcc ctgactcctc    113040
     ctccccgact aaaactcgca tgcgcgcaaa ggacaagctg acggacccgt cgtcggatgc    113100
     gtacgtgcga aggcgaacgg acgcgggcgt catggacttt gcgtcgatga cgttcagggt    113160
     ctccgagcgc accccgggca acgtcgagct cgacctgctc gaggcgggca tcgggccggg    113220
     aacctacgcg gcggagcccg tgtccaggcg cgtcccggag gttgactttg ctcgcggcgc    113280
     cgcgaggttc gcgctgacgg atgcggaaaa ggcaccgccg gacgaacccc tggagggtga    113340
     acgcgtcgcg atcgagccgg gacccgcctt cgacgccacc cgaccggacg ccacccgcgg    113400
     tggcgtcatc tcgccgctcc cgacacgcgc ggagtcgtcc aaaggaaaag acgatgctgg    113460
     taaagatggc gccacgcagc cgccgtacgc cgacgcgttg tacgacgtgg aacggggctt    113520
     gcggtacatg cgttcggcga gggacgacgt cgcgccggcg ttcgaacgcg ggggcccgcg    113580
     tgtcaccgat ccggcgcttc cggatccgcg ttcaaacccg gaggcggctg acttttacgt    113640
     tggcgatttg gacgagaggg gtcggtcgac gtcgacgggc gagtcgacgc gtcaccgggc    113700
     tcggggttgg atggggggtt ggaaagtggc gcccgcgccc ccagagttca cggaggggga    113760
     catactgtac ctcgacccgg cgagggcgga cgattatcgc cgacggcgga caattggaaa    113820
     cgttccggat ctcggcgcgg ggggctcgcg agagacttac ccaggcacgc aagagcttac    113880
     ccgggacgtg gactacgtca gggacgacgc cttgcggtct gcgtaccctc cgctggtgac    113940
     cgggaccggc gcggttcgcg tggatcgcgg ccgagccgga atgtccgaca tttttgtccg    114000
     acaaaccgac gctggcgatt tggacgcggg cgcgtaccac gacgaatcgc atcgagcgga    114060
     ggctcggtcg cggctgagca acagggaacg cgcgcggtcg gtcgactttt cgaaggcgcc    114120
     cggccggagg ggcgcggcgt cggacgggtt cggaaccgga ggcgagggcg acgtcctcgt    114180
     gctcgacccg atcgatccga gaacggcgcc ggttggtcga ggagacggcg ctaataatct    114240
     cgcggtggat tactcgaggg atcggacgag gcgcgcgttc ccggcgtcgt cgcccgcgaa    114300
     ccccggcggg gacgtgctcc accttcaacc cgggcggggg gacgcgcttg gcgaacgcgc    114360
     gcgtaaggct gatttcggcg cgggacccgg tcgcgggact catcccgccg ggacgtttgg    114420
     agagtggaca gacgcgaacg tgattcacgg gttgagagcc gaggtggatt tggacaagac    114480
     ggcgggcggg ttcggggacg cgaacgcccg gcgacgcgag cggatggccc ggctcgtggc    114540
     tcggcagccg cggcggggtc gcggggacca gcgtccggaa cccgagcgac cgggcaagat    114600
     cgtcatagcg taggcgcgcg ttgaacatta aacgtttgga gggcgagcta atactggcga    114660
     gtgctctccc agtcgccctg ccccatggcc tcgggcggcg gcgggagcat ctcccgcgag    114720
     tccagcacct gcacgagccc gaggtacgcc acggccagca ccacgctcac gacgcctgcg    114780
     ggtcgggatt gaagggtcga gaggggtcag cgtccttcgc tcggcggcgt cgggtggaaa    114840
     gttccgctcg tctggataag agaaaaagtt ggcgtcgttg ggtcgggcgt cgtcccgcac    114900
     cggtcacgat ggcggtcagc ttcgcgccct tgacctcctc gctgtcctcc tctggctccc    114960
     tggcggcggg cgcggcggtg gattcggcgg cgggcgcctc gtcctcgctc gctcgaacca    115020
     tcgtggagcg agacccatcg cggttggcgg ccatcatcgc cgtcttgaga gcccctgggg    115080
     tggtgccgat gcgaacggcg ctcggggctc ggacgacgga gacgacgcgg gtcctcgacg    115140
     aggacgcggc gcggcatccc gcgatgacgg cggtgttgtg gaggacgaag gtggacatct    115200
     cgcggtggga tgtgccgcgc gggtgctgaa gtgggtgacg tcgacgccca tgctgaaata    115260
     tgttgccaac gtggctaggg ccaaaacccg tccgggcgcg gctaggtgcc tttttttcct    115320
     tctcgagcct tccaccgccc gccacgatcg agcgcgcgga gtcagggttg tcaatacacc    115380
     ccgtcccgcc atgagcgacc agaaagagcg aatggtcccc gcggacaggt ccaactggaa    115440
     cgccatcctt aagtggtcca tggcgcagca aggggacggc acgtcgtcag agcccgcgcg    115500
     cgagatctcg gaggaggaca ggcggtggct cctcgacgcc atggcgagcg ggttcataga    115560
     cgagattaag cgcatgaagg acatcatagc ctgcatcagc gccgggatcg aagcgacgca    115620
     cgatgccgag gagatcgacg cgcgggtgga gctcatggag gagctgacgg accgcgtgag    115680
     cggcgtagac aacggcgggg atctgcacac gctgggaggc ttggagcccc tcgtgcggta    115740
     cgtggcgtcg tcgccgcacg ccaggctacg cgccgccgcg gcggaggtgc tcggcacgac    115800
     ggtacagaac cacccgaagg cgcaggaagc cgcgctggga tgcgacgcga tggatccgct    115860
     gctgcgcatg gccgcgggcg agggagacga cgcgccgccc accgacgccg cccaagccga    115920
     atccaccacc accgcccaag gggacgcgtc cgaggggacg aaggagctcg tcaaggctcg    115980
     cgtcaaggct ctattcgcgc tctcgtgcct cctccgagga tgtacaaggg cccaggaggc    116040
     gttccagctc ggcgacggct tcgcgctgct gaagaactgc ctacgcgtgg accacgcgcg    116100
     gctgcgaacg aaagcgctgc acctggcgag acacctggcg acgctggaca tgaggttcat    116160
     gcgcgcgtgc gtagacgcgg ggtacgttct cgccgccgcc gcgtcgctcg cgggctcact    116220
     ccctcgcgtg tttgatcgtg atgcagatgc agatgcgaat gcggaccttt ctgcggatgc    116280
     gttcacggag gaggacatcg agaagggtca ggttcgggag gctgcgctgc gtctcatggt    116340
     ggacgtggcg cggaaggttg actttgacgc ggtgccgaag gcggtggacc acctccggtc    116400
     ggcgatcgtc gtcaacgcca tcaacgcggt gggtaaggcg tatacgcgct tcggccggga    116460
     ggagaaggag acgtacaggg acgagatgca gctctgcgcg cagctggcga agatgttcga    116520
     gtgagcgtag gcggtagccg acggggagtt gacgaaacgc tcctcgacgg acgttttcgc    116580
     gaagaaaata ctagactatg tattcatcgg atgacgtgtt cgacgcggcg agttcacagc    116640
     gacgcgcgca ctcggcacat ccggagtttc cacgatatcc tcggcgttcg cctggacgtt    116700
     ggccaccgcg acgcgactgc tcaacgccgg tcgcgtcgcg atggtctcca ccagacggag    116760
     cgcccgcgga ccttccgcca ccgccaccgc gatcggcacc gggaaggata aaaagccaaa    116820
     ggctgacggt aagcgcaagc gctcggcgtc caccgccgcg gcgaaggcga cgcccgcggc    116880
     cgcgtccgcc cccgccgcga acaccgacgc cgcgacgccg ctcctggacc tcgggccgct    116940
     cgaggagggg gtgctggtgg gccgtccctc cgaacgcaac cgatcgccgt acgtgggcga    117000
     cgtgcgcatc acgtcgggtc cccacgcggg acgcgtggcg gtgacgcacc tcccgaacat    117060
     ggacagcggc ggaaagtgcc gccccggcgt gcgcgtcctg tgtcggcggc agccgggcgt    117120
     cacacccgac accgtaggcc agtacggaac ccccaagtgc gagctcgtgt gccagctcat    117180
     ccgatgcgac gagcccgaga atgacgcgct cggagggtgc tgggtatccg cgcatcccac    117240
     catcggcgaa aagctcgtcg aggcgctcat acgccgcggc gccctggacg ctcggctgca    117300
     cgccccggtt tgtaacctcg agacgcaggt gggcaagacg aggaaggtga gcgacagcgc    117360
     cagcggcggg taccgccccg actttcgagc cacgcacgcc gacggcaccg cgacggtgct    117420
     cgagacgaag caagtggtgg acaccgatta cgaccctcgc accgtccacg acgccgcggc    117480
     tttacaaccc gggcacccgg tgtacgcgcc gagggacgac gttaacgcgg gggggtacga    117540
     gcgcgcgggt atattcccgt ggggcaagcg gggtcagaag ggcccgggtg gcgagcaggt    117600
     cgtctccgct cgagccatcg agcacgttcg agagctcgcg gctgtggtcg acccggggac    117660
     tgtcagaggg aagaaaggga cgagtgggga tgttcacgcg gccgtggtgc tgatggcggg    117720
     gcggcacgac gtgtgcgcga tccgcgcgaa cggcgccgcg tgtccttcct tcgcggcgca    117780
     cctggccgcg gcggagggtc gaggcgttcg ggtgttgggg cacagggttc gatggggcga    117840
     gggggtcgac gtcgggaggg cgttcgacgg cggggaggtt ccggtgctgc cgccgctcac    117900
     ggaggaggac ctcgcggtgc tggtgcccaa gcccaagccc gggaaggaga agaaacccgc    117960
     ggtgaagaag gcgaggacgg acgagtgaag acgttgctag agtcggctac gataaatcca    118020
     tccaccctgg ctaatgttat gataatgtcg gcgacgcctg tcgactgacc tgattcgtca    118080
     gagcggcagg aacgacttct gcttgaccag acccagcgac cgcccgcacg cgaacaccac    118140
     gggcttcgcc atcgccagac ccatcccgaa caccgcctgt aaaccctgcg cccccatggg    118200
     aaagtagctc acctggtagt acagcagcga cgtcagctgc gcgaacgagc agaggatggt    118260
     gagcacgtaa gagtgcagca ccagcgcgca gtagagcgtg cccagcaacg acccgacgta    118320
     cgccgcggag tgggtgagac gctcgggggc ggtcatgtgc gccaactgcc cctgcaaccc    118380
     cctcagcgcc cccatcgccg acatggaaca cgcgcttcct atggagaagc agagcgcgaa    118440
     cttggcgggc gcgaggatga gcgtggggag gcccacgaag aaggcgaggg tgaacatgag    118500
     ggtcccgacc gtggagagcg cgaagaacca cgcgaccctc tccctcgaga gctggttgag    118560
     ggaatctccg atctgtctgg tgcccgcggc gatggacgag cccatctggt tggcgccctg    118620
     tgccatgtgc gcgcccagct cggcgccgtc ccgcccgatc tcgcgcccga aattcaggag    118680
     ctccgtcccg gtggaggacg cgacgctgct gagctcagcg cccgccgcgc tcagagaggt    118740
     ttgcagggac tttccaaagg cggagagatc gttcatgtcg ccgtactcct tcgagacgtt    118800
     ctgccaatct gcgggccgag gggcggagga gtttggatcg tcagttgaat ttcggataga    118860
     ttccttgtcg gcacggctgc gaaggacctt ggcgccggtc gatgggtgcg ggactcgaac    118920
     gggggcgcac cggagaggaa agacttcttt tcggatgagc ccgaaccaga tccgctcata    118980
     cccgacccgg atccaaccgt gtcgcgtggg cgggcgcgcc gaggagtggg agggcgccgc    119040
     ggcccgaaaa tattgacgtc tctgctgtca gcaagcaagt gccaaaaatg ttggcagcgg    119100
     cagctgtttc aagtctgctc taagatccta tcgattgcga cttcatccag cgcacgtgcg    119160
     cgtccacggg ctcaatcggc gtcggtgtcc caccggttcg aaagaaaacc agcgagaacc    119220
     tctcaccggt ccagccgctg acccagtgcg gcaccctccc gtccaacctg ccgagtctgt    119280
     tcttcacgtc caccgccagc gtcttctcgc caccctcgcc agcctcgacg cacagctccc    119340
     caccctcgaa gtcacccagc gcgagcacgt actggtgcga cgtatccttc ttatccacgt    119400
     ggggcgagcc cctaaaatcg gaagttatcg ccaaactgtc gtactcggga tgacgaccct    119460
     cgaggaagaa ggttcgcagc gcctcttcgc ataggctcca cacccgagcg cgttccctca    119520
     ccttgttccc agttccgacc atttccgacc gacaccgatc cggcacgtcc accaccgaac    119580
     gcctacgaaa cttttccgcg tcatcaaccg ccttccgctt cagcacgagg tacctccgcg    119640
     atcgaacgcc cttgcgctgc gggttgtcga aaaagtcctg aaagtcgcgc agcgcttcga    119700
     gaagcttccc gcgtagctcg tcaaagtcgg ccggtcggag cggtgccgct cccggacatc    119760
     gatacaccgg cctcacgcca cccatcgctc gtgctaggtc gttgacggcg agcgcgtgtg    119820
     ccagcgtctt gtttttgctc ccctttgctt gcgccttgcg tcgcttggac ggcggcgatg    119880
     tatcgtcttc cctcctagcc ttcttgagcc tcgtcagtat ctcctcggtg ctcagcggcg    119940
     cgagctgcgc gacgagcggc ggatcctcgc caggtacctg cgcatccgat atgttgtcgt    120000
     gcggtggcga cggctggagg cggtaatgtc ggtatccgtg cgtgagcggc acctcgagac    120060
     ctgacgggtt gggagattta gaatgttagt tcagacgtcg tcggtcggtg ctctgcgtcg    120120
     ttcggtcggg ttctcgtggc gcaccgttaa aactgagcgc cagcttgagg tctctcaacg    120180
     tgggcacctc cacggtcacc tcggtacccg ggcatccgct aaccctagcg cgcccatgcc    120240
     gcggtgggcc gaccgccgat gccttttcac cttcgtcgtg gggacgcccc atgtcgtcgg    120300
     cggcgtcgac ctccaggtcc aagcccagga gcgccgcgac gagcgcgggg gtccacgatt    120360
     tctccgtctc cctccacacg agtctgaacc gcgcatcctc agccggcccg gactgcgaca    120420
     ccatctcgac gcgcgcggac actggggaaa ctacggtcgc aaccttggat tcgtcaatcg    120480
     taaaaaggct aaaactcaga tcaccgattc gccttctgcg acaggatgcg gtcgactacg    120540
     aacgggtcca ggggggtcgg atcttcgctc ctctcccccg cggcgctcac catcgcccca    120600
     cacaacccca ccacccccgc cacgtccgaa tcaatggaaa cgaaacgtct cacgcgcctg    120660
     tccaggtacg tcgcgtccgc ctgcgtctgc tggtacccgc accggttgaa ccgtcgcacg    120720
     ccccgaacgc actcgacgaa cgacttgagc gccgatttgg tcaccgcgcc cagcacgtgc    120780
     gcccgcgtgg gttccaccgc gacgtcgaac accccggacg acgacgccga gccctcaccc    120840
     cggaacaggt ccgcgacgcc ccggtcgatg cccgtcgcag gcgccgcgtg cgtctcggag    120900
     agagccgaga gagagccgta gccgccatcc tccagtatcc ccgccgtctc agtctcgacg    120960
     gcgacgagcg acgccaccac cgcttttacc accggcgaca cgtccctcgg ctcgttcgcg    121020
     acgtcccacc gacccaacgc gacggactga cggatcatga gcgagaggcg cgtcgtttgc    121080
     tcagccgcgt acgcgcgaac gagctcgtcg gcgacttggg cgtatatttg ttccttctcc    121140
     gcgaagagcg ttcgcgtgtt cgcctcggag tctttcggtg ctgggaagaa ggcgtcgagg    121200
     gttcgcgcga tggtcgggac gccgtccgtc tccatgaagc tcgcgaggcg cgcgtggacg    121260
     aggaggacgg gcgggggtcc ggcggcggac ctcagcccgg cgagaagcgc gtcgagggtg    121320
     gacgcggcgt ggccccgaac gagggactca aactcctccc gccacgacgc caccatcacc    121380
     ggcctctcct cgagcagcga cctggtatcg gcgagcgcct ccttcacgcc ggcgagcgtc    121440
     gcgtcgcgga gctcctcgaa gcgatcgagt aaaaacgcgc catcctcccc gtcgtccgtt    121500
     cccccgcccc ccgcgtccgc gttcgtcacc ctcgcctcca cgtccgcgcc cgtacgttcg    121560
     atggcgtccg cgagcttaag ctccagcgcc ctgaacgcgg cgccgacgcg ttcgcgcgtc    121620
     gccgtctcca ccacctccgc cgcgcgatcg cccagacgaa tctcgggcac cagcctgttg    121680
     attccgctca gatccgcagc catctgcgcc agcgccgcca tcagacccct cgccggggtg    121740
     gtcccgacgc cggccgcccc agacccggcg ccccccgcga gacccagctt gacgacgccg    121800
     aagtacctct ggagcagctc gcggccgagg gcgacgaggg gctcgcgatc cttgaaaagc    121860
     tcggcgtact ccgccgccgt ctcccgaaaa tcctccaaaa aggacgcgct gagcgacacg    121920
     acaaacgccc tcgcgtccgg caccggggac gacgacgccg cggactcggc gtcgcccaac    121980
     gaccggtcca tggcgacgcg gcgcgacgcg aggtaggcgc cctggagttc gcccgagggg    122040
     gtcccgagcc gctccagaag ctcgacgcat tcggacgcgt ccagagttga cggcgacggg    122100
     tccggcgagt cgctgccagc cgtgtccgcg ttttcggacc cgtcgtcgcc tttggacccg    122160
     tgcgaagcct cctcggaagc cttctcgtgc atctcgcggc gcctcctccg gcgcgccgcc    122220
     gctaaaaccg ccgcgtcgtg aaaccccgcg cgcagcttct cctccaccgt cttcatcgcc    122280
     gcgtcgcact ctctcttgac gccgacaaac gcgcccgcgt ccccgtactt ggcgagcagc    122340
     ggccgcgcgc cgacgtggta cctcaccgcc agcgccagcg ccccggtgtc agcgcacgtc    122400
     ctcagcttgg cgggcaggtc gaacacggct tggagtttct tgatgagcgc gcggacgccg    122460
     ttgagctgct cgatctgttc ccggtgcgac gagagcttga ggttgacggc gtcggccgcg    122520
     gcggcggtgg cgtccacgct ggcggtgagt tcctcgaccc tggactcgat ggtggcgacg    122580
     tttgttcgca tctgcttgac ggtgtcggtg gccacgatga acttggagta gttctcgtac    122640
     accagcatct gcatgtcgcc gtcgagctgc ttgatctcgc cagccatgga gacgcacctc    122700
     gcctggagct cggccaaggg gacatcgcgc accgactccg tgacgtaagc gtcgtgatcg    122760
     aatccgtcgc ggtcgatggc ggggagcgat gcggtcttcg ggctcggtcc gccgacccca    122820
     ccgccgtagt aggaggagag taggctccgc acccgccgcg ccttctcctc ggcgctcgga    122880
     tccattgtaa ttgtaaccct gccccagtgc acgagttggg gtgcgggagg cgggattgga    122940
     ggagcgacgc cgggtttgag ctccgcgact tgtccacccg aaccgtctcg gaagttcgcg    123000
     gctgaacgac tcgcggggca ccacgccgca aggcgccgtg acggtctggc acgaggctcg    123060
     gagcaccaca aaggtggtgc cacgagcgta acaagtcagt gggatttttg ggcccataac    123120
     cactcgaatc tgaccagtct aaatgcccct acgagcactc aaaatcgcac gcgagcctca    123180
     aaatcgaggt gacgccgtcc tttggaagac gagaaaggcc tgccgcggct cgccagatct    123240
     gaccgcgctg gcgacacgtc cagggacggc cgttcgcacc cgcgcctttc gtttccgacg    123300
     cgcacacccg gtcccacgac gcagcgagcg cgatgggcta cgcgggctac gctcccggcc    123360
     accaggtcca gattgcgact ccgctgcagc agctcttgaa gctcatcaag aacgacgcca    123420
     cgctcgcaac catagagaag ctcacgcgga ataccgcgca ggctcccgcg gaggagaagt    123480
     ttcggaagat ccgactgacg aacgcgaaga tcgccgaggt catcaccaac gtgacgggcg    123540
     ccgtggaggc catggtcgag atgggctggg tcaaggagga cgacggggag ttcctcgtcc    123600
     ttcccgctgg cacgtccgtg agcatgaggg aggttcggga gattgacgac gcgaggaggg    123660
     cgctcaagaa gtgggaggag gaagagctca agcgtcgcat cgcggccagg aacaaggcca    123720
     acgcgtgccc ggagaaggcc cgcctcctcg cggagatggc cgccgaccgc gccgagcaaa    123780
     aggcgcgcgg acccgtcacc caagggtcag tcgccgtgga gaggagcgac aaagctctcg    123840
     ccgagcgcat gcaaaccgcc gcgggcgccg gatgctgcgg cagctccggc ggtggctgag    123900
     cctaaacggc tcggacgacg ccacggcgtc ttccgagcgg tagctcacga gtagcgcgag    123960
     agatcgtcga cggctgccgc gatcgcgtcc gcccatcgtc gcgacacagc tgtgtcgaaa    124020
     caaaaacaca gctgtgtcga aacggtggcc ggggcgatcg cggcggcgac gtgacgcgac    124080
     gcgcgggtaa aattcgcctt ttcggcaacc cgccgccgcc gagtaacgcc gacgacctcc    124140
     gcgaaggttc tttcccggaa ccgacgaaca aacgattctt tggggcgact tccccctctg    124200
     ccgaggagtt tgaggagttt gaggagtttg ccctcgccct gtaccgacta cgcccagctg    124260
     gcgatgtaac gatggatcaa cgcgatttaa accagcatga tatgaacaac acgtcggcgg    124320
     cgggctcgtc gcctgtcttc tccccgctaa ctatacataa taaggtttca cgcgccacgc    124380
     gcgaagcttc actcctcctc ctcggcgtac gccaccagct tggatgcggc gcccgagtcc    124440
     aggaagaaga tggtggagaa cgcgtcgacg caagcccccg gcaactcgct ctcgtcgtcc    124500
     tcgagcaccg ccctcaccgt ctccgccttc ttcgtcccgc tcgcggccac cacgaccctc    124560
     tccgcggtgt tgatgagggg cagggacatc gtgatggagc gcttgcccgg catgtccact    124620
     ccgagcactg ccgcgccagt ctcatccttg agcgcggccg agtctgggta gatggaaccc    124680
     acgtggccgt cggcgcccat gcccaggagg atgaggtcga agacgggcag gccgttgacc    124740
     tcgtcgagca tcatgacgtc gtcgtcgcgc tccgccagcg ttcgcatctg cgcctcgtac    124800
     gcggcagcct cctcctccac ggatccgccg gcatccggct tgtgcacgtt ggcgtcgggc    124860
     atgccaaccg cgccgaccca ggtgtccatg gcgagcttgt ggcacttgcc gtccgggacg    124920
     cgctcgttga cgaagaagag gtgaaccttg gaccagtcga tccccttggc gtccttcaaa    124980
     cccgcgagag ccttggcgac ggaaccgccg ggcaccgcga gggtgaatcc gcccctctcc    125040
     gcgaggcacg ccttggcgtt ctcctccacc tccgcgcaga gagccttggc gagctggtcc    125100
     tcgtcgtcga aggcctcgac gacgaactcc ccgtcgagga actcgatgtc gtcggggtcg    125160
     atgtcctccc agtcgtcgtc gtcgtcctta gcggcgaaga cggacgcggc gaatgcggcg    125220
     gcgggtcgca tggccacgcg ttttgcgggc cgcgccaatg acccacgggg ctcgagcgag    125280
     gacggcgagg tcgacgcggc gcgggtcggg acgcgacgcc ggggaacgac gcgggtcgcg    125340
     acgcgcggga cgatggcttg ggatgcgatg gcgagcatat cgagcggtgt ggagctcgga    125400
     gccgtgccga ggattgtgtt ggaacttttt ggagcgtccg gccgcgatta tgcttttccg    125460
     tgccgacgtg ttcagacgtc atcagtgcgc caggagcacc ccggcgggcg cgggatggcg    125520
     tcgcgtccgc tgctgcgcgg ggcgtgctcg cgactcgtga acgcgatcga aacctccgtc    125580
     gggtctcgcg cctacgcgtc gtcctcggcg tcgtcgcgcg cccgcggaga ggcgagggag    125640
     agcgctcacg tccaacaaga cggggaccgc gcggagggtt cgaggacttc gacgtccgcc    125700
     tc