(data stored in ACNUC8465 zone)

HOGENOMDNA: NANEQ_1

ID   NANEQ_1; SV 1; empty ; DNA; empty ; PRO; 490885 BP.
XX
AC   NC_005213;
XX
PR   Project: 58009;
XX
DE   Nanoarchaeum equitans Kin4-M chromosome, complete genome.
XX
OS   Nanoarchaeum equitans Kin4-M
OC   Archaea; Nanoarchaeota; Nanoarchaeum.
XX
RN   [1]
RP   1-490885
RX   PUBMED; 14566062.
RA   Waters,E., Hohn,M.J., Ahel,I., Graham,D.E., Adams,M.D., Barnstead,M.,
RA   Beeson,K.Y., Bibbs,L., Bolanos,R., Keller,M., Kretz,K., Lin,X., Mathur,E.,
RA   Ni,J., Podar,M., Richardson,T., Sutton,G.G., Simon,M., Soll,D.,
RA   Stetter,K.O., Short,J.M. and Noordewier,M.;
RT   "The genome of Nanoarchaeum equitans: insights into early archaeal
RT   evolution and derived parasitism";
RL   Proc. Natl. Acad. Sci. U.S.A. 100 (22), 12984-12988 (2003)
XX
RN   [2]
RP   1-490885
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-NOV-2003) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-490885
RG   NCBI Microbial Genomes Annotation Project
RT   "Direct Submission";
RL   Submitted (25-JUN-2001) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AE017199.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..490885
FT                   /strain="Kin4-M"
FT                   /mol_type="genomic DNA"
FT                   /organism="Nanoarchaeum equitans Kin4-M"
FT                   /db_xref="taxon:228908"
FT   gene            join(35233..35301,3254..3289)
FT                   /db_xref="GeneID:3362429"
FT                   /locus_tag="NEQ_t01"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /trans_splicing
FT   tRNA            join(35249..35287,3254..3289)
FT                   /db_xref="GeneID:3362429"
FT                   /locus_tag="NEQ_t01"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /product="tRNA-Met"
FT                   /trans_splicing
FT   gene            complement(join(490883..490885,1..879))
FT                   /db_xref="GeneID:2732620"
FT                   /locus_tag="NEQ001"
FT   CDS_pept        complement(join(490883..490885,1..879))
FT                   /locus_tag="NEQ001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical [Methanococcus jannaschii];
FT                   COG1583:Uncharacterized ACR; IPR001472:Bipartite nuclear
FT                   localization signal; IPR002743: Protein of unknown function
FT                   DUF57"
FT                   /db_xref="GI:41614797"
FT                   /db_xref="GeneID:2732620"
FT                   /translation="MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKKE
FT                   KYFNFTLIPKKDIIENKRYYLIISSPDKRFIEVLHNKIKDLDIITIGLAQFQLRKTKKF
FT                   DPKLRFPWVTITPIVLREGKIVILKGDKYYKVFVKRLEELKKYNLIKKKEPILEEPIEI
FT                   SLNQIKDGWKIIDVKDRYYDFRNKSFSAFSNWLRDLKEQSLRKYNNFCGKNFYFEEAIF
FT                   EGFTFYKTVSIRIRINRGEAVYIGTLWKELNVYRKLDKEEREFYKFLYDCGLGSLNSMG
FT                   FGFVNTKKNSAR"
FT                   /protein_id="NP_963295.1"
FT   misc_feature    complement(7..879)
FT                   /note="CRISPR associated protein Cas6; Region: Cas_Cas6;
FT                   cl11443"
FT                   /db_xref="CDD:164226"
FT                   /locus_tag="NEQ001"
FT   gene            883..2691
FT                   /db_xref="GeneID:2654355"
FT                   /locus_tag="NEQ003"
FT   CDS_pept        883..2691
FT                   /locus_tag="NEQ003"
FT                   /gene_family="HOG000225597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="large helicase-related protein [Pyrococcus abyssi].
FT                   SPLIT See NEQ409; COG1201: Lhr-like helicases; IPR001410:
FT                   DEAD/DEAH box helicase; IPR001472: Bipartite nuclear
FT                   localization signal; IPR001650: Helicase C-terminal domain;
FT                   IPR003593: AAA ATPase superfamily"
FT                   /db_xref="GI:41614798"
FT                   /db_xref="GeneID:2654355"
FT                   /translation="MKKPQPYKDEEIYSILEEPVKQWFKEKYKTFTPPQRYAIMEIHKR
FT                   NNVLISSPTGSGKTLAAFLAIINELIKLSHKGKLENRVYAIYVSPLRSLNNDVKKNLET
FT                   PLKEIKEKAKELNYYIGDIRIAVRTSDTKESEKAKMLKQPPHILITTPESLAIILSTKK
FT                   FREHIKKVEFVVVDEIHALAESKRGTHLALSLERLNYLTNFVRIGLSATIHPLEEVAKF
FT                   LFGYENGKPREGYIIDVSFEKPIEIQVYSPVDDIIYSSQEELMRNLYKFIGEQLKKYRT
FT                   ILIFTNTRHGAESVAYHLKKAFPDLEKYIAVHHSSLSREERLEIEEKLKRGELRIVCTS
FT                   TSLELGIDIGTIDLVIQIGSPKSVNRALQRIGRAGHRLDEKSKGILIGLDRDELLENTI
FT                   IKYSADNRRLDRIHIPTNALDVLAQHIVGMGLEKEWDLKEAYNLIRNAYPYRNLSWDDY
FT                   INTIKYLAGEYTKLEHKKVYAKIILRDNKFKTKGSVRAIYFMNIGTIPEETKIAVYTLD
FT                   NKRIGYVEEEFVEKLVKGDIFVLAGKTYEFLYSKGNKIYVRPVKGVNPTIPHWFSEMLP
FT                   LSYDLAIEIQKFREEIAKKLEREPLD"
FT                   /protein_id="NP_963296.1"
FT   misc_feature    949..1632
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="NEQ003"
FT   misc_feature    1018..1521
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ003"
FT   misc_feature    1045..1059
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ003"
FT   misc_feature    1411..1422
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ003"
FT   misc_feature    1636..2043
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ003"
FT   misc_feature    order(1741..1752,1819..1824,1897..1905)
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ003"
FT   misc_feature    order(1924..1926,1987..1989,1999..2001,2011..2013)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ003"
FT   gene            complement(2668..3189)
FT                   /db_xref="GeneID:2654520"
FT                   /locus_tag="NEQ002"
FT   CDS_pept        complement(2668..3189)
FT                   /locus_tag="NEQ002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
FT                   COG1047:FKBP-type peptidyl-prolyl cis-trans isomerases 2;
FT                   IPR000931:Adenovirus fibre protein"
FT                   /db_xref="GI:41614799"
FT                   /db_xref="GeneID:2654520"
FT                   /translation="MLKEGDYIEGKIKIYEGEKLLLEDKILTKLGSGLYNKEIENNLIG
FT                   KEGEKIELEFDENNNPFGKRNPKNIVIVPAKVFRENRLIPIPGLVVNMDGKTGIVLTVN
FT                   SDRVLVDFNHPLAGKKIKIIIEDIKKLDRKEFLEKLAQNLGYKDVIEEKDGQLIIKSKI
FT                   LESLVQRFSL"
FT                   /protein_id="NP_963297.1"
FT   misc_feature    complement(<2836..3189)
FT                   /note="FKBP-type peptidyl-prolyl cis-trans isomerases 2
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: SlpA; COG1047"
FT                   /db_xref="CDD:31248"
FT                   /locus_tag="NEQ002"
FT   promoter        3210..3215
FT                   /note="archaeal RNA pol III promoter consensus box A motif"
FT   misc_feature    3238..3250
FT                   /note="reverse complementary sequence cleaved during
FT                   processing of trans-spliced tRNAs"
FT   gene            complement(3290..3748)
FT                   /db_xref="GeneID:2654506"
FT                   /locus_tag="NEQ004"
FT   CDS_pept        complement(3290..3748)
FT                   /locus_tag="NEQ004"
FT                   /gene_family="HOG000229617" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical protein [Methanococcus
FT                   jannaschii]; COG1371: Uncharacterized ACR; IPR002804:
FT                   Protein of unknown function DUF101; IPR001472: Bipartite
FT                   nuclear localization signal"
FT                   /db_xref="GI:41614800"
FT                   /db_xref="GeneID:2654506"
FT                   /translation="MICIRDYCFEYLDHTADVMIKAYGRNLKHAFYSAAAGMLHLIYDV
FT                   DKVESDSEKIEIESYGDYASEVLYDWLSNILAQFYIKKIAFGFFKIKNLRRIKNGKKQW
FT                   YLKGYAMGEPYSMEKHNFKKEVKAVTWHGLDIKREGRAKYVIEFIVDI"
FT                   /protein_id="NP_963298.1"
FT   misc_feature    complement(3293..3724)
FT                   /note="Archease protein family (DUF101/UPF0211); Region:
FT                   Archease; cl00606"
FT                   /db_xref="CDD:174307"
FT                   /locus_tag="NEQ004"
FT   gene            complement(3745..4665)
FT                   /db_xref="GeneID:2654304"
FT                   /locus_tag="NEQ005"
FT   CDS_pept        complement(3745..4665)
FT                   /locus_tag="NEQ005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="tRNA m(1)G methyltransferase; COG2419:
FT                   Uncharacterized ACR"
FT                   /db_xref="GI:41614801"
FT                   /db_xref="GeneID:2654304"
FT                   /translation="MLYKYLLEWLKEHNIYFLHLNRRKLRSYLNPFQSVLLEILLNDYR
FT                   IDFKKEGGIPLYKEGEFYLLNRKGPYYSDAILSKQGVKPELNLPKYPLFIIDLRYYNRH
FT                   TEKEKRRIIKEILASLIEVRKYLWDRHLALVANRELFNFISHKLGNNKILRLDYPLNGI
FT                   ALDPNADEILTEKDIKENNIFLIGGIVDLGQNRPWTKELFKEFPRKRIEFYGKTKGVPD
FT                   RFNRIISILLKVKFENKTIEEAIKENLTRKDILERLSIELPKRWVKLDNKFVLPKKEYE
FT                   ELNKMFGRDIKPYLKVFKVEVIEKQ"
FT                   /protein_id="NP_963299.1"
FT   misc_feature    complement(3754..4665)
FT                   /note="tRNA (Guanine-1)-methyltransferase; Region:
FT                   tRNA_m1G_MT; cl00407"
FT                   /db_xref="CDD:174181"
FT                   /locus_tag="NEQ005"
FT   gene            4680..5090
FT                   /db_xref="GeneID:2654159"
FT                   /locus_tag="NEQ007"
FT   CDS_pept        4680..5090
FT                   /locus_tag="NEQ007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="cysteine methyltransferase [Pyrobaculum aeruphilum];
FT                   COG0350: Methylated DNA-protein cysteine methyltransferase;
FT                   IPR001497: Methylated-DNA-protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="GI:41614802"
FT                   /db_xref="GeneID:2654159"
FT                   /translation="MQYKVFCYYRPFLAIIKNNKIVEVKTTNKKCEISLDKLLEMYEPN
FT                   LYYPYNLLYEYMKEKRLYFYKELANLLKMHPRKIGLILKKNPLPIIIPCHRVIKSNYNI
FT                   GGYKFGIELKKYLLIQEKLCSEIKNGYCKPKA"
FT                   /protein_id="NP_963300.1"
FT   misc_feature    <4872..5045
FT                   /note="The DNA repair protein O6-alkylguanine-DNA
FT                   alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
FT                   reverses O6-alkylation DNA damage by transferring O6-alkyl
FT                   adducts to an active site cysteine irreversibly, without
FT                   inducing DNA strand breaks. ATases...; Region: ATase;
FT                   cd06445"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="NEQ007"
FT   misc_feature    order(4872..4874,4959..4964,4968..4970,5040..5042)
FT                   /note="active site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="NEQ007"
FT   misc_feature    order(4872..4877,4899..4901,4902..4904,4908..4913,
FT                   4917..4919,4926..4931,4935..4937,4959..4961,4974..4976,
FT                   4995..4997)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="NEQ007"
FT   gene            complement(5028..5582)
FT                   /db_xref="GeneID:2654392"
FT                   /locus_tag="NEQ006"
FT   CDS_pept        complement(5028..5582)
FT                   /locus_tag="NEQ006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614803"
FT                   /db_xref="GeneID:2654392"
FT                   /translation="MEKIFLGMEIQKEAVAIVFIIFSLILFIYNSFFALLFPFILLNYY
FT                   LLSKSKDIDDFVVINMVMLFSILLVYHLIFDSLTKGQWDLQGFFYYIDEYESHIFMLIP
FT                   LLIIFPFININKDNLLLNSFLIGLGLFLSIEGKIFPFVIISLMFIYPFVNKDKKELILL
FT                   TLGFGFAIAIFYFATKFFLNQ"
FT                   /protein_id="NP_963301.1"
FT   gene            5759..7000
FT                   /db_xref="GeneID:2654403"
FT                   /locus_tag="NEQ008"
FT   CDS_pept        5759..7000
FT                   /locus_tag="NEQ008"
FT                   /gene_family="HOG000224767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="hypothetical protein, contains Radical Sam domain;
FT                   COG0621: 2-methylthioadenine synthetase; IPR001861:
FT                   Uncharacterized protein family UPF0004"
FT                   /db_xref="GI:41614804"
FT                   /db_xref="GeneID:2654403"
FT                   /translation="MKVYFESYGCTLNKRDTLYMQAQIENTTNNLEEADVVVINSCIVK
FT                   QPTETKILYRINQLKKMGKKIVLTGCMVSEPYLKYKELQDISLVNIYNQDRIKEAIERT
FT                   YKGERVLFLEKKKIYKEFARPLSKARAIIQIQEGCLWRCTYCGTKLARSMFYSYPPKLI
FT                   KREIEEKLKQGIKIFYLTGPDTATYGKDINYSLADLLKDLIEIEGDFYIRVGMANPTFF
FT                   LEQIDELIDVFKSNKIFKFFHLPVQSGSNKVLKDMNRPYTIEEYKELIYKLRKHFPLAT
FT                   YVTDIIVGYPTETEEDFEQTLELVREIKFDGINISRFWRRPGTIAWNLKQLDPEIVTNR
FT                   VKRLKEVFLQGAYERNKLWLNWEGEAIIEEKGKNNTWIAKNEMYKQIIVKGNYEEGQKI
FT                   KVKIKKARAIDLIA"
FT                   /protein_id="NP_963302.1"
FT   misc_feature    5759..6997
FT                   /note="2-methylthioadenine synthetase [Translation,
FT                   ribosomal structure and biogenesis]; Region: MiaB; COG0621"
FT                   /db_xref="CDD:30966"
FT                   /locus_tag="NEQ008"
FT   misc_feature    5762..5977
FT                   /note="Uncharacterized protein family UPF0004; Region:
FT                   UPF0004; pfam00919"
FT                   /db_xref="CDD:144496"
FT                   /locus_tag="NEQ008"
FT   misc_feature    6155..6673
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="NEQ008"
FT   gene            complement(7001..7074)
FT                   /db_xref="GeneID:3362468"
FT                   /locus_tag="NEQ_t02"
FT   tRNA            complement(7001..7074)
FT                   /db_xref="GeneID:3362468"
FT                   /locus_tag="NEQ_t02"
FT                   /product="tRNA-Ile"
FT   gene            complement(7105..7401)
FT                   /db_xref="GeneID:2654360"
FT                   /locus_tag="NEQ009"
FT   CDS_pept        complement(7105..7401)
FT                   /locus_tag="NEQ009"
FT                   /gene_family="HOG000222897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical protein [Pyrobaculum
FT                   aerophilum]"
FT                   /db_xref="GI:41614805"
FT                   /db_xref="GeneID:2654360"
FT                   /translation="MKEIEQVIEEFNRLHKANCKLLEIKDDTIIVLFSGHICFTCGTYD
FT                   YFEDLAVLLSEKLNKQYGVEKYEQLNGDYIVYYKPKEKIKQTKRDIKVIFFQI"
FT                   /protein_id="NP_963303.1"
FT   gene            complement(7398..8423)
FT                   /db_xref="GeneID:2654552"
FT                   /locus_tag="NEQ010"
FT   CDS_pept        complement(7398..8423)
FT                   /locus_tag="NEQ010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614806"
FT                   /db_xref="GeneID:2654552"
FT                   /translation="MENREGIIEFVKEAYPITKGKYRIPLAVTEFFIEKEKLKEIEEKL
FT                   NAIFLRIKEIVFEFLDNSLKGYPIDEFRKNLYLKIYENYNYKFKGIIRFDMINFKLIEI
FT                   NADAVEGVIQLDITSKWFSELFDFVGEPRYNREPFLSLFDKPAIIVYPDNYLFVDEYYL
FT                   ESKLLKGPYIKESEFYENKKYRIYPIYRRAIDIDKVKKLDYWLEKQNINDILFTIMGNK
FT                   ANLAFLDKEVDWALDIVAKTSFKPEFKKYVCKPYFGTHGEVYFEKRDNCVYQEFIEIPK
FT                   REISYLDIDDKIKKGIFYYDFNPYAFFDKKLRFGNILLRFSKDHILNVAKGGGVGFYTI
FT                   V"
FT                   /protein_id="NP_963304.1"
FT   gene            complement(8399..8728)
FT                   /db_xref="GeneID:2654462"
FT                   /locus_tag="NEQ011"
FT   CDS_pept        complement(8399..8728)
FT                   /locus_tag="NEQ011"
FT                   /gene_family="HOG000008862" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Desulfoferrodoxin [Pyrococcus horikoshii]; COG2033:
FT                   Desulfoferrodoxin; IPR002742: Desulfoferrodoxin"
FT                   /db_xref="GI:41614807"
FT                   /db_xref="GeneID:2654462"
FT                   /translation="MIKTEYNPKHSPIIEIEKEGELYKITIEVGKEVKHPNEPSHHIQW
FT                   VDLYFEPEGKEPTHIARIEFKAHGEYNNYTEPKAIVYAKLEGKGKLIAISYCTLHGLWK
FT                   TEKEL"
FT                   /protein_id="NP_963305.1"
FT   misc_feature    complement(8408..8722)
FT                   /note="Superoxide reductase-like (SORL) domain, class II;
FT                   SORL-domains are present in a family of mononuclear
FT                   non-heme iron proteins that includes superoxide reductase
FT                   and desulfoferrodoxin.  Superoxide reductase-like proteins
FT                   scavenge superoxide anion...; Region: SORL_classII;
FT                   cd03172"
FT                   /db_xref="CDD:28803"
FT                   /locus_tag="NEQ011"
FT   misc_feature    complement(order(8429..8431,8438..8440,8606..8608,
FT                   8624..8626,8699..8701,8705..8707))
FT                   /note="non-heme iron binding site; other site"
FT                   /db_xref="CDD:28803"
FT                   /locus_tag="NEQ011"
FT   misc_feature    complement(order(8411..8413,8417..8419,8426..8437,
FT                   8441..8443,8453..8455,8459..8461,8483..8485,8501..8506,
FT                   8531..8533,8537..8557,8582..8584,8594..8599))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:28803"
FT                   /locus_tag="NEQ011"
FT   gene            8775..9815
FT                   /db_xref="GeneID:2654440"
FT                   /locus_tag="NEQ012"
FT   CDS_pept        8775..9815
FT                   /locus_tag="NEQ012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="glycosyltransferase [Mehanosarcina acetivorans];
FT                   COG0438: Predicted glycosyltransferases; IPR001296:
FT                   Glycosyl transferases group 1"
FT                   /db_xref="GI:41614808"
FT                   /db_xref="GeneID:2654440"
FT                   /translation="MKKIAVFVPHSIYPNFGGAVRCYELLKRLDKRFRLIIFSLSEKFE
FT                   IKRIWDNSILIEYPKGILPTIMFFRIVKQFNPDLVIVEYTSIYSFFPTIIGKLYGKPVI
FT                   LDAHNVEYVFKRGRLPSFLLPLFFLNELLLSKLSDILLVVSKLDKKIFELLYNIDRIVV
FT                   IPNGVNPDRFSNNETKSNCAVFHGDYNYDANREAINFILDLAKELPEIEFVIFGRDTNK
FT                   VKPKSKNVKVLGEVAYEEIPRILQKCKIAVVPLFRGSGTSLKILEYLSAGLTIVATKIA
FT                   VRGLPLKEGTHYYKAETEEEFVEKIKYALEHPTKQYSVIEFSWDNISKKLIKTIEKVIN
FT                   VRTKQD"
FT                   /protein_id="NP_963306.1"
FT   misc_feature    8781..9782
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:176609"
FT                   /locus_tag="NEQ012"
FT   gene            9793..10833
FT                   /db_xref="GeneID:2654521"
FT                   /locus_tag="NEQ013"
FT   CDS_pept        9793..10833
FT                   /locus_tag="NEQ013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="hypothetical protein, contains Radical Sam domain;
FT                   COG0535: Predicted Fe-S oxidoreductases; IPR000385: MoaA /
FT                   nifB / pqqE family"
FT                   /db_xref="GI:41614809"
FT                   /db_xref="GeneID:2654521"
FT                   /translation="MSVLNKIKTVLTTPIRDIEGRLKKGYYFLSLEISLTYLCNSRCTF
FT                   CNIWKIYKENPNLLKKELSKEEWIDFLSKNNKYLAWVSLTGGEPLLKDGAIDIINYLLN
FT                   NGKNVEITTNAIAYKYIIGNLEKIKNKKKLFVGVSLDGPKEIHDKLRGVPGNFDNAIKL
FT                   LEWLEQNNFNFGISVTISYQNAPYIMELFEFLEKRGWIDKVSFRVATISQYYRNEQKIV
FT                   ITKEHIQSIKEALLKIYKGYPRFRKDKFYFGNLLFLEGKIDFDCVAGRNFLFIDPYGNV
FT                   YPCLYRLDKKLGNIKENPNLLNYLGKFKRDCKCWSECHYLPARRSSTKELLSYIWFRLF
FT                   SNKKHL"
FT                   /protein_id="NP_963307.1"
FT   misc_feature    9889..10476
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="NEQ013"
FT   misc_feature    order(9907..9909,9913..9915,9919..9921,9925..9933,
FT                   10045..10047,10051..10056,10126..10134,10207..10209,
FT                   10327..10329,10414..10419)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="NEQ013"
FT   gene            complement(11037..11984)
FT                   /db_xref="GeneID:2654090"
FT                   /locus_tag="NEQ014"
FT   CDS_pept        complement(11037..11984)
FT                   /locus_tag="NEQ014"
FT                   /gene_family="HOG000009023" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="C4-dicarboxylate transporter [Magnetococcus sp];
FT                   COG1275: Tellurite resistance protein and related
FT                   permeases"
FT                   /db_xref="GI:41614810"
FT                   /db_xref="GeneID:2654090"
FT                   /translation="MTCRIRYFQPGFFAIPVGIGGLSIAYLRLAELFPYLKSIGLGLAW
FT                   LSFISLIVIAILYLAKIVFFKQEFLKDINNPIKLSMLPLFSIALLIDSISFGILKCNFA
FT                   LPLAIAGTMIHLLFTYFNLRTWITKDLHLSTITPTWYIPIVGNILVPITPINQILGIFN
FT                   WFFFSIGIIFWIILTTILFYRKFFHEPLPEALLPSLFILLAPPSVGFISYIKITHSLDS
FT                   IANILYFTALAFLLLLVTLIDRFVKIRFKLTWWAYIFPIDALTIATILYYHLTKMPLFI
FT                   DLAIAIESLATILLTIVGIKTLIAIKKGEICKEE"
FT                   /protein_id="NP_963308.1"
FT   misc_feature    complement(11184..11957)
FT                   /note="C4-dicarboxylate transporter/malic acid transport
FT                   protein; Region: C4dic_mal_tran; cl04176"
FT                   /db_xref="CDD:174809"
FT                   /locus_tag="NEQ014"
FT   gene            12031..13089
FT                   /db_xref="GeneID:2654528"
FT                   /locus_tag="NEQ015"
FT   CDS_pept        12031..13089
FT                   /locus_tag="NEQ015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Putative thymidylate synthase; COG1351: Predicted
FT                   alternative thymidylate synthase"
FT                   /db_xref="GI:41614811"
FT                   /db_xref="GeneID:2654528"
FT                   /translation="MRITVIDYFKDIEDIIGITAKSTQSLFPPSELEIDQKDIDDMLKY
FT                   TVEHKLSSVLDFPYYIIEIYGVSRSFTHQWVRHRLSSHMQQSLRYVKIIDEKVLELYES
FT                   DKRIDLITYVPKWFVIPPSILISGKEAIIKYIEAMINSSKAYLELLNYKIPEGNSFNHW
FT                   FLTKNREYIPKEDARFALPIGTKTFVTTAADAEEWLHIMKVRCCMDAQWEIRITAWTIG
FT                   FLLYLLHPRIFYRFGPWCIQERCRGFSIKRDPTCIKNIFNLKETLKEISNKIREHFINR
FT                   EDGEIETPLGRIKFYIENKKWDFFTIDLTDIFGYRTSEEIKKEVIDYFESQGIKLDKNL
FT                   LDFEVIGRIRYI"
FT                   /protein_id="NP_963309.1"
FT   misc_feature    12037..12726
FT                   /note="Thymidylate synthase complementing protein; Region:
FT                   Thy1; cl03630"
FT                   /db_xref="CDD:174787"
FT                   /locus_tag="NEQ015"
FT   gene            complement(14872..15147)
FT                   /db_xref="GeneID:2654480"
FT                   /locus_tag="NEQ016"
FT   CDS_pept        complement(14872..15147)
FT                   /locus_tag="NEQ016"
FT                   /gene_family="HOG000226098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1343: Uncharacterized ACR; IPR003799: DUF196"
FT                   /db_xref="GI:41614812"
FT                   /db_xref="GeneID:2654480"
FT                   /translation="MQYKINMYAIVVYDVNVSRQNQIREFLRKYLYHVQRSVFEGEISP
FT                   SSLYYMKKILQSYIGETDSLIIYVLRDKSCLMDKIVLGEDKDLQIY"
FT                   /protein_id="NP_963310.1"
FT   misc_feature    complement(14902..15129)
FT                   /note="CRISPR associated protein Cas2; Region: CRISPR_Cas2;
FT                   cl11442"
FT                   /db_xref="CDD:164225"
FT                   /locus_tag="NEQ016"
FT   gene            15157..16158
FT                   /db_xref="GeneID:2654474"
FT                   /locus_tag="NEQ017"
FT   CDS_pept        15157..16158
FT                   /locus_tag="NEQ017"
FT                   /gene_family="HOG000059257" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical protein [Pyrococcus
FT                   horikoshii]; COG1518: Uncharacterized ACR; IPR002729:
FT                   Protein of unknown function DUF48"
FT                   /db_xref="GI:41614813"
FT                   /db_xref="GeneID:2654474"
FT                   /translation="MKTIYILSIGKLYRGKNGLYFINKDKKKSPIPLESIKEIFILNKV
FT                   SVTYNALKLLADRNIPIHFFYENTKKGISYYLGSFLPRQKTKSGLVLVKQVEAYKDIEK
FT                   RTEIALEIVDAIRYNCIKVLEKYHIDEVKELRKIDVWKMFEESLNDWKDAINIIRGIES
FT                   NIWNLFYQGLDKILKLYKLERRTRRPPKNEANTIVSFANTLLYGVTLTEIYKTHLDPTI
FT                   SFLHELRDTRYSLALDLSENFKPIITFRILIWLVNQGIIKDTHFVKGLNGVLLNEQGKK
FT                   LVIKEFNKRLDETIKLKSGLKRSMRWYIKAQAYNLERFLLDGRKFKAFRLIY"
FT                   /protein_id="NP_963311.1"
FT   misc_feature    15160..16149
FT                   /note="CRISPR associated protein Cas1; Region: Cas_Cas1;
FT                   cl00656"
FT                   /db_xref="CDD:163892"
FT                   /locus_tag="NEQ017"
FT   misc_feature    15163..16140
FT                   /note="CRISPR-associated endonuclease Cas1; Region: cas1;
FT                   TIGR00287"
FT                   /db_xref="CDD:161805"
FT                   /locus_tag="NEQ017"
FT   gene            16354..17631
FT                   /db_xref="GeneID:2732553"
FT                   /locus_tag="NEQ018"
FT   CDS_pept        16354..17631
FT                   /locus_tag="NEQ018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614814"
FT                   /db_xref="GeneID:2732553"
FT                   /translation="MTGKPDNSLTIDLSKLNDPYYFNVLKSLLGHLKDARSAKDIQKLI
FT                   EILKNESEKSIEEDIRASILPTSVSKKEGRNFYLPKEGLLVEEEVNELIDDLAGVYLSS
FT                   GGNIYLLKIKNSQLFENYSNKIRGEGILDNGIDTKRLLGEVGLPRGVKISGDFPNINLF
FT                   LILNDFILFILGSEKLKKSINLKVEELSDDVLKNFLLPYLKDISFTSGVYTVLSRQKKR
FT                   KYYITNLTDFILKFYKNEIENPSSSIIGKFTFSFYITDKDFKDKALGLLDKFLYYLIFK
FT                   HSINWKILCDMLNIFYDYNYKKYLKNNKQPIHMRSAKEFFAMMNLEKIYDWAYATGKTI
FT                   LEVDKENGKDYVNEIIKEIKKEELPGKFKEELSKVLHKVSEKIRKDTRNDQFNLHIHPD
FT                   IAKKDLQGDEFYKVKAAVLAGLMNSL"
FT                   /protein_id="NP_963312.1"
FT   gene            17628..18596
FT                   /db_xref="GeneID:2732554"
FT                   /locus_tag="NEQ019"
FT   CDS_pept        17628..18596
FT                   /locus_tag="NEQ019"
FT                   /gene_family="HOG000144368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical protein [Pyrococcus
FT                   horikoshii]; COG1857: Uncharacterized ACR"
FT                   /db_xref="GI:41614815"
FT                   /db_xref="GeneID:2732554"
FT                   /translation="MMKTVQISILARVYGNVNADETIGNRVTIKKFYSSEGEVLPFVSA
FT                   RAIKYSIRQALKERGFEIDPFVAEKKEMRDSGNPIKYVDNDLFGFMAPYKGKKKGEGGS
FT                   VNRQAPIAISYFKALKNTPINVEFGARFPRENTIKIDKEKTEESNQESDQTLNPIPFEV
FT                   EVADFIGRLNVLIYENVGKFTEEELTNVQDKNILQNILQKEGKLYVLPEEERKKRLKAF
FT                   LEILLIPSYVLPRRTNSLNIPEYKVALIVLNKEGVLPIYQYLDYVKEGVVNLEKLKRLK
FT                   EIVEEAGSEAYIIDYDGWVEEEIFPKITVKQAVEKILNHLL"
FT                   /protein_id="NP_963313.1"
FT   misc_feature    17649..18578
FT                   /note="CRISPR-associated negative autoregulator DevR/Csa2;
FT                   Region: DevR; cl00803"
FT                   /db_xref="CDD:163910"
FT                   /locus_tag="NEQ019"
FT   gene            18593..19297
FT                   /db_xref="GeneID:2732555"
FT                   /locus_tag="NEQ020"
FT   CDS_pept        18593..19297
FT                   /locus_tag="NEQ020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614816"
FT                   /db_xref="GeneID:2732555"
FT                   /translation="MKALAFRISFFEHLFKNHYTKAFKLSYPTLLPTEALGLIGNICGY
FT                   DRKNVYKELKDLYFGSTFLDGYYIEENITFIQFKKETGGKYRSGIVKSQVYHNSEHLVI
FT                   IAGDEKKLNEKILNKIKTLNSDPIENNLGKWLLVKPIRYPYGGWNDFFAKDIRILDKFL
FT                   EVEEKENVRGYVPLDWVKSINENSEIETMPVKYKNKMEYFVFIKRGYALLKEKVKTVLD
FT                   IPIYSLEDFNYL"
FT                   /protein_id="NP_963314.1"
FT   misc_feature    18602..18727
FT                   /note="CRISPR-associated protein Cas5, N-terminal domain;
FT                   Region: CRISPR_cas5; cl12040"
FT                   /db_xref="CDD:164319"
FT                   /locus_tag="NEQ020"
FT   gene            19294..21561
FT                   /db_xref="GeneID:2654368"
FT                   /locus_tag="NEQ022"
FT   CDS_pept        19294..21561
FT                   /locus_tag="NEQ022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="DEAD Box helicase; COG1203: Predicted helicases;
FT                   IPR001410: DEAD/DEAH box helicase; IPR001687:
FT                   ATP/GTP-binding site motif A (P-loop); IPR001472: Bipartite
FT                   nuclear localization signal; IPR001650: Helicase C-terminal
FT                   domain"
FT                   /db_xref="GI:41614817"
FT                   /db_xref="GeneID:2654368"
FT                   /translation="MKCKSHPNKLLDQHIKEIKNIFNNLVNFYDIELNETEKKLFDYLI
FT                   ELHDIGKCRKEFQEYIKKLEKGEKPKSPGSHSLWSLEELERILSKIDLDKEYLPLLFYF
FT                   IAKHHSNLSLSNTDEKLKRQIAKLILKLNNLLNNQPEIDLLLNQGFFEIYYKGLLKKFE
FT                   KEELIKLADLFGVFKISDILSAKNILDKVNEIVYKEEITERKVEQLIGRSIDEERWGFQ
FT                   KCLSKFDYLSLRAPTGWGKTTTALLFALNKDYNKIFITLPTITAIEDFRQKLKNAGFKA
FT                   EEYFYFYDARAILDEEDERLNSLYFVQNLYSPINITTIDQILLSFLQAGKYFMKRLNLR
FT                   KSILIIDEIHLLTPQMLFLLKKLLEHLVPLYKIRLLLMSATLPKGIIDYLSENINIKFE
FT                   FVDIYELEPKYRNRERVEIELIKKDISENIERIVEENKKGKSVLVIANTVEKAVCIYKR
FT                   LKEEYNINNISLLHGRFMFKHRKEREREIRDLLENKGILVSTQVTEVSLDVDFDVLFTE
FT                   AAPISAIVQRLGRVNRYGKKSKSKVYIYYPKEIDKIEEDRRKKYPYNIEEIKKSWKFLE
FT                   ELDNFKEGIFIKKIDEVFTKEFYEGLIKGEEIFFKFREVFEDRKSQNNIHWFLQSTSEE
FT                   VGKKLLDFRDNVTTLIIPYGDLVEAEIYDEITKILEEYKKLKEKPYSYDEWKKFFAKAK
FT                   AHAVSVPLYLVLGLDPDKVGLPVINKLKEDYEFKYFKECGFVNLKKLKEMGCEFDSDYT
FT                   YQ"
FT                   /protein_id="NP_963315.1"
FT   misc_feature    19324..>19665
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="NEQ022"
FT   misc_feature    19984..21027
FT                   /note="CRISPR-associated helicase Cas3; Region: cas3_core;
FT                   TIGR01587"
FT                   /db_xref="CDD:162437"
FT                   /locus_tag="NEQ022"
FT   misc_feature    19990..20439
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ022"
FT   misc_feature    20005..20019
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ022"
FT   misc_feature    20332..20343
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="NEQ022"
FT   misc_feature    20578..20922
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ022"
FT   misc_feature    order(20632..20643,20707..20712,20791..20799)
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ022"
FT   misc_feature    order(20815..20817,20869..20871,20881..20883,20890..20892)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="NEQ022"
FT   gene            complement(21555..22061)
FT                   /db_xref="GeneID:2654369"
FT                   /locus_tag="NEQ021"
FT   CDS_pept        complement(21555..22061)
FT                   /locus_tag="NEQ021"
FT                   /gene_family="HOG000059268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1468: RecB family exonuclease; IPR002785: Domain
FT                   of unknown function DUF83; IPR001472: Bipartite nuclear
FT                   localization signal"
FT                   /db_xref="GI:41614818"
FT                   /db_xref="GeneID:2654369"
FT                   /translation="MALIGGAYIYYYFVCKRKLWFYANKITMEHESDLVQIGKYIELFY
FT                   KEKHKYERKVIINEISPDVIKRYKDFVLVFEIKKSDKFKEAALWQLKYYLWYLKRLGLN
FT                   VKGKLVIPEYNKEEYIELTEKDERKIKEILNEIKRIISMDKPPREVFKDYCKACAYYPL
FT                   CWEGY"
FT                   /protein_id="NP_963316.1"
FT   misc_feature    complement(21567..22049)
FT                   /note="Domain of unknown function DUF83; Region: Cas_Cas4;
FT                   cl00641"
FT                   /db_xref="CDD:174324"
FT                   /locus_tag="NEQ021"
FT   gene            22304..23197
FT                   /db_xref="GeneID:2732556"
FT                   /locus_tag="NEQ023"
FT   CDS_pept        22304..23197
FT                   /locus_tag="NEQ023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Peptidase M16 [Pyrobaculum aerophilum]; COG0612:
FT                   Predicted Zn-dependent peptidases"
FT                   /db_xref="GI:41614819"
FT                   /db_xref="GeneID:2732556"
FT                   /translation="MVIPVSPILFMCLITNTKFDEKEFEIEREIVLNEIKRYDSRPAGI
FT                   LCRNIPKSLFGESDYGDPIGGYEETIKNIEKSDLEEFKQKYYVSNNMFVVVNGNIKEKH
FT                   KQIIEKYFSKIEEGNPKKKKPTIGKGKDIEIKFPTKLVHCSLNFEAPLDLRYKLLTSIV
FT                   GYRGLMNAIFREKYGICYSCSFYIYNTYPDRLAISLELPGIEKQKLDLVEIAKEEFFEK
FT                   LKQLDEQEYKKAMEKFKLDFMTSKYNLYLKTKKDLIYINYFGKPWESIYKELLNINYEE
FT                   LKELTFKNGKKVIVSD"
FT                   /protein_id="NP_963317.1"
FT   misc_feature    22391..>22648
FT                   /note="Predicted Zn-dependent peptidases, insulinase-like
FT                   [General function prediction only]; Region: COG1026"
FT                   /db_xref="CDD:31229"
FT                   /locus_tag="NEQ023"
FT   misc_feature    22520..23005
FT                   /note="Peptidase M16 inactive domain; Region:
FT                   Peptidase_M16_C; pfam05193"
FT                   /db_xref="CDD:147402"
FT                   /locus_tag="NEQ023"
FT   gene            23219..24316
FT                   /db_xref="GeneID:2654373"
FT                   /locus_tag="NEQ024"
FT   CDS_pept        23219..24316
FT                   /locus_tag="NEQ024"
FT                   /gene_family="HOG000249377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   COG0446: Uncharacterized NAD(FAD)-dependent dehydrogenases;
FT                   IPR001327: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="GI:41614820"
FT                   /db_xref="GeneID:2654373"
FT                   /translation="MPRAIILGGGVAGLQAAHLLKDKAEVYVITENDYYISGPSRPLIL
FT                   SNEQQLDRIVRGYNHLPKEIKVLFGKAKIDLENNKVLVNNKELEYDYLIIATGIKYDYN
FT                   AIDIKDKIYNVYDIGKLFDLKHLIWTINKGSILVYAPKQPYRCAPAPGETIMTIDMVLR
FT                   HRKVRDNIKLIFVDANEKVQPPVIHDVWIKRFEEAGIEYYLGKEIVEVNEKGVKLNDGT
FT                   FIEADYKVILPPNKANNPIGEGFIEVRSPKDLRLKDYDNVYAVGDVAKLPFPKNAEIAL
FT                   QSAINAANQIIAEIEGTEYKPQDYRFGGWAYMGNLKELKTESTFFSLDFSEGKPKGNKD
FT                   PEPKVEYTKIKDQWEQSLLKKLFGY"
FT                   /protein_id="NP_963318.1"
FT   misc_feature    23231..>24046
FT                   /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
FT                   [General function prediction only]; Region: HcaD; COG0446"
FT                   /db_xref="CDD:30795"
FT                   /locus_tag="NEQ024"
FT   gene            24345..25118
FT                   /db_xref="GeneID:2654374"
FT                   /locus_tag="NEQ025"
FT   CDS_pept        24345..25118
FT                   /locus_tag="NEQ025"
FT                   /gene_family="HOG000038138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="glucose-1-phosphate uridyltransferase [Archaeoglobus
FT                   fulgidus]; COG1208: Nucleoside-diphosphate-sugar
FT                   pyrophosphorylases involved in lipopolysaccharide
FT                   biosynthesis-translation initiation factor eIF2B subunits;
FT                   IPR001825: ADP-glucose pyrophosphorylase"
FT                   /db_xref="GI:41614821"
FT                   /db_xref="GeneID:2654374"
FT                   /translation="MKDLSVIILSGGFATRLKPLSEYIPKPLLPIGGVPIINYILQRVI
FT                   ELNPERIIISVNKKFENHFRYWLKTLENDKIELIVTPIKDVKELKGAIWDLNYSIKEAW
FT                   INENLLVVAGDNLFDFNLRKLIRIMRENKSFALALYDVKNLELAKRYGVVKLKSNKIID
FT                   FKEKPEKPESTLVSTAIYAIPKEKLSLIDEYIENPNNEKDKLGKLIEWLLYTKNEPVYG
FT                   IIYEGNWFDIGSLDEYIRANKFVEKTGWNNRFLWP"
FT                   /protein_id="NP_963319.1"
FT   misc_feature    24360..25043
FT                   /note="NTP_transferases catalyze the transfer of
FT                   nucleotides onto phosphosugars; Region: NTP_transferase;
FT                   cd04181"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="NEQ025"
FT   misc_feature    order(24369..24380,24420..24425,24585..24587,24681..24683,
FT                   24687..24692,24873..24875)
FT                   /note="active site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="NEQ025"
FT   misc_feature    order(24369..24377,24507..24509,24681..24683,24687..24689)
FT                   /note="Substrate binding site; other site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="NEQ025"
FT   misc_feature    order(24687..24689,25035..25037,25041..25043)
FT                   /note="Mg++ binding site; other site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="NEQ025"
FT   gene            25199..25507
FT                   /db_xref="GeneID:2732557"
FT                   /locus_tag="NEQ026"
FT   CDS_pept        25199..25507
FT                   /locus_tag="NEQ026"
FT                   /gene_family="HOG000223158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614822"
FT                   /db_xref="GeneID:2732557"
FT                   /translation="MKTIEIEIVRPVNPVGISFVRYLWGAMAARDREVLERHRKEFSKL
FT                   VQRLGYTIEEKIGTGKLITGKVVIELDEDDKPLKARVEELKIWEPVKEINEKIEVEL"
FT                   /protein_id="NP_963320.1"
FT   gene            25482..26426
FT                   /db_xref="GeneID:2654375"
FT                   /locus_tag="NEQ028"
FT   CDS_pept        25482..26426
FT                   /locus_tag="NEQ028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614823"
FT                   /db_xref="GeneID:2654375"
FT                   /translation="MKKSKLNYSELNSIYKDLVFFDSNYIRKTLHRADYIEQFLDKYKI
FT                   DYHIYEHFVLVPDWVKYYLYIDGQKIDVLPTGLKSGKIEKNIKDSSDLENNYNYPNINF
FT                   NSYLESKTDISTPIFYNVPSLAVSKNSINLLLNSNDVDGYLKVKIRDIKNKNFVIGNVD
FT                   KAEQAIVVHYDALWYGAIDNTSSLGLILYMLKNKEINLNKNAIFLIGFTEIAYYWPEYW
FT                   DYSFIRVIEKYEDVFKKVKRKLIIDCIGYKDTQFLTDKEYIEAYGVFGDNILIYGTPLE
FT                   GLIAIYHATNDTIDKINFDQLKKDRDSLKTFLS"
FT                   /protein_id="NP_963321.1"
FT   gene            complement(26403..27497)
FT                   /db_xref="GeneID:2654376"
FT                   /locus_tag="NEQ027"
FT   CDS_pept        complement(26403..27497)
FT                   /locus_tag="NEQ027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614824"
FT                   /db_xref="GeneID:2654376"
FT                   /translation="MENSAIAKLLKNILGKRSLRSLFPHRGRLPYTLPQPLESRIEKFF
FT                   NFYKENREELKKAGIDDLPSFIYFSVYNLDKGVLDPYDPLAISRRLVFYYIWQHLPWDL
FT                   REYYEKISVSPKYRNNKDPVELLYEEKNRKELDGIVGFDIYEKPELNRLYIAGTVFFSI
FT                   KLTKLEDMYALLACLYNPQLCSELGKSVTPFPRKKHEPYDPEKIINKFKSKEKEIMDTL
FT                   EKVKRVPFDTIDKETFLPHYAKASVIAFGDRKAKSIAYDLLKFQTFYEIWNKYRHRNIL
FT                   DIFLYYLAHRKDQNYLSARTLRRLVSIYKIMDFNRLEREISKQKQEYEGLDFVRIEGDD
FT                   TYSIVITVLDRNKLIEYLRKKGFE"
FT                   /protein_id="NP_963322.1"
FT   gene            complement(27544..28059)
FT                   /db_xref="GeneID:2654377"
FT                   /locus_tag="NEQ029"
FT   CDS_pept        complement(27544..28059)
FT                   /locus_tag="NEQ029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614825"
FT                   /db_xref="GeneID:2654377"
FT                   /translation="MKAKKLLIFVPLLLLPLLTLLMHKTEPKHYKHYNIYVVYSPYCPH
FT                   CHNLLKTLDELGIKAITIDYREFPKTPYYKFVAKYFNGVPLVFAKTKNQLIIISGYPSE
FT                   IQDNNGYYYGKEYEIELCKKLGGKPVYINNSYYFCEINNTILGNRKAIEWLINICKSQG
FT                   CENLTIIK"
FT                   /protein_id="NP_963323.1"
FT   misc_feature    complement(<27868..27951)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="NEQ029"
FT   gene            complement(28056..28691)
FT                   /db_xref="GeneID:2654468"
FT                   /locus_tag="NEQ030"
FT   CDS_pept        complement(28056..28691)
FT                   /locus_tag="NEQ030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="IPR003834: Cytochrome c biogenesis protein
FT                   transmembrane region"
FT                   /db_xref="GI:41614826"
FT                   /db_xref="GeneID:2654468"
FT                   /translation="MDLVITTKLALVDAINPCVLAIQASLLAVLLTKSRRDALIGGILF
FT                   TITIFIMYLLYGLILHSILSMFYDYVRIFLLVLLLVLAILEIAAYFNYKPGLISIEMPI
FT                   KLRPLANQLIENTKNPLIAIPLAILLSLFLLPCSSGPYVSFLGLQKTIDWVLLLYYLTI
FT                   FVSPMILITLLVYYGFSPEKIKEWRDKHIRELHLVAGILLLLVLLYLI"
FT                   /protein_id="NP_963324.1"
FT   gene            complement(28722..29234)
FT                   /db_xref="GeneID:2654469"
FT                   /locus_tag="NEQ031"
FT   CDS_pept        complement(28722..29234)
FT                   /locus_tag="NEQ031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative RNA-processing protein"
FT                   /transl_table="11"
FT                   /note="Predicted RNA binding protein; similar to yeast
FT                   Dim2p protein that is essential for 40S ribosomal subunit;
FT                   structural studies show binding to 3' end of 16S rRNA in
FT                   complex with archaeal IF2 alpha"
FT                   /db_xref="GI:41614827"
FT                   /db_xref="GeneID:2654469"
FT                   /translation="MFSFEIEKKPNIIRNKKKLEERLNIELEEKENSYIVKANDGLTLN
FT                   KAIKIIDALNAGFGEEAYKLLDDNYDFMVIPIKRATKNDKERKRILARLIGTKGKAKKN
FT                   ISNLTGVSVIIDDKKKEAYLLGKIEDLIIARESINRIIEGQPHGKVYSFLESNRRLKKL
FT                   RDLRDSL"
FT                   /protein_id="NP_963325.1"
FT   misc_feature    complement(28764..>29120)
FT                   /note="arCOG04150 universal archaeal KH domain protein;
FT                   Region: arCOG04150; TIGR03665"
FT                   /db_xref="CDD:132704"
FT                   /locus_tag="NEQ031"
FT   gene            complement(29270..29341)
FT                   /db_xref="GeneID:3362467"
FT                   /locus_tag="NEQ_t03"
FT   tRNA            complement(29270..29341)
FT                   /db_xref="GeneID:3362467"
FT                   /locus_tag="NEQ_t03"
FT                   /product="tRNA-Phe"
FT   gene            29432..30583
FT                   /db_xref="GeneID:2732558"
FT                   /locus_tag="NEQ032"
FT   CDS_pept        29432..30583
FT                   /locus_tag="NEQ032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614828"
FT                   /db_xref="GeneID:2732558"
FT                   /translation="MMNVIDRMRKIPLPKKFVYKIEEKAKNYIIKEGPKLAPKLASVLT
FT                   ILAGAGLAMAKEYEIDLSSVKEGNIQYKNIKVKLNDTDISLNGNDMVDYVYEKDGFKYI
FT                   DYLNKVVSDTSGDWYVNNAFFTSSVNNPLRYSDLIENDQIKLSIPTKEKEINKLLDETD
FT                   TLNNLGGAYQITDGTLVIPKFEYNGKTHKVEIQLDGVNNAKLNIKFKVLPIVIDEKGLK
FT                   FNDSESLSNYYFDKNKLIDYLTNIASKMKDTNGHLIVKDGAVFVDYDKDNIWDAGIEPG
FT                   TYIDDTDLGKILTGRAIYAIGNISMDSLPQYIKVDGRNVDSSNPIYTNISRALQNGISF
FT                   EKLLYLVDVSEVDADYSKKFAIPAPVLGVMGLVPLFKRKRKNA"
FT                   /protein_id="NP_963326.1"
FT   gene            30576..32363
FT                   /db_xref="GeneID:2654040"
FT                   /locus_tag="NEQ033"
FT   CDS_pept        30576..32363
FT                   /locus_tag="NEQ033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="hypothetical protein [Cytophaga hutchinsonii]"
FT                   /db_xref="GI:41614829"
FT                   /db_xref="GeneID:2654040"
FT                   /translation="MLRLIILFLTIIGALAINVNVYSGTLVKSEDNYLILLKIGEGSFD
FT                   ANKVTITSLNSTFYLDYFNNINSSIDNYVYFDCPSGIKHTITFHDVINVGTDRGRIPQP
FT                   TIILDIPNETGCKLIMKDYNNALERSEFNVSVCKDLTCNKNHVQKVLSVQPTATLSVSP
FT                   STINVGESVTITLTANNCYKDPVNLGGSYEITDDKSEISYSGTFNGNLSISKSFTLTQT
FT                   GTHTITAKLYCYNGIITKTATVRVNKPSPTPSPSPKPSPSVSLSVTPTSINQYESIEIT
FT                   ATINNCNGGTFHIWDSQGEYDKTGNVTGNTYTFTDTIQLTIPGTHTISLSATCNSNNYT
FT                   DSKTVIVNEVPLQINSVTPINFTAIKIVTNKYVNTINATLNEKYLHWTPSQRKIENYNE
FT                   KVDCSQQGIKYEYICVFNNFIANGSKITIEADSKQFNFAMNNETLPDILYYIEPNKPIF
FT                   IAFEGYVDISYKPFNDAISNLTGTFMAYVNETPILYSDFSDYLPPYLAYFLNISNAVYL
FT                   PIKYKNVTNPKKYNLEKGKYSLLALAGNIDGMANKVSIDLSNFEVFDLVWDFREGKQTK
FT                   VFDLTPYWAKPLTNITWPN"
FT                   /protein_id="NP_963327.1"
FT   gene            32363..32998
FT                   /db_xref="GeneID:2654041"
FT                   /locus_tag="NEQ034"
FT   CDS_pept        32363..32998
FT                   /locus_tag="NEQ034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="IPR000531: TonB-dependent receptor protein; PS50321:
FT                   ASN_RICH"
FT                   /db_xref="GI:41614830"
FT                   /db_xref="GeneID:2654041"
FT                   /translation="MPAIPNCYYGNITNLCGIDINNSLLIAEPSNSSIEVVCDPNCHYG
FT                   GPKVKDKKLCLNSGNYSLYILKNDKKWFVETLEVNANGSVVKKDLTFRCNKTTNNTNNT
FT                   NSTENREVSTDNKNRSINNKKLSTYNKISNIVVPVTNNNQNQYYIPALYSIQANPTNSM
FT                   SFSETYESKQEMQKQSTQNIVTIEENNNWIWILPIIIFLVSFILAKNL"
FT                   /protein_id="NP_963328.1"
FT   gene            33020..34420
FT                   /db_xref="GeneID:2654055"
FT                   /locus_tag="NEQ035"
FT   CDS_pept        33020..34420
FT                   /locus_tag="NEQ035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614831"
FT                   /db_xref="GeneID:2654055"
FT                   /translation="MKRFLPAVVVLGLALAAPTAQLEVIDYPNTVYTKGVMAKSTIPIT
FT                   IKYNTTDATNSKLIVYLINQNEKNLALMEEYKIDAGKTKIETIEIPLYNLPDYPNVDDG
FT                   IYTIKFRLISFDNNGNTAADEKEINVSINEPFDVAQYDLDVLDLPLPEDKIVFTNTKTK
FT                   FQIPIIYDGIANSDYVTVTLCAIANGIKLACNDTSKTLTTRENLVELVMNIPSFTGDGK
FT                   LILSVKDNNGQNIVKEYAVKFVDGTLDVNVMPVSEKVMQGESTSIIVRVNNPIEKSRTV
FT                   YLTIKTPTDTITKTIYLEGYSSAQLVIPIKVKTNSNKFNVYVYASDGVYTYSKQLTLDV
FT                   VSKQDIINNIDVSYEKDKIELILYPKQPGVVTIKVLADGAIVDPSIKTISLDYKAKTVS
FT                   FNYKPLKDTATIKFEVYDLNNNKIAEKQIKIVQKKAQQFNWLLPIAIIIALGLGLYLGR
FT                   KKKEEIVE"
FT                   /protein_id="NP_963329.1"
FT   gene            34449..34733
FT                   /db_xref="GeneID:2654522"
FT                   /locus_tag="NEQ036"
FT   CDS_pept        34449..34733
FT                   /locus_tag="NEQ036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:41614832"
FT                   /db_xref="GeneID:2654522"
FT                   /translation="MKLNKIVALLDIIGDLLLCKMRDNYYIDIYSDENSIVVESEDLVV
FT                   TLKKSKNDKVFIKIEHPLGEWRFYANKKELEENLKNTKFAKLFVKLINL"
FT                   /protein_id="NP_963330.1"
FT   gene            34755..35015
FT                   /db_xref="GeneID:2654042"
FT                   /locus_tag="NEQ038"