(data stored in ACNUC8465 zone)

HOGENOMDNA: NITHX_2

ID   NITHX_2; SV 1; empty ; DNA; empty ; PRO; 188318 BP.
XX
AC   NC_007960;
XX
PR   Project: 58293;
XX
DE   Nitrobacter hamburgensis X14 plasmid 2, complete sequence.
XX
OS   Nitrobacter hamburgensis X14
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Nitrobacter.
XX
RN   [1]
RP   1-188318
RX   PUBMED; 18326675.
RA   Starkenburg,S.R., Larimer,F.W., Stein,L.Y., Klotz,M.G., Chain,P.S.,
RA   Sayavedra-Soto,L.A., Poret-Peterson,A.T., Gentry,M.E., Arp,D.J., Ward,B.
RA   and Bottomley,P.J.;
RT   "Complete genome sequence of Nitrobacter hamburgensis X14 and comparative
RT   genomic analysis of species within the genus Nitrobacter";
RL   Appl. Environ. Microbiol. 74 (9), 2852-2863 (2008)
XX
RN   [2]
RP   1-188318
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Ivanova,N., Ward,B., Arp,D., Klotz,M., Stein,L.,
RA   O'Mullan,G., Starkenburg,S., Sayavedra,L., Poret-Peterson,A.T.,
RA   Gentry,M.E., Bruce,D. and Richardson,P.;
RT   "Complete sequence of Plasmid2 of Nitrobacter hamburgensis X14";
RL   Unpublished
XX
RN   [3]
RP   1-188318
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (15-APR-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-188318
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Kyrpides,N., Ivanova,N., Ward,B., Arp,D., Klotz,M., Stein,L., O'Mullan,G.,
RA   Starkenburg,S., Sayavedra,L., Poret-Peterson,A.T., Gentry,M.E. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (28-MAR-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000321.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634489
CC   Source DNA and bacteria available from Dan Arp (arpd@bcc.orst.edu)
CC   Contacts: Dan Arp (arpd@bcc.orst.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..188318
FT                   /strain="X14"
FT                   /mol_type="genomic DNA"
FT                   /organism="Nitrobacter hamburgensis X14"
FT                   /plasmid="2"
FT                   /db_xref="taxon:323097"
FT   gene            44..628
FT                   /db_xref="GeneID:4025215"
FT                   /locus_tag="Nham_4355"
FT   CDS_pept        44..628
FT                   /locus_tag="Nham_4355"
FT                   /gene_family="HOG000026194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109491"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="GeneID:4025215"
FT                   /translation="MYRTKREYEVSWFQENPAPSLELIARAGLSNEAEIIDIGGGASRL
FT                   VDGLIDRRFRRITVLDLSAAALADAKTRLGRAGAGVEWVVADVTRWHPTRTYDLWHDRA
FT                   AFHFLTDPTDREAYIACLKKAVGPSGHVVIGTFAPDGPERCSGLPIIRYDADALAAVVG
FT                   AEFTLVDCRRHDHLTPGGNTQHFQFSVFQRN"
FT                   /protein_id="YP_571778.1"
FT   misc_feature    86..>376
FT                   /note="Trans-aconitate methyltransferase [General function
FT                   prediction only]; Region: Tam; COG4106"
FT                   /db_xref="CDD:33863"
FT                   /locus_tag="Nham_4355"
FT   gene            1159..1515
FT                   /db_xref="GeneID:4025216"
FT                   /locus_tag="Nham_4356"
FT   CDS_pept        1159..1515
FT                   /locus_tag="Nham_4356"
FT                   /gene_family="HOG000004477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109492"
FT                   /db_xref="GeneID:4025216"
FT                   /translation="MDVRRLIGRLLAVFVIAGLVTAPLVTPVAASALSISEMTGMSAMS
FT                   ADMPCCPDDQKNKNCHDCPLVAMCVLKTSQAGPSLTAALPLRQAIRTTHAVRNDVLADG
FT                   LDRPPPDHPPRNLA"
FT                   /protein_id="YP_571779.1"
FT   sig_peptide     1159..1251
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.504 at
FT                   residue 31"
FT                   /locus_tag="Nham_4356"
FT                   /product="hypothetical protein"
FT   gene            1615..2022
FT                   /db_xref="GeneID:4025217"
FT                   /locus_tag="Nham_4357"
FT   CDS_pept        1615..2022
FT                   /locus_tag="Nham_4357"
FT                   /gene_family="HOG000274045" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109493"
FT                   /db_xref="GeneID:4025217"
FT                   /translation="MKTFTLTRAVQAALIAAMMGGASMAALADIKDYKFELVDQTVQAG
FT                   PDKVITVRLLNTKTGKPVPDAVIFASRLDMTPDGMQEMVTKVEAVPAAEPGTYRFKATF
FT                   GMAGRWQLSLGAKVQGETGTVENKFVITAQQ"
FT                   /protein_id="YP_571780.1"
FT   sig_peptide     1615..1701
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.727 at
FT                   residue 29"
FT                   /locus_tag="Nham_4357"
FT                   /product="hypothetical protein"
FT   gene            2019..3437
FT                   /db_xref="GeneID:4025218"
FT                   /locus_tag="Nham_4358"
FT   CDS_pept        2019..3437
FT                   /locus_tag="Nham_4358"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109494"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:4025218"
FT                   /translation="MNRAVVTSATVAALIAAAGGGFVAARSPWSVAGVTGMVAPAAAEG
FT                   APTPIYYQDPDGKPSYSLTPRKTPDGRDYRAVPASADVSFDNDAPEPTPTASVGGSKER
FT                   RIKYYRNPMGLPDTSPKPKKDSMGMDYIPVYEGEDSDDGSVKLSPGKIQRTGVKSEPAA
FT                   RRVIRTIVCAPGTIALDERRISVIAMRSESFVLKVADVTTGSHVVKGQPLMEIYSPSVS
FT                   SAAAEYLTTITSKTTSGNVQYGRGSRQRLMNLDVPDAAISAIEKSRTVPTSIEWSAPRD
FT                   GIVLERNAIEGMRVQPGGVLFRIADHSVVWALIDVAERDLGAIAVGQPVTVKARSFPGR
FT                   EFTGKVDVIYPEINKETRTARVRVELKNADLILLHDMYVDAEINTGSPEAVLAIPESAV
FT                   LDTGARQSVLIDKGQGRFEPREVKLDQRGNGYVEVRSGVADGEPVVVSANFLIDAESNL
FT                   KAALKGFSETGAQP"
FT                   /protein_id="YP_571781.1"
FT   sig_peptide     2019..2096
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.883 at
FT                   residue 26"
FT                   /locus_tag="Nham_4358"
FT                   /product="hypothetical protein"
FT   misc_feature    2277..3404
FT                   /note="copper/silver efflux system membrane fusion protein
FT                   CusB; Provisional; Region: PRK09783"
FT                   /db_xref="CDD:170094"
FT                   /locus_tag="Nham_4358"
FT   gene            3434..6616
FT                   /db_xref="GeneID:4025219"
FT                   /locus_tag="Nham_4359"
FT   CDS_pept        3434..6616
FT                   /locus_tag="Nham_4359"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump CzcA"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109495"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:4025219"
FT                   /translation="MIARLIAWSARNLLLVFFGTGFAAAAGIYALVHLPLDAIPDLSDT
FT                   QVIVYTEYPGQAPQVIEDQVTYPLTTAMLTVPHSKVVRGFSFFGVSFVYVIFKDGTDIY
FT                   WARSRVLESLNSAASRLPAGVTPTIGPDATGVGWVYQYAVMSKELNLSDTRAIQDWNLK
FT                   FALAKAEGVAEVASVGGFVKQYNVILDPQRMRDLGITMQKMRDAIRASNADVGGRTVEL
FT                   SEFEYVIRGKGYLKDINDLGSIVLKTNNGTPVLLKDVARVELGPDERRGIAELNGEGEV
FT                   TSGIVLQRFGGNALDVIRNVKKRFKEIASSLPKSVDIVPVYDRSNLIIAAIATLKHTLL
FT                   EESAVVALVCIIFLLHVRSALVAILMLPVGVLMAFGAMKLLGLGSNIMSLGGIAIAIGA
FT                   MVDAAIVMIENAHKHLERAEPGRSRVNILIDAASEVGPALFFSLLIITVSFMPIFTLES
FT                   QEGRMFSPLAFTKTFSMAAAALLSVTLVPALMIVCVRGRIVPEHKNPINRFLIWIYRPV
FT                   IRGVMRAKTLVILLALGVLAVSVWPARQLGTEFMPNLNEGTLLYMPTTLPGISVTKAGE
FT                   LLQTQDRIIRSFPEVASVFGKAGRASTATDPAPSEMFETIINLKPKEQWRPGVTIDSLT
FT                   AEMDKALQFPGVSNAWTMPIKARIDMLSTGIRTPVGVKVIGIDLVEIDKLAKQIERVLK
FT                   VVPGTSSAYAERTIGGYYLDITPDRAALARYGIMIQDVQDVIATALGGQTVTTTVEGRQ
FT                   RFTVNMRYPRALRSDPQSIANVLVPMPGGGAVPLGEVAKIAPTRGPTSIRTEDGQLASY
FT                   IYVDIRDRDLGGYVADAQKAVQASIQFPPGYYVVWSGQYEYLERATARLKIVVPVTLLI
FT                   IFLLLYLNFRSLTETMIVMLSLPFALVGGLWLMWALGFNLSVAVAVGFIALAGVAAETG
FT                   VVMLIYLNQALAEIKARRLIEGRALMRTDLYDAVMEGAVERVRPKMMTVVAIMAGLLPI
FT                   MWSTGTGSEIMQRIAVPMIGGMISSTLLTLIVIPAIFALVKGFRLPNGVNRSTTPTTPT
FT                   MRAARRIPEPAE"
FT                   /protein_id="YP_571782.1"
FT   misc_feature    3434..6538
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="Nham_4359"
FT   sig_peptide     3434..3511
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.697 at
FT                   residue 26"
FT                   /locus_tag="Nham_4359"
FT                   /product="hypothetical protein"
FT   gene            6759..7466
FT                   /db_xref="GeneID:4025220"
FT                   /locus_tag="Nham_4360"
FT   CDS_pept        6759..7466
FT                   /locus_tag="Nham_4360"
FT                   /gene_family="HOG000061947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c, class I"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109496"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:4025220"
FT                   /translation="MSKFGILVLLAIAFLSPALAEQGNAARGRKDFKACAPCHSLEPGR
FT                   NMTGPSLADLWGRKAGGVLSFDRYSDALKASGIVWNDDTLDQWLTDPQNVVPGNEMPFD
FT                   GIKDVGARADLLAFLKEATKPGAAPARTAQSQMKGMSGMMDGGGHDPNLKSLEPARQVK
FT                   TITYCRDTYRVTTADGKMRAFWERNLRFMTDTSKDGPEKNAPAIMPAGMMGDRAAIIFA
FT                   EPEEIGRFIEPHC"
FT                   /protein_id="YP_571783.1"
FT   misc_feature    6759..7130
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="Nham_4360"
FT   sig_peptide     6759..6821
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT                   /locus_tag="Nham_4360"
FT                   /product="hypothetical protein"
FT   gene            7589..8146
FT                   /db_xref="GeneID:4025221"
FT                   /locus_tag="Nham_4361"
FT   CDS_pept        7589..8146
FT                   /locus_tag="Nham_4361"
FT                   /gene_family="HOG000094757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor"
FT                   /transl_table="11"
FT                   /note="Bacteria have multiple sigma factors which are
FT                   active under specific conditions; the sigma factor binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription"
FT                   /db_xref="GI:92109497"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="GeneID:4025221"
FT                   /translation="MMSHETELKALMLASLDGDAVSHRALLDQLSRYLRAFYKRHLDRI
FT                   GRGPEEAEDLVQEALLAIQLKRHTFDVETLLTPWVHAIARYKLIDYLRRNRALLAYLPI
FT                   GDHHELAAADDQIAVESTHDIGQLLNRLPTKVRHAIESVKLEGRSVAETAVRYDMTESG
FT                   VKISIHRGIKALAKLIGRETRA"
FT                   /protein_id="YP_571784.1"
FT   misc_feature    7589..8140
FT                   /note="RNA polymerase sigma factor; Provisional; Region:
FT                   PRK12539"
FT                   /db_xref="CDD:139049"
FT                   /locus_tag="Nham_4361"
FT   misc_feature    7664..7858
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Nham_4361"
FT   misc_feature    7961..8113
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:174508"
FT                   /locus_tag="Nham_4361"
FT   gene            8369..8710
FT                   /db_xref="GeneID:4025222"
FT                   /locus_tag="Nham_4362"
FT   CDS_pept        8369..8710
FT                   /locus_tag="Nham_4362"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109498"
FT                   /db_xref="GeneID:4025222"
FT                   /translation="MRHHEVSISGTHALTSDHTKSNSEIAGAGILPRQSQQENKMTNKN
FT                   DTSQQSVSAHGCCDGQASKEKAALAAAKPEAAPSSAAKRSAPAEAAGSCCHGEGSSDAD
FT                   HKKQHEHQS"
FT                   /protein_id="YP_571785.1"
FT   gene            complement(8861..9547)
FT                   /db_xref="GeneID:4025223"
FT                   /locus_tag="Nham_4363"
FT   CDS_pept        complement(8861..9547)
FT                   /locus_tag="Nham_4363"
FT                   /gene_family="HOG000274236" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109499"
FT                   /db_xref="GeneID:4025223"
FT                   /translation="MCFCEPVSFAAGGVLIVGGAFAGWKAFKINKRYFPVSQMPTLAGL
FT                   QQLMEGHVWMGVNNSDQSMIWWAAMGFIFFSWVIWPVWVPFSIYFLEPPGSRRKLPLLG
FT                   FALAGLVFGLILFVPHLFHPDWVNVRINRQSLAYEDTMFLDYLIPRWLTYLIYVFLLIT
FT                   PTMISTYLHIRLFGLTLIAITVVDYTFLSFAYISFFCFLAGLGTLHLIYIIVWNKCCRE
FT                   CPELFR"
FT                   /protein_id="YP_571786.1"
FT   sig_peptide     complement(9479..9547)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.869 at
FT                   residue 23"
FT                   /locus_tag="Nham_4363"
FT                   /product="hypothetical protein"
FT   gene            9583..12018
FT                   /db_xref="GeneID:4025224"
FT                   /locus_tag="Nham_4364"
FT   CDS_pept        9583..12018
FT                   /locus_tag="Nham_4364"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper-translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109500"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:4025224"
FT                   /translation="MTKITLEVGDLFSVLGAHGIERQVQRVAGVGHVSVNPVSGSTTVM
FT                   FDPGKTSPAAIQEAIKDCGFHCAGEAVPKHICEKPAMRGSSSKAPTSQLKPADSETHQD
FT                   HSGMAGMKPADTMAKPKAHGGDKSDAMAHEMGHGAGMDMQVMVRDMRNRFWIALAFSLP
FT                   IFLFSPMGMDFIQIPPPFGLRLDLILFVLASAAILYPVWPFVVAAYRALRSGVANMAVL
FT                   VVLSVGTGYLFSVGSTFFYGGQQFYEASAILLVFILLGHWLEMRARAGASEAIRALMDL
FT                   APPKATVLRDGKELEVATAEIISGDTVVIRPGNKIPVDGTVLEGTSQVDESMLTGESMP
FT                   VAKKAGDAVIGATINKSGAFHYRATKVGADTALAQIVKLVQEAQNSKAPSQLLADRASQ
FT                   WLVLAAVAVGLLTFVVWYWWIGQTLLFALSLTITVFVIACPDALGLATPMAIMVGTGLG
FT                   AMNGILFKNASALEDATKLNVVIFDKTGTLTMGHPEVVGLAIAVGATEEQLLSAAAAVE
FT                   AGSDHPLAQAILRRAANVKAPKTTGFGNIEGKGAQAEINGKIVLLGNKLLMSENNIDLG
FT                   ELGAKSEELQGAGRTVVHLAVDRKLVGLIAIADAVRPTAVEAVKSLRARGVEVAMLTGD
FT                   NQGTAERIAQSIGIDRVFANVLPGDKAGKVKELQSQGKKVGMVGDGVNDAPALTQADVG
FT                   FAIGAGTDVAMESADIVLMKSDPFDVVGAIELSHATLRKMHQNLWWAVGYNVVAFPLAA
FT                   GVLYPFLLSPTIAAIAMSGSSALVAANALMLKRTKLTGIRRQRPTASPETFTSVVATS"
FT                   /protein_id="YP_571787.1"
FT   misc_feature    9631..9786
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4364"
FT   misc_feature    10186..11880
FT                   /note="copper-(or silver)-translocating P-type ATPase;
FT                   Region: ATPase-IB1_Cu; TIGR01511"
FT                   /db_xref="CDD:130575"
FT                   /locus_tag="Nham_4364"
FT   misc_feature    10336..10998
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Nham_4364"
FT   misc_feature    11341..11718
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4364"
FT   gene            12054..13295
FT                   /db_xref="GeneID:4025225"
FT                   /locus_tag="Nham_4365"
FT   CDS_pept        12054..13295
FT                   /locus_tag="Nham_4365"
FT                   /gene_family="HOG000263335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109501"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4025225"
FT                   /translation="MAVLMASVFTVSIGYGVVLPLLPYLIERLLGAAADAAQVSRSTGL
FT                   LTGLYTLALFLFAPAWGHMSDRYGRRIILLIGLIGFSATMLTFAFIENLTAVYAERFLS
FT                   GMFAAAVTPGALATIGDLAATDEARARRLTFVSLAGISGFLLGPMLGVFVVRSAGSLLP
FT                   IGGGAGALTLPLAGTAVLALLVAAAAAVTVPGVKRGDATPKRDRADLAPSRWLVPKLLT
FT                   LAFVVSAGVGVFEVGLALRGKQELGLTQYQIALMFTECSSVMLVVQSIVFSPWIKPKTT
FT                   RWFIAPALAILAAGLFLVPRAPDFTLTLAVIGAVAASAGILSPILTYWISIKAGKAQGA
FT                   ELGKQTAASSLGAAVGSAAGGLLFDVAPLPHASFLLVAVLTVLGVLLSLGLPNALVTRK
FT                   LGEAACNGEGRAVS"
FT                   /protein_id="YP_571788.1"
FT   misc_feature    <12294..>12515
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cl11420"
FT                   /db_xref="CDD:176432"
FT                   /locus_tag="Nham_4365"
FT   gene            complement(13859..14338)
FT                   /db_xref="GeneID:4025226"
FT                   /locus_tag="Nham_4366"
FT   CDS_pept        complement(13859..14338)
FT                   /locus_tag="Nham_4366"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109502"
FT                   /db_xref="GeneID:4025226"
FT                   /translation="MGLRDYEGQRPADIRKARPDWNVFRDGCPSGESPAQVSERADRLI
FT                   ARLRTFKGNIAISHGHFGRVMAARWIGLEIRQAQHLLLSTASVSVLGYEHNLAEVPAIV
FT                   LWNGSTAGPRNGFKVGYAGRLVMNLGSTPRWVWIVVAVLAMAAAEYLMRPQIIPN"
FT                   /protein_id="YP_571789.1"
FT   misc_feature    complement(14024..>14326)
FT                   /note="Histidine phosphatase domain found in a functionally
FT                   diverse set of proteins, mostly phosphatases; contains a
FT                   His residue which is phosphorylated during the reaction;
FT                   Region: HP; cl11399"
FT                   /db_xref="CDD:175238"
FT                   /locus_tag="Nham_4366"
FT   gene            complement(14429..16810)
FT                   /db_xref="GeneID:4025227"
FT                   /locus_tag="Nham_4367"
FT   CDS_pept        complement(14429..16810)
FT                   /product="putative phosphoketolase"
FT                   /gene_family="HOG000236450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="Nham_4367"
FT                   /EC_number="4.1.2.22"
FT                   /db_xref="GI:92109503"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="GeneID:4025227"
FT                   /translation="MKTTADSKTLSPELLHNMDAYWRAANFLSVGQIYLYDNPLLKRPL
FT                   TLADVKHMLLGHWGTTPGQNFIYVHLNRVIKKYDLDMIYVSGPGHGGPAVVGNTYLEGT
FT                   YSEIYPDISQDEAGLRKLFTQFSFPGGIPSHASPECPGSIHEGGELGYSLSHSFGAVFD
FT                   NPDLVVACVVGDGEAETGPLATAWHSNKFLNPATDGAVLPILHLNGYKISNPTILARIT
FT                   REELEQLLRGYGWAPYFVEGHEPALMHEAMAATLDMAVEQIKQIQQDARIHGNVTRPRW
FT                   PMIVLDSPKGWTGPKVVDGLQVEGTFRAHQVPLSDPATHPEHLKLLEDWLRSYRPEELF
FT                   NEHGHLKPELAELAPKDERRMGANPHANGGILLRDLRMPNFRDYAADVPSPGVRGIGDT
FT                   RVLGPFLRDVTKLNSEQRNFRVFGPDETLSNGLEALFEVTNRQWDATTAANDDFLAPTG
FT                   RVMEMLSEHQCEGWLEGYLLTGRHGLFNCYEAFIHIVDSMFNQHAKWLEVTSHLPWRRK
FT                   IASLNYLLASHVWRQDHNGYTHQDPGFIGHVMNKKAEIVRVYLPPDANCLLSVTDHCLR
FT                   SRHYVNVVIAGKHPAPQWLTMDAAAAHCSEGIGIWQWAGSDQDSEPDVVMACCGDVPTL
FT                   ETLAAVSILRQRLPDLKIRVVNVVDLLKLQPKNEHPHGLSDTDFDSLFTKDKPVIFAFH
FT                   GYPWLVHRLTYRRTNHENLHVRGYKEEGTITTAFDMTVLNDLDRFHLVIDVIDRLPQLS
FT                   AKGAYLKQQLQDKLTEHKHYIRRYGEDMPEIRNWRWGAKT"
FT                   /transl_table="11"
FT                   /protein_id="YP_571790.1"
FT   misc_feature    complement(14435..16786)
FT                   /note="putative phosphoketolase; Provisional; Region:
FT                   PRK05261"
FT                   /db_xref="CDD:167947"
FT                   /locus_tag="Nham_4367"
FT   misc_feature    complement(15872..16552)
FT                   /note="Thiamine pyrophosphate (TPP) family, Phosphoketolase
FT                   (PK) subfamily, TPP-binding module; PK catalyzes the
FT                   conversion of D-xylulose 5-phosphate and phosphate to
FT                   acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O.
FT                   This enzyme requires divalent...; Region: TPP_PK; cd02011"
FT                   /db_xref="CDD:48174"
FT                   /locus_tag="Nham_4367"
FT   misc_feature    complement(order(16181..16183,16187..16189,16280..16291,
FT                   16361..16363))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48174"
FT                   /locus_tag="Nham_4367"
FT   misc_feature    complement(15080..15616)
FT                   /note="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; Region: XFP; pfam03894"
FT                   /db_xref="CDD:112695"
FT                   /locus_tag="Nham_4367"
FT   misc_feature    complement(14444..15049)
FT                   /note="XFP C-terminal domain; Region: XFP_C; pfam09363"
FT                   /db_xref="CDD:150139"
FT                   /locus_tag="Nham_4367"
FT   gene            complement(17002..18123)
FT                   /db_xref="GeneID:4025228"
FT                   /locus_tag="Nham_4368"
FT   CDS_pept        complement(17002..18123)
FT                   /locus_tag="Nham_4368"
FT                   /gene_family="HOG000268565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosidase, PH1107-related"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109504"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="GeneID:4025228"
FT                   /translation="MSDFQLRRLGLLMEPEPGNPLEAEGVLNPAAARGPDGQLYLFPRL
FT                   VARGNHSRIGIARVLFNEIGDPVGVERLGIALEPEMDYELRSDGTGGCEDPRITFVEPL
FT                   RRYVMTYTAHSPNGPRIALAISENLFRWQRLGLATFRPYEGIEFEGVDNKDASVFPVAI
FT                   PDPSGQLSMAILQRPLFPGTRPEETLRRPGSGLVDLDRESIWISYCSTALADCEPFHLS
FT                   HFGSHHRLAAPMAAWERLKIGGGTPPILTRHGWLTIYHGVSELSAAPGFPRKLLCYSAG
FT                   VLVLSEEHPQVIRFRSPEPVLIPELPQERQGIVANVVFPTGIDRRDDLGSPDRFDVYYG
FT                   MADNRIGVARLDIPKHLPSDGLKDLPPVKLLEL"
FT                   /protein_id="YP_571791.1"
FT   misc_feature    complement(17065..18075)
FT                   /note="Glycosyl hydrolases family 43; Region:
FT                   Glyco_hydro_43; cl09152"
FT                   /db_xref="CDD:158437"
FT                   /locus_tag="Nham_4368"
FT   gene            complement(18116..18892)
FT                   /db_xref="GeneID:4025229"
FT                   /locus_tag="Nham_4369"
FT   CDS_pept        complement(18116..18892)
FT                   /locus_tag="Nham_4369"
FT                   /gene_family="HOG000113408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD family hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109505"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="GeneID:4025229"
FT                   /translation="MKTLIVFDLDGTIAESKSSLDDEMSALLRDLLSIVKVAVISGGNW
FT                   PQFERQLVSNLPRDANLENLSLLPTCGTKFYRYGSAWEELYSENFTDEEKTKIIGSLHQ
FT                   AVGALGFNAEMVWGEPIEDRESQITFSALGQEAPLEEKKKWDPDFSKRKQIKAFLDNSI
FT                   PEFSVRLGGTTSVDVTKQGIDKAYGIKKLRDILGVAISEMIFIGDALFPGGNDYPAKEA
FT                   GVVSIQVRDPNETKRVIEAIIACLDSKRDQVSRRNE"
FT                   /protein_id="YP_571792.1"
FT   misc_feature    complement(18158..18889)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4369"
FT   misc_feature    complement(18206..18883)
FT                   /note="HAD-superfamily hydrolase, subfamily IIB; Region:
FT                   HAD-SF-IIB; TIGR01484"
FT                   /db_xref="CDD:162385"
FT                   /locus_tag="Nham_4369"
FT   gene            complement(18889..22155)
FT                   /db_xref="GeneID:4025230"
FT                   /locus_tag="Nham_4370"
FT   CDS_pept        complement(18889..22155)
FT                   /locus_tag="Nham_4370"
FT                   /gene_family="HOG000237472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Beta-phosphoglucomutase hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109506"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="GeneID:4025230"
FT                   /translation="MQVVITLSPRDYDAVLFDLDGVLTRTATVHASAWKKLFDGFLEQH
FT                   ATQSGEPFVPFDIDADYPRYVDGKSRYDGVASFLKSRRIELPLGTPEDGAEVQSVHALG
FT                   NLKDRYFLEHLKRDGVDPYETSVALVRKLRALEIKTAVVSSSVNCAEVLEAAGITQLFD
FT                   ARVDGTDITRLKLTGKPAPDAFLEAARRVGAEASRGVVVEDAIVGVAAGHAGRFGCVIG
FT                   VDRSGHAMALRDAGADVVVTDLAQVQVAVEPPSTWSLAYEGFDPAQEGIREALCTLGNG
FT                   YFATRGAAAGPIANDIHYPGTYLAGGYNRLRTNIASRVVESEDLVNCPNWLALEFRMAE
FT                   QDWFDARTVKLLSYHQELDLRNGMLLRSVGFEDAEGRRSTLKERRLISMGSMHLGALEL
FT                   TLTADNWSACVTVRSAIDGRVINAGAKLYRKFNNKHLEPLTSEVVDEDSMCLQVRTCQS
FT                   NIHVAQAARTRAFLDGQILTVQRRVIEEPGYIGQELKIDVKQGERLVLEKLASFYTSRD
FT                   QAISECALEARKAIARVGRFDALMADHVLAWRHLWHRFDVHIQPAEPGFRMNVQMLLRL
FT                   DMFHLLQAVSPNSIGIDIGVPARGWTGEAYQGHVFWDELFIFPFFNYRMPEITRSLLMY
FT                   RYRRLGEARAAAIAAGYKGAMFPWQSGSDGQEETQALNLNPRSQRWVPDNSYLQRHVGS
FT                   AIAYNVWQYFQVTHDVEFLNSYGAELILDIACFWSSIATFDDVRGRYEIRGVMGPDEFH
FT                   DGTPDSATPGLNNNAYSNIMAVWVLCRALEVHDLLSKVRRAELTTQLGLSAEEIARWGD
FT                   ISRKMYVPFHDDGIISQFEGYEKLREFDWEDYRARYGNIQRLDLILEMENDSANRYKLS
FT                   KQADVLMLFYLFSAEEIGELFERLGYPFEYETIPRNVAYYAARSSHGSTLCRVVHAWVL
FT                   ARSDRQRAMDFFAEALQSDVSDIQQGTTAEGIHLGAMAGTVDLMQRVSTGIEVRGDVLR
FT                   LNPELPQEIERLDMSIRYRGHSLDLRLTRDSLTVHGHDDAAAPISLCIDGKLCEFLGGT
FT                   TRVFQLNGNAADSEIVEKEPADGRARLHDRLGDSGEAEYR"
FT                   /protein_id="YP_571793.1"
FT   misc_feature    complement(21496..22122)
FT                   /note="beta-phosphoglucomutase family hydrolase; Region:
FT                   PGMB-YQAB-SF; TIGR02009"
FT                   /db_xref="CDD:162658"
FT                   /locus_tag="Nham_4370"
FT   misc_feature    complement(21487..22116)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4370"
FT   misc_feature    complement(19000..21387)
FT                   /note="Trehalose and maltose hydrolases (possible
FT                   phosphorylases) [Carbohydrate transport and metabolism];
FT                   Region: ATH1; COG1554"
FT                   /db_xref="CDD:31743"
FT                   /locus_tag="Nham_4370"
FT   misc_feature    complement(20605..21381)
FT                   /note="Glycosyl hydrolase family 65, N-terminal domain;
FT                   Region: Glyco_hydro_65N; pfam03636"
FT                   /db_xref="CDD:146332"
FT                   /locus_tag="Nham_4370"
FT   gene            complement(22288..23238)
FT                   /db_xref="GeneID:4025231"
FT                   /locus_tag="Nham_4371"
FT   CDS_pept        complement(22288..23238)
FT                   /product="glucokinase"
FT                   /gene_family="HOG000274469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="Nham_4371"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="GI:92109507"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="GeneID:4025231"
FT                   /translation="MTALRVIGDIGGTYARFAVAERGKYSELQHLSVSKYAALKDALGE
FT                   YLAALPRDLRPTRGALAVAGPVSGDEVKLTNLNWSFSITALKADLGMSSLVVVNDFAAT
FT                   AMSVPYLPEADCYPIGPPQSKTSGPVGVIGPGTGLGVSALVPDAGRWILLPGEGGHSTL
FT                   PPATQAESLIVEVLRTHWPHVSAERALSGAGLVNLYQALCSIEGKRPDPLSPADVTDRA
FT                   MRGSDPTCVKAFEVFCSMLGTVAGDLALTIGATGGIYIAGGILLRFKEAFASSPFRDRF
FT                   EDKGRFQDYLRRIPTLLILEESPALLGLANLPLEP"
FT                   /transl_table="11"
FT                   /protein_id="YP_571794.1"
FT   misc_feature    complement(22309..23229)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="Nham_4371"
FT   gene            complement(23417..24655)
FT                   /db_xref="GeneID:4025232"
FT                   /locus_tag="Nham_4372"
FT   CDS_pept        complement(23417..24655)
FT                   /locus_tag="Nham_4372"
FT                   /gene_family="HOG000288399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetate kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109508"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="GeneID:4025232"
FT                   /translation="MAIPTKALEARRGPYSLLAINGGSSSIRFALFDVGEPLRRLLDGK
FT                   VDRIGLSGTNFTFKDATGQSQNSHAIDASDRHSAVGFLLDWLETQQAFASVKAIGHRVV
FT                   HGMTHSEPERVTPELLDELHRIMPYDPDHLPLEIESIEAFRQHHPALPQVACFDTAFHR
FT                   TMPRVASLLPIPRRYEAAGVRRYGFHGLSYEFLMEELARLGDPAATKGRVILAHLGNGA
FT                   SLAAVRDGNSIDTSMGFTPTSGLVMSSRSGDLDPGLVSYLARTEQMSASHFWEMVNQAS
FT                   GLLGVSEISSDLRDLLARESDDVRAAEAVALFCYQAKKWIGSFAAALGGLDTLVFAGGI
FT                   GENAALIRERICDGLGFLDIELDQKRNAKNASLISTDGGRVAVRVIRTDEEIMIARSVV
FT                   RLFGLDDGKPVEG"
FT                   /protein_id="YP_571795.1"
FT   misc_feature    complement(23450..24607)
FT                   /note="acetate kinase; Reviewed; Region: PRK12440"
FT                   /db_xref="CDD:171501"
FT                   /locus_tag="Nham_4372"
FT   misc_feature    complement(23453..24604)
FT                   /note="Acetokinase family; Region: Acetate_kinase; cl01029"
FT                   /db_xref="CDD:174499"
FT                   /locus_tag="Nham_4372"
FT   gene            complement(24706..25170)
FT                   /db_xref="GeneID:4025233"
FT                   /locus_tag="Nham_4373"
FT   CDS_pept        complement(24706..25170)
FT                   /locus_tag="Nham_4373"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109509"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:4025233"
FT                   /translation="MYEFLEGLVANYMTCPVKTVTRQVTMRELNLLFESNDFNAYPVEE
FT                   HARVLGLVTKFDFLSCFAFRPGQMVPRYDELMNRTVADVMTPEFIYVNETTRLTRVLQL
FT                   IVDHRIKSIPVIEADHRLGRNHFTRRYYASVGALHRQPKQRRSKSNITLS"
FT                   /protein_id="YP_571796.1"
FT   misc_feature    complement(24802..25131)
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so...; Region: CBS_pair; cl10010"
FT                   /db_xref="CDD:99705"
FT                   /locus_tag="Nham_4373"
FT   gene            25600..25887
FT                   /db_xref="GeneID:4025234"
FT                   /locus_tag="Nham_4374"
FT   CDS_pept        25600..25887
FT                   /locus_tag="Nham_4374"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109510"
FT                   /db_xref="GeneID:4025234"
FT                   /translation="MRGVSEQPVSKKIKRRNRGGDYNSALVRCLSSDQRLRFAIDQAGV
FT                   GTWDLDLATQELFFSDRTRALFGLSAFKNLLLDDFHASLGAGYRGQSDLR"
FT                   /protein_id="YP_571797.1"
FT   gene            25981..26787
FT                   /db_xref="GeneID:4025235"
FT                   /locus_tag="Nham_4375"
FT   CDS_pept        25981..26787
FT                   /locus_tag="Nham_4375"
FT                   /gene_family="HOG000186462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Crp/FNR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109511"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="GeneID:4025235"
FT                   /translation="MLTQPLSAPVIPTKFSKIPSAAADEFCSVTGHAGLVATEFSYSKD
FT                   AEIYGEEELGEYVYQIVRGAVRTYKLLSDGRRQIGAFHLPGDFFGLESGPVHRLTAEAI
FT                   IDTTVRLVTRRGLEKAAVTDVQVARSLWAMTSSDLRHAEDHMLLLGRKNAKERVATFLL
FT                   EMDGRLAGTGMMALPMCRRDIGDYLGLTLETVSRTLSQFHSQECWGFRGPAKFCFATAS
FT                   VSSIWMRENKGSFVCQTEKRLFHQERLYTTRNDTAPNASAGCAQRC"
FT                   /protein_id="YP_571798.1"
FT   misc_feature    26002..26616
FT                   /note="transcriptional regulator FixK; Provisional; Region:
FT                   fixK; PRK09391"
FT                   /db_xref="CDD:169830"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    26089..26376
FT                   /note="effector domain of the CAP family of transcription
FT                   factors; members include CAP (or cAMP receptor protein
FT                   (CRP)), which binds cAMP, FNR (fumarate and nitrate
FT                   reduction), which uses an iron-sulfur cluster to sense
FT                   oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
FT                   cd00038"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    order(26248..26253,26269..26277)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    order(26335..26343,26353..26361)
FT                   /note="flexible hinge region; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    26440..>26595
FT                   /note="helix_turn_helix, cAMP Regulatory protein
FT                   C-terminus; DNA binding domain of prokaryotic regulatory
FT                   proteins belonging to the catabolite activator protein
FT                   family; Region: HTH_CRP; cd00092"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    26449..26454
FT                   /note="putative switch regulator; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    order(26512..26514,26518..26526,26551..26553)
FT                   /note="non-specific DNA interactions; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    26551..26571
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    order(26554..26559,26569..26571)
FT                   /note="sequence specific DNA binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   misc_feature    26554..26559
FT                   /note="putative cAMP binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Nham_4375"
FT   gene            26781..27416
FT                   /db_xref="GeneID:4025236"
FT                   /locus_tag="Nham_4376"
FT   CDS_pept        26781..27416
FT                   /locus_tag="Nham_4376"
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109512"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="GeneID:4025236"
FT                   /translation="MLGANDGIVSTASLVLGVAAAHGSRSNVLVAGVAGLVAGAMAMAA
FT                   GEYVSVHSQADTEKAELKRELAELKADDKGEHEELTAIYVARGLDPLLAKQVADQLMAH
FT                   DAIGAHARDELGVTETLRARPIQAAFASALSFAVGAAMPLLTAASVPEASLIILVPATS
FT                   LMFLALLGALAAGAGGAGLAVGAIRVTFWGALAMGLTAGVGALFGTVV"
FT                   /protein_id="YP_571799.1"
FT   misc_feature    26784..27401
FT                   /note="Nodulin-21 and CCC1-related protein family; Region:
FT                   Nodulin-21_like_1; cd02432"
FT                   /db_xref="CDD:153123"
FT                   /locus_tag="Nham_4376"
FT   gene            27655..30093
FT                   /db_xref="GeneID:4025237"
FT                   /locus_tag="Nham_4377"
FT   CDS_pept        27655..30093
FT                   /locus_tag="Nham_4377"
FT                   /gene_family="HOG000265624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109513"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:4025237"
FT                   /translation="MSSSDAEQRLAQYGPNSDAEAKADSLLRAIFRRLLEPLSLILLAA
FT                   GIISVVTGDAIGGSIIVAILALSIGLDTVQEGHAVRTADILRRSVALKAEVKRDGTFHQ
FT                   IEVERVVPGDILRVRAGDIIPADALILQSTACTTGEAALTGEPYPIEKRAGVVTGTNAG
FT                   EASNTLFRGAVAQTGEAIALAVNTGRATVFGAAASALAQAQAPSPFQRDLHQFGLVIAR
FT                   LTLALVVIVLATRVLLGRPVLDSLLFAVALAVGLTPELLPMITTVTLSRGAMRMAGRKV
FT                   IVKRLASIHDLGAMTVLCTDKTGTLTSAEITLARSLDAFGADDPRAARLGAIAADLGGD
FT                   RGSLDAALLRGSSAAAGGWTLLGRHAFDFTRRLGSVLAAGPDGQLLIVKGAPEAVLALC
FT                   TKQRRGKDVLAMDGRARTEAIDRVHALAQNGLRAVAVASRPWSEKAHEVEVADENELVF
FT                   EGVCAFADPPKPTAAAAIARLASAGVRLKILSGDDPIVVKRLAGLVGLNAEKVLSGNDI
FT                   AKLSDEALAVQVQSVDAYGRLAPDQKSRIVKALQSKGAVVGFLGDGINDAPGLKAADIG
FT                   LSVEGATGVAQAAADMILLASDLEVVADGVEEGRRTFANILKYVRMGASSNFGNMLSMA
FT                   VASIALPFLPMLPTQILLNNLLYDLSELGIPFDGVRPEATARPQVWDMSGLIRFAAIMG
FT                   PLSSLFDFLTFGALVFVFNASPAEFRTTWFLESMATQILVIFIIRTNGRPWQDLPRPAL
FT                   AASSLVALIVAMVLPFTPVGGWFGFEAPPLAMLVGTGIIVIVYLVFAELLKPLVVRSRH
FT                   "
FT                   /protein_id="YP_571800.1"
FT   misc_feature    27655..30081
FT                   /note="magnesium-transporting ATPase MgtA; Provisional;
FT                   Region: PRK10517"
FT                   /db_xref="CDD:170493"
FT                   /locus_tag="Nham_4377"
FT   misc_feature    27658..>27753
FT                   /note="Cation transporter/ATPase, N-terminus; Region:
FT                   Cation_ATPase_N; cl02930"
FT                   /db_xref="CDD:155184"
FT                   /locus_tag="Nham_4377"
FT   misc_feature    27832..28521
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Nham_4377"
FT   misc_feature    <29104..29436
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4377"
FT   misc_feature    29581..30072
FT                   /note="Cation transporting ATPase, C-terminus; Region:
FT                   Cation_ATPase_C; pfam00689"
FT                   /db_xref="CDD:144331"
FT                   /locus_tag="Nham_4377"
FT   gene            complement(30520..31326)
FT                   /db_xref="GeneID:4025238"
FT                   /locus_tag="Nham_4378"
FT   CDS_pept        complement(30520..31326)
FT                   /locus_tag="Nham_4378"
FT                   /gene_family="HOG000004276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine phosphorylases family protein 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109514"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="GeneID:4025238"
FT                   /translation="MATPPILDNKNTSSPSVFLPSALLRESRRQKNLPVSQVPPVCLLD
FT                   PDGDLVGKLRQTGQAKRFASWPCYHTELDTFMLAGREIGIVGRVVGAPSAVLVAEELFA
FT                   SGCRLLISLTSAGQIVPCGPTPYFIIIDRALRDEGTSYHYAPPSEFAEACPLLVSKAFD
FT                   ATSRIEPRVVVGSTWTTDAPFRETAEAIRAAKLKGILAVEMEAAALYAFAQAAGAKLLC
FT                   LAHVTNTMGQGGADFDKGEADGTTDAIKMLDRVVAALSHTIDTPAV"
FT                   /protein_id="YP_571801.1"
FT   misc_feature    complement(30550..>31053)
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Nham_4378"
FT   gene            31364..31984
FT                   /db_xref="GeneID:4025239"
FT                   /locus_tag="Nham_4379"
FT   CDS_pept        31364..31984
FT                   /locus_tag="Nham_4379"
FT                   /gene_family="HOG000026194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109515"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="GeneID:4025239"
FT                   /translation="MDEIDRQAHWENVYRTKREYEVSWFQENPAPSLELIARAGLSNEA
FT                   EIIDIGGGASRLVDGLIDRRFRRITVLDLSAAALADAKTRLGRAGAGVEWVVADVTRWH
FT                   PTRTYDLWHDRAAFHFLTDPTDREAYIACLKKAVGPSGHVVIGTFAPDGPERCSGLRII
FT                   RYDADALAAVVGAEFTLVDCRRHDHLTPGGNTQHFQFSVFQRN"
FT                   /protein_id="YP_571802.1"
FT   misc_feature    31442..>31732
FT                   /note="Trans-aconitate methyltransferase [General function
FT                   prediction only]; Region: Tam; COG4106"
FT                   /db_xref="CDD:33863"
FT                   /locus_tag="Nham_4379"
FT   gene            complement(32047..34503)
FT                   /db_xref="GeneID:4025240"
FT                   /locus_tag="Nham_4380"
FT   CDS_pept        complement(32047..34503)
FT                   /locus_tag="Nham_4380"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper-translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109516"
FT                   /db_xref="InterPro:IPR001756"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:4025240"
FT                   /translation="MTSPEKANSKGECGCSSKASAAPGPDETKAACCGDGHGGHDHDAH
FT                   EHRHHPVSGDGKVVDPVCGMTVDPTSSKHRFDYQGHTYHFCSAGCRTKFAAAPETYLDK
FT                   SKATPKDPVPEGTVYTCPMHPEIRQIGPGSCPICGMALEPEVATLDAAPNPELADMTRR
FT                   FWIGLVLALPAVVLEMGGHLVGGHGWVDQTLSNWIQLVSATPVVIWAGWPFFVRGWQSL
FT                   VTRNLNMFTLIAMGTGVAYVYSLVATVAPQVFPPAFRGHDGAVAVYFEAAAVITVLVLL
FT                   GQVLELRAREATSGAIKALLDLAPKTARLVAEDGTDHEVPLDGLNVGDRLRVRPGEKVP
FT                   VDGVILEGRSSVDESLVTGESMPVTKEIDAKVIAGTLNQSGSFVMQAEKVGRDTVLSQI
FT                   VQMVAQAQRSRAPIQRLADQVAGWFVPAVIGAALVAFAVWALVGPEPRLAFGLVAAVSV
FT                   LIIACPCALGLATPMSIMVGVGRGAQVGVLIKNAEALERMEKIDTLVVDKTGTLTEGKP
FT                   KVVSIVASAGFREDDLLRFAASVERASEHPLADAIVRAAKERDLSLANVEEFDSPTGKG
FT                   VTGKVDGKNILLGNVGYLQSLGVETQSMEAQAEALRGDGATVINIAVDGKLAGLFAIAD
FT                   PIKPSTPDALRALAADGIKVIMLTGDNRTTANAVAKRLGISEVEAEVLPDQKSAVVSKL
FT                   QKAGRIVAMAGDGVNDAPALAAAEVGIAMGTGTDVAMESAGVTLLKGDLGGIVRARLLS
FT                   EATMANIRQNLFFAFIYNAAGIPIAAGVLYPVFGLLLSPIIAAAAMALSSVSVVGNALR
FT                   LRMVKL"
FT                   /protein_id="YP_571803.1"
FT   misc_feature    complement(34201..>34317)
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:176577"
FT                   /locus_tag="Nham_4380"
FT   misc_feature    complement(32152..34161)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Nham_4380"
FT   misc_feature    complement(33013..33684)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Nham_4380"
FT   misc_feature    complement(<32341..32631)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4380"
FT   gene            34557..34832
FT                   /db_xref="GeneID:4025241"
FT                   /locus_tag="Nham_4381"
FT   CDS_pept        34557..34832
FT                   /locus_tag="Nham_4381"
FT                   /gene_family="HOG000023915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109517"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:4025241"
FT                   /translation="MRKDIKTSCQKRLSRIEGQVRGLAKMVEEDRYCIDIVTQISAVRA
FT                   ALRRVEEEVLKDHVAHCVEYAIASGDKADQRRKIAELMAVVGRAER"
FT                   /protein_id="YP_571804.1"
FT   misc_feature    34587..34814
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="Nham_4381"
FT   gene            34919..35395
FT                   /db_xref="GeneID:4025242"
FT                   /locus_tag="Nham_4382"
FT   CDS_pept        34919..35395
FT                   /locus_tag="Nham_4382"
FT                   /gene_family="HOG000271423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109518"
FT                   /db_xref="GeneID:4025242"
FT                   /translation="MLLGLTRMQRRRAGWFIALAYLFCVMAPTLSFALPGSQAAPYCLT
FT                   DEDHVPGMIHMHHEGVMHVHKGGHDQHHSGVQTHADSSADHDAKPVALKSDAGPAKAPH
FT                   SADGKCCGLKCVTALPAPLVAMTQPSVPKAVRASDQYRKLTDNAPPQRYRPPIS"
FT                   /protein_id="YP_571805.1"
FT   sig_peptide     34919..35020
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.679 at
FT                   residue 34"
FT                   /locus_tag="Nham_4382"
FT                   /product="hypothetical protein"
FT   gene            35416..35775
FT                   /db_xref="GeneID:4025243"
FT                   /locus_tag="Nham_4383"
FT   CDS_pept        35416..35775
FT                   /locus_tag="Nham_4383"
FT                   /gene_family="HOG000067130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109519"
FT                   /db_xref="GeneID:4025243"
FT                   /translation="MPCPVRGTRACGPSSVQETLMSAQLGATVAAVGSVVRGISGRRLG
FT                   TFAGMVAAAITLGGCALPPAPLIGRDPADPGARTAGVGYRSSIAPYTSFRPTAPSGWTE
FT                   QNQRVTPSPKSGHEH"
FT                   /protein_id="YP_571806.1"
FT   gene            35785..37242
FT                   /db_xref="GeneID:4025244"
FT                   /locus_tag="Nham_4384"
FT   CDS_pept        35785..37242
FT                   /locus_tag="Nham_4384"
FT                   /gene_family="HOG000127096" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109520"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:4025244"
FT                   /translation="MKIIRGLLSHQNLLRNNRSPLVLAISLVLSGCATFSPDQGMGVVA
FT                   DIADGTIKKDVIAIRSVDDARQADDNVKRLLHRTLTVDTAVQVALLNNRGLQASYNELA
FT                   LAEADRIQESLPPNPTFSVSRISGNGATEIERQVVGDILALATLPFRSEIAKQRFRQAQ
FT                   LRAVLETLRLAADVRRAYYRAVAANELVALLSGAKATAESTAQLSKKLGETGSLNKLDQ
FT                   AREQVFYAETTADLATLRQEATSSREALARLLGLWDGDLNFKLPSHLPTLPPRPRALPR
FT                   IEVDAVEHRIDLQVARIELDALAKSLNLTEANRFVTMLDIAGIDRKTREPEGAPFRERG
FT                   FDIQFQIPIFDGGEARVRQAAETYNQAFNRLTEKAVNVRSEARDAYRTYRSSYEIASQY
FT                   QREVLPLRKIITEEMQLRFSSMQVDVFALLTEARQRIASLRAAIEAKRAFWFAQSDLQT
FT                   AVNGGGSGEGQSKSPTTTAQAGGNGGH"
FT                   /protein_id="YP_571807.1"
FT   sig_peptide     35785..35907
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.918) with cleavage site probability 0.581 at
FT                   residue 41"
FT                   /locus_tag="Nham_4384"
FT                   /product="hypothetical protein"
FT   misc_feature    36031..36549
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Nham_4384"
FT   misc_feature    36640..37167
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Nham_4384"
FT   gene            37254..38633
FT                   /db_xref="GeneID:4025245"
FT                   /locus_tag="Nham_4385"
FT   CDS_pept        37254..38633
FT                   /locus_tag="Nham_4385"
FT                   /gene_family="HOG000127207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109521"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="GeneID:4025245"
FT                   /translation="MLSRRGFLGTAALVSASAVSGRVQAANIPEAPMMDKATMQPPLHP
FT                   SSGPDYRPVVTLNGWSLPWRMNGDWKEFHLVAEPVVREFAPGMKAFLWGYNGQAPGPTI
FT                   EAVEGDKVRIFVTNKLPEHTTVHWHGMIVPNGMDGVGGLNQPHIKPGQTFVYEFEMRNS
FT                   GTFMYHPHSDEMVQMAMGMMGMIVVHPRDATFRPVDRDFVFIMSTYDIDPGTYLPKVSE
FT                   MTDFNMWTWNSRVFPGIDVLPVRLGDRVRVRMGNLSMTSHPIHLHGHHFAVTCTDGGWV
FT                   PESAQWPESTVNVPVGAVRAFDVVADNPGDWAFHCHKSHHTMNAMGHNVANMIGVSPKD
FT                   LAKAVGKLAPDAMAMGSRGMAMGDMEMPMPDNTLMMMTGRGPFGPIEMGGMFTVMKIRE
FT                   GLARDDYSDPGPYEYPEGTVAHLVDAPAGQAPRQGNPKKTDQPDEMKGMKGMDMKGMKG
FT                   M"
FT                   /protein_id="YP_571808.1"
FT   sig_peptide     37254..37331
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT                   /locus_tag="Nham_4385"
FT                   /product="hypothetical protein"
FT   misc_feature    37257..>37691
FT                   /note="repressor protein for FtsI; Provisional; Region:
FT                   PRK10883"
FT                   /db_xref="CDD:170794"
FT                   /locus_tag="Nham_4385"
FT   misc_feature    37509..37769
FT                   /note="Multicopper oxidase; Region: Cu-oxidase; cl11412"
FT                   /db_xref="CDD:164213"
FT                   /locus_tag="Nham_4385"
FT   misc_feature    37887..38261
FT                   /note="Multicopper oxidase; Region: Cu-oxidase; cl11412"
FT                   /db_xref="CDD:164213"
FT                   /locus_tag="Nham_4385"
FT   gene            38650..38937
FT                   /db_xref="GeneID:4025246"
FT                   /locus_tag="Nham_4386"
FT                   /pseudo
FT   gene            39069..39689
FT                   /db_xref="GeneID:4025247"
FT                   /locus_tag="Nham_4387"
FT   CDS_pept        39069..39689
FT                   /locus_tag="Nham_4387"
FT                   /gene_family="HOG000016759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109522"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:4025247"
FT                   /translation="MTKLVGAAILAVVIALAGAGAFVFSGVYDVGADTPHWTLTRKIME
FT                   IVRDRAIAVRAKDIQVPDLTGEQLILKGAGQYAAMCADCHLAPGKSESEIRPGLYPKPP
FT                   KLSEHPFDPKTVFWVTKHGLKMSGMPAWGLGHNDATLWSIVAFVGKLSGMSAQQYKDIV
FT                   AKAPPDEEMESMGQGDGHTHAGGHHEHNAEPSKEVSPKPDHHH"
FT                   /protein_id="YP_571809.1"
FT   sig_peptide     39069..39146
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.456 at
FT                   residue 26"
FT                   /locus_tag="Nham_4387"
FT                   /product="hypothetical protein"
FT   gene            complement(39661..40298)
FT                   /db_xref="GeneID:4025248"
FT                   /locus_tag="Nham_4388"
FT                   /pseudo
FT   gene            40454..40774
FT                   /db_xref="GeneID:4025249"
FT                   /locus_tag="Nham_4389"
FT   CDS_pept        40454..40774
FT                   /locus_tag="Nham_4389"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109523"
FT                   /db_xref="GeneID:4025249"
FT                   /translation="MGWTLDNAIRTGQGVPVDQKTASPQAEFFHPDGKRYEAFPPAAEP
FT                   DGATALYRFMLLFDIPEPMLPPIISGCFFIMAMHFLFFIMASSDIDWHFFMIVMSLFDV
FT                   AA"
FT                   /protein_id="YP_571810.1"
FT   gene            40876..41298
FT                   /db_xref="GeneID:4025250"
FT                   /locus_tag="Nham_4390"
FT                   /pseudo
FT   gene            41336..41665
FT                   /db_xref="GeneID:4025251"
FT                   /locus_tag="Nham_4391"
FT                   /pseudo
FT   gene            41764..43289
FT                   /db_xref="GeneID:4025252"
FT                   /locus_tag="Nham_4392"
FT                   /pseudo
FT   gene            complement(42574..43149)
FT                   /db_xref="GeneID:4025253"
FT                   /locus_tag="Nham_4393"
FT   CDS_pept        complement(42574..43149)
FT                   /locus_tag="Nham_4393"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109524"
FT                   /db_xref="GeneID:4025253"
FT                   /translation="MLDGVEADRTELEGLLHRRMQIGKLEAFHETQDLHVLAPVGAVVC
FT                   VHARDMKAAWCLAASNAEATAREITNHYARRWTIEPGFRDTKDLRFGMGLGVLRIADPQ
FT                   RRDRLLLLNAFAIVLLTLLGAAGESLGMDRHLKVATAKRRTHSLFRQGCMLYELIPNMP
FT                   DVRLRPLVARFSEYINQHAALNQTFSCV"
FT                   /protein_id="YP_571811.1"
FT   gene            43286..43636
FT                   /db_xref="GeneID:4025254"
FT                   /locus_tag="Nham_4394"
FT   CDS_pept        43286..43636
FT                   /locus_tag="Nham_4394"
FT                   /gene_family="HOG000275720" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109525"
FT                   /db_xref="GeneID:4025254"
FT                   /translation="MSTDVPEILLSHYLKTLKLPTFQREYQKLARLCATEGVDHVGYLT
FT                   RLSEREMIERDRRKVERRIKAARFPVVKSLDSFDFTAIPKLNKMQVLELARCEWIERRE
FT                   NVIALGPSEPAS"
FT                   /protein_id="YP_571812.1"
FT   misc_feature    43289..>43618
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Nham_4394"
FT   misc_feature    43454..>43621
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Nham_4394"
FT   gene            complement(43656..45509)
FT                   /db_xref="GeneID:4025255"
FT                   /locus_tag="Nham_4395"
FT   CDS_pept        complement(43656..45509)
FT                   /locus_tag="Nham_4395"
FT                   /gene_family="HOG000228685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109526"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="GeneID:4025255"
FT                   /translation="MAAICEGRVGAVVSIEASRLARNGRDWHTLLEFCGLVGTLILGED
FT                   GVYDPRHPNDRLLLGMKGTMSEMELSVLRQRSLEALKQKASRGELFMTVAIGYVRIGNN
FT                   RIEKDPDRRITEAIALTFARFAEMQSVRQVHLWLRQERIPLPAVTYGAEGRLIEWKLPV
FT                   YNTILHILTNPIYAGAYAFGRTGSRVSIEAGRKRVVRGFKKERKDWEVLIPNHHEGYLS
FT                   WADYERNLGLIADNANGKNPMSRGALRRGEALLAGLLRCGHCGRKLHVAYSGANGNTGR
FT                   YHCQGGFINHGGDRCISFGDMRIDRDIGAEVIVRLQPLGIEAALAAQALRSRANEDKRR
FT                   QIALALEQARYEVGRARRQYDAVDPDNRLVASELETRWNERLTIARDLEAELEELTASP
FT                   AAEPAPADRERLMMLGADLQRAWTSAGVTPEAKKRIVRTVIDEIVVRVEDNALDLVIRW
FT                   HGGDHSALKVKKNRTGQHRWSVEGETIDLVRVLARQMPDKAIASVLNRAGKTTGRGNGW
FT                   TQSRVCSLRSHNTIPTYREGERRERGEVTLDEAAAALSVSPSTVRRLIKDGQLSANQLC
FT                   KGAPWIIHAADLDRNDVKGAATARRLRRPPSSNPLQKTLEL"
FT                   /protein_id="YP_571813.1"
FT   misc_feature    complement(45270..>45509)
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cd00338"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="Nham_4395"
FT   misc_feature    complement(order(45444..45446,45453..45458))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="Nham_4395"
FT   misc_feature    complement(44802..45164)
FT                   /note="Recombinase; Region: Recombinase; pfam07508"
FT                   /db_xref="CDD:148873"
FT                   /locus_tag="Nham_4395"
FT   gene            complement(45704..46390)
FT                   /db_xref="GeneID:4025256"
FT                   /locus_tag="Nham_4396"
FT   CDS_pept        complement(45704..46390)
FT                   /locus_tag="Nham_4396"
FT                   /gene_family="HOG000111053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LuxR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109527"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="GeneID:4025256"
FT                   /translation="MEQTRTAAEIEDCLLGLAAGFGFTGLFGGIVPTRPAPLAELRSRI
FT                   LFQRFPAQWLDRYSRKGYVFRDPIIQHLFHERAPFTWHEGYESCPQRRNVRLIRGEAAE
FT                   FGLRDGYVVPISTIDGEIASLSFGGPGTLPVSADLSVLNFAASYALGRHLHRIATWQRV
FT                   SSNLTAREWDCLLWAGEGKTNWETSAILGISRSTVTKHIMAARAKLGAVSKAHAIATAI
FT                   RTKLLR"
FT                   /protein_id="YP_571814.1"
FT   misc_feature    complement(45974..46294)
FT                   /note="Autoinducer binding domain; Region: Autoind_bind;
FT                   pfam03472"
FT                   /db_xref="CDD:146226"
FT                   /locus_tag="Nham_4396"
FT   misc_feature    complement(45722..45892)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4396"
FT   misc_feature    complement(order(45749..45751,45782..45796,45800..45805,
FT                   45809..45814,45836..45844,45881..45889))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4396"
FT   misc_feature    complement(order(45722..45727,45734..45736,45743..45751,
FT                   45842..45844,45848..45850,45854..45856))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4396"
FT   gene            complement(47118..48077)
FT                   /db_xref="GeneID:4025257"
FT                   /locus_tag="Nham_4397"
FT   CDS_pept        complement(47118..48077)
FT                   /locus_tag="Nham_4397"
FT                   /gene_family="HOG000121218" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper resistance D"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109528"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="GeneID:4025257"
FT                   /translation="MDWLETVNDPLIVVRAIHFTATAVTAGSMLFRVAVAEPALGSGAP
FT                   ATAARMQSLSVAWIGLAIAAVSGAIWVLLEAAAMSGLSLSEAMTADILSTVLNETQFGL
FT                   VSEIRLALASTLAACLACSRMPWTRWPALTSAFGLIAALAWAGHAGSSVGLIGLLHLTA
FT                   DVLHLTAAAAWIGALVPLAMLLAVARRRQDFVWTSLARHATQRFSTLGLLSVGVLLITG
FT                   VVNACILVGSFYALQATEYGRLVILKTALFAVMLLLAAANRFWLMPQLAPLSRTDMQID
FT                   ALRRLTRNSVLEIILGVAVIAIVGALGILHPAIHIALA"
FT                   /protein_id="YP_571815.1"
FT   misc_feature    complement(47199..48044)
FT                   /note="Copper resistance protein D; Region: CopD; cl00563"
FT                   /db_xref="CDD:153858"
FT                   /locus_tag="Nham_4397"
FT   gene            complement(48092..48448)
FT                   /db_xref="GeneID:4025258"
FT                   /locus_tag="Nham_4398"
FT   CDS_pept        complement(48092..48448)
FT                   /locus_tag="Nham_4398"
FT                   /gene_family="HOG000127318" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper resistance protein CopC"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109529"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="GeneID:4025258"
FT                   /translation="MRRTALTAMVPLLILLATGDASAHASLDHAEPRVGNTVATAPREV
FT                   TLWFTQKLETAFSTITVTNSAGQRVDTGKTRVSGNRMAISLRPTGAGTYRVKWRVLSVD
FT                   THRADGDFTFKVSP"
FT                   /protein_id="YP_571816.1"
FT   misc_feature    complement(48101..48448)
FT                   /note="Copper resistance protein CopC; Region: CopC;
FT                   cl01012"
FT                   /db_xref="CDD:154145"
FT                   /locus_tag="Nham_4398"
FT   sig_peptide     complement(48377..48448)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.856 at
FT                   residue 24"
FT                   /locus_tag="Nham_4398"
FT                   /product="hypothetical protein"
FT   gene            complement(48451..49455)
FT                   /db_xref="GeneID:4025259"
FT                   /locus_tag="Nham_4399"
FT   CDS_pept        complement(48451..49455)
FT                   /locus_tag="Nham_4399"
FT                   /gene_family="HOG000061165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109530"
FT                   /db_xref="GeneID:4025259"
FT                   /translation="MSSHLLRAALPGLAIALVPPTGSIAHEIVGNRFFPATLGTDDPGV
FT                   NDELSLPTVSAFKTGDDPSIKQRDFSGEFSKRITEAFAVSFGSTYTHLGAPGWPTGMGA
FT                   SGFQNLETAFKYRLFKDPAHEFVMSVGLGVEWGRTSAQSVGAEQFNTYTPTLYFGKGFG
FT                   DLPDTMSWLRPIAVTGQVGYAIPGKRSTTVLGIDPDTGEQRVDTEFHPRVLAWGGTVQY
FT                   SMPYLKSAVVDLGLPDFINRFIPLVEATFQTPVGNTFTSATGTTGTINPGFIWVGNTFQ
FT                   IGVEALIPINRQSGSTVGAIAQLHFYLDDLDPRGIGKPIFGNAAQPARPFGGN"
FT                   /protein_id="YP_571817.1"
FT   sig_peptide     complement(49378..49455)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.991 at
FT                   residue 26"
FT                   /locus_tag="Nham_4399"
FT                   /product="hypothetical protein"
FT   gene            complement(49533..49976)
FT                   /db_xref="GeneID:4025260"
FT                   /locus_tag="Nham_4400"
FT   CDS_pept        complement(49533..49976)
FT                   /locus_tag="Nham_4400"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109531"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="GeneID:4025260"
FT                   /translation="MNRRLFCLATAATLAGLPLASRAETLHATLYKNPDCSCCEGYATY
FT                   LRDNGFAVDVKPTNDLAQISLNAGIPENLQGCHTMFIDGYVVDGHVPIKTIRKLLTERP
FT                   TIAGITLPAMPTGSPGMVGQKRGPFTIYAVAKDGTVPTVYATE"
FT                   /protein_id="YP_571818.1"
FT   sig_peptide     complement(49905..49976)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT                   /locus_tag="Nham_4400"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(49539..49913)
FT                   /note="Protein of unknown function, DUF; Region: DUF411;
FT                   cl01142"
FT                   /db_xref="CDD:154225"
FT                   /locus_tag="Nham_4400"
FT   gene            complement(50108..50350)
FT                   /db_xref="GeneID:4025261"
FT                   /locus_tag="Nham_4401"
FT                   /pseudo
FT   gene            complement(50347..50556)
FT                   /db_xref="GeneID:4025262"
FT                   /locus_tag="Nham_4402"
FT                   /pseudo
FT   gene            complement(50713..51111)
FT                   /db_xref="GeneID:4025263"
FT                   /locus_tag="Nham_4403"
FT   CDS_pept        complement(50713..51111)
FT                   /locus_tag="Nham_4403"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109532"
FT                   /db_xref="GeneID:4025263"
FT                   /translation="MHFIDSYHWASPAGVLTAALLGAALALPTGVAFAQNGAGMSDMKK
FT                   MPAMSDTKKATTATGTGTGIVTAIDAANLKITFDHGPIPAINWPAMKMEFATAPSVDLA
FT                   KVKTGDKVNFTLSGSGGTYTVQSITPAP"
FT                   /protein_id="YP_571819.1"
FT   sig_peptide     complement(51007..51111)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT                   /locus_tag="Nham_4403"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(50743..50889)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:154873"
FT                   /locus_tag="Nham_4403"
FT   gene            complement(51243..54440)
FT                   /db_xref="GeneID:4025264"
FT                   /locus_tag="Nham_4404"
FT   CDS_pept        complement(51243..54440)
FT                   /locus_tag="Nham_4404"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump CzcA"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109533"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:4025264"
FT                   /translation="MIARLIAWSARNLMLVLIGAVFAIAAGIYALRTLPLDAIPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLTTAMLTVPKSKVVRGFSFFGVSFVYVIFEDGTDPY
FT                   WARSRVLEYLNTVARRLPTGVTPTLGPDATGVGWVYQYAVVAKNMTLAELRSVQDWIIR
FT                   YGISKAEGVAEVASVGGFVKQYNIVVDPQKLRAQGISLDKLRSAVRASNMDVGGRTVEL
FT                   SEFEFVVRGRGYLRGIEDIENIVLKTDAGTPLRLRDVARVELGPDERRGITELNGDGEV
FT                   VSGIALQRFGANALTVIDNVKARLSEIASSLPKGVDIVTVYDRSELIKAAIETLKGTLL
FT                   EESIIVALVCFVFLLHLRSALVAILMLPVGILMAFAAMKFMGLGANIMSLGGIAIAVGA
FT                   MIDAAIVMIENAHKHLERAEPGTPRTQILIDAASEVGPALFFSLLVITVAFLPIFTLED
FT                   QEGRMFGPLAYTKTFSMAAAALLSITLVPALMVVFVRGRIISEHKNPVNRFLIWVYRPV
FT                   IRWVLNAKTLTIMLALVALAVTVWPARQLGSEFMPSLNEGTLMYMPTTLPGLSITKAAE
FT                   LLQTQDRIIKSFPEVASVYGKAGRASTATDPAPTEMFETIINLKPKSEWRPGVTIDSLK
FT                   AEMDKALQFPGVSNAWTMPIRARIDMLSTGIRTPVGIKIFGKDLAEMEKIAREVEGVVR
FT                   SVPGTSSAYAERVIGGYYLEIIPDRMALGRYGLTISDVQDVISTALGGETVTTTVEGRE
FT                   RYSVNIRYPRALRSNPQTISTDVQVPLASGGSVPLGQVASVKLTRGATSIRTENGQLAV
FT                   YIYVDITGRDLGGYVAEAQHAVAQKVKFPPGYYVSWSGQFEYLQRAEARLKIVVPVTLL
FT                   IIFLLLYLNFRKLADTLIVMLSLPFSLVGGIWLMWWLGFNMSVAVAVGFIALAGVAAET
FT                   GVVMLIYLEQAMAELKAERAAAGRPFTRADLYDAIMLGAVDRVRPKMMTVVAIMAGLLP
FT                   ILWSTGTGSEVMQRIAVPMIGGMASSTVLTLVVIPAIFAVVKGFGLPAAPQDGEEKGGG
FT                   RRDSTPKLDLHRAENVQ"
FT                   /protein_id="YP_571820.1"
FT   misc_feature    complement(51324..54440)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="Nham_4404"
FT   sig_peptide     complement(54363..54440)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.949) with cleavage site probability 0.725 at
FT                   residue 26"
FT                   /locus_tag="Nham_4404"
FT                   /product="hypothetical protein"
FT   gene            complement(54437..56089)
FT                   /db_xref="GeneID:4025265"
FT                   /locus_tag="Nham_4405"
FT   CDS_pept        complement(54437..56089)
FT                   /locus_tag="Nham_4405"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109534"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:4025265"
FT                   /translation="MKNRQIILDIGDGSRPPPRGDFRRASPWGPIAFFRASSVRGRLLM
FT                   DKFTDDRPFEDGHLTRRARAGRSTAKRVALIVFAISALAATLGIGYRLGHTSQVLPDWV
FT                   PPRLATALGIQPVKPRATGPVIYYRDPDGKALYSKDARITPDRRPYVAVHASEDVSFDN
FT                   APETAAPAQDANSGAKRILFYRNPMGLPDTSSVPKKDSMGMDYIAVYAGDEDASTIQIS
FT                   PAKLQRTGVRSEPASRRVVIRPIRAPGTIKLDERRVVVVSLRAQAFIESVANVTTGDHV
FT                   TKGQPLFKLYSPDVASASAQYLSIIRDDGRTASLAGRKQLAEGARQRLENLAVPADVIA
FT                   DIERTKTVPLTITWAAPRDGVVLERTAVEGMRAMPGDVLFRMADTSVIWVLADVAEQDI
FT                   DAVRVGAAATIKLRSLPGREFKGSVALIYPQVNTETRTTKARIELPNPDGVLLPDMFAD
FT                   VEIASGAEKPVVAVPNGAVIDTGARQIVFIDKGEGRFEPREVKVGTHGEDYTEIREGVG
FT                   EGDLVVVAANFLIDAESNLKSALQAFTDGEKAK"
FT                   /protein_id="YP_571821.1"
FT   misc_feature    complement(54440..55591)
FT                   /note="copper/silver efflux system membrane fusion protein
FT                   CusB; Provisional; Region: PRK09783"
FT                   /db_xref="CDD:170094"
FT                   /locus_tag="Nham_4405"
FT   gene            complement(56331..56600)
FT                   /db_xref="GeneID:4025266"
FT                   /locus_tag="Nham_4406"
FT   CDS_pept        complement(56331..56600)
FT                   /locus_tag="Nham_4406"
FT                   /gene_family="HOG000077263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109535"
FT                   /db_xref="GeneID:4025266"
FT                   /translation="MKITTLIPLALIASLAASAAVQADETSTPPKTPTETNQPMMGNGS
FT                   QGMQEMMGMMSQMKQMMESCNQMMKASNERHDKQNAPKQKDRHG"
FT                   /protein_id="YP_571822.1"
FT   sig_peptide     complement(56529..56600)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 24"
FT                   /locus_tag="Nham_4406"
FT                   /product="hypothetical protein"
FT   gene            complement(56966..57607)
FT                   /db_xref="GeneID:4025267"
FT                   /locus_tag="Nham_4407"
FT   CDS_pept        complement(56966..57607)
FT                   /locus_tag="Nham_4407"
FT                   /gene_family="HOG000250410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109536"
FT                   /db_xref="InterPro:IPR009495"
FT                   /db_xref="GeneID:4025267"
FT                   /translation="MKTNELISMLSSQVDPVDTREVVRNVRIAILVGAAASLLAVVFVL
FT                   GVRTDLNEMHAQVFLVAKLAFSLSVVILASHYLVKYIRPGGEFRVRFALTVLPFLAVMI
FT                   LAAISLATAPRSHWETMVFGSYWLECLIAIPTVAVVPFAAIMSAVRLAAPTDLVRTGAL
FT                   AGLVAGGVSATAYALHCMDDLLPFIALWYGGTIVLCTVAGAVLGPKLLRW"
FT                   /protein_id="YP_571823.1"
FT   misc_feature    complement(56969..57580)
FT                   /note="Protein of unknown function (DUF1109); Region:
FT                   DUF1109; cl02071"
FT                   /db_xref="CDD:154732"
FT                   /locus_tag="Nham_4407"
FT   gene            complement(57604..58158)
FT                   /db_xref="GeneID:4025268"
FT                   /locus_tag="Nham_4408"
FT   CDS_pept        complement(57604..58158)
FT                   /locus_tag="Nham_4408"
FT                   /gene_family="HOG000094757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor"
FT                   /transl_table="11"
FT                   /note="Bacteria have multiple sigma factors which are
FT                   active under specific conditions; the sigma factor binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription"
FT                   /db_xref="GI:92109537"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="GeneID:4025268"
FT                   /translation="MTKESDLKALMAASLEGDSNAHRSLLTALSGHLRSYYKNKLARAG
FT                   RTAEEAEDLVQEALIVIHTQRHTYDPEQPLTPWVYAIARYKLIDHLRRTRSTTADVPLE
FT                   NAEYMLASNDNAAAESQLDLAKLFERLPERMRLSLQYVKLDGLSVTEAADRSGMSPSAV
FT                   KVNIHRGLKILTALIARETKA"
FT                   /protein_id="YP_571824.1"
FT   misc_feature    complement(57610..58158)
FT                   /note="RNA polymerase sigma factor; Provisional; Region:
FT                   PRK12539"
FT                   /db_xref="CDD:139049"
FT                   /locus_tag="Nham_4408"
FT   misc_feature    complement(57868..58086)
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Nham_4408"
FT   misc_feature    complement(57637..57798)
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:174508"
FT                   /locus_tag="Nham_4408"
FT   gene            58439..58681
FT                   /db_xref="GeneID:4025269"
FT                   /locus_tag="Nham_4409"
FT   CDS_pept        58439..58681
FT                   /locus_tag="Nham_4409"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109538"
FT                   /db_xref="GeneID:4025269"
FT                   /translation="MAPDRLRHRRKLLIRRQSGGGLNAGVDAKSAGNDTVPSDLPTSFL
FT                   SRNFRLRGEEFNRAHIVVTCNRRSFVSEFIHVRSI"
FT                   /protein_id="YP_571825.1"
FT   gene            complement(59184..60467)
FT                   /db_xref="GeneID:4025270"
FT                   /locus_tag="Nham_4410"
FT   CDS_pept        complement(59184..60467)
FT                   /locus_tag="Nham_4410"
FT                   /gene_family="HOG000025946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109539"
FT                   /db_xref="GeneID:4025270"
FT                   /translation="MRKGVLLGLVVLVFSAGGAAGADLTTKARTSVPALPSWWDTVTIT
FT                   GHVQAGITFNEGPSGGINFGHLFTDKANSLLMNQALLTVQRPLDPKASGYDFGFKFQAM
FT                   YGSDARYTHFLGEFDQSISGRNQFDIVEAHALFHLPWLTSGGVDVKVGQYVTLEGAEVI
FT                   YAPDNALYSHSYIFNFGIPFKHTGIMTTTHVTPILDVYAGIDTGVNTTFGNRFDRFNGG
FT                   DNNMAAAFHGGIGLNLMDGALTVLATTHIGPENPNVSSAVLAGVNPNRALRYLNDVTIV
FT                   WKATDKLTLTTDLNYIREEGFNAAGGGVAQYVTYALNDWLKITGRGEVWRDNSGFFVAA
FT                   FPGNLDFVRLEHGNPLGTAIGGGATTYGALTVGLAIKPPVPKELDGLVVRPEIRYDTSL
FT                   NGTTPFGAGTKRSQFTFGGDIIIPFKIR"
FT                   /protein_id="YP_571826.1"
FT   sig_peptide     complement(60402..60467)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.731 at
FT                   residue 22"
FT                   /locus_tag="Nham_4410"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(59997..60320)
FT                   /note="Protein of unknown function (DUF1597); Region:
FT                   DUF1597; pfam07642"
FT                   /db_xref="CDD:148960"
FT                   /locus_tag="Nham_4410"
FT   gene            complement(60539..60916)
FT                   /db_xref="GeneID:4025271"
FT                   /locus_tag="Nham_4411"
FT   CDS_pept        complement(60539..60916)
FT                   /locus_tag="Nham_4411"
FT                   /gene_family="HOG000144719" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109540"
FT                   /db_xref="GeneID:4025271"
FT                   /translation="MFQRNRKTEAFVDFINLALGGFLILSPWLLGFKSQLGWHTSWMAG
FT                   AAIGVVAIFSIADLFDTVSIPAFFESEEWINLTIGSWLAICPWVLNFNDDTMAMQVHLV
FT                   VGIVVAAIGAVELWVIHHRPA"
FT                   /protein_id="YP_571827.1"
FT   gene            complement(61175..61429)
FT                   /db_xref="GeneID:4025272"
FT                   /locus_tag="Nham_4412"
FT   CDS_pept        complement(61175..61429)
FT                   /locus_tag="Nham_4412"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109541"
FT                   /db_xref="GeneID:4025272"
FT                   /translation="MIGQNAPSPDARVCLCNRRVYGRPSDGLNAMPDLAFQSMSRNNRS
FT                   SAYRFFSRLPPETTKLCVLTARGPSFREPRSLLARLLLS"
FT                   /protein_id="YP_571828.1"
FT   gene            61457..62107
FT                   /db_xref="GeneID:4025273"
FT                   /locus_tag="Nham_4413"
FT   CDS_pept        61457..62107
FT                   /locus_tag="Nham_4413"
FT                   /gene_family="HOG000224694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109542"
FT                   /db_xref="GeneID:4025273"
FT                   /translation="MNENILWGGATISIVVVSWCFYRLVVPKGWREWTRAGIVQAFVIA
FT                   FYAEMYGFPLTIYLLARVFNLDVAGNLWDGNLWVYLTGSWWVMPASMALGYTVVFFGAA
FT                   LIIAGWREVYRARARGRLARGGPYSLMRHPQYAGIFLALFGESVVHWPTLFSLTAFPII
FT                   VGAYWLLARMEEKQMIQQYGDKYRSYQRRVPMFWPDHRGWRVAFRNYSFRRML"
FT                   /protein_id="YP_571829.1"
FT   misc_feature    <61688..62050
FT                   /note="Isoprenylcysteine carboxyl methyltransferase (ICMT)
FT                   family; Region: ICMT; cl00763"
FT                   /db_xref="CDD:174378"
FT                   /locus_tag="Nham_4413"
FT   gene            62216..62539
FT                   /db_xref="GeneID:4025274"
FT                   /locus_tag="Nham_4414"
FT   CDS_pept        62216..62539
FT                   /locus_tag="Nham_4414"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109543"
FT                   /db_xref="GeneID:4025274"
FT                   /translation="MKGDETMELNRNLTTRSSGSPAAGRKRGWLSGWSGLAVCAVVFVG
FT                   AILVFSGAFGTQSAGKLLPLLFLLPCAIMMFMCMKNMGGNQNDTGSSNVKTGVHKTDSD
FT                   DRH"
FT                   /protein_id="YP_571830.1"
FT   gene            complement(62766..64145)
FT                   /db_xref="GeneID:4025275"
FT                   /locus_tag="Nham_4415"
FT   CDS_pept        complement(62766..64145)
FT                   /locus_tag="Nham_4415"
FT                   /gene_family="HOG000271865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109544"
FT                   /db_xref="GeneID:4025275"
FT                   /translation="MHSASSNSPSSANRAPARKQSEVKMVHTPANNTLPISGRDHRLDL
FT                   FRGIANWAIFLDHIPNNVVAWITIRNYGFSDAAELFIFMSGYMTSLVCTNIMRRRGFVA
FT                   GMSWLMKRVWQLYVAHIFLFVLYAAMIGHIAQSYDNPALINEFNIAGLVSNPFDVLTQG
FT                   LLLRFKPLNMDVLPLYIVLLAGILPILWLMLRLPDATMLGSLYLYLAARHFGWNLSAYP
FT                   EGAWYFNPFTWQLLFVLGAWFAVGGAKRSRRLIRSRSLLYVGVVYLLFSFAMTMAGHIP
FT                   NLANEFPKWLFDAFNPNDKTDLAPYRVIHFAFIALLATRLLPVNWSGLQCSILQPLIKC
FT                   GEQSLHVFCSGIILSFLAHFVLESGSQTVLAQILVSVAGLSIMTAIAYFASWSKTFDKP
FT                   RSLVFLGHSGSDVIETADSDDAEVRSKTVLAWSDPTFLTKGKNGGYVGIGSRKNVHLKC
FT                   Q"
FT                   /protein_id="YP_571831.1"
FT   misc_feature    complement(62961..64031)
FT                   /note="OpgC protein; Region: OpgC_C; cl10497"
FT                   /db_xref="CDD:158884"
FT                   /locus_tag="Nham_4415"
FT   misc_feature    complement(62970..64028)
FT                   /note="Acyltransferase family; Region: Acyl_transf_3;
FT                   pfam01757"
FT                   /db_xref="CDD:145093"
FT                   /locus_tag="Nham_4415"
FT   gene            complement(64478..64816)
FT                   /db_xref="GeneID:4025276"
FT                   /locus_tag="Nham_4416"
FT   CDS_pept        complement(64478..64816)
FT                   /locus_tag="Nham_4416"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109545"
FT                   /db_xref="GeneID:4025276"
FT                   /translation="MPLEGAYDRLATKPYLLTDVGIGLVTRRHAQHLFYHFAEQSGAIA
FT                   KRRCLPDKKLGIDGSPTSPSGLAMLLDKPVGLSRLGEDHRDTITHPPCCRRTAFHYPGT
FT                   RCCGSVAR"
FT                   /protein_id="YP_571832.1"
FT   gene            complement(64853..65137)
FT                   /db_xref="GeneID:4025277"
FT                   /locus_tag="Nham_4417"
FT   CDS_pept        complement(64853..65137)
FT                   /locus_tag="Nham_4417"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mercuric transport protein periplasmic protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109546"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="GeneID:4025277"
FT                   /translation="MTKFPTSLALGLLIISSGGAMAEQRTVTLAVDNMYCEACPYMIKK
FT                   TIEKVSGVSKVTVSFKEKTAIVVFDDARAEVNDLTNATTSAGFPSAPKR"
FT                   /protein_id="YP_571833.1"
FT   sig_peptide     complement(65069..65137)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT                   /locus_tag="Nham_4417"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(64865..65056)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4417"
FT   misc_feature    complement(order(65021..65023,65030..65038))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4417"
FT   gene            complement(65149..65526)
FT                   /db_xref="GeneID:4025278"
FT                   /locus_tag="Nham_4418"
FT   CDS_pept        complement(65149..65526)
FT                   /locus_tag="Nham_4418"
FT                   /gene_family="HOG000002849" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mercuric ion transport protein, MerT"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109547"
FT                   /db_xref="GeneID:4025278"
FT                   /translation="MTSRESDSSRDVTRLQNAAAAGGVLGAVAASSCCMLPLLLFTLGA
FT                   SAPWIGTLVRLAPYQPYFIALAVACLGCGYWLWHRSSNQKRDAACSIRSASKFVNPALV
FT                   VATILVVAAIAFNVLWPVLTS"
FT                   /protein_id="YP_571834.1"
FT   misc_feature    complement(<65251..65436)
FT                   /note="MerT mercuric transport protein; Region: MerT;
FT                   cl03578"
FT                   /db_xref="CDD:174778"
FT                   /locus_tag="Nham_4418"
FT   gene            complement(65539..66237)
FT                   /db_xref="GeneID:4025279"
FT                   /locus_tag="Nham_4419"
FT   CDS_pept        complement(65539..66237)
FT                   /locus_tag="Nham_4419"
FT                   /gene_family="HOG000097105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109548"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="GeneID:4025279"
FT                   /translation="MMDTESLRLAVEHAGIAAAGVAFLTGLVFSFNPVALASIPVSLAY
FT                   VTKGRNKDQAFLFGAMFILGMVLTHVLLGLIAGLGGKWAADIAGRGWGLFLGPLLIILG
FT                   LMWVGWLRIPLPSFGFRASRPAAAWGAFLLGIPFAIAVCPICTPTLVVLLGVTAGIGSV
FT                   WLGVVLLLAFALGRAVPIAIGAFAVSWLENLSHFARYRRGFEIAGGVLLIAMGFYMLNA
FT                   VYIWIPELAV"
FT                   /protein_id="YP_571835.1"
FT   misc_feature    complement(65578..66180)
FT                   /note="Cytochrome c biogenesis protein [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: CcdA;
FT                   COG0785"
FT                   /db_xref="CDD:31128"
FT                   /locus_tag="Nham_4419"
FT   misc_feature    complement(65578..66174)
FT                   /note="Cytochrome C biogenesis protein transmembrane
FT                   region; Region: DsbD; cl00515"
FT                   /db_xref="CDD:153822"
FT                   /locus_tag="Nham_4419"
FT   gene            complement(66234..66494)
FT                   /db_xref="GeneID:4025280"
FT                   /locus_tag="Nham_4420"
FT   CDS_pept        complement(66234..66494)
FT                   /locus_tag="Nham_4420"
FT                   /gene_family="HOG000077283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin/glutaredoxin"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109549"
FT                   /db_xref="InterPro:IPR006663"
FT                   /db_xref="GeneID:4025280"
FT                   /translation="MKVEMFYSPGCSECVAAHARLRTTAQEAVKNLVWRELNVLDELDY
FT                   AVELGVLTLPSIAVDGKLIFTSMPTVAQLRTALIERSKGRE"
FT                   /protein_id="YP_571836.1"
FT   misc_feature    complement(66252..66494)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="Nham_4420"
FT   gene            complement(66498..66917)
FT                   /db_xref="GeneID:4025281"
FT                   /locus_tag="Nham_4421"
FT   CDS_pept        complement(66498..66917)
FT                   /locus_tag="Nham_4421"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109550"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:4025281"
FT                   /translation="MFTIGKLASLTSVSNDTLRYYEQEGLVEPAGKSPAGYRLYDKDSA
FT                   RRIRFIKHAQNCGFTLAEIRDLLVLRGRDKACCGDVRTRAVEKKLQIESKIRAMKAMSK
FT                   ALDELIADCANETQPVNECTIIAALERANVKTPVH"
FT                   /protein_id="YP_571837.1"
FT   misc_feature    complement(66528..66917)
FT                   /note="zinc-responsive transcriptional regulator;
FT                   Provisional; Region: zntR; PRK09514"
FT                   /db_xref="CDD:169938"
FT                   /locus_tag="Nham_4421"
FT   misc_feature    complement(66540..66914)
FT                   /note="Helix-Turn-Helix DNA binding domain of Heavy Metal
FT                   Resistance transcription regulators; Region: HTH_HMRTR;
FT                   cd04770"
FT                   /db_xref="CDD:133398"
FT                   /locus_tag="Nham_4421"
FT   misc_feature    complement(order(66804..66812,66861..66863,66903..66911))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133398"
FT                   /locus_tag="Nham_4421"
FT   misc_feature    complement(order(66543..66545,66549..66551,66570..66575,
FT                   66588..66590,66609..66614,66621..66623,66633..66635,
FT                   66651..66653,66663..66665,66672..66674,66681..66686,
FT                   66717..66719,66744..66749,66759..66761,66768..66770))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133398"
FT                   /locus_tag="Nham_4421"
FT   misc_feature    complement(order(66549..66551,66579..66581,66684..66686))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:133398"
FT                   /locus_tag="Nham_4421"
FT   gene            complement(67035..68267)
FT                   /db_xref="GeneID:4025525"
FT                   /locus_tag="Nham_4422"
FT   CDS_pept        complement(67035..68267)
FT                   /locus_tag="Nham_4422"
FT                   /gene_family="HOG000054975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109551"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4025525"
FT                   /translation="MRVRQTAPGAIDDHRRERLLRMLAAATFIIFFQAYMVAPIIPALS
FT                   NAFGTSVQTVGLIVPAYLIPYGIATLAYGILADRLGYPCVMFVSLMAFSALTMLTATAQ
FT                   SVEQLALWRTVTGIGASGVVPLALALVGRLYPYEQRGRPLGWLFGAMAGGMAFGSPLGA
FT                   MIVPFVGWQGLFVVVGAVGAVLLLVLLPYRSVIAATAQSVTGTLRDLVRGYKDLLGTPR
FT                   GQRTYGYVLINSIFHSGVFTWLGVYFEQRYGVGPIGIGLALLGYGVPGLLFGPLIGRAA
FT                   DRFGRARLIPIGLLLSTLAAAALMLGFPMVLAPVVAMVLSLGYDMTQPLFAGIVTSLGG
FT                   KRAGQAMGLNVFMLFVGFGLGSLIFGELLRYNFAAALGVFAVVEMILALLSLALFRSEV
FT                   PSARPTISTQG"
FT                   /protein_id="YP_571838.1"
FT   misc_feature    complement(67080..68189)
FT                   /note="Arabinose efflux permease [Carbohydrate transport
FT                   and metabolism]; Region: AraJ; COG2814"
FT                   /db_xref="CDD:32643"
FT                   /locus_tag="Nham_4422"
FT   misc_feature    complement(67083..68189)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Nham_4422"
FT   misc_feature    complement(order(67194..67196,67203..67208,67215..67220,
FT                   67227..67232,67260..67262,67269..67274,67284..67286,
FT                   67293..67298,67305..67307,67446..67448,67458..67460,
FT                   67467..67469,67479..67481,67491..67493,67533..67535,
FT                   67542..67547,67554..67559,67566..67568,67803..67805,
FT                   67821..67826,67833..67838,67872..67874,67881..67886,
FT                   67893..67898,67905..67910,68046..68051,68055..68060,
FT                   68070..68072,68079..68084,68091..68093,68142..68147,
FT                   68151..68159,68166..68168))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Nham_4422"
FT   gene            complement(68287..70740)
FT                   /db_xref="GeneID:4025434"
FT                   /locus_tag="Nham_4423"
FT   CDS_pept        complement(68287..70740)
FT                   /locus_tag="Nham_4423"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109552"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:4025434"
FT                   /translation="MALSTATDSPFALWTEEPSTRPNRRKIRARIGGLHCSLCTGTIEK
FT                   ALGRMPGVDKVAVSLTHEQALVEYDPTIARPEHLLQTLRDIGYTISDPRKLRAFEEEEH
FT                   DLLREARRFVLAVVLSVAAIPIIADPAVGWIGFLPAMVCLSLGGFVFLVLRSSGLWTAI
FT                   GAALGLTVMALSLLYLNLQGYLTDAAPWLAGALALMLVFGVGRHILYMAVQALRRGILN
FT                   QHVLLEIGAFAGIAGGIIGLILDRPGYPTAAFFAVSVMVGTYHIFSEWLSLIVKTRSSQ
FT                   AVKRLLDLQPETARVVRGTEELELPIDEVRIGDLVRIRPGERIPADGTVVDGHSGVDQS
FT                   LVTGEAVPIEKTEGDSVIGGSINSTGTLLLRITAIGEGSFLHQVIRHVEDARALKPGLL
FT                   HLVDRVLRVYTPTVLLIAALAFIGWLIGSWLGTGYVDVERAVFAGLSVLVMGYPCAIGI
FT                   SAPLSIVRGAGQAAERGILMRTGEAFQGFRTVTKIILDKTGTLTEGRPTVREIRAMDVG
FT                   EQELLAIAAAAEASSEHPLARAVIKAAFDYGATPRDVESFEAFPGKGIVARIDAREVFV
FT                   GSPRFLADRDIDLTPLREAIDSLEAAGRTVIAVARDGHALGIVALGDALRPDAVSAIAA
FT                   LRKAGLRTILVTGDNERAAQRVGRDVGIDEIHAGVLPQDKARIVRELQINARVAMVGDG
FT                   INDAPALMQADIGIAMGSGTDIAIESADIIILSNRLDALPVARDISRRSYSKMVQNVAL
FT                   AFLFNGLGIPLAATGLIHPVWAMVAMAVSVTAIFINSLWGTPRLFFDAIRSVGRPIART
FT                   TSQAA"
FT                   /protein_id="YP_571839.1"
FT   misc_feature    complement(68368..70668)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Nham_4423"
FT   misc_feature    complement(70468..70653)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4423"
FT   misc_feature    complement(order(70624..70626,70633..70641))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4423"
FT   misc_feature    complement(69286..69963)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Nham_4423"
FT   misc_feature    complement(68518..68904)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4423"
FT   gene            complement(70806..71021)
FT                   /db_xref="GeneID:4025435"
FT                   /locus_tag="Nham_4424"
FT   CDS_pept        complement(70806..71021)
FT                   /locus_tag="Nham_4424"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal transport/detoxification protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109553"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="GeneID:4025435"
FT                   /translation="MKTTTFKIEGMNCDACANTIKKLVEKEPGVRVAEVSFDEGSARIL
FT                   YDPQSVEEERLVDTIQKPGFRVVARG"
FT                   /protein_id="YP_571840.1"
FT   misc_feature    complement(70821..71009)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4424"
FT   misc_feature    complement(order(70974..70976,70983..70991))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4424"
FT   gene            complement(71270..71737)
FT                   /db_xref="GeneID:4025436"
FT                   /locus_tag="Nham_4425"
FT   CDS_pept        complement(71270..71737)
FT                   /locus_tag="Nham_4425"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109554"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:4025436"
FT                   /translation="MRNAMLAVASHATRVSPGQDLSEPHAISALAALAQPTRLAIFRLL
FT                   VKHEPVGITAGVIAETVGAPHNTLSTHLAILVRAGLLRSSRDGRTIIYRSDVKGMQSLI
FT                   SFLIDDCCNGHPELCGIPNATGASCDCETASKKASPKKRSARQPKASRKRA"
FT                   /protein_id="YP_571841.1"
FT   misc_feature    complement(<71456..71650)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4425"
FT   misc_feature    complement(order(71498..71500,71597..71599,71606..71611,
FT                   71618..71623,71630..71632,71639..71641,71645..71650))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4425"
FT   misc_feature    complement(order(71459..71467,71480..71488,71504..71509,
FT                   71513..71518,71525..71530,71534..71545,71570..71578,
FT                   71624..71632,71642..71647))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4425"
FT   misc_feature    complement(order(71567..71569,71576..71578))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4425"
FT   gene            71968..72489
FT                   /db_xref="GeneID:4025437"
FT                   /locus_tag="Nham_4426"
FT   CDS_pept        71968..72489
FT                   /locus_tag="Nham_4426"
FT                   /gene_family="HOG000253906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109555"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:4025437"
FT                   /translation="MSHCDHLVDVGRRKFLSGAGLAAAGAAAATMVPVHAKAAPGSARV
FT                   DYPSNRLANIGELKPNEAFNVAYPDADAPGVLLKLGKRVPGGAGPDGDIVGFSTICPHK
FT                   GFPLNYNGVDKTLNCPGHYSRFDCESGGQQVWGHATQNLPQYMLRIDGKGDIYAEGVDE
FT                   LLYGRLSNVL"
FT                   /protein_id="YP_571842.1"
FT   sig_peptide     71968..72078
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.979 at
FT                   residue 37"
FT                   /locus_tag="Nham_4426"
FT                   /product="hypothetical protein"
FT   misc_feature    72106..72480
FT                   /note="Small subunit of Arsenite oxidase (ArOX) family,
FT                   Rieske domain; ArOX is a molybdenum/iron protein involved
FT                   in the detoxification of arsenic, oxidizing it to arsenate.
FT                   It consists of two subunits, a large subunit similar to
FT                   members of the DMSO reductase...; Region:
FT                   Rieske_ArOX_small; cd03476"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Nham_4426"
FT   misc_feature    order(72268..72270,72274..72279,72322..72324,72331..72333,
FT                   72337..72339)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Nham_4426"
FT   misc_feature    order(72271..72279,72283..72285,72307..72312,72331..72336,
FT                   72346..72348,72352..72354,72364..72387)
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Nham_4426"
FT   gene            72502..74964
FT                   /db_xref="GeneID:4025438"
FT                   /locus_tag="Nham_4427"
FT   CDS_pept        72502..74964
FT                   /product="arsenate reductase (azurin)"
FT                   /gene_family="HOG000249382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="Nham_4427"
FT                   /EC_number="1.20.98.1"
FT                   /db_xref="GI:92109556"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="GeneID:4025438"
FT                   /translation="MAYKRQIDRLPIIPKDAKEFNVTCHYCIVGCGYKAYTWPTNKQGG
FT                   TAADQNKFGVDLAKQQGADTPNWYAPSMYNIVRQNGEDMHIVIKPDQDCVVNSGLGSVR
FT                   GARIAEMSYSQARNTQLQRLTDPMVWRYGQMQPTGWEDALDLVARVTVAVINDMGEDGL
FT                   FVSAYDHGGAGGGYENTWGTGKLYFGAMKVKNIRIHNRPAYNSEVHATRDMGVGELNNC
FT                   YEDAELADTIVAVGTNALETQTNYFLNHWVPNLRGSSVDKKKAEFGAEPVDRGRIIVVD
FT                   PRRTVTINACEAEAGKDGVMHLAVNSGTDLILFNAWLTYIASKGWIDKAFIDASTKNFD
FT                   KARTANNVSLDEAARVTGLTADQIRQSAEWIAQPKSGNARRRTMFAYEKGLIWGNDNYR
FT                   TNAALVNLALATGNVGRPGGGCVRMGGHQEGYSRPSDAHVGRPAAYVDKLLMEGKGGVH
FT                   HIWGCDHYKTTLNAFKFKQTYKRRTDMVKDAMMTASYGDRAAMVNAIVDAIKKGGLFAV
FT                   DVDIVPTKIGEACHVWLPAATSGEANLTSMNGERRMRLTEKYMDPPGQAMPDSLIAARI
FT                   ANHMERVLHEQGKGKYADQFKGFNWKTEEDAFMDGYHGHEKGGEFVTYERLRVMGNNGF
FT                   QEPATAFRDGKIVGTKRLFADGKFNSKDGKATFMETQWRGLQAAGKEEERKKWPFLINN
FT                   GRANVVWQSAYLDQKNEFVMDRMPYPFIQMNPQDMADLKLNQGDLVEVYNDNGSTQAMV
FT                   YPTASAKRKQTFMLFGYPTGVVGNVVSAGVNEFIVPNYKQTWGGIRKIADAPEGVKHLS
FT                   FKSDEYTA"
FT                   /transl_table="11"
FT                   /protein_id="YP_571843.1"
FT   misc_feature    72523..74529
FT                   /note="Arsenite oxidase (Arsenite-Ox) oxidizes arsenite to
FT                   the less toxic arsenate; it transfers the electrons
FT                   obtained from the oxidation of arsenite towards the soluble
FT                   periplasmic electron carriers cytochrome c and/or
FT                   amicyanin.  Arsenite oxidase is a...; Region:
FT                   MopB_Arsenite-Ox; cd02756"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Nham_4427"
FT   misc_feature    72526..74904
FT                   /note="arsenite oxidase, large subunit; Region:
FT                   arsenite_ox_L; TIGR02693"
FT                   /db_xref="CDD:131740"
FT                   /locus_tag="Nham_4427"
FT   misc_feature    order(72571..72573,72580..72582,72589..72594,72598..72600,
FT                   72805..72807,72811..72813,73234..73236)
FT                   /note="[3Fe-4S] binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Nham_4427"
FT   misc_feature    order(72811..72813,73021..73023,73096..73101,73207..73215,
FT                   73222..73230,73339..73350,73423..73425,73429..73431,
FT                   73663..73671,73678..73680,73777..73779,73885..73893,
FT                   73903..73905,74056..74064,74107..74112,74206..74208)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Nham_4427"
FT   misc_feature    74563..74904
FT                   /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
FT                   of the MopB superfamily of proteins, a  large, diverse,
FT                   heterogeneous superfamily of enzymes that, in general, bind
FT                   molybdopterin as a cofactor. The MopB domain is found in a
FT                   wide variety of molybdenum-; Region: MopB_CT; cl09929"
FT                   /db_xref="CDD:158784"
FT                   /locus_tag="Nham_4427"
FT   misc_feature    order(74590..74595,74599..74610,74803..74805,74827..74829,
FT                   74872..74877)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30307"
FT                   /locus_tag="Nham_4427"
FT   gene            complement(75160..75882)
FT                   /db_xref="GeneID:4025439"
FT                   /locus_tag="Nham_4428"
FT   CDS_pept        complement(75160..75882)
FT                   /locus_tag="Nham_4428"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109557"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:4025439"
FT                   /translation="MRTEMQDLPNVNDEAFSLPDAGLLHRPMPTHRPRILLLYGSLRER
FT                   SFSRFATVEAARLLQTFGAETRIFDPSGLPLPDDAPATHEKVQELRELSAWSEGQVWCS
FT                   PERHGAMTGIMKAQIDWIPLSLGAVRPTQGKTLAVMQVCGGSQSFNAINQLRVLGRWMR
FT                   MITIPNQSSVAKAYEQFDEDGRMKPSPYYDRIVDVIEELVKFTLLTRGVSGYLTDRYSE
FT                   RKETAEKLVKRMSLDQAL"
FT                   /protein_id="YP_571844.1"
FT   misc_feature    complement(75208..75861)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Nham_4428"
FT   gene            complement(75872..76276)
FT                   /db_xref="GeneID:4025440"
FT                   /locus_tag="Nham_4429"
FT   CDS_pept        complement(75872..76276)
FT                   /locus_tag="Nham_4429"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenate reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109558"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:4025440"
FT                   /translation="MTITIYHNPDCGTSRNTLAMIRQSGIEPEIIEYLKQPPSREKLIE
FT                   LMTRMGISPRDLLRQKGTPYDDLELADLRWTDDELIDFMIAHPILINRPVVVTPKGVKL
FT                   CRPSEEVLSILPNPHIGRFVKEDGEIINAN"
FT                   /protein_id="YP_571845.1"
FT   misc_feature    complement(75935..76270)
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Nham_4429"
FT   misc_feature    complement(order(75959..75961,75998..76000,76100..76102,
FT                   76244..76246))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Nham_4429"
FT   gene            complement(76273..76971)
FT                   /db_xref="GeneID:4025441"
FT                   /locus_tag="Nham_4430"
FT   CDS_pept        complement(76273..76971)
FT                   /locus_tag="Nham_4430"
FT                   /gene_family="HOG000288286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major intrinsic protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109559"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="GeneID:4025441"
FT                   /translation="METYSLSRRAVAEALGTGLLVATVVGSGVMAETLTKDTALALLGN
FT                   TLPTGAILVVLITILSPISGAHFNPAVTLVFALKREMSARDGVCYVGAQIVGGVLGTIV
FT                   AHAMFALPLLEASTKVRTGGGQWLAEGVATFGLVATIVAGIRFQRTAVPWLVGLYITAA
FT                   YWFTASTSFANPAVAISRAFTNTFSGIRPTDLPGFIIAELCGALVGMALIGWLLRADET
FT                   KPQLAQEAIL"
FT                   /protein_id="YP_571846.1"
FT   sig_peptide     complement(76876..76971)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.950 at
FT                   residue 32"
FT                   /locus_tag="Nham_4430"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(76336..76950)
FT                   /note="Major intrinsic protein (MIP) superfamily. Members
FT                   of the MIP superfamily function as membrane channels that
FT                   selectively transport water, small neutral molecules, and
FT                   ions out of and between cells. The channel proteins share a
FT                   common fold: the N-...; Region: MIP; cl00200"
FT                   /db_xref="CDD:174030"
FT                   /locus_tag="Nham_4430"
FT   misc_feature    complement(order(76441..76443,76450..76452,76453..76458,
FT                   76765..76773,76825..76827))
FT                   /note="amphipathic channel; other site"
FT                   /db_xref="CDD:29423"
FT                   /locus_tag="Nham_4430"
FT   misc_feature    complement(order(76444..76452,76759..76767))
FT                   /note="Asn-Pro-Ala signature motifs; other site"
FT                   /db_xref="CDD:29423"
FT                   /locus_tag="Nham_4430"
FT   gene            complement(76971..77846)
FT                   /db_xref="GeneID:4025442"
FT                   /locus_tag="Nham_4431"
FT   CDS_pept        complement(76971..77846)
FT                   /locus_tag="Nham_4431"
FT                   /gene_family="HOG000221769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109560"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:4025442"
FT                   /translation="MDTSFAIAALSALAQATRLDVFRLLVEREPGGAAAGELARLAGVP
FT                   QNTMSTHLATLSRAGLVRGERRSRSIVYRANLEAFRKVTLFLLKDCCGGRTEVCAPLIE
FT                   DLAPLPKRRNPQMSDKIYNVLFLCTGNSARSILAESIMSKDGNGRFRAFSAGSQPKGKV
FT                   NPFALSVLNSFGYPSDGARSKSWEEFAVPDAPVMDFVFTVCDSAAGESCPVWPGQPMTA
FT                   HWGIEDPAAIEGTDIQKEAAFVAAFRYLKNRISLFTNLPLASIDQLSLGTKLREIGRLD
FT                   GSTFGQGKVI"
FT                   /protein_id="YP_571847.1"
FT   sig_peptide     complement(77796..77846)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.731) with cleavage site probability 0.615 at
FT                   residue 17"
FT                   /locus_tag="Nham_4431"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(77538..>77717)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Nham_4431"
FT   misc_feature    complement(77070..77483)
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Nham_4431"
FT   misc_feature    complement(77076..77483)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Nham_4431"
FT   misc_feature    complement(order(77442..77450,77454..77459,77463..77465))
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Nham_4431"
FT   gene            77954..78271
FT                   /db_xref="GeneID:4025443"
FT                   /locus_tag="Nham_4432"
FT   CDS_pept        77954..78271
FT                   /locus_tag="Nham_4432"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109561"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:4025443"
FT                   /translation="MKLDDAATRLEALGNPTRLKIYRALVRAGTVGMPVGRLQEKLKVA
FT                   PSTLSHHIKSLVSVGLIRQVRESTTLVCHAEYDAMHALVDFLVAECCADEAGCKDAKTA
FT                   A"
FT                   /protein_id="YP_571848.1"
FT   misc_feature    77981..>78163
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4432"
FT   misc_feature    order(77981..77986,77990..77992,77999..78001,78008..78013,
FT                   78020..78025,78032..78034,78131..78133)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4432"
FT   misc_feature    order(77984..77989,77999..78007,78053..78061,78086..78097,
FT                   78101..78106,78113..78118,78122..78127,78143..78151)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4432"
FT   misc_feature    order(78053..78055,78062..78064)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Nham_4432"
FT   gene            78321..79691
FT                   /db_xref="GeneID:4025444"
FT                   /locus_tag="Nham_4433"
FT   CDS_pept        78321..79691
FT                   /locus_tag="Nham_4433"
FT                   /gene_family="HOG000236827" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative secreted protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109562"
FT                   /db_xref="InterPro:IPR000205"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:4025444"
FT                   /translation="MTSSKIVAVIGGGPVGLAAAAHLMERGMTPIVLEAGEQAAHAVRQ
FT                   WRHVQLFSPWKYNIDGAAARLLAATGWNSPDPEAYPTGGELIERYLDPLATKTPLRDVI
FT                   RTSSRVTAISRVGFDKAKTKGRESAPFEIRFQNGKGPETLRADAVIDASGTWSSPNPAG
FT                   VNGLAAIGERECAARITYGMPDVRGTERERYEGQTVAVVGAGHSAIGTLIELARLRDNA
FT                   PPTNVIWLLRGTDPSKAFGGGANDKLVARGELGAAFADLVSKGAIQVETGFGITHVSAS
FT                   GERLRIGAGSACCGRHVVVDELIVATGFRPDLWFLSEMRLRLDSAIEAPVDLAPLVDPN
FT                   EHSCGTVRPHGARELRQDEPGLYLAGMKSYGRAPTFLMITGYEQVRSIAAEIAGDHEAA
FT                   ARVELDLPETGVCTRGGVEVGTASAGCCGGPAPVGADACCAEDADAKTAGRSGCSCS"
FT                   /protein_id="YP_571849.1"
FT   sig_peptide     78321..78386
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.430 at
FT                   residue 22"
FT                   /locus_tag="Nham_4433"
FT                   /product="hypothetical protein"
FT   misc_feature    78339..>79154
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="Nham_4433"
FT   misc_feature    78339..>78434
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Nham_4433"
FT   gene            79702..80883
FT                   /db_xref="GeneID:4025445"
FT                   /locus_tag="Nham_4434"
FT   CDS_pept        79702..80883
FT                   /locus_tag="Nham_4434"
FT                   /gene_family="HOG000236838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109563"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4025445"
FT                   /translation="MSGRQLPVIFALGTTQTLAWASSYYLPAILADPIARDLGISSNWF
FT                   FAAFSAALVISGLLGPRVGRQIDLIGGRPVLSGSNLIFAAGLALLGASTSGWMLGAAWF
FT                   LLGIGMGTGLYDAAFGALGRIYGNDARRAITGITLIAGFASTVGWPLSSFGLEAIGWRA
FT                   TCYAWAVAHLLVGFPLNLLFLPRVTTAKRNEASTVKPHMPIDRTMILLSLAFAAAWTVT
FT                   SAMAAHLPRIVEAFGATPAQAVFAGMMIGPAQVAARVLEAGTLGRFHPLFSTRLACITH
FT                   PIGACIIGIFGGGAAAAFALLHGAGNGLLTIARGTLPLEIFGPENYGYRLGLLGAPSRV
FT                   CQALAPLGFSLLIDPLGGAVLIVSSLLSLVAFGALLLLPRHATKDTVAEEAKS"
FT                   /protein_id="YP_571850.1"
FT   sig_peptide     79702..79767
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.872) with cleavage site probability 0.817 at
FT                   residue 22"
FT                   /locus_tag="Nham_4434"
FT                   /product="hypothetical protein"
FT   misc_feature    79873..80211
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cl11420"
FT                   /db_xref="CDD:176432"
FT                   /locus_tag="Nham_4434"
FT   gene            complement(81125..81820)
FT                   /db_xref="GeneID:4025446"
FT                   /locus_tag="Nham_4435"
FT   CDS_pept        complement(81125..81820)
FT                   /locus_tag="Nham_4435"
FT                   /gene_family="HOG000111053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LuxR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109564"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="GeneID:4025446"
FT                   /translation="MEAVEQTRTAAEIEDCLLGLAAEFGFTGLFGGIVPTRPAPLAELR
FT                   SRILFQRFPAQWLDRYSRKGYVFRDPIIQHLFHERTPFTWHEGYKSCPQRSNVRLIQGE
FT                   AAEFGLRDGYVVPISTIDGEIVSLSFGGPGTLPASADLSVLNFAASYALGRHLHRIATW
FT                   RRVNSNLTAREWDCLLWAGEGKTNWEISAILGISKSTVTKHIMAARAKLGAVSKAHAIA
FT                   MAIRTKLLR"
FT                   /protein_id="YP_571851.1"
FT   misc_feature    complement(81143..81811)
FT                   /note="LuxR family transcriptional regulatory, chaperone
FT                   HchA-associated; Region: reg_near_HchA; TIGR03541"
FT                   /db_xref="CDD:132580"
FT                   /locus_tag="Nham_4435"
FT   misc_feature    complement(81395..81796)
FT                   /note="Autoinducer binding domain; Region: Autoind_bind;
FT                   pfam03472"
FT                   /db_xref="CDD:146226"
FT                   /locus_tag="Nham_4435"
FT   misc_feature    complement(81143..81313)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4435"
FT   misc_feature    complement(order(81170..81172,81203..81217,81221..81226,
FT                   81230..81235,81257..81265,81302..81310))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4435"
FT   misc_feature    complement(order(81143..81148,81155..81157,81164..81172,
FT                   81263..81265,81269..81271,81275..81277))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Nham_4435"
FT   gene            complement(82387..84531)
FT                   /db_xref="GeneID:4025447"
FT                   /locus_tag="Nham_4436"
FT   CDS_pept        complement(82387..84531)
FT                   /locus_tag="Nham_4436"
FT                   /gene_family="HOG000077281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TRAG protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109565"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="GeneID:4025447"
FT                   /translation="MARVVAYRIGIAVLLLLAFWLLWSMAYEVVVALRWAPSRFPSEGA
FT                   SRWALFRMQNTDRSVDFFLIAWRHFYDRLLFPSMRLEALIRAGYAVAAVGALAIAGVMF
FT                   AVINRRQMPYGEARFGTLMEAARQGLTAKQGIVLGTLGGATIRSDEPAHILVVGPSRSG
FT                   KGTGFVLPNGYLWQGSAVFFDPKRENFDALANHRAAMGNKVFMFSPGSNDTHRYNPLDF
FT                   VRRDARMATDCLVVASFVIPEKADDTWAGAGRLLLSALIGYVLSSPLIAGAQHMRTVAR
FT                   MTTTGKDISSVLRAIVKTECQHLPTWVVDSFNQYIALEPETRNSAVFNVNMATSLWNNG
FT                   LISAATETSDFDIRELRRQPMTIFIGCTIAELSIFRPLIRILFQQIHDLMMVKIPGADE
FT                   PHQVLLMLDEFYHVGRMDSLISKITISAGYGFRMAIVMQDIAQLDELYGKNTRITTVSG
FT                   SQIKLFIQINDLETSDFVSEMLGETTQVYKTPIQRPGQGIFAPRVWAPHYTPRPLRSPL
FT                   ELREMSARLSILMVKNSRSFELTKIRHYLDKPYRAFYEKAKGSPPVLPALRDWQDESLG
FT                   GAINPMPDQTKKLADAGPAPMEMNSPTPRKTKSRRPPKSASNKATATERPQAPAAPLTL
FT                   VARRTAKPESKSLSLGIAPPAPPGESCDVRNILKSAEARQDEEFSAMMRVLDTSSGSKT
FT                   REAADTLALLHRSFGDDTKP"
FT                   /protein_id="YP_571852.1"
FT   sig_peptide     complement(84451..84531)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.823) with cleavage site probability 0.540 at
FT                   residue 27"
FT                   /locus_tag="Nham_4436"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(82876..84180)
FT                   /note="TraG/TraD family; Region: TraG; pfam02534"
FT                   /db_xref="CDD:111435"
FT                   /locus_tag="Nham_4436"
FT   misc_feature    complement(82966..84075)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Nham_4436"
FT   misc_feature    complement(order(84037..84045,84055..84060))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Nham_4436"
FT   misc_feature    complement(order(83305..83310,83977..83982,83986..83988,
FT                   84037..84045,84055..84057))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Nham_4436"
FT   misc_feature    complement(83308..83322)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Nham_4436"
FT   gene            complement(84509..85558)
FT                   /db_xref="GeneID:4025448"
FT                   /locus_tag="Nham_4437"
FT   CDS_pept        complement(84509..85558)
FT                   /locus_tag="Nham_4437"
FT                   /gene_family="HOG000119934" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109566"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4025448"
FT                   /translation="MARSLTVFIDRALEPIRPWLKDDQVVEICANGPGEVWVERFGQSA
FT                   MERHDVPHLTEHALRHLAERVAGHSGQSVNEEHPLLSAALPTGERFQGVMPPATTAGGA
FT                   FAIRKQVIKEMRLDDYRKLGSFEKVSTAGEGALSETDRRLCEHLDAGRIEDFIRLAVAN
FT                   RYSILLSGGTSSGKTTFLNAILKEVPVDERIITIEDTREVNPIQKNYLPLVASKGDQGE
FT                   ARVTVETLLQASMRLRPDRIFLGEIRGAEAYSFLRAINTGHPGSITTVHADSPAGAFEQ
FT                   LALMVMQAGLGLRRDEIVGYIKSVLPIVIQQTKVGGWRGTSAVHFSRMAEWREQRTGGK
FT                   GRHGARRRL"
FT                   /protein_id="YP_571853.1"
FT   misc_feature    complement(84581..85504)
FT                   /note="P-type DNA transfer ATPase VirB11; Region: VirB11;
FT                   TIGR02788"
FT                   /db_xref="CDD:163021"
FT                   /locus_tag="Nham_4437"
FT   misc_feature    complement(84599..85108)
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Nham_4437"
FT   misc_feature    complement(order(85025..85033,85043..85048))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Nham_4437"
FT   misc_feature    complement(order(84617..84619,84719..84721,84728..84730,
FT                   84740..84748,84776..84781,84788..84790,84800..84802,
FT                   84839..84841,84845..84853,84917..84922,84926..84937,
FT                   84956..84958,84980..84982,85037..85042))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Nham_4437"
FT   misc_feature    complement(order(84602..84604,85022..85039))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Nham_4437"
FT   misc_feature    complement(84821..84838)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Nham_4437"
FT   gene            complement(85530..86867)
FT                   /db_xref="GeneID:4025449"
FT                   /locus_tag="Nham_4438"
FT   CDS_pept        complement(85530..86867)
FT                   /locus_tag="Nham_4438"
FT                   /gene_family="HOG000296197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugation TrbI-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109567"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="GeneID:4025449"
FT                   /translation="MPSADDYRSFELEAAAATSVARGRTALGSFLKFGVPIGALMVAAW
FT                   IIYGSVARRAPTLTTPDKEEFTTTQFPAPSLSSPRTQTNQGMIVIPQAPAEPPSPPVAP
FT                   PLALPAPPPPEPPRAAAPPNDDEARRLAELERLRQEERRKWERLRAPQVIADNAAAAAA
FT                   RNPEDGSKAAAGPDDDPNRRFLASVSAAGVEVSRATKNNRIDALVAQGTMIRGVLETAL
FT                   QSDLPGMVRAVVSENVWSFDGRRVLIPAGSRLVGEYKSGIAQGQTRVFVVWTRMLRSDG
FT                   VSVQLGSNGADDLGRAGNAGFVDNHYLERFGSAIMLSVVGGVSQFLSAYGQNTNTNGNG
FT                   SIITTTDPVTGIVTQTQTGVNQSQLSLQARAIAAQNVSQTLTNIAQQALRNSINIPPTI
FT                   YLDQGTQIIVFVRRDLDFSALYSDPVKEALRELKRERIGAKPDGLH"
FT                   /protein_id="YP_571854.1"
FT   misc_feature    complement(85617..86249)
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:174812"
FT                   /locus_tag="Nham_4438"
FT   gene            complement(86874..87677)
FT                   /db_xref="GeneID:4025450"
FT                   /locus_tag="Nham_4439"
FT   CDS_pept        complement(86874..87677)
FT                   /locus_tag="Nham_4439"
FT                   /gene_family="HOG000119712" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbG/VirB9/CagX"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109568"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="GeneID:4025450"
FT                   /translation="MIKGCAVLTVVLCITAGAAFAEALPRPGRVDSRVRDVVYNKDNVT
FT                   AIDASYGTSTMIELQPDEKIETLALGDSIAWKVEPNRKGDVIFVKPVEKNAQSNLNVVT
FT                   DKRIYSFLLRSNTRPPAGQIYAVRFRFPDDEASAKLLAEAKERAANPNLKDLNIANANS
FT                   DYGYKGSSVNKPVAAFDDGTKTWFRFEGETPAIYIVDGDRNESLVNFRTEGPYVIVDKV
FT                   SPQWTLRNGQESTCVFNRRLNNVHEPNGLEPYAPQRVGSATNLGG"
FT                   /protein_id="YP_571855.1"
FT   sig_peptide     complement(87612..87677)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT                   /locus_tag="Nham_4439"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(86955..87206)
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cd06911"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Nham_4439"
FT   misc_feature    complement(order(86964..86984,86997..86999,87141..87158,
FT                   87171..87191))
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Nham_4439"
FT   gene            complement(87674..88390)
FT                   /db_xref="GeneID:4025451"
FT                   /locus_tag="Nham_4440"
FT   CDS_pept        complement(87674..88390)
FT                   /locus_tag="Nham_4440"
FT                   /gene_family="HOG000119601" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="VirB8"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109569"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="GeneID:4025451"
FT                   /translation="MTETTASESARVDSRYYADGATWERDIARRNRNSRALAWIVAAVM
FT                   TIVAVGALGTLALLVPLKTYEPYMVVVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRY
FT                   IKARETYDPKALKDNFDLAQLLASGDASRELTEIYSPANPSNPVKVFGSNTVIAVNIKS
FT                   VTFPNNRTALARFSTEEKSSTNIITRNWVSLVRFRYTSAPMRNEWRFDNPLGFQVLEYR
FT                   RDQETAPSPGTVGAQQ"
FT                   /protein_id="YP_571856.1"
FT   misc_feature    complement(87692..88384)
FT                   /note="VirB8 protein; Region: VirB8; cl01500"
FT                   /db_xref="CDD:174634"
FT                   /locus_tag="Nham_4440"
FT   gene            complement(88387..89517)
FT                   /db_xref="GeneID:4025452"
FT                   /locus_tag="Nham_4441"
FT   CDS_pept        complement(88387..89517)
FT                   /locus_tag="Nham_4441"
FT                   /gene_family="HOG000077280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109570"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="GeneID:4025452"
FT                   /translation="MGNSFSITSLLQSVDQLGQNYVSTAYQALANAATSGGATSVAGSL
FT                   LTLYMIFWGIGIWQGTSTGGPADHAFRLFRAVLIYTMATKWGDFQTLAYNALNDGPSAI
FT                   GNALLSAVTSANNTGTSANLNSVNGVQSALQNMWDTTNSATEAFLQNAGITNWGPYIFA
FT                   AVFYVVMAILIGFAIFLIVLSKMFMWLLLALAPLFIILLLFGVTTRFFSGWLSALVQYF
FT                   LVQVLVYAFLAFYVSLIQQTIDTLNSVANSKSATWATIGPVVLLAIIGILLLSQINNMA
FT                   AAIAGGVPIFAPRIGAVLATATGYRLGAAANRARLAFRNPLNPASTSRREELASRQRAR
FT                   VGLRAASWAQSAEFRRLADQLRNPNVPPASSGSGRP"
FT                   /protein_id="YP_571857.1"
FT   misc_feature    complement(88741..89379)
FT                   /note="TrbL/VirB6 plasmid conjugal transfer protein;
FT                   Region: TrbL; cl01503"
FT                   /db_xref="CDD:174636"
FT                   /locus_tag="Nham_4441"
FT   gene            complement(89714..89923)
FT                   /db_xref="GeneID:4025453"
FT                   /locus_tag="Nham_4442"
FT   CDS_pept        complement(89714..89923)
FT                   /locus_tag="Nham_4442"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109571"
FT                   /db_xref="GeneID:4025453"
FT                   /translation="MNRKGGRSVSKRNLILIIVVAVAAFAIGRFVVSRGPTPSAESGTT
FT                   GDQSAAAKAASRAMTFTQPKAPAQ"
FT                   /protein_id="YP_571858.1"
FT   sig_peptide     complement(89822..89923)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.555 at
FT                   residue 34"
FT                   /locus_tag="Nham_4442"
FT                   /product="hypothetical protein"
FT   gene            complement(89920..90639)
FT                   /db_xref="GeneID:4025454"
FT                   /locus_tag="Nham_4443"
FT   CDS_pept        complement(89920..90639)
FT                   /locus_tag="Nham_4443"
FT                   /gene_family="HOG000296199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109572"
FT                   /db_xref="GeneID:4025454"
FT                   /translation="MRLKFVLLVLAALIATGVPPAAAQVPVLDNANLAKAQQIATSTQQ
FT                   ILTADKQILQFTQKTLQAVTGDRSSQAQGTLAQMALGGGFSMAQAPSLGSVISGGALSF
FT                   AGMGSASQNIVSTLINGLQLVQTITGLVNGQSHPADTAYKNSVNVAATLSGLINSTQGA
FT                   VQQRSSAFTQGGQQIGKAQDLKGSVDQNTQVQIQTGQTINELNGVVNNAAAAANQANLD
FT                   RIAAESSAARAMKFTQQ"
FT                   /protein_id="YP_571859.1"
FT   misc_feature    complement(90028..90639)
FT                   /note="Type IV secretion system proteins; Region: T4SS;
FT                   cl06849"
FT                   /db_xref="CDD:164091"
FT                   /locus_tag="Nham_4443"
FT   sig_peptide     complement(90568..90639)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 24"
FT                   /locus_tag="Nham_4443"
FT                   /product="hypothetical protein"
FT   gene            complement(90650..91543)
FT                   /db_xref="GeneID:4025455"
FT                   /locus_tag="Nham_4444"
FT   CDS_pept        complement(90650..91543)
FT                   /locus_tag="Nham_4444"
FT                   /gene_family="HOG000077279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109573"
FT                   /db_xref="GeneID:4025455"
FT                   /translation="MRCAIAATTVVLLAMTAPVLASIPVNDAAQLTQHSQTASTTVKLV
FT                   PVTTQRQDANSGVKCAVTTGKKASVTDPTAQPQSGAGSKAIQSYAPDQPAAPDTAAQGA
FT                   ALNNQTLFKSSGDVVAGLDASRQTLSAAQTAFKTAGQQVGTATTVMAAIDMNSAARLQN
FT                   NLAWNSAIGSANLWVTALNALNLALTSDTSRAALGMRATATAGATPRQGPACPLGMIGA
FT                   GTAANPCRAPSTCSTTPAGSPTDPACIVARYVDSDGNVVFYLSQAQSAANAAGSLNAFT
FT                   ADDVAAGLAAIASNSR"
FT                   /protein_id="YP_571860.1"
FT   sig_peptide     complement(91478..91543)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT                   /locus_tag="Nham_4444"
FT                   /product="hypothetical protein"
FT   gene            complement(91540..93951)
FT                   /db_xref="GeneID:4025456"
FT                   /locus_tag="Nham_4445"
FT   CDS_pept        complement(91540..93951)
FT                   /locus_tag="Nham_4445"
FT                   /gene_family="HOG000119263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV secretion/conjugal transfer ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109574"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="GeneID:4025456"
FT                   /translation="MVARALLDELTFGAVSRRERPVASHVPYTRHVDDHIIKTRDGLVL
FT                   TTLKLDGYSFETSDMSEVNARLLGRNDVVRTLANSRFALVSHIVRREVQPRIVSTFDNA
FT                   LCRELDERYNAALSKRRMFVNDIYLTIIRRPLQGQAGTFDAMLTRLLGRKDVAGESVAM
FT                   QTALAELRDAATAVRENLAGYGARQLGVVRRDGVWFSEPLEFLTLLLNGGLPRPMHLPR
FT                   MNLADALSMKRIFFGHNAIEVRGAGPEDTRFGAMVSIREYPAQTGPGSFDNLLRVPHEF
FT                   IATQSFAIVDRPEAAKQIDRVSRQVDMSDEAGSIVSEHLDDARDELLASEAIYGEHHMT
FT                   VMCLGRDLAEVGAAVTAVGAALTDRSVIWTREDLNCEPAFWAQLPGNFTYIARKGVISS
FT                   KNFAGFTSLHNYPSGRPAGNHWGPAISVFETTSQTAYYYNHHVRDIGNFTVVGPTGSGK
FT                   TVFLSFIAAQTQRIQPRPKLLFVDKDRGAEIFIRALGGQYETLVPGEQTGFNPLSLPDS
FT                   APNREFLYQLFAFMLRPGKGGELSASEEQVIRNAIASALAAGPAGRTLKAFSTLLRGRI
FT                   RAGEGDLLARLESWMRPDQRGWLFNNDEDRFSLSSVFGFDMTRVLDDPVVRTAALMYIF
FT                   HRTDELLTGDPVMIFLDEGWRLLDDEVFAFFIRDKLKTIRKQNGIVGFGTQSAADIVRS
FT                   KASNTLIEQTSTNIFFPNPKADDESYKQAFRLSGREVAWIRGTVPESRSFLIKHGRDSV
FT                   VAKLNLANMPDLIKVLSGRTETVAELDALRARVGDDPAAWLPIFMGRAQG"
FT                   /protein_id="YP_571861.1"
FT   misc_feature    complement(91552..93924)
FT                   /note="Type IV secretory pathway, VirB4 components
FT                   [Intracellular trafficking and secretion]; Region: VirB4;
FT                   COG3451"
FT                   /db_xref="CDD:33254"
FT                   /locus_tag="Nham_4445"
FT   misc_feature    complement(92773..93303)
FT                   /note="VirB family, component of type IV transporter
FT                   system; Region: CagE_TrbE_VirB; pfam03135"
FT                   /db_xref="CDD:111973"
FT                   /locus_tag="Nham_4445"
FT   gene            complement(93962..94258)
FT                   /db_xref="GeneID:4025457"
FT                   /locus_tag="Nham_4446"
FT   CDS_pept        complement(93962..94258)
FT                   /locus_tag="Nham_4446"
FT                   /gene_family="HOG000273006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV secretory pathway, VirB3-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109575"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="GeneID:4025457"
FT                   /translation="MTGDELEDPLISPLVKALTRAPTLMGVPYMYFMFNGVVSSVCFLV
FT                   THNLFMLLVAIPLHLFGYVMTLRDDRIFEILFVKSTKCPPRSRAFWAADSYSA"
FT                   /protein_id="YP_571862.1"
FT   misc_feature    complement(93968..94237)
FT                   /note="Type IV secretory pathway, VirB3-like protein;
FT                   Region: VirB3; cl01501"
FT                   /db_xref="CDD:174635"
FT                   /locus_tag="Nham_4446"
FT   gene            complement(94255..94560)
FT                   /db_xref="GeneID:4025458"
FT                   /locus_tag="Nham_4447"
FT   CDS_pept        complement(94255..94560)
FT                   /locus_tag="Nham_4447"
FT                   /gene_family="HOG000296201" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein, trbC"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109576"
FT                   /db_xref="GeneID:4025458"
FT                   /translation="MKTMLSRTPLAGVLLALSAVEAAAQSSGGTLQPVQSTLTQLVSAL
FT                   TGPIATALATLAVIACGFFAWSGRLTWGIAGSVIFGIVLVFGSAQIVQFFQSAVGQ"
FT                   /protein_id="YP_571863.1"
FT   sig_peptide     complement(94486..94560)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.581 at
FT                   residue 25"
FT                   /locus_tag="Nham_4447"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(94276..>94482)
FT                   /note="TrbC/VIRB2 family; Region: TrbC; cl01583"
FT                   /db_xref="CDD:174649"
FT                   /locus_tag="Nham_4447"
FT   gene            complement(94575..95327)
FT                   /db_xref="GeneID:4025459"
FT                   /locus_tag="Nham_4448"
FT   CDS_pept        complement(94575..95327)
FT                   /locus_tag="Nham_4448"
FT                   /gene_family="HOG000077278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109577"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4025459"
FT                   /translation="MLIRVAAIGFGVLASLAGAAAQDARPQTLAAVDASGHVLPLGAAP
FT                   VSVERIGAAQVSQVASPCPDAVAMVPEEARALVTRIATEEAFYPDFVLSVAKAESQFNS
FT                   VALSDKGAFGLMQLEPETAQRFKVDLCDPVGNIRGGIRFLRALHEKYRNPLFILAAYNA
FT                   GEGAVEQSRGVPPYPETVRFVAQVLNDFYAWPALGPAAARGPLRSASRTLEAPDLIEPR
FT                   EATAPPKTPKPAPKDRTRWDNGFVMHVD"
FT                   /protein_id="YP_571864.1"
FT   sig_peptide     complement(95268..95327)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.493 at
FT                   residue 20"
FT                   /locus_tag="Nham_4448"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(94761..95063)
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Nham_4448"
FT   misc_feature    complement(order(94845..94847,94899..94901,94971..94973,
FT                   95031..95033))
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Nham_4448"
FT   misc_feature    complement(95031..95033)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Nham_4448"
FT   gene            95428..95937
FT                   /db_xref="GeneID:4025460"
FT                   /locus_tag="Nham_4449"
FT   CDS_pept        95428..95937
FT                   /locus_tag="Nham_4449"
FT                   /gene_family="HOG000296208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109578"
FT                   /db_xref="GeneID:4025460"
FT                   /translation="MMRRGALVIAVVGLGSGLDMPPPATAQDASFGCKVLLCAAAPAPA
FT                   PGWAGIPYCVPVMQTLFRQLAKGGGWPSCAEGNTSGHGYEPYQACPSELTPVQLAADGG
FT                   AGLERASNGGLCADLSRPQQVCSGGDGGCTASYPTTPREARSDPYFVDITTANRSQRFY
FT                   FSLQGY"
FT                   /protein_id="YP_571865.1"
FT   sig_peptide     95428..95508
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 27"
FT                   /locus_tag="Nham_4449"
FT                   /product="hypothetical protein"
FT   gene            95939..96538
FT                   /db_xref="GeneID:4025461"
FT                   /locus_tag="Nham_4450"
FT   CDS_pept        95939..96538
FT                   /locus_tag="Nham_4450"
FT                   /gene_family="HOG000296204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinoglycan biosynthesis protein exoI-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109579"
FT                   /db_xref="GeneID:4025461"
FT                   /translation="MRWSHALAVALAPLAVLNGASAQTAPSRWFPVPASAVYLTGDSWS
FT                   DAGTIYRLYGVQSCLRGTSFTNAHGMRRDCGEASLAMLVALTRDLQPRCYDAAEQPQTQ
FT                   TVFVFCVATRTVGSGQGSRIDLGTALIATGFGFAALKPDGQPVHAPYFVAQLVAQRAKA
FT                   GLWAFADMPEPNAIILRTLREGTPSPTPAAPQLATP"
FT                   /protein_id="YP_571866.1"
FT   sig_peptide     95939..96007
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.834 at
FT                   residue 23"
FT                   /locus_tag="Nham_4450"
FT                   /product="hypothetical protein"
FT   gene            96567..96905
FT                   /db_xref="GeneID:4025462"
FT                   /locus_tag="Nham_4451"
FT   CDS_pept        96567..96905
FT                   /locus_tag="Nham_4451"
FT                   /gene_family="HOG000106484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein/primosomal
FT                   replication protein n"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109580"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="GeneID:4025462"
FT                   /translation="MRTTNLFILRGRVGQAPKAFNKAAKINVATDRAWTDGKGERREET
FT                   DWVTVTILNEKAAEWAIANVAKGDAVYAECRIADGSYKKDGETVYTTDVIANVFHKLDL
FT                   GQRNDAAA"
FT                   /protein_id="YP_571867.1"
FT   misc_feature    96585..96872
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4451"
FT   misc_feature    order(96585..96596,96654..96662,96702..96704,96708..96710,
FT                   96774..96776,96801..96803,96831..96833,96840..96842)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4451"
FT   misc_feature    order(96600..96608,96624..96626,96639..96641,96660..96665,
FT                   96696..96701,96705..96707,96711..96713,96717..96719,
FT                   96723..96725,96765..96770,96792..96794,96798..96800,
FT                   96804..96809,96843..96845,96849..96851)
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4451"
FT   misc_feature    order(96774..96776,96780..96782,96786..96788,96864..96866)
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4451"
FT   gene            96892..97476
FT                   /db_xref="GeneID:4025463"
FT                   /locus_tag="Nham_4452"
FT   CDS_pept        96892..97476
FT                   /locus_tag="Nham_4452"
FT                   /gene_family="HOG000077277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109581"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="GeneID:4025463"
FT                   /translation="MPPPSVVLGVVSALAVLSASMALAQTGNAPPGVYEPKAVVQSPPL
FT                   RVEVIDGTRFRDVESKEVYQLYGIDTCAPGQTARLKRQPWPCGTMATAWLVTATLNAWL
FT                   ACRTLRDEASEHLARCSSAGHPDIAADMVRDGIAVARLPTPEDPGVRAYAAAEQDARKA
FT                   YRGLWSSTFQMPWDWRAKTDPSRAAQRGATP"
FT                   /protein_id="YP_571868.1"
FT   sig_peptide     96892..96966
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT                   /locus_tag="Nham_4452"
FT                   /product="hypothetical protein"
FT   misc_feature    <97015..97431
FT                   /note="Staphylococcal nuclease homologues. SNase homologues
FT                   are found in bacteria, archaea, and eukaryotes. They
FT                   contain no disufide bonds; Region: SNc; cl00140"
FT                   /db_xref="CDD:176576"
FT                   /locus_tag="Nham_4452"
FT   misc_feature    97030..97401
FT                   /note="Staphylococcal nuclease homologues; Region: SNc;
FT                   smart00318"
FT                   /db_xref="CDD:128613"
FT                   /locus_tag="Nham_4452"
FT   gene            97473..98021
FT                   /db_xref="GeneID:4025464"
FT                   /locus_tag="Nham_4453"
FT   CDS_pept        97473..98021
FT                   /locus_tag="Nham_4453"
FT                   /gene_family="HOG000077276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109582"
FT                   /db_xref="GeneID:4025464"
FT                   /translation="MIRRAYSLVAPLLAVLAGCAAPTAPVVDVVTPASEPLYSPGRVKP
FT                   GRLEYAPDRSTFAPVLTERFTYPTQPEANAAYRRLVASAPAQGHYPASVWLFGCKPGGL
FT                   DEETARVTRYRSPVVHCATDYLDAAGGRLRRETANFYYYGVVWNMQPVHPPLTAAPWFN
FT                   REASPKDFWWWVPGRPRYE"
FT                   /protein_id="YP_571869.1"
FT   sig_peptide     97473..97535
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.808 at
FT                   residue 21"
FT                   /locus_tag="Nham_4453"
FT                   /product="hypothetical protein"
FT   gene            98031..98696
FT                   /db_xref="GeneID:4025465"
FT                   /locus_tag="Nham_4454"
FT   CDS_pept        98031..98696
FT                   /locus_tag="Nham_4454"
FT                   /gene_family="HOG000077275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109583"
FT                   /db_xref="GeneID:4025465"
FT                   /translation="MEASVASTHQIQYIRCWEAAASALPARRALCSVAASLMMMMIEIV
FT                   GAVEARPLTPDPGAWRPMAYADLQRPSAQAATYLDIWKDAVDSNNRAYAAAGDRRFTAG
FT                   NAPATEAHFVIWSTRRSVVLSVLDTAPGCTVKQVGVHAHATVKLCPTRVAIYEGIQVRT
FT                   MDAGRSCFLELAPGAPPDPAASVAYASYDVAARTLKTGMILDHRAVEGCSLDIPLHRQ"
FT                   /protein_id="YP_571870.1"
FT   gene            98723..99205
FT                   /db_xref="GeneID:4025466"
FT                   /locus_tag="Nham_4455"
FT   CDS_pept        98723..99205
FT                   /locus_tag="Nham_4455"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109584"
FT                   /db_xref="GeneID:4025466"
FT                   /translation="MQCRRLRFLTACFLALAYAAPATAAEAAFAYKTSYRNVAEDPDHV
FT                   WTGTALAPTAKGTVTIHEYQLRTAHGDWLISQIWNEDCSSGACPTRLVRIGEDGHRTVA
FT                   VDDMMHQVVPPDDPRFATTPMSDAQKTFARRPFALSEDGKTLVNGDYKFEVAGAKP"
FT                   /protein_id="YP_571871.1"
FT   sig_peptide     98723..98797
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT                   /locus_tag="Nham_4455"
FT                   /product="hypothetical protein"
FT   gene            99202..99894
FT                   /db_xref="GeneID:4025467"
FT                   /locus_tag="Nham_4456"
FT   CDS_pept        99202..99894
FT                   /locus_tag="Nham_4456"
FT                   /gene_family="HOG000091348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109585"
FT                   /db_xref="GeneID:4025467"
FT                   /translation="MTIRAAVRQTLFDAALILCLSAAAAFAGQSAASLTAAGIPSNCAD
FT                   FAAKVSSSEGNFGTTNQYGCLGAFQFCPGTFERYYNDSAQSFLNSPSAQTAAWTQYEQN
FT                   SWSQAQKNGLTSLVGQQVCSGGKCATIDQSAILMACQFGCGPKGKLANYAAGGDCSARN
FT                   VKDGNGVSVCTYLMRGAGYDASCFTGQQSTVCVQSPSGPGDFPTTTGIAANPPAADSAS
FT                   VVVSPSDV"
FT                   /protein_id="YP_571872.1"
FT   sig_peptide     99202..99300
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.654 at
FT                   residue 33"
FT                   /locus_tag="Nham_4456"
FT                   /product="hypothetical protein"
FT   gene            101024..102037
FT                   /db_xref="GeneID:4025468"
FT                   /locus_tag="Nham_4457"
FT   CDS_pept        101024..102037
FT                   /locus_tag="Nham_4457"
FT                   /gene_family="HOG000118217" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109586"
FT                   /db_xref="GeneID:4025468"
FT                   /translation="MAFNEDRLILNLTDSELEDLIKKWVACLKDSYVGFERPTQSADMG
FT                   RDAVGFLSPQRYDGEWHNYQCKHLKAPLGKADFTIELGKIFHYACRGEFTPPTKYIFVC
FT                   PNSAVRDVKKVIDRPSLIADFVVEHWDKYCLNGISKTASPLTPEIEAAIRAYAFEHVEL
FT                   WKASELVEQPRMRAVLNEHLDIDPGEAPRVHVDEVPEEVADEEMAYVTQLVAVFAAESG
FT                   TALADYAAVVVHATYGPQIVNARRRYLERKAFRRHFRDNLPANQIDNVDEDVHETVIDR
FT                   YHALERARLFERLNEVMSAASTVQITGPLGRHNRVTPSVKQGVCHHFANVGRMPWA"
FT                   /protein_id="YP_571873.1"
FT   gene            102034..102522
FT                   /db_xref="GeneID:4025469"
FT                   /locus_tag="Nham_4458"
FT   CDS_pept        102034..102522
FT                   /locus_tag="Nham_4458"
FT                   /gene_family="HOG000229160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative threonine efflux protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109587"
FT                   /db_xref="GeneID:4025469"
FT                   /translation="MSVLVTPPQLFNTPLEAGVRALLVLDAFAPQAFDLATLSLLDYYV
FT                   VHTGDAGGPPSIHPENAARAGEYFVRRHLVEEGLLLMARASLVEQVFGNDGITFQAHET
FT                   ATAMIDLFGSSYNRRLAEAARWLAEEATAQGNDWFFQKLRDSLERWSHEIVGGASDNG"
FT                   /protein_id="YP_571874.1"
FT   gene            102515..104383
FT                   /db_xref="GeneID:4025470"
FT                   /locus_tag="Nham_4459"
FT   CDS_pept        102515..104383
FT                   /locus_tag="Nham_4459"
FT                   /gene_family="HOG000118214" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109588"
FT                   /db_xref="GeneID:4025470"
FT                   /translation="MADRRRIIIDKLAFTGPERGPIEVSFQSGVNIIWGASNSGKSFVR
FT                   KSIDYLLGGDLPTLPPEGQGVDNYLLWLTLPGGRPVTLRASALGGDIYKAEGHLYAVDQ
FT                   NSPGYESFSRKHVTSPNISRFLLSQVGFREALLLKNERAEKSPFSLRLLMRYLLVDETR
FT                   MIDEKSLLLAYHIAITSEDKSLLKFLLTGIDGASIPQVRSGDQLKAAKEAKIELLSQMA
FT                   DQLRKLIDDTVETATVVAELTQAEREKAELLEVVNERQDSLDTLSAEERSLAADIRAYH
FT                   ARIAELKALIIRFDELASVYASDIERLDGLEEGGFLLQRFATINCPLCGALPQHQQHDH
FT                   GLGGIEEQRHAVELEIDKIRVEARDLAAAIADAKSEIDSVENLIAIAEQELERHRLARK
FT                   EAEQQEISARSIFKSASERCERFEVDLDNRQRLSELEQHVARINAESVRSRPRADGLDV
FT                   NLDLSTSEAHELSTAVRAVLTAWNYPGAQAVHFEKGDQDIVVDGKRRRDNGAGVRALLH
FT                   AAFKVGVLVYCIEKGRPHPGFIILDSPLLAYRPAEETRFGDLGDDDLALRNADVATHFY
FT                   RHLNGLSDKAQFIIVENHKSDQDVVKPYHNYQFTKNPQAGRIGLFV"
FT                   /protein_id="YP_571875.1"
FT   misc_feature    <103109..103825
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Nham_4459"
FT   gene            104409..105296
FT                   /db_xref="GeneID:4025471"
FT                   /locus_tag="Nham_4460"
FT   CDS_pept        104409..105296
FT                   /locus_tag="Nham_4460"
FT                   /gene_family="HOG000254357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109589"
FT                   /db_xref="GeneID:4025471"
FT                   /translation="MANRLFIIGNGFDLHHGIPSRYSQFGEYLLAVDPTAWQMINEYLY
FT                   VDEDFWACFEERLASFDEDAVINHAEQFLVGYGADDWSDAYHHDFEYEIEQVVDALSRK
FT                   LRDHFAAWIRQLPPPIPDTYSPVRCIDPGALYLTFNYTPTLEATYGVPSANVLHIHGNA
FT                   TIPSDQIVLGHGWERLEEEKLSPKVHEDTDTRVAGGYQLIDGYFSGTFKPTDDILCRNA
FT                   AFFSGITNIDEVLVLGHSLSDVDVAYLHEVIRSIRPYATWTVSYHGSPVGEVERMGRLG
FT                   VSPALSRFCPLSLL"
FT                   /protein_id="YP_571876.1"
FT   gene            105421..106866
FT                   /db_xref="GeneID:4025472"
FT                   /locus_tag="Nham_4461"
FT   CDS_pept        105421..106866
FT                   /locus_tag="Nham_4461"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109590"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="GeneID:4025472"
FT                   /translation="MTADAQHSVRITSGNPALTDLTLSWRTAEYGAEDGIGPMGSLHEA
FT                   GDALVAVARFEEDGVTILGSGVMVAPGMLLTATHVLDEFPADGPGPVFLTFLPSAKRAW
FT                   LPQDVRTISRPSIFDAERKISSDLSLVSCTLNSEAHAGLPLMLAPMQIALPLVGDRLWA
FT                   MGFRHQGIDKQAALVTPLVSSGLVTAAFPMGRGERMVSPCFEVAMETVGGMSGGAVVND
FT                   KGYLVGILSSSFEGGPSYVTLIWDAIRMRVRGSVPRLQVNDTVSVMGANEWGLAKIKGS
FT                   VERDPFGDVRIALSDDEMALFTTSLSRAEWTEVKTSALNREQLEDFEENWGRELEEAAV
FT                   EIVLQTLNGLPVSRIQEFLEDSDIPEDLLTAIEGFSVEDFDGLEDISITSTEAIDETRF
FT                   RLDYYFDIPSLIWTVEMDAGFADAHASSLDVRFFNRRVENGIARMEMAQRRYFRGSAIF
FT                   HRDAEIFTDATITLSAIKPRRKA"
FT                   /protein_id="YP_571877.1"
FT   misc_feature    105616..106122
FT                   /note="Trypsin-like serine protease; Many of these are
FT                   synthesized as inactive precursor zymogens that are cleaved
FT                   during limited proteolysis to generate their active forms.
FT                   Alignment contains also inactive enzymes that have
FT                   substitutions of the catalytic...; Region: Tryp_SPc;
FT                   cl00149"
FT                   /db_xref="CDD:153545"
FT                   /locus_tag="Nham_4461"
FT   gene            complement(107266..107400)
FT                   /db_xref="GeneID:4025473"
FT                   /locus_tag="Nham_4462"
FT                   /pseudo
FT   gene            107776..108690
FT                   /db_xref="GeneID:4025474"
FT                   /locus_tag="Nham_4463"
FT   CDS_pept        107776..108690
FT                   /locus_tag="Nham_4463"
FT                   /gene_family="HOG000250461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109591"
FT                   /db_xref="GeneID:4025474"
FT                   /translation="MIRFRRLKPVHLNSWLVDQGIPQTHQRYRLRVWREVHAALGPLRD
FT                   ELIAYVQEALDDARRRIRSGFQDDLSPFSGLVHDPAAHYPAMLNRISLQGYLGETLGVL
FT                   AVEHFGAIGYSNWMVPALLFRFHDQEFQHLDLINERLLAGEAHEPDADKEKRPGRTGDD
FT                   GLAFRVDENGVITDILTLEAKCLTTNNTGIMKDAHEKLMVGGNRPSGVRELINLLTEYD
FT                   TPEAEAWQQALLQFYRDGFRTAARHDGLAYAVGHSPKQPADRIAWLPPEAPHPAYTIQR
FT                   NLEAMEFQFENLDAVIDILYRGA"
FT                   /protein_id="YP_571878.1"
FT   gene            108692..112255
FT                   /db_xref="GeneID:4025475"
FT                   /locus_tag="Nham_4464"
FT   CDS_pept        108692..112255
FT                   /locus_tag="Nham_4464"
FT                   /gene_family="HOG000250462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109592"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="GeneID:4025475"
FT                   /translation="MANAATIAIAREIRENLAGQALTARQAKLYSQRLRRDMGRDDLAS
FT                   FGAGDIAGYLEEAMLLLESGWFERSADITSPWRTSIKRAAEIIEWLSQSRLKPPGAPLH
FT                   LLAAAAYQLADYPAMALGHLRRLPEGEPLSELLRQFVRADFPGAFQAAQTFWNNYRGLR
FT                   AEGRIDPNDLEVAAVQHTVMCVGTICAFLRTGGDVPVERAVIKLEALALGFLHSRDSYS
FT                   YLLARLTAASARRFIETCLWPQIDRLRLTSSGPAGNALIQFARSAFANKRALVWPAQAA
FT                   GIAKLRDNSSFVLCTPTGSGKTTVATLGAVQGLFADPPVGGAAGNLVLYLVPSRALAAE
FT                   VESRLAEDLRGIAAEPVVVTGLYGGVDWGPTDAWIQTDQPTVVICTFEKADALLRYLGV
FT                   LFLSRVRTVIIDEAHMVEQDEARLTGLGDGTSRAFRLEQLGTRLMRAREEHDFRIVALS
FT                   AVAARAAPALARWVSDAPDAIPTSSSYRSTRQMLGRLEVRPAGQFSIRYSLMDGHSLKF
FT                   DDERRDDSPFVPDPFPAVPGGINPQDGPEVRMRAPTLWAALNLAAKRPDGSLPSVLISL
FT                   TQNIDTFAATCADLLDKWQDTALPDYWAIEEDNEVWARCLATAIDYFTADSVEYRLLAR
FT                   GIVVHHGKMPGLLARRLKTVIDRGYVRVIIATSTLSEGVNIPVNFLLIPSVFRSNAELP
FT                   LQEFSNLIGRAGRPGVATEGSALVVLPERTYENRFRRIVPTYNRQWNGYESLVAQLEAA
FT                   TAAVGDLIPDDQASSPLGHLLRELEHAWKALVGGGTETEFTAWLEQTAVTEQAAYPPSS
FT                   HDYLDSLDAFLIAAIQEVEELRGIELDPAQLEAELAKIWRRTYAHAASHGEAHLATIWL
FT                   ARGRAVKTQYPDADQRRRLYKTSLTPRSAKLLLDRAEAIRVKLSEGRDYARWTTEEQFA
FT                   FIRDVLSFLSEIPVFAIETKLGRKKKFDDWPMLLRWWLAKPTLVRQPRPNEVTNWYAFV
FT                   ANNFIYRGTWGLGSVIGLLLDTTEDGQPIRALEITDWPMSGLPWIGFWLKELISWGTLD
FT                   PVAAFLLARGDAVDRPQAELDAKTYYESRPEGEDANAVLDPRTIRAWVEARQPARAARI
FT                   GTTTIAIKVECVRPVEAYRQQRLVVLPLVEADAIVWLDPAGYEVARSVKPGDWPEKPAL
FT                   LQFELLVAVSSVIGEPYLPHR"
FT                   /protein_id="YP_571879.1"
FT   misc_feature    109520..>110914
FT                   /note="Superfamily II RNA helicase [DNA replication,
FT                   recombination, and repair]; Region: COG4581"
FT                   /db_xref="CDD:34219"
FT                   /locus_tag="Nham_4464"
FT   misc_feature    109559..109969
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4464"
FT   misc_feature    109586..109600
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4464"
FT   misc_feature    109922..109933
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4464"
FT   misc_feature    110567..110818
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Nham_4464"
FT   misc_feature    <110585..>111571
FT                   /note="Superfamily II helicase [General function prediction
FT                   only]; Region: COG1204"
FT                   /db_xref="CDD:31397"
FT                   /locus_tag="Nham_4464"
FT   gene            complement(112568..112813)
FT                   /db_xref="GeneID:4025476"
FT                   /locus_tag="Nham_4465"
FT   CDS_pept        complement(112568..112813)
FT                   /locus_tag="Nham_4465"
FT                   /gene_family="HOG000077272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109593"
FT                   /db_xref="GeneID:4025476"
FT                   /translation="MIHTAHTKIVADELHTRYDHARAVTLISRTLQKALFAGRSDEVVF
FT                   WALVHAHYRGGGLCDATEEQLHAFSDFIVRDPTEIN"
FT                   /protein_id="YP_571880.1"
FT   gene            complement(112846..113469)
FT                   /db_xref="GeneID:4025477"
FT                   /locus_tag="Nham_4466"
FT   CDS_pept        complement(112846..113469)
FT                   /locus_tag="Nham_4466"
FT                   /gene_family="HOG000271290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="autoinducer synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109594"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="GeneID:4025477"
FT                   /translation="MLMVIPGSDISRHAALMDRAFRFRHTVFVDEKGWEDLRQPDGRER
FT                   DRFDDAHAIHHICLRGDDIVGYQRLLPTTRPHLLSDVLTDLCRHRPPRGPRVYEWTRFS
FT                   VAPGRREMRPHGDAPFLELALGVVEWGMVNKVDTVTVAIDWRLMVIAMQLRFFVRTLGF
FT                   PKRVGRDEAVALRMSFNRETLAAIRQARGCDDRVLPDAMLPTAA"
FT                   /protein_id="YP_571881.1"
FT   misc_feature    complement(112861..113469)
FT                   /note="Lysophospholipid acyltransferases (LPLATs) of
FT                   glycerophospholipid biosynthesis; Region: LPLAT; cl00357"
FT                   /db_xref="CDD:176926"
FT                   /locus_tag="Nham_4466"
FT   gene            113545..113916
FT                   /db_xref="GeneID:4025478"
FT                   /locus_tag="Nham_4467"
FT                   /pseudo
FT   gene            complement(113996..114313)
FT                   /db_xref="GeneID:4025479"
FT                   /locus_tag="Nham_4468"
FT   CDS_pept        complement(113996..114313)
FT                   /locus_tag="Nham_4468"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109595"
FT                   /db_xref="GeneID:4025479"
FT                   /translation="MNNGCLFAKGWRRPLINAFEPAVRNGNCEALLAGAALARTEDDRP
FT                   DVVGDRPDQIGSTVVAVGRLEALASGMAAREGDDPLEGLQRSRQPDPAGVTPNSSLEHV
FT                   Q"
FT                   /protein_id="YP_571882.1"
FT   gene            114574..114750
FT                   /db_xref="GeneID:4025480"
FT                   /locus_tag="Nham_4469"
FT   CDS_pept        114574..114750
FT                   /locus_tag="Nham_4469"
FT                   /gene_family="HOG000141016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109596"
FT                   /db_xref="GeneID:4025480"
FT                   /translation="MSHNLALAQNHAFDLARTLMVPVVLFQVDNEFGVMVSSEYDGEED
FT                   AIVHEYDPWCPAH"
FT                   /protein_id="YP_571883.1"
FT   gene            114957..115883
FT                   /db_xref="GeneID:4025481"
FT                   /locus_tag="Nham_4470"
FT   CDS_pept        114957..115883
FT                   /locus_tag="Nham_4470"
FT                   /gene_family="HOG000274248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109597"
FT                   /db_xref="GeneID:4025481"
FT                   /translation="MEKKDIEELRAKVACAAVLEKDGWKIDLKESTRRALKYRRDANII
FT                   IVIHEGRGWFDPLSPAKGDVFDLVEHLGASGFPEACDRVAALVGFVPSSPVWTRVSRPP
FT                   ALTSVADRWACRTVPRPGSATWRYLADLRCIPDTIIAAAVVQGRLREGPQGSMWAAHDD
FT                   LAGRVIGWEERGPRWRGFATDGTKELFRFGPIGAQRICITEAAIDALSLAAIEVLRDDT
FT                   LYVSTGGGWSPATDEAIRGLAGRVNTRLVAATDNNRQGDVYADRIRAIAAEATALYARS
FT                   RPRAGDWNEDLKVLVMRLEIEPVAASG"
FT                   /protein_id="YP_571884.1"
FT   misc_feature    115551..115769
FT                   /note="Topoisomerase-primase domain. This is a nucleotidyl
FT                   transferase/hydrolase domain found in type IA, type IIA and
FT                   type IIB topoisomerases, bacterial DnaG-type primases,
FT                   small primase-like proteins from bacteria and archaea, OLD
FT                   family nucleases from...; Region: TOPRIM; cd00188"
FT                   /db_xref="CDD:173773"
FT                   /locus_tag="Nham_4470"
FT   misc_feature    order(115566..115571,115578..115580,115719..115721,
FT                   115725..115727,115731..115733)
FT                   /note="active site"
FT                   /db_xref="CDD:173773"
FT                   /locus_tag="Nham_4470"
FT   misc_feature    order(115566..115568,115719..115721)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173773"
FT                   /locus_tag="Nham_4470"
FT   gene            116016..116429
FT                   /db_xref="GeneID:4025482"
FT                   /locus_tag="Nham_4471"
FT   CDS_pept        116016..116429
FT                   /locus_tag="Nham_4471"
FT                   /gene_family="HOG000075861" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109598"
FT                   /db_xref="GeneID:4025482"
FT                   /translation="MALRTIETTYRLPVFRHKTYEAETLAQACRLAIEDDNWDDEKRDY
FT                   ESAGEVYVTGIWSGPDAAYSGASQSIPSHYTETHQRIVQHFEVLLGLVKVLAKQDQESP
FT                   DPNFWREPAQPAIAKAEAILAGARDPDIVGDAP"
FT                   /protein_id="YP_571885.1"
FT   gene            116426..116689
FT                   /db_xref="GeneID:4025483"
FT                   /locus_tag="Nham_4472"
FT   CDS_pept        116426..116689
FT                   /locus_tag="Nham_4472"
FT                   /gene_family="HOG000124938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109599"
FT                   /db_xref="GeneID:4025483"
FT                   /translation="MTGYIVKIGFWLRAYHSVSIEAESDAEAIEKAKAAAKSAMDSTAQ
FT                   PEHIDVDERREGIIAFIDRITPGGREVVIEDVAFDDDRIHPA"
FT                   /protein_id="YP_571886.1"
FT   gene            116867..117355
FT                   /db_xref="GeneID:4025484"
FT                   /locus_tag="Nham_4473"
FT   CDS_pept        116867..117355
FT                   /locus_tag="Nham_4473"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109600"
FT                   /db_xref="GeneID:4025484"
FT                   /translation="MTGKAWLHPTASPTQRGQERKAMCRVLNEHHAGVPAGAVYIGRGS
FT                   KWGNPFRIGPDGDRAAVIAKHERWLADQHDLLRALDELRGRDLVCFRAARVPRRSPASS
FT                   RKCVERRTDRVVARRDGRCVNARGRAFHEIGKERRNMKSLPHARPTRQGCAAPACRGP"
FT                   /protein_id="YP_571887.1"
FT   gene            117468..118073
FT                   /db_xref="GeneID:4025485"
FT                   /locus_tag="Nham_4474"
FT   CDS_pept        117468..118073
FT                   /locus_tag="Nham_4474"
FT                   /gene_family="HOG000274249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109601"
FT                   /db_xref="InterPro:IPR009862"
FT                   /db_xref="GeneID:4025485"
FT                   /translation="MHTSPTIRKIFEGVATRPDMYRMFNRHRGDPAVAEGDAQHLFAGE
FT                   WFEIAEREHDYMLEILPPLWMRTDMFAMREFMTGNVTSVFFALWIDGRKRFFHGYCDLS
FT                   DRRSPECMKQVIVDRECRPIRAMTREERLEHIWSSTHDDYRGYASERWAVHLRGKRTVL
FT                   LYGGPLGTVLKLLGDLTEAEISAKLPVHLRHLPDAVAA"
FT                   /protein_id="YP_571888.1"
FT   misc_feature    117474..117803
FT                   /note="Protein of unknown function (DUF1419); Region:
FT                   DUF1419; pfam07215"
FT                   /db_xref="CDD:148677"
FT                   /locus_tag="Nham_4474"
FT   gene            118090..118284
FT                   /db_xref="GeneID:4025486"
FT                   /locus_tag="Nham_4475"
FT   CDS_pept        118090..118284
FT                   /locus_tag="Nham_4475"
FT                   /gene_family="HOG000274207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109602"
FT                   /db_xref="GeneID:4025486"
FT                   /translation="MQGAYDRLRVHVFASWRDVVRAANTRIARKHRRGAAMREARKRFY
FT                   REMLGCHQRHQELVLTFRL"
FT                   /protein_id="YP_571889.1"
FT   gene            118388..123499
FT                   /db_xref="GeneID:4025487"
FT                   /locus_tag="Nham_4476"
FT   CDS_pept        118388..123499
FT                   /locus_tag="Nham_4476"
FT                   /gene_family="HOG000229061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109603"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="GeneID:4025487"
FT                   /translation="MTQKDPFTLDLFNNTSLSSGLGLGVTAFATSVEGEDPDRDPSSPS
FT                   SPAISPMTVVQSETARVAGENFYLADSRGLAASWRDRARDNLVAIRLAADLEAEQHPAT
FT                   SDEQAQLIRFTGFGASELANGVFRRPGEDGFRKGWEVIGQQLVELVGTADYASLARCTQ
FT                   YAHFTPEYIARAVWAGALRLGFRGGRVLEPGIGTGLFPALMPKALRDVSHVTGVELDPI
FT                   TTRIAKLLQPRAMIVNEDFARSSLKQHFDLAIGNPPFSDRTVRSDRAFRSLGLRLHDYF
FT                   IVKAIDRLKPGGIAAFVTSHGTLDKADATAREQIAAMADLLGAIRLPEASFRADAGTDV
FT                   VVDILFFRKRRNGETVANDAWLDLSEVRAATEDEGAIRVNRYFAERPDMVLGEHALRRG
FT                   VYGPDETYTCLSRVGSDLETALTAAVLQLPEAVYDGEPEAVRSDHAEPSAATGREPQAS
FT                   AVREGSYFVGTNGALMQVVDGVAVTITVRKGRSTDGIFEKHARIIRKLIPIRDAVREIL
FT                   KCQETDQPWKQAQVRLRIAWSSFVRNFGPINTTVVSSTEDDETGEVRETHRRPNLAPFT
FT                   DDPDCWLVASIEDYDLETDTAKPGPIFTERVIAPPPAPIITSAIDALAVVLNERGAVDP
FT                   DHVAELLHRESDDVIAELGDAIFRDPETGAWQTADAYLSGAVRSKLVAAQAAAKLDPIF
FT                   ARNAAALERVQPADLKPSDITARLGAPWIPATDIIAFVKETMEADITIHHTPELACWTV
FT                   NARQLSWTAAGTTEWGTHRRHAAELLSDALNSSVPQIFDIVKDGDSERRILNTVDTEAA
FT                   KEKLQKIKTAFQGWIWADPDRTDRLARLYNDTFNNIVPRHFDGSHLQLPGASGAFSLYG
FT                   HQKRVIWRIIASGATYVAHAVGAGKTLSIAAAIMEQRRLGLINKAMLVVPGHCLAQAAR
FT                   EFLALYPNARILVADETNFVKEKRHRFLSRAATANWDAIIITHSAFKFIPVPSVFEQQI
FT                   LQDELEAYEELLTRIDSQDRLSRKRVERMKEGHKERLEALASRKDDLLTISEIGVDQII
FT                   VDEAQEFRKLSFATNMTSLRGVDPNGSQRAWDLYVKSRFIDMKNPGRALVLASGTPITN
FT                   TLGEMFTVQRLMDRAALEVRGLHEFDAWASTFGDTSTELELQPSGKYRPVTRFAQFVNV
FT                   PELIAMFRSFADVVLPDDLRAFVKVPTIASGKRQIITAQPTAAFKAYQRLLDERITAIE
FT                   ERDRAPEPGDDILLSVITDGRHAAIDLRLVDSTQDNEEGNKLNALIANAFRVWQETGHH
FT                   TFRLKDGQPFEKPGAGQLIFSDLGTISVEASRGFSAYRWIRNELVRLGVPAPEIAYMQD
FT                   HKKSEAKQRLFNDFNAGKVRILLGSSDTMGTGVNVQLRLKALHHLDVPWLPSQIEQREG
FT                   RIVRQGNQHDEVDVFAYATLGSLDATMWQNNERKARFIAAALSGDTSVRRLEDLGEGQA
FT                   NQFAMAKAIASGDPRLMQKAGLEAEIARLERLRAAHIDDQHAIRRQIRDAGREIELATR
FT                   RIGEVGQDIERFIPTAGDTFAMSVKGQHFAERKLAGRAVMQEVLTLVQLQHDGDIAIAS
FT                   IGGFELRFEGQRLGHDGYTYTTMLQRTGAVFEIELSMTVSPLGAVARLEHALSNFHGEQ
FT                   ETYRRRLLDAQKRRATFSARVGEAFAFDAELGLKREALVALEADLAASGAEGEKEKPGV
FT                   AKRIAA"
FT                   /protein_id="YP_571890.1"
FT   sig_peptide     118388..118492
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.748 at
FT                   residue 35"
FT                   /locus_tag="Nham_4476"
FT                   /product="hypothetical protein"
FT   misc_feature    118580..119425
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Nham_4476"
FT   misc_feature    119522..121165
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Nham_4476"
FT   misc_feature    <120935..>121414
FT                   /note="ATP-dependent DNA helicase RecG; Region: recG;
FT                   TIGR00643"
FT                   /db_xref="CDD:161975"
FT                   /locus_tag="Nham_4476"
FT   misc_feature    <121529..122158
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Nham_4476"
FT   misc_feature    <122420..122611
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Nham_4476"
FT   gene            123748..125430
FT                   /db_xref="GeneID:4025488"
FT                   /locus_tag="Nham_4477"
FT   CDS_pept        123748..125430
FT                   /locus_tag="Nham_4477"
FT                   /gene_family="HOG000000664" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid partitioning protein"
FT                   /transl_table="11"
FT                   /note="ParB family"
FT                   /db_xref="GI:92109604"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:4025488"
FT                   /translation="MRLMTVDPRALKPNPDPTRRTPATPQADALLLATIKAVGIVQPPI
FT                   ISPQQDGGNSFYIQYGHRRVSQAIAADLAEIEVLVADPETDKDALRALVENVAREGMNP
FT                   VDLWRSIERLVGLGWTEESIAIALAQSVRQVRKLRLLANVLPAMLDQMARGDMPSEQQL
FT                   RIIAAAADEEQGEVWKKHKPKKGQPTVSWSEVARALTRTRMYARDASFDDDLAKAYGIV
FT                   WQEDLFAPANEDSRYTTDVEAFLGAQHEWMANHLPKRGAIIEVNEWGQPKLPAKAERVY
FT                   GKPGKSDHVGMYLDRSGKVETVAYRVPKPDKKTKGAPAESDDAAAVAKPRPDVTRKGCE
FT                   MIGDIRTDALHEALGRAPIEEDTLLALLVLAFAGQNVSIASGASDNPYGHARVERHVVR
FT                   LISQEGKLDFDRETLHQVARSVLSDVLSCRENRSDSGVIARIAGEAIGADAFLPNMGTE
FT                   EFLSCLSRSALEGACAGTSVLPRPRVKDTRAELVKHFADGQFVHPSALFAPPLETVTAW
FT                   VGRFSGDTDPDDERDGPSDESDAQAEDTGADDDTPAGFAEAAE"
FT                   /protein_id="YP_571891.1"
FT   misc_feature    123748..124794
FT                   /note="plasmid partitioning protein; Provisional; Region:
FT                   PRK13832"
FT                   /db_xref="CDD:172359"
FT                   /locus_tag="Nham_4477"
FT   misc_feature    123763..124038
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Nham_4477"
FT   gene            125517..125990
FT                   /db_xref="GeneID:4025489"
FT                   /locus_tag="Nham_4478"
FT   CDS_pept        125517..125990
FT                   /locus_tag="Nham_4478"
FT                   /gene_family="HOG000274250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109605"
FT                   /db_xref="GeneID:4025489"
FT                   /translation="MSAQSIYDQAPIGALIRYSDGTPRPPQRFKNKLAAWESNNNVGRL
FT                   VRKAESHTIGNHTTPASFTLHQGDFGSAGVVVLKVFKTFSVGSPLAFTIVERPAPGMVR
FT                   VLDRTGGRAELLHLAADRAAAQAWLASHRYSDAVLDEVIDDDTAAGSGEGRAA"
FT                   /protein_id="YP_571892.1"
FT   gene            125987..126859
FT                   /db_xref="GeneID:4025490"
FT                   /locus_tag="Nham_4479"
FT   CDS_pept        125987..126859
FT                   /locus_tag="Nham_4479"
FT                   /gene_family="HOG000274251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109606"
FT                   /db_xref="GeneID:4025490"
FT                   /translation="MTAPRTCDQANHPTPAAAGVLFTRTHDGLLVAKIRDNAFAMMPAR
FT                   NDRYYLASAWRLSRPMEEWSRGDFYGHGGELADEAAFRARVHENAEHQRQRAALGRREI
FT                   RSGANTPWGASQCVTVYADGVVSHSTAGHGGFHLDAARNAKVHPAFRARGGWYEEDCAW
FT                   ATVAQAFPELFTDFERRCADQTIRDWYPDAWETIHGRPLLPGESHEKDRQAFERDHASD
FT                   WIVISAIRSDHHRGMTECVATLGGDRRAAEQRRYLVPSDEYHLGRFGFVINEARHRLYG
FT                   GPSNFVGWR"
FT                   /protein_id="YP_571893.1"
FT   gene            126856..127314
FT                   /db_xref="GeneID:4025491"
FT                   /locus_tag="Nham_4480"
FT   CDS_pept        126856..127314
FT                   /locus_tag="Nham_4480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109607"
FT                   /db_xref="GeneID:4025491"
FT                   /translation="MTHALAPHRQSLRLAHGHRRGRRDAHPRRLASPPQTAFYRFRSLE
FT                   ARRASVYPRAATLPGRRRQKGDSVMKAYLVAVNLLVQAHHRPESAIADALNGILTPDMH
FT                   KHAGSNSALIDWAIAGDDIASSIAGVSFSDDYMPGVSAFPLWPTGTVR"
FT                   /protein_id="YP_571894.1"
FT   gene            127311..127718
FT                   /db_xref="GeneID:4025492"
FT                   /locus_tag="Nham_4481"
FT   CDS_pept        127311..127718
FT                   /locus_tag="Nham_4481"
FT                   /gene_family="HOG000274254" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109608"
FT                   /db_xref="GeneID:4025492"
FT                   /translation="MNELPERRVLLARMEVAQAETQRHLGIIERQIAARAERLTITDRA
FT                   KRRHHGRGASNWTNADERLFQEHVAELTLARRVEIDALTRKLERQDQAIAEFRSRQHAY
FT                   AAWRSAAEAPGSSGCERNVRTLGADEEGSPV"
FT                   /protein_id="YP_571895.1"
FT   gene            128030..128617
FT                   /db_xref="GeneID:4025493"
FT                   /locus_tag="Nham_4482"
FT   CDS_pept        128030..128617
FT                   /locus_tag="Nham_4482"
FT                   /gene_family="HOG000274255" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109609"
FT                   /db_xref="GeneID:4025493"
FT                   /translation="MTKTARSPRASARVIPLRRATTLEMVRLACPDSAQALRISESFGL
FT                   AILDSDGIRDLHERLIVETADALKDGLSDRAMEIHLQRIVGSYVGSAHGAGQFYSRAVT
FT                   EARDATAKLANDLRDEDLDGPVGFDSQSQRKREFAADMGLQAHALRMAAEGAVAAYEQV
FT                   IGEAWKPFERQIEHAGETVTKKAAVAQMAAFE"
FT                   /protein_id="YP_571896.1"
FT   gene            128906..129832
FT                   /db_xref="GeneID:4025494"
FT                   /locus_tag="Nham_4483"
FT   CDS_pept        128906..129832
FT                   /locus_tag="Nham_4483"
FT                   /gene_family="HOG000141063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArdC gene in pSa(IncW plasmid)-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109610"
FT                   /db_xref="GeneID:4025494"
FT                   /translation="MSRKEDNPRADIYARITDRIVADLERGVRPWVKPWNAANAAGRIT
FT                   RPLRHNGMPYQGINVVLLWSEAVARGFTSPIWMTFKQSLELGGHVRKGESGTMVVYANK
FT                   ITKTETDEHGDEVERAIPFLRAYTVFCVDQIENLPDHYYGRPAPSIAPAQRLAQVDAFF
FT                   ANTDATIRHGGDKAFFAPSLDLIQMPPFESFRDAESYAATLAHECVHWTAPAHRANRDL
FT                   SRYAKDRSERAREELVAELGACFLSADLGIVPELEPRADHASYLASWLEVLSNDKRFIF
FT                   SAAALAQRAVAYLHDLQPKPAEIDEAA"
FT                   /protein_id="YP_571897.1"
FT   misc_feature    128906..129814
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /db_xref="CDD:33952"
FT                   /locus_tag="Nham_4483"
FT   misc_feature    128930..129295
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /db_xref="CDD:149455"
FT                   /locus_tag="Nham_4483"
FT   gene            130464..130814
FT                   /db_xref="GeneID:4025495"
FT                   /locus_tag="Nham_4484"
FT   CDS_pept        130464..130814
FT                   /locus_tag="Nham_4484"
FT                   /gene_family="HOG000140892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109611"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="GeneID:4025495"
FT                   /translation="MVAARETKESTNMATIGNFTVNGNGFVGTVKTLALGTVKAKIVPA
FT                   ERSSDKAPDYRIFAGTIEFGAAWKKKSQEQNRDYLSVKLDDPSFPAPIYATLVEVEGEE
FT                   GHSLIWSRPNRD"
FT                   /protein_id="YP_571898.1"
FT   misc_feature    130554..130808
FT                   /note="Protein of unknown function (DUF736); Region:
FT                   DUF736; cl02303"
FT                   /db_xref="CDD:154848"
FT                   /locus_tag="Nham_4484"
FT   gene            130997..132019
FT                   /db_xref="GeneID:4025496"
FT                   /locus_tag="Nham_4485"
FT   CDS_pept        130997..132019
FT                   /locus_tag="Nham_4485"
FT                   /gene_family="HOG000251882" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="luciferase-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109612"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="GeneID:4025496"
FT                   /translation="MKKIGFLSFGHWTPSSQSQTRSAADALLQSIDLAVAAEALGADGA
FT                   YFRVHHFARQLASPFPLLAAVGAKTSRIEIGTAVIDMRYENPHYMVEDAGAADLIAGGR
FT                   LQLGISRGSPEQVIDGWRYFGYQPAEGQSDADMGRRHAEVFLDLLRGEGFAQPNPRPMF
FT                   SNPPGLLRVEPHSDGLRGRIWWGASSNATAIWAAKLGMNLQSSTLKNDETGEPFHMQQA
FT                   AQIRAFRAAWKETGHIREPRVSVSRSIFALLDDRDRAYFGRGGEEKDQVGFIDEKTRAI
FT                   FGRSYAAEPDVLIEQLKTDEAIAEADTLLLTAPNQLGVAYNTHVIEAILAHVAPALGWR
FT                   "
FT                   /protein_id="YP_571899.1"
FT   misc_feature    131006..>131386
FT                   /note="Flavin-utilizing monoxygenases; Region:
FT                   Flavin_utilizing_monoxygenases; cl07892"
FT                   /db_xref="CDD:174883"
FT                   /locus_tag="Nham_4485"
FT   misc_feature    131132..132001
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="Nham_4485"
FT   gene            complement(132038..132316)
FT                   /db_xref="GeneID:4025497"
FT                   /locus_tag="Nham_4486"
FT   CDS_pept        complement(132038..132316)
FT                   /locus_tag="Nham_4486"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109613"
FT                   /db_xref="GeneID:4025497"
FT                   /translation="MCFHHGVASVVSTVIFNIKYGGYGGTMPAVTLSATPKGNGYQATV
FT                   TFLDGVSMSSAETYPTIAEAIAAGARKLLDTPERLEALDRSEAARVF"
FT                   /protein_id="YP_571900.1"
FT   gene            complement(132456..132674)
FT                   /db_xref="GeneID:4025498"
FT                   /locus_tag="Nham_4487"
FT   CDS_pept        complement(132456..132674)
FT                   /locus_tag="Nham_4487"
FT                   /gene_family="HOG000066805" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109614"
FT                   /db_xref="GeneID:4025498"
FT                   /translation="MLKLSPQKFAPELVSTMRSVLNVAVDQIDAAHRTPATKAKMAERI
FT                   LRTAAEGVTEAQDFITVAIEEGKQPAD"
FT                   /protein_id="YP_571901.1"
FT   gene            133163..134437
FT                   /db_xref="GeneID:4025499"
FT                   /locus_tag="Nham_4488"
FT   CDS_pept        133163..134437
FT                   /locus_tag="Nham_4488"
FT                   /gene_family="HOG000296073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109615"
FT                   /db_xref="GeneID:4025499"
FT                   /translation="MKNLIVCCDGTGNEIGENISNVLKLYRVLRKTDKTDPRQIAFYDP
FT                   GVGTLARPNPWTKLKQDTVTVLGLATGYGLDDNVLKAYRFLINNYEEGDDIFLFGFSRG
FT                   AYTVRVLAGLIHKVGLLAPQQCNLADAALTAYKQANSTIVERDEQKGPDNTSVDTEDER
FT                   QAPPAARDDPASQFARIVSTRWPTIKFLGVWDTVASVIVPRPDRFYAFSLQKLSFTQVN
FT                   PSVKVFRHAIAIDERRRMLRLEPWKETQTFMHNRFSATNNAEPQDSLQVWFAGVHADIG
FT                   GGYAEKESGLSKFPLLWMIEEAVKYGLTVSRQTVNQLAWGIQRRGSPFSYVAPDIRRDP
FT                   HQSMTLAWRSLEWIPKADRFKEWKDRRSWLRHYIPSAEPRVIPDGAYIHESVIDRMKAV
FT                   PAYSPINLPSSCEVIPLPSGSDVLR"
FT                   /protein_id="YP_571902.1"
FT   misc_feature    133166..134071
FT                   /note="Uncharacterized conserved protein (DUF2235); Region:
FT                   DUF2235; cl01480"
FT                   /db_xref="CDD:154426"
FT                   /locus_tag="Nham_4488"
FT   gene            complement(134519..135442)
FT                   /db_xref="GeneID:4025500"
FT                   /locus_tag="Nham_4489"
FT   CDS_pept        complement(134519..135442)
FT                   /locus_tag="Nham_4489"
FT                   /gene_family="HOG000041624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109616"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="GeneID:4025500"
FT                   /translation="MKNLQLGARTVADIDAQVAKVLRGLGNPEPPIDLAVVRDLLRLDR
FT                   YYYSTTDDGLLSETISRLKVAGLQVLLRPTLLKEAVRSLSLKALYLPDQKRILIDKDLP
FT                   KLKHRWNEAHEVGHDIIPWHEGMMLGDTEQTLTPTCHAIMEAEANYAAGQLLFLAERFR
FT                   SDACDSEPSLGHIRQLSERFGNTMTSTLWRFIEQGHRGRPMVALVTGHPHQIKRKADFD
FT                   PANPCRYCVQSPAFVQRFGGLGEVDLFRVVTSYAGAQRGGGLGAKEVILADASDERHLF
FT                   KFETFFNGHEALTLGHWLRATPKPAV"
FT                   /protein_id="YP_571903.1"
FT   misc_feature    complement(<134849..>135184)
FT                   /note="Domain of unknown function (DUF955); Region: DUF955;
FT                   cl01076"
FT                   /db_xref="CDD:154183"
FT                   /locus_tag="Nham_4489"
FT   gene            complement(135439..135939)
FT                   /db_xref="GeneID:4025501"
FT                   /locus_tag="Nham_4490"
FT   CDS_pept        complement(135439..135939)
FT                   /locus_tag="Nham_4490"
FT                   /gene_family="HOG000041649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109617"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4025501"
FT                   /translation="MRIERSKQWWLDRARLEGADVIGAGLAARDPVLDDRPIAGVSAPR
FT                   EEARIAFGRFINLMRRQRGFSMERLAEEAELDASELLVIEGDVHYIPEPRTVYRLAQTF
FT                   NVSQQRLMQLAGLSAANDSGLSQEAVRFAARSESVQKLSREENAALDAFVAVLSRQDVK
FT                   QSK"
FT                   /protein_id="YP_571904.1"
FT   gene            complement(135945..136565)
FT                   /db_xref="GeneID:4025502"
FT                   /locus_tag="Nham_4491"
FT   CDS_pept        complement(135945..136565)
FT                   /locus_tag="Nham_4491"
FT                   /gene_family="HOG000041650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109618"
FT                   /db_xref="GeneID:4025502"
FT                   /translation="MTEISTIYLLDGVSGQGVEAELRDAIEEAQLGDWQTQWQPALIKV
FT                   LQELRRKGVPMAQWPQSWHWDWREKTARVQGFLAFPGFCIVCGGVTQGLMLLDLRKVAR
FT                   EPSQTGKPLVYVDYLEVAPWNRPDLEQRPQLKGVGMALLTAAIALSEQEGYRGRIGLHS
FT                   LPQSEAFYRDRCRMSDLGPDGAYQNLRYFEMTAERARSFLGEE"
FT                   /protein_id="YP_571905.1"
FT   gene            complement(136562..136774)
FT                   /db_xref="GeneID:4025503"
FT                   /locus_tag="Nham_4492"
FT   CDS_pept        complement(136562..136774)
FT                   /locus_tag="Nham_4492"
FT                   /gene_family="HOG000041651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CopG-like DNA-binding"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109619"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="GeneID:4025503"
FT                   /translation="MTAKKTMTLNLTDAEMRVLDELSARKDLTKTAVIRQALRLYQTVE
FT                   ARLERGEKFLFENDTTKEKAELMLL"
FT                   /protein_id="YP_571906.1"
FT   gene            136934..137899
FT                   /db_xref="GeneID:4025504"
FT                   /locus_tag="Nham_4493"
FT   CDS_pept        136934..137899
FT                   /locus_tag="Nham_4493"
FT                   /gene_family="HOG000236821" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase, beta-like region"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109620"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="GeneID:4025504"
FT                   /translation="MGRQHVGHSEIATFAQDKVNLPKVKADEYRAQARRLREKLEGYLG
FT                   EHPDFTLKKMMLSGSLAKGTALRSLNDIDVACYVSGADAPKDVRALLDYLAERLRNAFP
FT                   NFSPDQVQPQTYSVTVSFRGTGLDVDVVPILYDGDPQWYGNLISQDDGSFLKTSIPLHL
FT                   DFAAKRKRAQEKHFAQVVRLAKFWARRMKQERDGFRFKSFMIEMILAKLCDDGLDFSDY
FT                   PEALQHFFTYIARTDFRQRIVFGDYYAVSSVGTFSDTVQIIDPVNAVNNVARLYTMANA
FT                   DAIVDAAIDAGDAVDAALAAPNKQLTVAYWQKVFGSSFQA"
FT                   /protein_id="YP_571907.1"
FT   misc_feature    137006..137440
FT                   /note="Nucleotidyltransferase (NT) domain of
FT                   2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
FT                   CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
FT                   cd05400"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="Nham_4493"
FT   misc_feature    order(137105..137113,137120..137122,137126..137134,
FT                   137147..137149,137153..137155,137270..137275,
FT                   137282..137284,137321..137323,137393..137395,
FT                   137405..137407,137417..137419)
FT                   /note="active site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="Nham_4493"
FT   misc_feature    order(137108..137113,137147..137149,137153..137155,
FT                   137273..137275,137393..137395,137405..137407,
FT                   137417..137419)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="Nham_4493"
FT   misc_feature    order(137147..137149,137153..137155,137321..137323)
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143390"
FT                   /locus_tag="Nham_4493"
FT   gene            137909..138424
FT                   /db_xref="GeneID:4025505"
FT                   /locus_tag="Nham_4494"
FT   CDS_pept        137909..138424
FT                   /locus_tag="Nham_4494"
FT                   /gene_family="HOG000236820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109621"
FT                   /db_xref="GeneID:4025505"
FT                   /translation="MSYSLSYTESSTFTVTHARHMVAKVATDLKRMQRFYGSPSDESIT
FT                   NYEAEATEMIRAGYLGTVTYGFRKDGNWIEPTLRYTARDLAGASANDDDPGRIRPGADI
FT                   SGASFYSYMTYSAAWDQLTQTQRDAFKATLPFSRNGAAEPGVSGYLDNDHSYSSGGRAL
FT                   DRACVRSF"
FT                   /protein_id="YP_571908.1"
FT   gene            138424..139371
FT                   /db_xref="GeneID:4025506"
FT                   /locus_tag="Nham_4495"
FT   CDS_pept        138424..139371
FT                   /locus_tag="Nham_4495"
FT                   /gene_family="HOG000236819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase, central region"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109622"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="GeneID:4025506"
FT                   /translation="MNTKPTLDELFERRITYPDFEPQSRLARLVGLDDQKSRLAKILGL
FT                   LVNPSGLAEWAQRHHPGTQALLDAVLRRPPLVVLAGDVGSGKTELAETIGDAVARQEKI
FT                   DITLLPLSLSTRGQGRVGEMTQLLSAAFDYTVAEASRLKSASGKARGAVILLVDEADAL
FT                   AQSRETAQMHHEDRAGVNAFIRGIDRIANAKLPAAVLMCTNRLSALDPAVRRRAADVLS
FT                   FARPGDEQRRFVLSSRLEPIGLGRHHIDALVIATGPQRSARDYGFTFSDLTQRLLPSIV
FT                   LDAYPSRPVNGARAVEIAKAMTPTPPFRDGEPVA"
FT                   /protein_id="YP_571909.1"
FT   misc_feature    138640..139080
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Nham_4495"
FT   misc_feature    138652..139083
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Nham_4495"
FT   gene            139382..140920
FT                   /db_xref="GeneID:4025507"
FT                   /locus_tag="Nham_4496"
FT   CDS_pept        139382..140920
FT                   /locus_tag="Nham_4496"
FT                   /gene_family="HOG000121051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109623"
FT                   /db_xref="GeneID:4025507"
FT                   /translation="MTQAVTVRRDGDTFQARIFWLHAARLLDPQSPVTRVGFETGPKSF
FT                   DDIWVEYDPARSALDQYGDPLRREHMQCKWHVTPDSYGYSHLVDPEFINANARSLLQRA
FT                   REAQLAYAPAGIGVRFKLVTNWRLDRADPLREMVGNRSGAMRLDRLYGSLTDNSKAGAV
FT                   RKAWREHLDIDEEELRLLARTLAFGEATDTLDALRDHLDILFGLVGLRRIPANQSAFPY
FT                   DDVVFQWMAQGRLNFDRAAFRAICAREDLLGPAQSARRVYGIKSFEHAFDRLEERCHSV
FT                   LDLIPAFDERYIRSDSDWETILYPALRTFLLAAAKDPPRLRLALDAHVTLAFAAGSIIN
FT                   IKSGRQVELEQRSTSRRVWAADDAISDPSWPPLIAESIELRPNQPDLAVALGLTHDVSA
FT                   DVRRYCEAKLPDVGRLLILKPSTGSGAQAVACGRHAFELADGAIDAVRSARAEGTRLTH
FT                   LFIAAPNAFTFFLGQRQTALGSVRLYEFDFDGGRGRSYAPALTLPLAPPTKKAI"
FT                   /protein_id="YP_571910.1"
FT   gene            140955..141190
FT                   /db_xref="GeneID:4025508"
FT                   /locus_tag="Nham_4497"
FT                   /pseudo
FT   gene            141250..141699
FT                   /db_xref="GeneID:4025509"
FT                   /locus_tag="Nham_4498"
FT   CDS_pept        141250..141699
FT                   /locus_tag="Nham_4498"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109624"
FT                   /db_xref="GeneID:4025509"
FT                   /translation="MQAWLLQLRRRGVTVLVVHHAGRGGNARGTSKREDVLDTVIQLKH
FT                   PEDYDPAEGARFEVHLTKARGVFGEDALAFEAKLELDDEGAARWVCTDLKSEDAEEVQK
FT                   VLELSEAGKSTREIGKELSMSKSRVDRLLKKAKRSKKAKPAEAKQ"
FT                   /protein_id="YP_571911.1"
FT   gene            141946..144711
FT                   /db_xref="GeneID:4025510"
FT                   /locus_tag="Nham_4499"
FT   CDS_pept        141946..144711
FT                   /locus_tag="Nham_4499"
FT                   /gene_family="HOG000023836" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA methylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109625"
FT                   /db_xref="REBASE:NhaXORF4499P"
FT                   /db_xref="GeneID:4025510"
FT                   /translation="MNAVEIEEAISALAERPFDGGEFPFAFLQAFGNKETTIKKLRAGA
FT                   SNSSDLGGVLQRNHIHIAVCAPGAVTKTLAALKASPATAKAKARFTLATDGADFEAEEL
FT                   DTGETVACAYADFPDHFGFFLPLAGITTVKQVRESSFDIRATSRMNRLYVELLKDNPDW
FT                   GTAARRHDMNHFMVRLIFCFFAERTDIFHGIGLFTDTIARMSAKDSSDTHKVIGELFLS
FT                   MNTKREDRASVGIPRWADAFPYVNGELFSGSVDTPRFSKIARAYLLHIGSLDWTKINPD
FT                   IFGSMIQAVAEDEERGALGMHYTSVPNILKVLNPLFLDDLRARLAEADDNPRKLLNLRN
FT                   RMAKIRVFDPACGSGNFLVIAYKAMREIEAEINRRRGEADRRTDIPLTNFRGIELRDFP
FT                   AEVARLALIIAEFQCDVLYRGQKEALQDFLPLDAQNWITCGNALRLDWLSICPPTGTGV
FT                   KLQADDLFSTPLDQAQIDFENQGGETYICGNPQFKGARKQSRDQKNDLSLLFHGNIDYK
FT                   DCDYVVGWFIKASEYSTTCGAPFAFVATNSIAQGEQVAHLWSRLYAKNLHIFFAHRTFL
FT                   WRNNASNNAGVHCVIVGVSNRASGAKFIYEADTAREVNCIGPYLIPGDEIFVEAADSPV
FT                   SSDLPRMISGNMARDGGNLILSRDDTEALLSAHPQAVSLIKKLVGTKEINQGSKRYCLW
FT                   ITDKDVQRAKDIPEVARRIEQVKKERTASTAKTTRGYANIPHKFAQRCHRDESCIGIPK
FT                   TITGNDAYLTPDVFGSDAVISDLAFVIYPMDMVAFSIISSSLHLIWSKTVAGGMRDGLR
FT                   YSSQLAYHTFPIHRLTEKNKADLSRCAENILLAREANFPATIAYLYDPENLPDDLRAAH
FT                   ERNDEVLERIYIGRRFRNDTERLEKLFELYTKMIASPGAAAKKKKTEVSA"
FT                   /protein_id="YP_571912.1"
FT   misc_feature    142657..>143724
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Nham_4499"
FT   gene            144708..146786
FT                   /db_xref="GeneID:4025511"
FT                   /locus_tag="Nham_4500"
FT   CDS_pept        144708..146786
FT                   /locus_tag="Nham_4500"
FT                   /gene_family="HOG000229693" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109626"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="GeneID:4025511"
FT                   /translation="MTDHEKTVPSVSVSYARNGSSTKANALGMRPMQERAYERRGEQYL
FT                   LIKSPPASGKSRALMFIALDKLANQGLKQAIIVVPEKSIGASFHDEPLTKFGFWADWTV
FT                   APKWNLCDAPGSDNGGKVNSLGAFLDSDDKVLVCTHATFRFAVDKFGVEKFDSRLIAVD
FT                   EFHHVSADPESKLGQHLGALIVRDKVHIVAMTGSYFRGDAVPVLAPLDEAKFDTVTYTY
FT                   YEQLNGYEYLKQLDIGYFFYSGSYADDILSVLDPNEKTIIHIPSVNSRESTKDKIREVE
FT                   HIIEALGEWQGIDPATGFQLVKQRDGRVLRIADLVDDDPAKREKVSAALKDPAQKHNRG
FT                   HVDIIIALGMAKEGFDWVWCEHALTVGYRSSLTEIVQIIGRATRDAPGKTRARFTNLIA
FT                   EPDASEEAVTEAVNDTLKAIAASLLMEQVLAPRFNFTPKNPQSGPVDGFDYGEDGYDPS
FT                   KGNVGFNEQTGQFHIEIKGLAEPKSKEGARICTEDLNEVIAAFVQDKTAIERGLFDEEL
FT                   IPEELTQVRLGKIIKDKYPELNEEDQEAVRQHAIAALNITQKAKQIALGGDGAGTGGDD
FT                   QPSANTALIDGVRKFAMDVRELDIDLIDRINPFGEAYAILAKTMSEDSLKQVAAAIAAK
FT                   RTSLTPEEAKELAIRASRFKRERGRLPSVDAQDPWERRMAEGAVAFMRFKKEGRYDG"
FT                   /protein_id="YP_571913.1"
FT   misc_feature    144795..145958
FT                   /note="DNA or RNA helicases of superfamily II
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]; Region: SSL2; COG1061"
FT                   /db_xref="CDD:31261"
FT                   /locus_tag="Nham_4500"
FT   misc_feature    144834..145298
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4500"
FT   misc_feature    144861..144875
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4500"
FT   misc_feature    145194..145205
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Nham_4500"
FT   gene            146776..148005
FT                   /db_xref="GeneID:4025512"
FT                   /locus_tag="Nham_4501"
FT   CDS_pept        146776..148005
FT                   /locus_tag="Nham_4501"
FT                   /gene_family="HOG000229692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109627"
FT                   /db_xref="GeneID:4025512"
FT                   /translation="MTDDLDLDELAADLADFAPQDKKGGRSAREQRIIAGFEEVQRFAE
FT                   ANGRAPAHGESNDIFERLYAVRLDRLRGLEECRSLLAPLDKQGLLAGVVTPATEPVETI
FT                   GDDELLAELEGMGGASDITELRHVRTAADKRAAEEIANRTPCKDFDNFKPLFVQVKKDL
FT                   DAGIRQTRRFQTMAEIQPGEFFIVGGQIAYVAEVGAEFVTEYDRRDSRLRVIYDNGTES
FT                   DVLLRSLQRALHRDEAGRRITDPTAGPLFSGESGDGDLASGTIYVLRSKSDHPAVAAHR
FT                   DVLHKIGVTGGDIARRIAAAKHDPTFLMADVEVIATYELFNVNRTRLENLIHRVFDLAR
FT                   LDIEIKDRFGQPVIPREWFLVPLFVVNEAVDRIRDGTITDYLYDPKTAALVRVDKAKGG
FT                   RRERDQSRKT"
FT                   /protein_id="YP_571914.1"
FT   misc_feature    147613..147894
FT                   /note="T5orf172 domain; Region: T5orf172; pfam10544"
FT                   /db_xref="CDD:151089"
FT                   /locus_tag="Nham_4501"
FT   gene            148292..150496
FT                   /db_xref="GeneID:4025513"
FT                   /locus_tag="Nham_4502"
FT   CDS_pept        148292..150496
FT                   /locus_tag="Nham_4502"
FT                   /gene_family="HOG000059109" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109628"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:4025513"
FT                   /translation="MVDSFDDKALIEAFNGPFRAYRDEPWAVEWRQKYVAHVELVRNAD
FT                   KEQWLDPAFQRRLWDENPISNIGPGTSVTVEGAYSDVAISLELLQFRDAPIGSDLAERG
FT                   KRLQDMFDHVLAKVYPAHAKRRPKARLVRLMAAMFPRDMTCLMDAPRVWATQRLIMAPR
FT                   LVGGFIAQHPAVRQRIRDAIGPASDIAGEVDQSIFAWFLWNRYLNRPDEGAITVEAAQP
FT                   EASDIPPLSLLPVSAQRRSLACMKGAVGVFVAVVREAENGIARDDLASVILSEAPQLNT
FT                   NSAANVISQATGGLGLIHLVDGAYRPTQRGLELLSANEPAEVLRAPLVGRVFGMGHLLL
FT                   QLSRHPEGMGATDAAKWLQSLVPTWTTTMPGSHIIAWARVTGLVRAETVQGINRLYLTD
FT                   DGQEYVSALPRDFEERWRIDVAAEALDDGAPEIIAEEASSGASYTVEAIIDEGCFLERA
FT                   TLEQAIDLLKTKKNLVLQGPPGTGKTWLAKRLGYALIGEKDPSRLMAVQFQPSLSYEDF
FT                   VRGYRPNGTTGLQLVDGAFLEAVAVAKAEPARPYVLVIEEINRGNPAQIFGELLTLLEA
FT                   DKRSESEALRLAYPISQTERVHVPPNLYVVGTMNLADRSLALVDLALRRRFAFVNLNPN
FT                   FGAAWQQYCKARGAPDELLQAIGQAIVALNEVIAADQSLGAQFSVGHSFLTPAENMDAA
FT                   RWKTWIGNVILTEIKPLLLEYWYDARAKAEDHVKTLQACL"
FT                   /protein_id="YP_571915.1"
FT   misc_feature    <149651..150481
FT                   /note="5-methylcytosine-specific restriction enzyme subunit
FT                   McrB; Provisional; Region: PRK11331"
FT                   /db_xref="CDD:171074"
FT                   /locus_tag="Nham_4502"
FT   misc_feature    149657..>150016
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Nham_4502"
FT   misc_feature    149720..149743
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Nham_4502"
FT   misc_feature    order(149723..149746,149957..149959)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Nham_4502"
FT   misc_feature    149945..149962
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Nham_4502"
FT   gene            150509..151594
FT                   /db_xref="GeneID:4025514"
FT                   /locus_tag="Nham_4503"
FT   CDS_pept        150509..151594
FT                   /locus_tag="Nham_4503"
FT                   /gene_family="HOG000226165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-methylcytosine-specific restriction enzyme
FT                   subunit McrC"
FT                   /transl_table="11"
FT                   /note="McrC protein together with McrB forms the McrBC
FT                   restriction system; recognizes N4- and C5-methylcytosine
FT                   (and 5-hydroxy-methylcytosines); appears to act against
FT                   5-methylcytosine preceded by a purine residue; MrcC
FT                   modulates the specificty of McrB and has DNA cleavage
FT                   activity"
FT                   /db_xref="GI:92109629"
FT                   /db_xref="GeneID:4025514"
FT                   /translation="MSDQVWRSQTGIPIRNLWLLLVYASGLAEFESQCGAGTDDDIELA
FT                   DILGRLLVRLAKRRLRTNLSRGYQRRQAVIPRVRGRVDWLQTLSRQHLQRGRLACRFEE
FT                   LSFDTPRNRLVRCALIAIAGRVRDHAVAADCRRLGDDLGRLGIAASRPTQQEMSADTIG
FT                   SHQSEDRFMISAARLVFEMLLPNETPGDMKLSRLKRDEITLRKIFEKAVTGFYRHHLRA
FT                   ADGWSVREQNYQSWQLEPGRSGDVGLLPGMKPDIILDRKQDRRIVIDTKFTSILAKGIA
FT                   DRDKLKSANIYQIYAYLHSQRGRGRLCDRAEGVLLYPALDHDVDETFTIQGHDIRFVTV
FT                   DLALKPSEILDRLHSIAQDGD"
FT                   /protein_id="YP_571916.1"
FT   misc_feature    150527..151591
FT                   /note="McrBC 5-methylcytosine restriction system component;
FT                   Region: McrBC; cl01737"
FT                   /db_xref="CDD:174668"
FT                   /locus_tag="Nham_4503"
FT   gene            151764..152447
FT                   /db_xref="GeneID:4025515"
FT                   /locus_tag="Nham_4504"
FT   CDS_pept        151764..152447
FT                   /locus_tag="Nham_4504"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109630"
FT                   /db_xref="GeneID:4025515"
FT                   /translation="MATDEEKEHVFQAIEQAVDTIVSEVVEGHYEALTQEPQLTSKIAG
FT                   AIEHTIKMMDVGDLNVQVEVRDFPAQGRGALEGKVGADVYISVAVIPEDRKDVSKGMLA
FT                   QAKWDHSAKDPKLPEQIGKMTERSKSSSYVWVYGPNGVTCYPAGDYLNPHPKGSGGQSV
FT                   GSLIANGLRCEEGDRSIGRDLTKPLITSLNEIMEELGVQTAVSFTIREGSRRRRFYRRR
FT                   RGKRA"
FT                   /protein_id="YP_571917.1"
FT   gene            complement(152709..153923)
FT                   /db_xref="GeneID:4025516"
FT                   /locus_tag="Nham_4505"
FT   CDS_pept        complement(152709..153923)
FT                   /locus_tag="Nham_4505"
FT                   /gene_family="HOG000274259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109631"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="GeneID:4025516"
FT                   /translation="MKSLTRQVEIARTNPSPEIRLNLGKDMTIHSCNRQGKATPLAAAE
FT                   DSLARLDERLAKSPIREGWIARTHFTDAAACLWLEGALVHLDDFVLHDAGMDVRAPTFE
FT                   LTRAHAVLRTRRRIAEAKPDWALSAAGLAGLLGRGGQCDREDGSGDGEEEGDDALDMDG
FT                   DGAAETAEPLRLTPPDDQLADVFAAVDAAIAQADRTLAGDIATQARRPPERHPLVYDLD
FT                   WDEEERLDAWRAVIDQTRTLPPTLAAAIAADAWSAIEPLQHTPWIGRLLAASVLRQRGK
FT                   TRSHLACLHDGLKAIPRERRRPRDSAGRLAVGLEAIAAAAAAGLKEHDRWLMARTLLTR
FT                   KLDGRRSTSRLPALLEYVLTRPIVSAGMIAAELKITPRAAQDLVAELGLREATGRGRYR
FT                   AWGIL"
FT                   /protein_id="YP_571918.1"
FT   misc_feature    complement(152892..153278)
FT                   /note="Protein of unknown function (DUF1612); Region:
FT                   DUF1612; pfam07756"
FT                   /db_xref="CDD:149040"
FT                   /locus_tag="Nham_4505"
FT   misc_feature    complement(152712..152873)
FT                   /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
FT                   /db_xref="CDD:152407"
FT                   /locus_tag="Nham_4505"
FT   gene            153924..155606
FT                   /db_xref="GeneID:4025517"
FT                   /locus_tag="Nham_4506"
FT   CDS_pept        153924..155606
FT                   /locus_tag="Nham_4506"
FT                   /gene_family="HOG000115898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109632"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4025517"
FT                   /translation="MAASGSGCGSRSVAIARDDAWAQAKRQVRELDRILDGQGPRQVSI
FT                   ARAAAELGLTTRHIYNLLKRYAPDRRITVLLPRRDRPRATRLTAPVEAVIAEVLREQWL
FT                   VKEGPELRPCVGEIRARCCEAGERPPSYRAVQRRIPMLFEDLAIAKGRSANPSHARRLK
FT                   ARPGYISARGLLDVGQIDHTPADIQFVEVIDGVGVVVGRPYLTVVIDVFSRAILGFCLT
FT                   LEKPSSLSVALCLQQALTPKAPWLAAHGLGEHDWPMSGRPRVLVVDRAKEFKGHAFARG
FT                   CDDFGITIRPRHKGNVHQGGVIERLLGALNTVLRTLPGQTGRSVTERDHYPSEARARLS
FT                   FADLERCVALAVLEHNAKPNEKTLDIPDQVWRAHAAGLPPHQDDPDQVLIAFLPGGDRR
FT                   LTPQGVSVNAIDYYAPWLGELVPRRDRVGKLAMRTDPRDLSHIYLRHPDTGAFLAVERR
FT                   DGRTDAVTLWEHEHARAIRRALGGGPESRIALRRALRAIADGAMRPAVEPDTPKPGKHA
FT                   RRQAARTALAHAAPKPHQALASQPARFPDHPVRARNPLPVEDW"
FT                   /protein_id="YP_571919.1"
FT   misc_feature    154527..154841
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Nham_4506"
FT   misc_feature    155091..155288
FT                   /note="Mu transposase, C-terminal; Region: Mu-transpos_C;
FT                   pfam09299"
FT                   /db_xref="CDD:117843"
FT                   /locus_tag="Nham_4506"
FT   gene            155610..156500
FT                   /db_xref="GeneID:4025518"
FT                   /locus_tag="Nham_4507"
FT   CDS_pept        155610..156500
FT                   /locus_tag="Nham_4507"
FT                   /gene_family="HOG000116009" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TniB"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109633"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="GeneID:4025518"
FT                   /translation="MGEHLTESLRPWLQKPASERIAHLQAPRWIGTQAARDAIDLLQAG
FT                   LDRAPALRTRGVMLIGPYANGKSMIAERFAIMDRRRADAARNPRRVVLVQTREGSGLVN
FT                   FYAGILAALEAPQIKARDTSAKADQLDRLLRQLKPRVMIFDEFHNCLRGRRRDIEAIFA
FT                   VLRRFGRDYDLSPALVGELSIFDHVMLTAEMASRFQLAPVPRWSYDEAYLSLLDSLEAA
FT                   LPLAQASGLSDAPTAKLIFELSDGLIGETVAIVTTAAIAAVRSGAERISRECLRDLGYI
FT                   PLSRRRQSLAREVLA"
FT                   /protein_id="YP_571920.1"
FT   misc_feature    155619..156494
FT                   /note="Bacterial TniB protein; Region: TniB; pfam05621"
FT                   /db_xref="CDD:114349"
FT                   /locus_tag="Nham_4507"
FT   gene            156497..157417
FT                   /db_xref="GeneID:4025519"
FT                   /locus_tag="Nham_4508"
FT   CDS_pept        156497..157417
FT                   /locus_tag="Nham_4508"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109634"
FT                   /db_xref="GeneID:4025519"
FT                   /translation="MRPAAVEIEITLQPRYRSPSSRRWPVMVAPRPDEWLPGWLIRFGA
FT                   ANGVPAHALGALLGLESGNWARNIECGMSPAIACDLETASGLSAAMLPTLVLPRTDHIL
FT                   MLAPRVNVSSSAVGRRQATWLQLCPRCLEEDEAPYLRSHWRLATRLICQHHGRQLIDRC
FT                   PACRQGFAVCEAASLSPFITCTTCGQDLRAAAGPQLGTSTLRIALALERASRIAGFHHR
FT                   SKILALPLELDPPLSRPLTQLSGMVRARCLSFARPRILALAKTPSPLPPVSPRTTMHDL
FT                   LTAYAAVAIRPHAQSAGKRSGAPKT"
FT                   /protein_id="YP_571921.1"
FT   gene            complement(157378..158088)
FT                   /db_xref="GeneID:4025520"
FT                   /locus_tag="Nham_4509"
FT   CDS_pept        complement(157378..158088)
FT                   /locus_tag="Nham_4509"
FT                   /gene_family="HOG000242838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109635"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="GeneID:4025520"
FT                   /translation="MAKRATADGFDAELADLPAELRWREWMGRVEAAIFASPTPVPRET
FT                   LARLIGRACVLDELIADIRDELKPRPYELVFVAGGFQHRSKARFTEAIRAVLGGRETGP
FT                   PDLSKTESLVISAIAYLQPVTRSSISRLLGKAISRDIIAKLKRLDLIGAGPRMAEPGAP
FT                   FSYVTTPTFLSVFGLASLRDLPEIEAMQEAGLLDLAQDIALVDPLDDALADGDDSDDDS
FT                   RDQVFGAPDRLPAD"
FT                   /protein_id="YP_571922.1"
FT   misc_feature    complement(157528..158007)
FT                   /note="Putative transcriptional regulators (Ypuh-like);
FT                   Region: DUF387; cl00612"
FT                   /db_xref="CDD:174311"
FT                   /locus_tag="Nham_4509"
FT   gene            complement(158151..159056)
FT                   /db_xref="GeneID:4025521"
FT                   /locus_tag="Nham_4510"
FT   CDS_pept        complement(158151..159056)
FT                   /locus_tag="Nham_4510"
FT                   /gene_family="HOG000268356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109636"
FT                   /db_xref="InterPro:IPR009843"
FT                   /db_xref="GeneID:4025521"
FT                   /translation="MIPPPDRRRRTRVANPGDDRDVVASTLIPQPLPRWVGYGAGPSAG
FT                   GGARDAAFAAGAALLSLDQIVRTQAPWLGVLRARLALKATSVAARLLRLKADAAALRDA
FT                   EHLTRSGDDPGPAGRLHRLLRQFASRPTRHAGEVLPMLEAELRGAPVAAELVSLLEADL
FT                   ALAQKLGWTTPLLLHAGIVLEPALRPGPEGRRPRADRPDWSAVCDQVLLFAVSACHAEA
FT                   VTLARRAAALAVAARRLRTRDQGRGLALVLADDAIAPWRMVGRAGLGSDRAARRFCETL
FT                   ASQGVLKRLTDRPTFRLYGL"
FT                   /protein_id="YP_571923.1"
FT   misc_feature    complement(158154..159005)
FT                   /note="Protein of unknown function (DUF1403); Region:
FT                   DUF1403; pfam07183"
FT                   /db_xref="CDD:148659"
FT                   /locus_tag="Nham_4510"
FT   gene            159191..160300
FT                   /db_xref="GeneID:4025522"
FT                   /locus_tag="Nham_4511"
FT   CDS_pept        159191..160300
FT                   /locus_tag="Nham_4511"
FT                   /gene_family="HOG000002860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109637"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:4025522"
FT                   /translation="MAAAPEFEPQNQPSSPPEDRAARAPARRATPQLSGFDGSGGTPLP
FT                   SPELERLAGSARGYAKAKDSAHTTRAYASDWRQFERWCRRQGFEARHPDPRVVGLFIAA
FT                   SAAGTGIAKAAVSTIERRLAAVTTTYRSAGTPLPRQDRHIVDVMAGIRRSHGRPPCQKE
FT                   ALFAEDILAMIAMLEQNLRGWRDRAILLIGFAGGLRRSEITGLDCGPKQSDDSRGWIEI
FT                   LDGGVVLTIDGKTGWRTVEIARGSSDRSCPVQALETWLKLGRIVDGPVFRPVTLANGGM
FT                   QSGRLSDRHVARLVQKLALAAGVRGDLPEGERALAFAGHSLRAGLASSAAVDEAHIQRQ
FT                   LGHASAEMTRRYQRRRDRFRVNLTKAAGL"
FT                   /protein_id="YP_571924.1"
FT   misc_feature    159335..160237
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Nham_4511"
FT   misc_feature    159389..160237
FT                   /note="Cre recombinase, C-terminal catalytic domain.
FT                   Cre-like recombinases belong to the superfamily of DNA
FT                   breaking-rejoining enzymes, which share the same fold in
FT                   their catalytic domain and the overall reaction mechanism.
FT                   The bacteriophage P1 Cre...; Region: INT_Cre; cd00799"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4511"
FT   misc_feature    order(159389..159394,159398..159400,159419..159421,
FT                   159539..159544,159551..159553,159743..159745,
FT                   159785..159793,160007..160015,160058..160060,
FT                   160064..160066,160142..160150)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4511"
FT   misc_feature    order(159476..159478,159485..159490,159623..159625,
FT                   159629..159631,159635..159640,159689..159691,
FT                   159770..159775,160166..160168,160178..160180)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4511"
FT   misc_feature    order(159785..159787,159890..159892,160148..160150,
FT                   160157..160159,160217..160219)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4511"
FT   misc_feature    order(159785..159787,159890..159892,160148..160150,
FT                   160157..160159)
FT                   /note="active site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4511"
FT   gene            complement(160739..161185)
FT                   /db_xref="GeneID:4025523"
FT                   /locus_tag="Nham_4512"
FT   CDS_pept        complement(160739..161185)
FT                   /locus_tag="Nham_4512"
FT                   /gene_family="HOG000273925" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109638"
FT                   /db_xref="GeneID:4025523"
FT                   /translation="MLPTEIKLGWIFRYSYLWDWQHREGREEGDKDRPCLVLAIVMTTE
FT                   DGAPVVRVLPITHTPPANPADAIEIPAAVKNRLRLDHERSWIVLTESNRFVWPGPDLRN
FT                   IETDSGYYGALTPGLFGEVKRRFVAIARGEVAISAPHRSVPRSE"
FT                   /protein_id="YP_571925.1"
FT   gene            complement(161172..161447)
FT                   /db_xref="GeneID:4025524"
FT                   /locus_tag="Nham_4513"
FT   CDS_pept        complement(161172..161447)
FT                   /locus_tag="Nham_4513"
FT                   /gene_family="HOG000218520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prevent-host-death protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109639"
FT                   /db_xref="InterPro:IPR003756"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:4025524"
FT                   /translation="MSSTVTAAEVSKNFGAYQDAAVREPVVITKNGRPRTVLMAYEDFV
FT                   RLSKRDRRVQRTIDLSEAEIAAVEAAEMTPDPGHLSSAPDAKHAAD"
FT                   /protein_id="YP_571926.1"
FT   misc_feature    complement(<161307..161438)
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:175019"
FT                   /locus_tag="Nham_4513"
FT   gene            161562..161837
FT                   /db_xref="GeneID:4025574"
FT                   /locus_tag="Nham_4514"
FT   CDS_pept        161562..161837
FT                   /locus_tag="Nham_4514"
FT                   /gene_family="HOG000138298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prevent-host-death protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109640"
FT                   /db_xref="InterPro:IPR003756"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:4025574"
FT                   /translation="MTDNGRSEPSSNIWTLADAEVRFSEIIDRAQTRPQVITRRGHPCA
FT                   VLVSAEEWARRTARKGTLADFLLASPLRQDPMDIERVRDRPRDIEL"
FT                   /protein_id="YP_571927.1"
FT   misc_feature    161595..161795
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:175019"
FT                   /locus_tag="Nham_4514"
FT   gene            161894..162133
FT                   /db_xref="GeneID:4025283"
FT                   /locus_tag="Nham_4515"
FT                   /pseudo
FT   gene            162229..163497
FT                   /db_xref="GeneID:4025284"
FT                   /locus_tag="Nham_4516"
FT   CDS_pept        162229..163497
FT                   /locus_tag="Nham_4516"
FT                   /gene_family="HOG000002860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109641"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4025284"
FT                   /translation="MDDITSRALVSDPETRRALQLDALSAILPMERRDRLAELLTDDDV
FT                   ATLKHLAREGMGENTLRALASDLAYLEGWAKAATGAPLPWPAPESLALKYVAHHLWDPA
FT                   ERETDPQHGMPAEVAADMRSALLLRTDGPHAPSTVKRRLANWGTLHRWKGQEGPFHSPS
FT                   LRTALRLAVRASSRPRQRKSMRAVTRDVLDRLLATCRSDRLADTRDLAILLLAFASGGR
FT                   RRSEVARLRVEQLSDEPDVALNPMDPKSPRVPCVTIQLGRTKTAVADEAGRVLLVGPPV
FT                   EALREWLERADIGKGPIFRAIDRWEAIEERALTPQSINLIVKRRCVMAGLEPREFSAHG
FT                   LRSGYLTEAARQGVALPEAMQQSQHRSVQQAATTMTPSVFVGAPSAWGSSLGLLVKLSM
FT                   YNSGEDCSVGRGPRGRGESLSRC"
FT                   /protein_id="YP_571928.1"
FT   misc_feature    162400..163341
FT                   /note="Cre recombinase, C-terminal catalytic domain.
FT                   Cre-like recombinases belong to the superfamily of DNA
FT                   breaking-rejoining enzymes, which share the same fold in
FT                   their catalytic domain and the overall reaction mechanism.
FT                   The bacteriophage P1 Cre...; Region: INT_Cre; cd00799"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4516"
FT   misc_feature    order(162403..162408,162412..162414,162433..162435,
FT                   162637..162642,162649..162651,162850..162852,
FT                   162895..162903,163129..163137,163177..163179,
FT                   163183..163185,163237..163245)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4516"
FT   misc_feature    order(162496..162498,162505..162510,162721..162723,
FT                   162727..162729,162733..162738,162793..162795,
FT                   162877..162882,163261..163263,163273..163275)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4516"
FT   misc_feature    162781..163353
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Nham_4516"
FT   misc_feature    order(162895..162897,163018..163020,163243..163245,
FT                   163252..163254,163321..163323)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4516"
FT   misc_feature    order(162895..162897,163018..163020,163243..163245,
FT                   163252..163254)
FT                   /note="active site"
FT                   /db_xref="CDD:29500"
FT                   /locus_tag="Nham_4516"
FT   gene            163691..164896
FT                   /db_xref="GeneID:4025285"
FT                   /locus_tag="Nham_4517"
FT   CDS_pept        163691..164896
FT                   /locus_tag="Nham_4517"
FT                   /gene_family="HOG000144216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109642"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:4025285"
FT                   /translation="MPTSAKPLDENVRDLRSLINADAAELSARLRAQQLRDFPPAAEKT
FT                   IRRFSSAEAARFIGIAEGYLRQLVSEGKGPSAPANSRRSYSIEDIDALRRDLDSAGKGA
FT                   RRYVPHRRDTEALQVISVMNFKGGSGKTTTAAHLAQYLAFRGYRVLAIDLDPQASLSTL
FT                   FGHQPELDVGDNETIFGAIRYDSERRPMPEIVRATYIPNLHIVPGQLELMEFEHETPKA
FT                   LMTRQSNDSMFFARIGEALAQVSDVYDVVVIDCPPQLGFLTLSALCAATAVLITVHPQM
FT                   LDVMSMSQFLNMTGSLLDVVAEAGGATQYDWMRYLVTRYEPSDGPQTTMVGLMRSIFGS
FT                   RVLTHPMVKSTAIADAGLTKQTLYEVERQQFTRGTYDRAIEALDLVNGEIESLIKQVWK
FT                   RN"
FT                   /protein_id="YP_571929.1"
FT   misc_feature    163739..164890
FT                   /note="plasmid partitioning protein RepA; Region:
FT                   partition_RepA; TIGR03453"
FT                   /db_xref="CDD:163271"
FT                   /locus_tag="Nham_4517"
FT   misc_feature    164045..>164161
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4517"
FT   misc_feature    164066..164086
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4517"
FT   misc_feature    164084..164086
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4517"
FT   misc_feature    <164432..164569
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4517"
FT   misc_feature    164450..164452
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4517"
FT   gene            164899..165918
FT                   /db_xref="GeneID:4025286"
FT                   /locus_tag="Nham_4518"
FT   CDS_pept        164899..165918
FT                   /locus_tag="Nham_4518"
FT                   /gene_family="HOG000274215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="parB-like partition proteins"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109643"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="GeneID:4025286"
FT                   /translation="MARKINFDLPTTAEQTPHEAPPVSPANRVRPLLGLDRPIKQSSAL
FT                   GAISQSLGGISEKVKRAEEIEQKLIEGQVIVELDPALIDNSFIPDRMEAPEEQNAAFRE
FT                   LIREHGQNVPILVRPKPSDTERYEVAFGHRRLRAARDLGIKVRAVVRTLTDEQLVVAQG
FT                   QENSGRTDLTFIERARFAAKLEDRKFSREIIMASLNVDKAALSRLISIATRVPAAVIEA
FT                   IGPAPAFGRVRWQDLTDLLEHEDNRTRAIDMVKAPSFCALETDKRFETLAAGLREKTSR
FT                   ARAETWAAKDGTPAAKVSRAGKKLTLIFDDRVAPKFGDFVRKRLQTLYDEFKAGDPPA"
FT                   /protein_id="YP_571930.1"
FT   misc_feature    164902..165900
FT                   /note="plasmid partitioning protein RepB; Region:
FT                   partition_RepB; TIGR03454"
FT                   /db_xref="CDD:163272"
FT                   /locus_tag="Nham_4518"
FT   misc_feature    165124..165396
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Nham_4518"
FT   misc_feature    165298..>165549
FT                   /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
FT                   Enzymes; Region: PLPDE_III; cl00261"
FT                   /db_xref="CDD:153634"
FT                   /locus_tag="Nham_4518"
FT   misc_feature    165349..165351
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:143484"
FT                   /locus_tag="Nham_4518"
FT   gene            166144..167376
FT                   /db_xref="GeneID:4025287"
FT                   /locus_tag="Nham_4519"
FT   CDS_pept        166144..167376
FT                   /locus_tag="Nham_4519"
FT                   /gene_family="HOG000274216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication initiation protein RepC"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109644"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="GeneID:4025287"
FT                   /translation="MQSHSPTTPFGRRSLTLAHVASQMVATTRPPEKVVHKWKIFHAIC
FT                   TARPRLGVSERSLSVLNALLTFHPETALTGEDDLIVFPSNHQLSLRAHGMPASTLRRHL
FT                   AVLVDAGLVVRRDSPNGKRYARKGTAGEIELAFGFDISPLVVRSEEFESLAADIEAEAR
FT                   TLKLVRERITLCRRDIAKMIATGIEEGVPTRRGGQGPADWQEVHVAFRSIVDQIPRTAT
FT                   RQELEPVADELSQLADDVLNLLETHIKSTNPSANESHTERHIQNSNTDSLIDFEPSLHE
FT                   GRAARTEPKPQAPRVAEGSYPLGMVLNACPDIIDYAKGGISSLRDLLATAAVVRSMLGI
FT                   SPSAWEDAQTILGETPAAIVVACILQRGAAIRSAGGYLRGLTRKAEAGEFSLGPILMSQ
FT                   INSRLNEKRRA"
FT                   /protein_id="YP_571931.1"
FT   misc_feature    166144..167373
FT                   /note="replication initiation protein RepC; Provisional;
FT                   Region: PRK13824"
FT                   /db_xref="CDD:172352"
FT                   /locus_tag="Nham_4519"
FT   misc_feature    166180..166710
FT                   /note="Replication protein C N-terminal domain; Region:
FT                   RP-C; pfam03428"
FT                   /db_xref="CDD:146192"
FT                   /locus_tag="Nham_4519"
FT   misc_feature    166744..167355
FT                   /note="Replication protein C C-terminal region; Region:
FT                   RP-C_C; pfam11800"
FT                   /db_xref="CDD:152236"
FT                   /locus_tag="Nham_4519"
FT   gene            167995..168327
FT                   /db_xref="GeneID:4025288"
FT                   /locus_tag="Nham_4520"
FT   CDS_pept        167995..168327
FT                   /locus_tag="Nham_4520"
FT                   /gene_family="HOG000077271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein/primosomal
FT                   replication protein n"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109645"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="GeneID:4025288"
FT                   /translation="MRNIAEFTLIGRVGTIKQVGKTVRVSICANYPFKDDKGQWKDDAH
FT                   WNEVTIFTKAIQSYVNEHLSKGDLVHVRGRLRQNSFERDGQRVYTVDLIALELGRLAQA
FT                   SQRAAA"
FT                   /protein_id="YP_571932.1"
FT   misc_feature    168013..168297
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4520"
FT   misc_feature    order(168013..168024,168079..168087,168127..168129,
FT                   168133..168135,168199..168201,168226..168228,
FT                   168256..168258,168265..168267)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4520"
FT   misc_feature    order(168028..168036,168052..168054,168064..168066,
FT                   168085..168090,168121..168126,168130..168132,
FT                   168136..168138,168142..168144,168148..168150,
FT                   168190..168195,168217..168219,168223..168225,
FT                   168229..168234,168268..168270,168274..168276)
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4520"
FT   misc_feature    order(168199..168201,168205..168207,168211..168213,
FT                   168289..168291)
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Nham_4520"
FT   gene            complement(168416..168787)
FT                   /db_xref="GeneID:4025289"
FT                   /locus_tag="Nham_4521"
FT   CDS_pept        complement(168416..168787)
FT                   /locus_tag="Nham_4521"
FT                   /gene_family="HOG000077270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109646"
FT                   /db_xref="GeneID:4025289"
FT                   /translation="MPPVRKPLPVDHSILNEMLAIRLQQLEIENGGMEAFLPKTGLARG
FT                   TYYTILRGIGNPTLRTMERIASSLNMSVLELLGFEVGDARRALKKSGVNYDELVSAIGK
FT                   KNRADRGLARQTRSRKLPS"
FT                   /protein_id="YP_571933.1"
FT   misc_feature    complement(168575..>168742)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Nham_4521"
FT   gene            complement(168897..169208)
FT                   /db_xref="GeneID:4025290"
FT                   /locus_tag="Nham_4522"
FT   CDS_pept        complement(168897..169208)
FT                   /locus_tag="Nham_4522"
FT                   /gene_family="HOG000124937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109647"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4025290"
FT                   /translation="MGEKKCRRKAAHTAQGSTLRQAFQAGLEGLRLESGLSRRKFAEHL
FT                   GIPRSSYFHLMTTAANPSLDYIELIAERAGIDPLRLLRRSANTAGDRRPEVREDRPAR"
FT                   /protein_id="YP_571934.1"
FT   gene            169374..170999
FT                   /db_xref="GeneID:4025291"
FT                   /locus_tag="Nham_4523"
FT   CDS_pept        169374..170999
FT                   /locus_tag="Nham_4523"
FT                   /gene_family="HOG000274216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein C"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109648"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="GeneID:4025291"
FT                   /translation="MNELATPIMPQSYERILARTIRLQGDPRFHATVFVCPRADRPGAP
FT                   DLPRITHDITFDRVTFQYEGGETPVLNNLSLKFDVGKRIAIVGPSGSGKSTLLNLILRL
FT                   RFRGGGHKKSYRIVDFKAPTRGREWRCLVKSRNAVWTTTAIAQHRKGAARRQGMSPGQA
FT                   GHKWHVFRNICEARTSLPVSDRALAVLNALLSFHPDTVLTAGAADLVVFPSNRLLSLRA
FT                   HGMAASTLRRHLAGLVDSGLVLRRDSPNGKRYARKATSGDIEQAFGFDLGPIVARADEF
FT                   AALAEAAIARRQALTVLRERITLARRDIAKMIATGVEQRGAADWGSLHRTFRDIMARLP
FT                   RAPTCEVLEPIVVELAILAETIVGVLERHLDPIESGPPNLPADQIPNSAPQRPNSSEPD
FT                   PRPGAPETADADRPQSAGAIPIRMVVELCPDIIDYARDGIRTSQDLITTASAVRPMLGI
FT                   SPSAWEEACTAMGDGQASVVLAAILQRGAAIKSPGGYLRVLARRAAAGEFSVWPMLMAL
FT                   RRQGRAARDRDCLPSSFPDDFSQG"
FT                   /protein_id="YP_571935.1"
FT   misc_feature    169380..>169688
FT                   /note="Tfp pilus assembly protein, ATPase PilU [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: PilU; COG5008"
FT                   /db_xref="CDD:34613"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    169533..>169685
FT                   /note="The MRP (Mutidrug Resistance Protein)-like
FT                   transporters are involved in drug, peptide, and lipid
FT                   export.  They belong to the subfamily C of the ATP-binding
FT                   cassette (ABC) superfamily of transport proteins.  The ABCC
FT                   subfamily contains transporters with...; Region:
FT                   ABCC_MRP_Like; cd03228"
FT                   /db_xref="CDD:72987"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    169635..169658
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72987"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    order(169644..169649,169653..169661)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72987"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    169686..>169736
FT                   /note="50S ribosomal protein L2; Validated; Region: rplB;
FT                   PRK09374"
FT                   /db_xref="CDD:169822"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    169827..170330
FT                   /note="Replication protein C N-terminal domain; Region:
FT                   RP-C; pfam03428"
FT                   /db_xref="CDD:146192"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    169839..170954
FT                   /note="replication initiation protein RepC; Provisional;
FT                   Region: PRK13824"
FT                   /db_xref="CDD:172352"
FT                   /locus_tag="Nham_4523"
FT   misc_feature    170340..170942
FT                   /note="Replication protein C C-terminal region; Region:
FT                   RP-C_C; pfam11800"
FT                   /db_xref="CDD:152236"
FT                   /locus_tag="Nham_4523"
FT   gene            complement(171049..171462)
FT                   /db_xref="GeneID:4025292"
FT                   /locus_tag="Nham_4524"
FT   CDS_pept        complement(171049..171462)
FT                   /locus_tag="Nham_4524"
FT                   /gene_family="HOG000124935" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109649"
FT                   /db_xref="GeneID:4025292"
FT                   /translation="MTDPASAQKPDRPPLPRDAFRAHRVSAAAPDALAAKPVVVTPAYE
FT                   DQVTTPAAHSAHADSASARKQPRPQNTRSRNPFDAYGERSSSRPYALRFPDAIDLVVRQ
FT                   MAAEERTQPLRIIDRIVYDHLKRIGRLPPPRET"
FT                   /protein_id="YP_571936.1"
FT   gene            complement(171459..172214)
FT                   /db_xref="GeneID:4025293"
FT                   /locus_tag="Nham_4525"
FT   CDS_pept        complement(171459..172214)
FT                   /locus_tag="Nham_4525"
FT                   /gene_family="HOG000077269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109650"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:4025293"
FT                   /translation="MFIMLYVVIPPMPVGGTQLPSIFAIANPKGGSGKTTVAIILAGEF
FT                   AKHGYSAAIVDADPQGSSYQWHASSVARGLSPQGVDLVRAPDETALAQTIDRLDGYDVV
FT                   VVDTPGYYGDVLIQSALRADLVVLPCKVHTFDASQVVRTIRNLEQHAATSKLPMSQHRV
FT                   LFNEYDSLDRNTRPLKEVVAYLDAEKVPVCAKALYRRITYRTMTSGHGTLYQMSDKDES
FT                   IRKARYNADQVVRELLAASQGAGQGGSAA"
FT                   /protein_id="YP_571937.1"
FT   misc_feature    complement(171501..172157)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Nham_4525"
FT   misc_feature    complement(171768..172151)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4525"
FT   misc_feature    complement(172110..172130)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4525"
FT   misc_feature    complement(order(171894..171896,172110..172112))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Nham_4525"
FT   gene            172699..173127
FT                   /db_xref="GeneID:4025294"
FT                   /locus_tag="Nham_4526"
FT   CDS_pept        172699..173127
FT                   /locus_tag="Nham_4526"
FT                   /gene_family="HOG000077268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109651"
FT                   /db_xref="GeneID:4025294"
FT                   /translation="MVRTVRALRRKPRLRTELSDADEQRLQEAVALFGLPKAEVVRRLI
FT                   RASVQAGPALSADNTRAVVELASQVRMVGRNLAQVLRAIHRGQAVRIEDTEPVWRGLHE
FT                   VVAAINDELTEMTVAYGSKLRREAKLALPAEISGEELT"
FT                   /protein_id="YP_571938.1"
FT   gene            173229..175466
FT                   /db_xref="GeneID:4025295"
FT                   /locus_tag="Nham_4527"
FT   CDS_pept        173229..175466
FT                   /locus_tag="Nham_4527"
FT                   /gene_family="HOG000077267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109652"
FT                   /db_xref="GeneID:4025295"
FT                   /translation="MLDEDVRARRARVAPLPNTPPAQDIIRGATITGERDEERARSIAA
FT                   VGGGGGAGPGAAPLRGAPSPISGGFGASGAATSSAGAGQGGPVGRARQLAAGYQPAVIK
FT                   VVSYARGVARATATGQYVQREDVPLETHDGRLLTDREAVADEIKAWSADFSKRAESQDV
FT                   GAFRLKLEGVPDTAEGRATYEKAIAAAFSGHRYAARVDVDEKGALEAHVVAAMAGSGKE
FT                   RFRIREAQAADRNHDARPRRLDSVSDAAVRARIEAASGIDGKAVVIRPGATSHGRDGVS
FT                   YRLNKLIEKSAALDDRGKSLCNVADARVTAREWGPSLRSQSARDTMHLIISAKAGTDVA
FT                   ALTNAARAFLHDRFADHKFMFGVHTDKESAGHIHAHAVITVKNESGQKIHPNRDTFAEW
FT                   REVYAQHAQAQGLKIVATSAKERASSQSYGPKDKAIVEAADRPRAAREARDRAYAADPF
FT                   NQRLIDNARQRIRVARTNPIRLPMSAPDRKVVNESLLAWKTVAAEQPSNGAAKDMLERL
FT                   LMAQTVGAILHTIGKRVEFLTRESEMPITSEQMLQDQRLMNDAVSRTSDRLDGETKQQF
FT                   RQTSARYLETLANRIDLQRMQERGVQQLSRADVEAVVGVNADRLIERAQEIRIKEEREA
FT                   TSAEHLATSAIDAERRQEARGGIDPASQKELRAERAIVAGSQQSAAREAREAAAAVEAA
FT                   RAIAEHPAQPLPTSLVQTDALTKLRLEQEKIVSELEAQRSEAQSSKGQRYR"
FT                   /protein_id="YP_571939.1"
FT   misc_feature    173499..174536
FT                   /note="Relaxase/Mobilisation nuclease domain; Region:
FT                   Relaxase; cl01584"
FT                   /db_xref="CDD:174650"
FT                   /locus_tag="Nham_4527"
FT   gene            complement(175640..175869)
FT                   /db_xref="GeneID:4025296"
FT                   /locus_tag="Nham_4528"
FT                   /pseudo
FT   gene            176212..176583
FT                   /db_xref="GeneID:4025297"
FT                   /locus_tag="Nham_4529"
FT   CDS_pept        176212..176583
FT                   /locus_tag="Nham_4529"
FT                   /gene_family="HOG000274183" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109653"
FT                   /db_xref="GeneID:4025297"
FT                   /translation="MERQIGQKELPRPRAPRLRRMLLLFVAFAYLFVGLAHTVSCTDET
FT                   VTSLISMGGAFGNVSDEGSSKKSPLVAQHCYVCAPVLMPALIPMAVPSARSVKVALIVP
FT                   KVLRATQPWADTPPPKYLT"
FT                   /protein_id="YP_571940.1"
FT   sig_peptide     176212..176322
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.431 at
FT                   residue 37"
FT                   /locus_tag="Nham_4529"
FT                   /product="hypothetical protein"
FT   gene            176638..177915
FT                   /db_xref="GeneID:4025298"
FT                   /locus_tag="Nham_4530"
FT   CDS_pept        176638..177915
FT                   /locus_tag="Nham_4530"
FT                   /gene_family="HOG000274172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109654"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:4025298"
FT                   /translation="MFSKRAAARLMCVSLILIGPPSAVAWAASRPMTLQHALQQALAAN
FT                   PRLTASERDVGIATGQRIQAGALINPDLSYEQDNSLGSGSYRGTRSAEMTLQISQLFEL
FT                   FGKRDARIAAGAAGVNVAVIQRKAVRLEVLSETAVAFLTVLGAQRRVQILDDQVAAIDR
FT                   LTPLLQRRVEAGASSPAETGRAQVASDLVKADRERVKASLSSARRDLAVLMGDTSPRFS
FT                   TVTGRLETVGRPPTFKAVIAAIDANPQLVRWTAVYAQRNAELLLARLKPYPDVRVSAGW
FT                   RHFNETGDDAVRLGISIPIPVFDQNQGNILSAQESLAKAAAERAANKATLVVLAGRAYD
FT                   SLEGSLRELAILRESAIPKAQAAAQAIFDGYGQGRFTLLEVLDAQATLAQARLREQEAL
FT                   QNFHIAVATIEGLVGNPFSLTHQSSR"
FT                   /protein_id="YP_571941.1"
FT   sig_peptide     176638..176721
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.803 at
FT                   residue 28"
FT                   /locus_tag="Nham_4530"
FT                   /product="hypothetical protein"
FT   misc_feature    176770..177882
FT                   /note="type I secretion outer membrane protein, TolC
FT                   family; Region: type_I_sec_TolC; TIGR01844"
FT                   /db_xref="CDD:162556"
FT                   /locus_tag="Nham_4530"
FT   misc_feature    176770..177282
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Nham_4530"
FT   misc_feature    177361..177879
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Nham_4530"
FT   gene            177912..178862
FT                   /db_xref="GeneID:4025299"
FT                   /locus_tag="Nham_4531"
FT   CDS_pept        177912..178862
FT                   /locus_tag="Nham_4531"
FT                   /gene_family="HOG000002593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109655"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:4025299"
FT                   /translation="MIKATLRYSIFILVAVALAYGGYRMLMPASSKVTPTEKSDKDEHS
FT                   DSVILSDAKVEASRIELATASSGVLRESLFLNGIVQPNQESLVQVTPRFPGIVRDVRKR
FT                   IGNAVQKGDVLAVIESNQSLTQYELKASLAGTVIDRQITLGEYASEQKPAFLVADLSTV
FT                   WVDFSVYRRDLKRVSVGDQVFIDPADGGAPIDAKISYLSPVGSSDTQSAIARAVVPNTG
FT                   QRLRPGLFVTGRLMLTAKKVGVAVKSSALQTVENRTVVFVRNGEKFEARNVEIGERDPQ
FT                   LVEITVGILEGDVYAAKNSFIVKAEMTKGAGGDEH"
FT                   /protein_id="YP_571942.1"
FT   sig_peptide     177912..178007
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.803) with cleavage site probability 0.309 at
FT                   residue 32"
FT                   /locus_tag="Nham_4531"
FT                   /product="hypothetical protein"
FT   misc_feature    <178155..178322
FT                   /note="pyruvate carboxylase subunit B; Validated; Region:
FT                   PRK09282"
FT                   /db_xref="CDD:169772"
FT                   /locus_tag="Nham_4531"
FT   misc_feature    <178293..178823
FT                   /note="Membrane Fusion Protein cluster 2 (function with RND
FT                   porters); Region: 8a0102; TIGR00999"
FT                   /db_xref="CDD:162153"
FT                   /locus_tag="Nham_4531"
FT   gene            178852..179217
FT                   /db_xref="GeneID:4025300"
FT                   /locus_tag="Nham_4532"
FT   CDS_pept        178852..179217
FT                   /locus_tag="Nham_4532"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109656"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="GeneID:4025300"
FT                   /translation="MNTENGMILITALIRPHMEGHMVRALHDLTDFPGFTFDEVRGQGR
FT                   GRGQGGSYVASDEDITYHQFLELRLVCQSDQAVSICERIAAAAWTGRKGDGVIYTTPVH
FT                   SFGRIREIGGHQERPHD"
FT                   /protein_id="YP_571943.1"
FT   misc_feature    178879..179181
FT                   /note="Nitrogen regulatory protein P-II; Region: P-II;
FT                   cl00412"
FT                   /db_xref="CDD:174186"
FT                   /locus_tag="Nham_4532"
FT   gene            179210..182419
FT                   /db_xref="GeneID:4025301"
FT                   /locus_tag="Nham_4533"
FT   CDS_pept        179210..182419
FT                   /locus_tag="Nham_4533"
FT                   /gene_family="HOG000126203" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump CzcA"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109657"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:4025301"
FT                   /translation="MIDGILSFAIRQRWLVMIGVLAMAAFGAWNFTRLPIDAVPDITNV
FT                   QVQINSSAPGYSPLEVEQRITFPIETAMGGLPHLDSTRSQSRYGLSQVTIIFKDGTDIY
FT                   FARQLVNERIQQVKDQLPAGVETAMGPISTGLGEIYLFTVEAKPGARKEGGGDYTPSDL
FT                   RTIQDWIIKPQLRNVPGVIEVNTIGGFEKQFHVLPDPAQLMAYKLSFRDVMTALASNNA
FT                   NVGAGYIERNGEQYLVRTPGQVANVEDIKEIVIGSHNGVPVRIGDVAEVREGKDLRTGA
FT                   ATVNGKETVLGTVMLLIGENSRAVAQRVAAKLKEIGRSLPDGVIARAVYDRTHLVEATV
FT                   ATVEKNLVEGALLVIVILFMILGNFKAAIATACVIPLAMLFTITGMVENKVSANLMSLG
FT                   AIDFGIIIDGAVIIVENCLRLLAEEQHRQGRLLNRQERFETILAGSREVIGPSLFGTLI
FT                   IGVVYLPILTLTGVEGKMFTPMALTVLMALTGASILSLTFVPAAVALLVTGKVSEHENV
FT                   FMRGARKLYTPLLAASIRNRFGVAAIAALLVVVCGIAATRMGGEFIPSLDEGDVALQAI
FT                   RIPGTSLTQSLEMQAMLEKRLLKIPEVKEAFARTGTAEVATDLMPPSTSDGYVMLKPRK
FT                   EWPDPEKSKAAVVREIQEAAEEIPGNVYEISQPIEQRFNELISGVRSDVGIKIFGDDLD
FT                   TLVQSAAKVQAVLQNVEGAADVKTEQASGLPVLTVKLNRQALSRYGINVSDVQNLIEIA
FT                   VGGKPSGLVFEGDRRFDIVVRLPEHLRSDMEAIRALPVPLPPLENNAKATPAVWNNSPL
FT                   AQIRYVPLSELAEIDVALGPNQISRENGKRRIVVTANVRGRDLGSFVADAQKQVEEKVK
FT                   LPAGYWIGWGGQFEQLVSATQRLTIVVPIALLLILLLLFMSLGSMADALLVFSGVPLAL
FT                   TGGIVALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIEGLRREGHALVDAVREGAL
FT                   TRLRPVLMTALVASLGFVPMAIATGAGAEVQRPLATVVIGGIISSTILTLLVLPALYVL
FT                   FRREEPENGGSNLPTVGGVNP"
FT                   /protein_id="YP_571944.1"
FT   misc_feature    179210..182281
FT                   /note="heavy metal efflux pump (cobalt-zinc-cadmium);
FT                   Region: 2A0601; TIGR00914"
FT                   /db_xref="CDD:129992"
FT                   /locus_tag="Nham_4533"
FT   sig_peptide     179210..179293
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.610) with cleavage site probability 0.347 at
FT                   residue 28"
FT                   /locus_tag="Nham_4533"
FT                   /product="hypothetical protein"
FT   gene            182563..182929
FT                   /db_xref="GeneID:4025302"
FT                   /locus_tag="Nham_4534"
FT                   /pseudo
FT   gene            182973..185177
FT                   /db_xref="GeneID:4025303"
FT                   /locus_tag="Nham_4535"
FT   CDS_pept        182973..185177
FT                   /locus_tag="Nham_4535"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109658"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001366"
FT                   /db_xref="InterPro:IPR001756"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:4025303"
FT                   /translation="MSDFAQPTKIRLRVEGMDCASCATKIENALQRLPGVQEVFVSIPA
FT                   GTVIVSHDGSEADDGIRQRVSDLGYRVAQVDAAGSSNHRQQQADDEASHAEDGPSHLHE
FT                   HTSGGGPWWRTRKGILTIASGLALAVAYVLGKAVPTEHWAFLLAMLVGLVPIARRAVSA
FT                   ARVGTPFSIEMLMSVAAIGAVVIGATEEAATVIFLFLIGELLEGVATSRARASIQDLTR
FT                   LVPKTARVEEDGQVREVQAETLAVGALIQIRPGDRIPADGMIVSGQSAIDEAPVTGEST
FT                   PVRKRPDDTLFAGTVNGDGLLRVRVTAAAADNTIARVVRLVEEAQESKAPTERFIDRFS
FT                   RIYTPGVVAVAILVAVVPPLLFGGVWSNWIYKGLAILLIGCPCALVISTPAAIAASLSA
FT                   GARRGLLLKGGAVLEQVGKVTMACFDKTGTLTAGKPQVTDVIGLARSENDVLRFAAALE
FT                   AGSSHPLATAILAEAHKRDIPIPATSESEAVGGKGIRARVDGLHVFLGSPSAAAEIVSL
FT                   KPDDELRFAGLNDEGKTVSVLLIGQLLAGAIAMRDEPRPDAEKGLRLLSKAGIKAVMLT
FT                   GDNLRTATAVGKQLGIDVQAGLLPQDKQRIVAQFRNKGWTVAKIGDGINDAPALAAADV
FT                   GIAMGGGTDVALETADAAVLHGRVSDIAAMVDLSKRTMVNIRQNIAVALGLKAVFLVTT
FT                   IVGLTGLWPAILADTGATVLVTLNALRLLAPSGANEADEK"
FT                   /protein_id="YP_571945.1"
FT   misc_feature    183006..183191
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4535"
FT   misc_feature    183009..185141
FT                   /note="zinc/cadmium/mercury/lead-transporting ATPase;
FT                   Provisional; Region: zntA; PRK11033"
FT                   /db_xref="CDD:170902"
FT                   /locus_tag="Nham_4535"
FT   misc_feature    order(183021..183029,183036..183038)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Nham_4535"
FT   misc_feature    183555..184142
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Nham_4535"
FT   misc_feature    <184671..184988
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Nham_4535"
FT   gene            185354..185638
FT                   /db_xref="GeneID:4025304"
FT                   /locus_tag="Nham_4536"
FT   CDS_pept        185354..185638
FT                   /locus_tag="Nham_4536"
FT                   /gene_family="HOG000272123" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus assembly PilZ"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109659"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="GeneID:4025304"
FT                   /translation="MEELRRKRRSRVLKAGTISFGGATISCVVRNLSTVGALLDVESPL
FT                   GIPRCFTLLVASDSFAKECRVIWIKEKRVGISFEQPNDGGVQHRASEPE"
FT                   /protein_id="YP_571946.1"
FT   misc_feature    185360..185617
FT                   /note="PilZ domain; Region: PilZ; cl01260"
FT                   /db_xref="CDD:163963"
FT                   /locus_tag="Nham_4536"
FT   gene            185607..186200
FT                   /db_xref="GeneID:4025305"
FT                   /locus_tag="Nham_4537"
FT   CDS_pept        185607..186200
FT                   /locus_tag="Nham_4537"
FT                   /gene_family="HOG000274233" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109660"
FT                   /db_xref="GeneID:4025305"
FT                   /translation="MCSIARRNLNDGDRDRPLSARPRARRTQMYGICKKWLRSMTAGAI
FT                   CLLAALIDMHAVAAARGGLASENPLAAEHVDALPTDIRRAVAIRKRACGNKAAAAHYFS
FT                   VSIEAGGRRFVSLHFEDFVCANRAAVCVADRCLHEVYLESHGRYRIVFRTHASDLKLIN
FT                   AGAAGIEVTDGTSRQFFRWNGRRFVSVRTIKNGW"
FT                   /protein_id="YP_571947.1"
FT   gene            186204..186719
FT                   /db_xref="GeneID:4025306"
FT                   /locus_tag="Nham_4538"
FT   CDS_pept        186204..186719
FT                   /locus_tag="Nham_4538"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109661"
FT                   /db_xref="GeneID:4025306"
FT                   /translation="MVSSIIGHLHFGGADLSFRKKFRLFFTVAAVVLLLGGIKAAVHFF
FT                   GFEFLELNRLLTSGIGGAIFIIGFLLSSILADYKEAERIPADIRTSIEAIDGDLESFAV
FT                   INNDFDLIASRRILIATIDKLRTGRGHASDHKNIPPVLDEIGKLTPIFGRLEGLGMSYP
FT                   QTLQVKQL"
FT                   /protein_id="YP_571948.1"
FT   gene            complement(187482..188288)
FT                   /db_xref="GeneID:4025307"
FT                   /locus_tag="Nham_4539"
FT   CDS_pept        complement(187482..188288)
FT                   /locus_tag="Nham_4539"
FT                   /gene_family="HOG000004276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine phosphorylases family protein 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:92109662"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="GeneID:4025307"
FT                   /translation="MATPPILDNKNTSSPSVFLPSALLRESRRQKNLPVSQVPPVCLLD
FT                   PDGDLVGKLRQTGQAKRFASWPCYHTELDTFMLAGREIGIVGRVVGAPSAVLVAEELFA
FT                   SGCRLLISLTSAGQIVPCGPTPYFIIIDRALRDEGTSYHYAPPSEFSEACPLLVSKAFD
FT                   ATSRIEPRVVVGSTWTTDAPFRETAEAIRAAKLKGILAVEMEAAALYAFAQAAGAKLLC
FT                   LAHVTNTMGQGGADFDKGEADGTTDALEMLDRVVEALSHTIDTPAA"
FT                   /protein_id="YP_571949.1"
FT   misc_feature    complement(187512..>188015)
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Nham_4539"
SQ   Sequence 188318 BP; 37009 A; 57088 C; 58148 G; 36073 T; 0 other;
     GCAGTTCATC GACGAGATCG ATCGGCAAGC CCACTGGGAA AACGTGTACC GCACCAAGCG        60
     AGAGTATGAA GTCAGCTGGT TTCAGGAGAA CCCGGCGCCA TCCCTGGAGC TTATTGCACG       120
     TGCCGGCTTG TCCAACGAAG CGGAGATCAT CGACATCGGT GGCGGCGCCT CACGCCTGGT       180
     TGATGGTCTC ATCGACCGCC GGTTTCGCCG CATCACTGTG CTCGATCTCT CGGCGGCCGC       240
     CCTTGCCGAC GCGAAAACAC GTCTTGGCCG CGCCGGCGCC GGGGTAGAAT GGGTTGTCGC       300
     GGATGTTACG CGATGGCACC CGACGCGTAC CTACGATCTC TGGCACGACC GGGCTGCGTT       360
     CCATTTCCTG ACGGACCCGA CTGATCGTGA GGCTTACATT GCGTGCCTCA AAAAGGCCGT       420
     CGGCCCAAGC GGGCATGTCG TCATCGGCAC GTTTGCGCCG GACGGTCCGG AGCGGTGCAG       480
     CGGACTGCCG ATCATACGCT ATGACGCCGA TGCTCTTGCC GCCGTGGTCG GGGCGGAATT       540
     TACATTGGTC GATTGTCGGC GGCACGATCA TTTGACCCCG GGCGGCAATA CGCAGCATTT       600
     TCAATTCAGC GTCTTCCAAA GAAATTGAGT CGGTATCGTA TACTTGTCCA GCATCGTCAC       660
     GTTGCGTTCC GCCTTGCGGC AGCGACTTGC GATCAAAGCT TGACCATCCG CAGACGTAGT       720
     GCATTGCCGA CCACGCTCAC CGAGGAAAGC ACCATCGCGG CGGCGGCTAC GATCGGAGAA       780
     AGCATTTTCG TAGATATCGA TCCTAGGCCG CACTCCTGCC GCAACTTGCG ATATGCTTAA       840
     CGGGAGCCGG GAATTCGATC ATGCAATTTG AGTCCGTCCT GACCTGTCCG AAATGCGCTC       900
     ATCAGGCCCT GGAAACGATG CCTGCTGATG CGTGCCAGTT TTTCTATGAG GCTGCGGAGA       960
     GAGGCTTAAG CCACTTGCCG GGGACTGTTG CGTTTTCTGC TCTTACGGTT CGGTGCCGTG      1020
     TCCCCCAATC CAGAATGATG CAAATCTGCT GCCCACCGGG GGCCTCTTAG CGCGCAAAGG      1080
     CGCAAAAAAG CGCCTCGCTG GCGCATATGT GAAGTGGCTG CGGCTGGTCA AGTTCCGTGG      1140
     CCTGTGTGAT GGTGGGTCAT GGATGTACGC CGACTCATCG GTCGTTTGCT TGCGGTCTTT      1200
     GTGATCGCCG GGCTCGTTAC TGCACCACTG GTGACGCCAG TGGCTGCAAG CGCACTGTCC      1260
     ATCTCCGAAA TGACCGGGAT GTCGGCTATG TCCGCCGACA TGCCCTGTTG TCCGGACGAC      1320
     CAGAAGAACA AGAACTGCCA TGATTGTCCC CTGGTTGCGA TGTGCGTCCT TAAGACGTCG      1380
     CAGGCGGGTC CCTCTCTGAC GGCGGCCCTA CCGCTGCGGC AGGCGATCCG GACGACACAT      1440
     GCGGTTAGGA ACGACGTTCT AGCCGACGGC CTTGACCGCC CGCCTCCCGA CCATCCCCCT      1500
     CGAAACCTGG CCTGACCGGC GCTTAGTCGT CGGTTGCTGC CGCACGCCCT CAGGCGTGCG      1560
     GGCAAATGCA TGCCGCTTAA CGGCAGATTC AGGACAATCG AGGATTTTAG AGAAATGAAG      1620
     ACGTTTACTC TGACGCGCGC CGTCCAGGCG GCGCTGATCG CTGCCATGAT GGGCGGCGCA      1680
     AGCATGGCTG CTCTGGCCGA CATCAAGGAT TACAAGTTCG AACTCGTCGA CCAGACCGTT      1740
     CAGGCAGGTC CCGACAAGGT CATCACGGTC CGGCTCTTGA ATACGAAGAC CGGCAAGCCT      1800
     GTGCCCGATG CCGTCATCTT CGCGAGCCGC CTGGATATGA CTCCAGATGG CATGCAGGAG      1860
     ATGGTCACCA AGGTCGAGGC GGTACCGGCT GCCGAGCCTG GCACCTACAG GTTCAAGGCG      1920
     ACATTCGGCA TGGCCGGCCG CTGGCAGCTT TCGCTCGGCG CCAAGGTCCA GGGCGAGACC      1980
     GGCACCGTCG AGAACAAGTT CGTCATCACG GCGCAGCAAT GAACCGCGCC GTCGTCACCA      2040
     GCGCCACCGT CGCCGCATTG ATCGCGGCGG CGGGAGGCGG GTTCGTCGCG GCGCGTTCGC      2100
     CGTGGTCCGT GGCAGGCGTC ACCGGCATGG TCGCTCCCGC TGCGGCGGAG GGCGCTCCCA      2160
     CGCCGATCTA CTATCAGGAT CCCGACGGCA AACCTTCGTA CTCGCTGACG CCGAGGAAGA      2220
     CTCCTGACGG CCGCGACTAT CGCGCCGTCC CGGCGAGCGC CGACGTCAGT TTCGACAACG      2280
     ACGCTCCGGA GCCGACGCCC ACGGCGTCGG TCGGCGGCTC CAAAGAGCGA CGCATCAAAT      2340
     ACTACCGCAA CCCGATGGGG CTCCCCGACA CGTCGCCCAA ACCGAAGAAG GATTCGATGG      2400
     GGATGGACTA CATCCCGGTC TATGAGGGCG AGGATTCCGA CGACGGGTCG GTCAAGTTGT      2460
     CTCCGGGCAA GATCCAGCGC ACCGGCGTGA AGTCGGAACC CGCAGCAAGG CGGGTGATTC      2520
     GGACGATAGT CTGCGCTCCC GGCACCATCG CGCTCGACGA GCGGCGGATT TCCGTCATCG      2580
     CGATGAGGTC CGAAAGCTTT GTCCTGAAGG TCGCCGACGT CACGACGGGA TCGCACGTCG      2640
     TCAAGGGCCA GCCGCTGATG GAGATCTATA GCCCGTCGGT TTCGTCCGCC GCCGCTGAGT      2700
     ACCTCACGAC GATCACCTCG AAGACGACCA GCGGCAACGT CCAGTACGGT CGGGGATCGC      2760
     GGCAGCGTCT GATGAACCTC GACGTTCCGG ATGCCGCCAT TTCAGCCATC GAGAAGAGCC      2820
     GAACCGTACC GACATCGATC GAGTGGAGCG CACCGCGCGA CGGCATCGTT CTCGAGCGCA      2880
     ACGCGATCGA GGGCATGCGT GTCCAGCCGG GCGGCGTCCT GTTCAGGATC GCCGACCACT      2940
     CCGTCGTGTG GGCGCTGATC GACGTTGCCG AACGCGATCT CGGCGCCATC GCCGTCGGCC      3000
     AGCCGGTCAC AGTCAAAGCG CGGAGCTTTC CCGGGCGGGA GTTCACCGGA AAGGTCGACG      3060
     TGATCTATCC AGAGATTAAC AAGGAGACGC GGACGGCACG CGTCCGTGTA GAGCTAAAGA      3120
     ATGCCGACCT GATCCTGCTG CATGACATGT ATGTCGATGC CGAGATCAAT ACCGGCAGCC      3180
     CCGAGGCGGT ACTGGCGATT CCGGAGAGCG CCGTGCTCGA CACCGGCGCC CGGCAATCGG      3240
     TGCTTATCGA CAAGGGACAA GGCCGTTTCG AGCCGCGCGA GGTCAAGCTC GATCAACGGG      3300
     GCAACGGTTA TGTCGAAGTC CGGTCGGGTG TCGCGGACGG GGAGCCGGTT GTCGTTTCCG      3360
     CGAACTTCTT GATCGATGCG GAGAGCAATC TCAAGGCGGC GCTGAAGGGA TTCTCTGAAA      3420
     CGGGAGCTCA ACCATGATCG CCCGCCTAAT CGCCTGGTCG GCCCGCAACC TGCTGCTGGT      3480
     GTTCTTCGGT ACCGGTTTCG CCGCAGCCGC GGGAATCTAT GCGCTGGTCC ACTTGCCGCT      3540
     CGACGCCATC CCCGATCTCT CCGATACCCA AGTCATCGTC TACACCGAAT ATCCGGGCCA      3600
     GGCCCCGCAA GTGATCGAGG ATCAGGTCAC CTATCCGCTG ACGACGGCGA TGCTGACCGT      3660
     TCCCCACTCC AAGGTCGTCC GCGGCTTCTC GTTCTTCGGC GTCTCCTTTG TCTACGTCAT      3720
     CTTCAAGGAC GGCACCGACA TCTACTGGGC GCGCTCGCGC GTTCTTGAAT CCCTCAATAG      3780
     CGCGGCATCA CGGTTGCCGG CCGGGGTCAC CCCTACGATC GGGCCGGACG CTACCGGCGT      3840
     CGGCTGGGTC TACCAGTATG CGGTGATGTC GAAGGAATTG AACCTTTCCG ACACCCGCGC      3900
     TATCCAGGAC TGGAATCTGA AGTTCGCGCT GGCAAAGGCT GAGGGCGTGG CCGAGGTCGC      3960
     AAGCGTCGGC GGTTTCGTCA AGCAATACAA CGTCATCCTC GATCCACAGC GCATGCGCGA      4020
     TCTCGGCATT ACGATGCAGA AGATGCGCGA CGCGATCCGC GCCAGCAACG CCGATGTCGG      4080
     CGGCCGCACC GTAGAGCTGT CGGAGTTTGA ATACGTTATT CGCGGCAAGG GCTATCTGAA      4140
     AGACATCAAC GATCTGGGCA GCATCGTTCT GAAGACCAAC AACGGCACCC CGGTTCTGCT      4200
     GAAGGATGTC GCCCGCGTCG AATTGGGTCC GGACGAGCGA CGCGGCATCG CCGAATTGAA      4260
     CGGCGAGGGT GAAGTCACAA GCGGCATCGT GCTGCAGCGG TTCGGGGGCA ATGCGCTCGA      4320
     CGTGATCCGG AACGTCAAAA AGCGATTCAA GGAAATCGCC AGCAGCCTGC CGAAATCAGT      4380
     GGATATCGTG CCGGTTTATG ACCGCTCGAA TTTGATCATC GCAGCCATCG CGACCCTCAA      4440
     ACACACGCTG CTTGAGGAAA GCGCGGTGGT CGCGCTGGTG TGCATCATAT TCCTGCTGCA      4500
     CGTCCGCAGC GCTCTGGTGG CGATCCTGAT GCTGCCGGTC GGCGTGCTGA TGGCGTTCGG      4560
     TGCGATGAAA CTGCTGGGGC TCGGCTCCAA TATCATGAGC CTCGGCGGCA TCGCGATCGC      4620
     GATCGGCGCC ATGGTCGACG CCGCGATCGT CATGATCGAA AACGCCCACA AGCACCTGGA      4680
     GCGGGCCGAG CCCGGACGCT CGCGGGTCAA TATCCTGATC GATGCGGCCT CTGAGGTCGG      4740
     TCCGGCGCTG TTCTTCAGCC TGCTGATCAT CACGGTGTCG TTTATGCCGA TCTTCACTCT      4800
     GGAATCGCAG GAGGGACGAA TGTTCAGTCC CCTGGCGTTC ACCAAGACGT TCTCCATGGC      4860
     GGCGGCAGCG CTGTTGTCCG TGACTCTTGT TCCGGCCTTG ATGATCGTCT GCGTCCGCGG      4920
     CCGCATCGTC CCGGAGCACA AGAACCCGAT CAACCGCTTC CTGATCTGGA TCTATCGCCC      4980
     GGTGATCAGG GGCGTGATGC GCGCCAAGAC GCTGGTGATC CTGCTCGCGC TTGGCGTGCT      5040
     GGCGGTCTCC GTCTGGCCGG CGCGCCAGCT TGGCACCGAA TTTATGCCCA ACCTGAACGA      5100
     GGGCACGCTG CTTTACATGC CGACGACGCT GCCGGGCATT TCGGTGACCA AAGCAGGCGA      5160
     ACTGCTGCAA ACCCAGGACA GGATCATCCG GTCGTTTCCG GAGGTCGCAT CAGTGTTCGG      5220
     CAAGGCCGGA CGTGCGTCGA CCGCCACCGA TCCGGCGCCG TCAGAAATGT TCGAAACCAT      5280
     CATCAATCTC AAGCCGAAGG AGCAATGGCG CCCGGGCGTG ACGATCGACA GTCTGACCGC      5340
     CGAGATGGAC AAGGCGCTGC AATTCCCCGG CGTCTCCAAC GCCTGGACCA TGCCGATCAA      5400
     GGCGCGCATC GACATGCTGT CGACGGGTAT CCGAACCCCG GTCGGGGTAA AGGTGATCGG      5460
     CATCGATCTA GTCGAGATCG ACAAGCTCGC CAAGCAGATC GAACGGGTCT TGAAGGTCGT      5520
     GCCCGGAACA TCGTCGGCCT ACGCCGAGCG CACGATCGGC GGATACTATC TGGACATCAC      5580
     GCCGGATCGT GCGGCATTGG CGCGCTACGG CATCATGATC CAGGACGTGC AGGACGTCAT      5640
     CGCGACGGCG CTGGGCGGAC AAACGGTCAC GACAACGGTG GAAGGCCGCC AGCGCTTCAC      5700
     CGTCAACATG CGTTACCCGC GCGCGCTGCG CAGCGATCCG CAATCAATTG CCAACGTCCT      5760
     GGTGCCGATG CCGGGTGGAG GTGCGGTGCC GCTCGGCGAA GTCGCCAAGA TCGCGCCGAC      5820
     GCGCGGGCCG ACGTCGATCC GTACCGAAGA TGGACAACTG GCCAGTTACA TCTATGTCGA      5880
     CATCCGCGAT CGCGACCTCG GTGGTTACGT CGCCGACGCG CAGAAGGCGG TGCAGGCGAG      5940
     CATCCAGTTT CCGCCGGGTT ACTATGTGGT CTGGAGCGGT CAGTACGAAT ATCTCGAGCG      6000
     CGCCACAGCG CGGCTCAAGA TTGTGGTTCC GGTAACGCTG CTGATCATCT TCCTGCTGCT      6060
     CTACCTCAAC TTCCGTTCTT TGACGGAAAC CATGATCGTG ATGCTGTCGC TGCCGTTCGC      6120
     GCTGGTCGGC GGGCTATGGC TGATGTGGGC GCTTGGCTTC AATTTGTCGG TCGCCGTCGC      6180
     CGTCGGCTTC ATCGCGCTGG CCGGCGTCGC CGCCGAGACC GGCGTGGTGA TGTTGATCTA      6240
     CCTCAACCAG GCACTGGCCG AGATCAAAGC GCGAAGGTTG ATCGAGGGCC GGGCCCTCAT      6300
     GCGCACTGAC CTCTACGATG CCGTCATGGA GGGCGCGGTC GAACGCGTGC GGCCGAAGAT      6360
     GATGACGGTC GTCGCCATCA TGGCCGGCCT GCTGCCGATC ATGTGGAGCA CCGGCACGGG      6420
     CTCGGAAATC ATGCAGCGAA TCGCTGTGCC GATGATCGGC GGCATGATCT CCTCGACGCT      6480
     GCTGACGCTG ATCGTGATCC CGGCGATCTT CGCCCTCGTC AAAGGTTTTA GGCTGCCGAA      6540
     CGGCGTTAAT CGATCTACAA CGCCGACGAC TCCGACGATG CGCGCGGCAC GACGGATTCC      6600
     AGAGCCGGCC GAATGAGGTG AATCATGATG AACGGAATGA TGACGTCCGG AATGATGTGG      6660
     GGCATGGCGT TGGTCTGGCT GCTGGTGGTC GCTGTCCTGG TCCTCTCGAT GGCTGCACTG      6720
     GTGAAGTATC TGTTTTCTGG ACACAAGGGA GACCGGCAAT GAGCAAATTC GGAATCTTGG      6780
     TGCTGCTCGC TATCGCATTT CTGTCGCCGG CTCTCGCCGA GCAGGGTAAC GCTGCGCGTG      6840
     GTCGGAAGGA TTTCAAAGCT TGCGCGCCAT GTCATTCTCT TGAACCCGGC CGCAATATGA      6900
     CGGGGCCCAG TTTGGCCGAT CTCTGGGGGC GGAAAGCCGG TGGGGTATTG AGCTTCGACC      6960
     GCTACTCCGA CGCGCTGAAG GCGTCCGGGA TTGTCTGGAA TGATGACACG CTCGATCAAT      7020
     GGCTGACCGA TCCGCAGAAC GTGGTGCCGG GTAATGAGAT GCCGTTCGAC GGCATCAAGG      7080
     ATGTTGGCGC CCGCGCAGAC CTGCTGGCGT TCCTCAAGGA GGCTACGAAG CCCGGAGCCG      7140
     CACCCGCGCG GACCGCACAA AGCCAGATGA AGGGCATGAG CGGCATGATG GACGGCGGCG      7200
     GCCATGACCC TAATCTGAAA AGCCTTGAGC CCGCCAGACA GGTCAAAACG ATTACCTATT      7260
     GCCGCGACAC CTATCGCGTC ACTACCGCCG ACGGCAAGAT GCGCGCGTTC TGGGAACGCA      7320
     ACCTCCGCTT CATGACGGAC ACAAGCAAGG ATGGACCGGA GAAAAATGCG CCCGCGATTA      7380
     TGCCTGCGGG AATGATGGGT GATCGTGCCG CGATAATCTT TGCCGAACCG GAAGAGATCG      7440
     GCAGGTTTAT CGAGCCGCAT TGCTAGGTGG TGAGATCGGT CCGTCCCTGG TCGGATTCCC      7500
     CCCTCGATGC CGGATTTATT ATCCGCGAGG CATCATCGTT TGTAACCGAA CCGGATTGAC      7560
     CAGCGAATTG ATAGAGAAGA CGCCAAGCAT GATGAGCCAC GAGACCGAAC TGAAGGCACT      7620
     TATGCTTGCC AGCCTGGATG GCGACGCGGT CTCGCACCGC GCACTGCTTG ATCAATTGAG      7680
     CCGCTATCTG CGGGCGTTCT ACAAACGCCA TCTGGACCGC ATCGGGCGAG GTCCCGAGGA      7740
     GGCGGAGGAT CTGGTGCAGG AAGCCCTGCT GGCAATCCAG CTCAAGCGTC ACACGTTTGA      7800
     CGTCGAGACG CTGCTGACCC CGTGGGTACA TGCGATCGCA CGCTACAAGC TGATTGACTA      7860
     TCTCCGGCGC AATCGCGCGT TGCTGGCGTA TTTGCCGATC GGGGATCACC ACGAACTCGC      7920
     GGCGGCCGAC GATCAGATCG CCGTCGAGAG CACGCACGAC ATCGGGCAGT TGCTGAACCG      7980
     TCTGCCAACG AAGGTCCGTC ATGCGATTGA GAGCGTGAAG CTCGAGGGTC GAAGCGTCGC      8040
     AGAAACAGCC GTCCGGTACG ATATGACGGA ATCGGGCGTT AAGATCAGCA TCCATCGCGG      8100
     CATCAAGGCT TTGGCGAAAC TGATCGGCAG GGAGACCAGG GCATGAAGAC GGAAGAACTG      8160
     GTCAACGCGC TCAGCAACAA CACCGAACCC GTCGACCGCG GACTCGTCGG GCGGATGGTC      8220
     GGTATCGCCT TGGGCGCCGG TGTTACCGTG GCCTTTGAGG CGCATCGGCG ACTCCTGAAT      8280
     GCGAGGCCAT TTTGGAAAAG CTAATTGATC ACCGAAGAAG CTTCAGCGGC ATTCCGCACG      8340
     TGACATATAT CAATATGCTG GTTCAGAATT GCGTCATCAT GAGGTGAGTA TCTCCGGAAC      8400
     CCACGCGCTT ACTTCCGACC ACACTAAGTC GAATAGCGAA ATAGCCGGAG CAGGTATCCT      8460
     CCCCCGCCAA AGCCAACAGG AGAACAAGAT GACCAATAAG AACGACACAT CGCAGCAGTC      8520
     CGTATCGGCG CATGGTTGCT GCGACGGTCA GGCTTCCAAG GAAAAGGCGG CGCTCGCGGC      8580
     TGCCAAGCCG GAAGCGGCCC CATCCTCAGC GGCAAAGCGT TCAGCGCCGG CGGAAGCCGC      8640
     CGGATCTTGC TGCCACGGCG AGGGCTCTTC CGATGCTGAT CATAAGAAGC AGCACGAGCA      8700
     TCAATCATAG CCGTCGTGCG AGGTGCGAAG CAATCATCCA TGACAACGAG CACGCTCAAC      8760
     GTCGGCGACC GGTTCTCGGT CGTTGATGCC CAGAAATTGT GCGGCCATGA CATTTCATGG      8820
     GCCCGTCCAA TCCAGAATTC CGTTTACCGG GAACGGTCGC CTATCTGAAC AATTCCGGGC      8880
     ATTCGCGACA ACACTTGTTC CACACGATGA TGTAAATCAG GTGCAGGGTG CCGAGACCGG      8940
     CCAAAAAACA GAAGAATGAT ATGTAGGCAA AACTCAGAAA CGTGTAGTCC ACAACTGTGA      9000
     TGGCAATAAG CGTCAATCCA AACAGGCGTA TGTGCAGGTA GGTCGAGATC ATGGTCGGCG      9060
     TAATGAGCAG AAAAACATAG ATCAGATAGG TCAGCCAGCG CGGGATCAGA TAATCGAGAA      9120
     ACATGGTGTC TTCATAAGCC AGTGACTGTC GGTTAATCCT GACATTTACC CAATCTGGAT      9180
     GGAAAAGATG TGGGACAAAG AGGATCAGGC CGAAAACAAG CCCTGCCAAG GCAAAGCCCA      9240
     GCAATGGCAA TTTGCGCCGA CTGCCTGGAG GTTCCAGAAA ATAGATGCTG AACGGGACCC      9300
     AGACCGGCCA AATCACCCAA GAGAAAAAGA TAAAGCCCAT GGCGGCCCAC CAGATCATGG      9360
     ATTGGTCGGA GTTGTTCACT CCCATCCAGA CATGGCCCTC CATCAATTGC TGAAGCCCGG      9420
     CCAGTGTCGG CATTTGAGAA ACCGGAAAGT ACCGTTTGTT TATCTTGAAG GCTTTCCAGC      9480
     CTGCAAACGC ACCGCCAACA ATCAGGACGC CGCCGGCAGC AAAACTCACG GGTTCGCAAA      9540
     AGCACATACT CAATTCTCTA TCGCCGGTAG GAGTAAGCTT CAATGACCAA GATTACGCTC      9600
     GAAGTCGGAG ATCTGTTCTC GGTCCTCGGC GCACACGGGA TCGAACGGCA GGTACAGCGT      9660
     GTTGCAGGTG TCGGTCACGT ATCGGTCAAT CCGGTCTCCG GCTCGACGAC CGTGATGTTT      9720
     GACCCGGGGA AGACCAGCCC TGCCGCAATA CAGGAAGCGA TCAAGGATTG CGGCTTTCAT      9780
     TGTGCGGGCG AAGCCGTGCC GAAGCATATT TGCGAAAAGC CCGCGATGCG GGGTTCTAGT      9840
     TCGAAGGCCC CGACCAGCCA GCTAAAGCCT GCGGATTCCG AAACGCATCA GGATCATTCG      9900
     GGGATGGCCG GCATGAAGCC GGCCGACACG ATGGCTAAAC CCAAGGCGCA TGGCGGGGAC      9960
     AAGAGCGATG CTATGGCCCA TGAAATGGGC CACGGCGCTG GCATGGACAT GCAGGTCATG     10020
     GTCCGCGACA TGCGCAACCG CTTCTGGATC GCGCTTGCCT TCAGCCTGCC GATCTTTCTC     10080
     TTTTCTCCTA TGGGCATGGA CTTCATTCAA ATTCCGCCAC CATTCGGCCT GCGGCTGGAT     10140
     CTGATACTGT TCGTTTTAGC CAGCGCCGCC ATCCTCTACC CGGTCTGGCC CTTCGTTGTT     10200
     GCAGCCTACC GAGCGCTCCG CAGCGGTGTC GCCAATATGG CGGTGCTGGT CGTCCTCAGT     10260
     GTCGGCACCG GGTACCTGTT CAGCGTCGGG TCCACGTTCT TTTACGGTGG CCAGCAGTTC     10320
     TACGAAGCGT CTGCAATCCT GCTGGTCTTC ATCCTTCTCG GACACTGGCT CGAAATGCGC     10380
     GCAAGGGCAG GGGCATCTGA AGCCATCCGC GCACTCATGG ATCTGGCGCC GCCCAAAGCA     10440
     ACGGTGCTGC GGGATGGCAA GGAACTGGAA GTGGCGACCG CCGAGATCAT TTCGGGCGAT     10500
     ACGGTCGTGA TCAGGCCCGG GAATAAGATC CCGGTCGACG GGACCGTGCT GGAAGGCACA     10560
     TCCCAGGTCG ATGAATCCAT GCTCACGGGT GAATCGATGC CGGTGGCCAA AAAAGCCGGC     10620
     GACGCGGTGA TCGGCGCGAC TATCAACAAG AGCGGTGCGT TTCACTATCG CGCGACCAAG     10680
     GTCGGCGCTG ACACGGCGCT CGCCCAAATC GTCAAGCTGG TCCAAGAAGC GCAGAACTCC     10740
     AAGGCGCCGT CACAACTGCT TGCGGATCGT GCGTCGCAAT GGTTGGTCCT GGCGGCGGTT     10800
     GCGGTGGGCC TTCTTACGTT CGTCGTCTGG TATTGGTGGA TCGGCCAGAC GCTGCTGTTC     10860
     GCGCTCAGCC TCACGATCAC CGTCTTCGTG ATCGCGTGCC CGGATGCCCT TGGGTTGGCG     10920
     ACCCCAATGG CGATCATGGT CGGAACCGGG CTCGGCGCCA TGAACGGAAT TTTGTTCAAG     10980
     AATGCGTCGG CGCTGGAGGA CGCGACCAAG TTGAACGTCG TCATCTTCGA CAAGACCGGC     11040
     ACGCTGACGA TGGGCCATCC CGAGGTGGTG GGTCTGGCGA TAGCTGTTGG CGCCACCGAG     11100
     GAACAGTTGC TATCTGCGGC CGCGGCGGTG GAAGCAGGAT CGGACCATCC CTTGGCGCAG     11160
     GCAATACTGC GCCGGGCCGC CAATGTGAAG GCGCCAAAGA CGACCGGTTT CGGGAACATC     11220
     GAGGGCAAGG GCGCGCAAGC CGAGATCAAC GGGAAGATAG TCTTGCTCGG CAACAAGTTG     11280
     TTGATGTCGG AGAATAACAT TGATCTCGGC GAACTTGGCG CGAAATCCGA GGAGTTGCAG     11340
     GGCGCTGGCC GGACCGTCGT CCACCTCGCA GTGGACCGCA AGCTCGTGGG TTTGATCGCC     11400
     ATCGCCGATG CGGTAAGGCC GACCGCGGTG GAAGCGGTCA AGTCGCTACG CGCGCGGGGT     11460
     GTCGAGGTCG CAATGCTAAC CGGAGACAAT CAGGGCACGG CAGAGCGGAT CGCGCAGAGT     11520
     ATCGGGATAG ATAGAGTGTT CGCCAACGTG TTGCCTGGCG ACAAGGCAGG CAAGGTCAAG     11580
     GAGCTGCAAT CGCAAGGTAA GAAAGTCGGC ATGGTCGGCG ACGGAGTGAA TGACGCTCCG     11640
     GCTCTGACAC AGGCCGACGT CGGCTTCGCG ATCGGAGCCG GTACGGATGT CGCAATGGAA     11700
     AGCGCCGACA TCGTCCTGAT GAAAAGCGAC CCATTCGACG TGGTCGGCGC CATCGAACTG     11760
     TCCCATGCGA CGCTCAGAAA AATGCATCAG AATCTTTGGT GGGCAGTCGG CTACAACGTC     11820
     GTCGCCTTTC CTCTGGCCGC TGGTGTTCTC TATCCGTTTT TGCTCAGCCC AACCATCGCG     11880
     GCCATTGCCA TGTCCGGCAG CTCGGCGCTG GTCGCGGCCA ATGCACTGAT GCTGAAGCGG     11940
     ACCAAGCTGA CGGGTATCCG TCGTCAGCGC CCCACTGCAT CTCCTGAGAC GTTCACCTCC     12000
     GTCGTGGCGA CGTCGTGATC TTACGCGGCG CATCGGGCGT GCCGCTGAGC ACTATGGCCG     12060
     TCTTGATGGC GTCGGTGTTC ACAGTGTCGA TTGGCTACGG TGTGGTACTG CCTCTGCTCC     12120
     CATATCTCAT AGAGCGTCTG CTCGGCGCGG CTGCCGATGC GGCGCAAGTA TCGCGCTCGA     12180
     CCGGGCTGCT GACAGGCCTC TACACATTGG CTCTCTTTCT CTTTGCTCCG GCTTGGGGAC     12240
     ACATGTCTGA CCGGTACGGA CGTCGCATCA TCCTTCTGAT CGGTTTGATC GGTTTCAGCG     12300
     CCACCATGTT GACCTTCGCA TTCATCGAGA ACCTGACGGC GGTTTACGCC GAGCGTTTCT     12360
     TGAGCGGTAT GTTCGCCGCT GCGGTGACGC CGGGCGCGCT GGCCACGATC GGGGATCTCG     12420
     CAGCGACAGA TGAGGCACGA GCGCGCCGCC TCACCTTCGT CAGCCTAGCG GGAATCAGCG     12480
     GGTTTCTGCT CGGACCTATG CTTGGCGTCT TCGTTGTGCG GAGCGCAGGG AGCCTGCTCC     12540
     CGATTGGCGG CGGGGCCGGA GCACTGACCT TGCCACTGGC GGGGACTGCG GTCTTGGCGC     12600
     TTCTTGTGGC GGCCGCTGCC GCCGTGACCG TACCTGGAGT GAAGCGGGGC GATGCTACCC     12660
     CCAAGCGCGA CCGAGCAGAT CTGGCGCCTA GCCGCTGGCT CGTTCCCAAG CTGCTTACCC     12720
     TCGCATTCGT CGTCTCTGCT GGAGTGGGTG TGTTCGAGGT TGGATTAGCG CTTCGCGGCA     12780
     AACAGGAACT CGGGCTCACC CAATACCAGA TTGCGCTGAT GTTCACCGAG TGCAGCTCTG     12840
     TGATGTTGGT CGTGCAATCG ATCGTCTTCT CGCCTTGGAT CAAACCCAAG ACCACGCGCT     12900
     GGTTTATTGC GCCGGCTCTC GCCATCTTGG CGGCAGGATT ATTCCTTGTC CCACGTGCGC     12960
     CGGACTTCAC GCTGACGCTC GCGGTGATCG GGGCGGTGGC GGCGAGCGCC GGTATTCTCT     13020
     CTCCGATCCT GACCTACTGG ATATCGATCA AGGCCGGCAA GGCGCAGGGA GCGGAACTTG     13080
     GCAAGCAAAC GGCCGCATCA AGCCTTGGTG CTGCCGTGGG GTCCGCAGCC GGAGGACTCC     13140
     TCTTCGATGT TGCGCCGCTG CCGCACGCCT CGTTTTTGCT GGTAGCTGTG CTAACCGTCC     13200
     TGGGTGTCCT GTTGAGTCTC GGCCTTCCGA ATGCGCTTGT GACGCGGAAA CTCGGCGAAG     13260
     CCGCCTGCAA CGGGGAGGGC CGCGCCGTGT CTTAGATTAG GCCTGATCTT CTCGCCCCCT     13320
     CCCGTTGGAA ATTGTATGCC TGACAGGAAA AGCTTGAGTA TCGGGCATTT GACTGGTGCG     13380
     TGATCGAACG CCCCGGCTAT GTTCCCGGCA CGAATCAGTC CCATCAGAGG CCCCTCGCTG     13440
     GTGGGTTGGC GGCCGTAGGG CTGGCGACCG GCGCAGGAGC CGTGTTGGCA GCGTCATGCT     13500
     GCGTGCTGCC CGTTGTCCTT CGTGGCTAGG AACAAGCGTT ACGCGGGGCT AGAAGCACCG     13560
     CGGTTGTTCT GGCCGCAGCA TCAATGCTCG TTGTCACCGC AGCAAACTGG GACGCACTAG     13620
     AACGGACGCT GCTCAAGATC GTGCGAGCGA ACCGCCGATG CAGTTGAAAT CCACGCTCAC     13680
     TTGTCCGAAT TGCGCCTATT AAGCAATCGA GAAGATGCCG ACGGACGCCT GCCAGTTTTT     13740
     CTATGACTGC AAAGGTTGCG GCCAGCGGCT AAAGCCTAGG CAGAGTGATT GTTGCGTGTT     13800
     TTGCTCTTAC GGCTCGGTGC CGTGTCCGCC GATTCAAGAG AACGGAAAGT GCTGCTAACT     13860
     AGTTCGGAAT TATCTGAGGC CTCATCAGAT ACTCGGCGGC CGCCATAGCC AACACGGCAA     13920
     CAACAATCCA GACCCATCGC GGTGTTGATC CTAAGTTCAT GACAAGCCTC CCAGCATACC     13980
     CAACTTTGAA ACCATTCCTG GGCCCCGCTG TGGAGCCATT CCATAAGACG ATGGCCGGCA     14040
     CTTCGGCGAG GTTGTGCTCA TAACCGAGAA CGCTGACTGA CGCCGTGCTG AGAAGGAGAT     14100
     GCTGCGCCTG CCTTATCTCC AATCCGATCC AACGCGCGGC CATGACACGC CCGAAATGGC     14160
     CGTGCGAGAT GGCGATATTA CCCTTAAACG TCCGGAGTCG AGCAATCAGC CGATCTGCGC     14220
     GTTCGGAAAC TTGGGCGGGC GATTCGCCGC TTGGGCATCC GTCTCGAAAG ACGTTCCAGT     14280
     CCGGCCGTGC CTTGCGAATA TCCGCAGGGC GCTGTCCCTC GTAGTCGCGT AGTCCCACTC     14340
     CGCGAGGTCC GGTTCTGGCC CGAGAGCGAC CAAGCGGTTT AGCCGTGTCG CATCAGATAA     14400
     AGGCGCGAGA GCAAGCTCGG GATGCCCGTC ACGTCTTTGC ACCCCACCGC CAGTTGCGGA     14460
     TTTCCGGCAT GTCTTCGCCA TACCTGCGGA TGTAGTGCTT ATGCTCGGTG AGCTTGTCCT     14520
     GAAGCTGCTG CTTCAGATAA GCCCCCTTGG CACTCAACTG CGGTAGGCGG TCGATTACAT     14580
     CGATCACCAG ATGGAAACGA TCCAGATCGT TAAGCACGGT CATGTCGAAG GCGGTGGTGA     14640
     TCGTGCCTTC CTCTTTGTAG CCGCGGACGT GCAAGTTCTC GTGGTTGGTA CGGCGGTAGG     14700
     TCAGCCGGTG GACCAACCAT GGGTAACCAT GGAACGCAAA AATGACCGGT TTATCCTTGG     14760
     TGAAGAGTGA ATCGAAATCT GTATCGCTCA AACCGTGCGG GTGCTCGTTC TTCGGCTGTA     14820
     GCTTCAGGAG ATCGACGACG TTGACCACCC GGATTTTCAA GTCCGGAAGA CGTTGGCGCA     14880
     GAATCGAGAC AGCGGCGAGC GTCTCCAGCG TAGGCACGTC GCCGCAGCAG GCCATTACAA     14940
     CGTCTGGCTC AGAGTCTTGG TCACTGCCAG CCCATTGCCA GATGCCGATG CCTTCTGAGC     15000
     AATGCGCGGC GGCGGCGTCC ATGGTCAACC ATTGGGGTGC CGGGTGTTTG CCTGCAATCA     15060
     CGACGTTGAC GTAATGGCGG CTACGCAGGC AGTGGTCCGT CACCGACAGA AGGCAGTTGG     15120
     CGTCGGGCGG AAGGTAAACC CGCACGATCT CGGCCTTTTT GTTCATGACG TGGCCAATAA     15180
     AACCGGGGTC CTGGTGTGTG TAGCCGTTGT GATCCTGTCG CCAGACATGT GAGGCCAGCA     15240
     GGTAGTTCAA GGAGGCGATC TTCCGACGCC ACGGCAGGTG TGACGTGACC TCCAGCCACT     15300
     TGGCATGCTG GTTGAACATT GAATCGACGA TGTGGATGAA CGCTTCGTAG CAATTAAATA     15360
     GTCCGTGCCG CCCGGTGAGC AGGTAGCCCT CGAGCCAACC CTCACACTGG TGCTCGCTCA     15420
     GCATTTCCAT CACGCGCCCG GTGGGCGCGA GAAAATCGTC GTTCGCCGCG GTCGTCGCGT     15480
     CCCATTGGCG ATTGGTCACC TCAAAGAGCG CTTCCAGACC GTTGGAGAGC GTCTCGTCAG     15540
     GTCCAAAGAC CCGGAAATTC CGTTGTTCGC TGTTCAGCTT GGTCACATCG CGCAGGAAAG     15600
     GCCCGAGCAC CCGGGTGTCG CCGATGCCGC GAACTCCCGG CGAGGGCACG TCCGCTGCGT     15660
     AGTCGCGGAA ATTCGGCATC CGCAGGTCGC GGAGCAAAAT GCCGCCGTTA GCGTGAGGAT     15720
     TCGCACCCAT GCGTCGTTCG TCCTTGGGCG CAAGTTCAGC CAGCTCCGGC TTTAGGTGTC     15780
     CGTGCTCATT GAAGAGTTCC TCCGGCCGAT AGCTCCTCAG CCAGTCTTCC AGCAGCTTGA     15840
     GGTGTTCAGG ATGGGTGGCC GGGTCAGAAA GCGGCACCTG GTGCGCACGG AAAGTACCTT     15900
     CAACCTGCAG GCCATCAACG ACCTTGGGCC CGGTCCAACC TTTGGGTGAA TCAAGGACGA     15960
     TCATCGGCCA GCGTGGACGC GTGACATTGC CGTGGATGCG GGCGTCCTGC TGGATTTGTT     16020
     TGATCTGCTC CACTGCCATA TCGAGCGTTG CGGCCATGGC CTCGTGCATC AGCGCGGGCT     16080
     CGTGGCCCTC GACAAAGTAG GGCGCCCACC CATAACCCCG AAGCAACTGC TCCAATTCCT     16140
     CGCGCGTGAT GCGGGCGAGG ATCGTCGGGT TGGAAATCTT GTAGCCGTTG AGATGCAGGA     16200
     TCGGCAGTAC CGCGCCGTCG GTCGCCGGGT TGAGGAACTT GTTGGAATGC CACGCCGTGG     16260
     CCAGCGGTCC GGTTTCAGCT TCGCCGTCGC CGACGACGCA GGCCACAACG AGATCGGGAT     16320
     TGTCGAACAC CGCACCGAAA GAGTGGCTGA GCGAATAACC CAGTTCGCCG CCCTCGTGGA     16380
     TCGAGCCTGG GCACTCCGGC GATGCGTGGC TGGGAATGCC TCCGGGAAAC GAAAACTGAG     16440
     TGAAGAGTTT CCGAAGCCCG GCCTCATCCT GGCTGATGTC GGGATAGATC TCGCTGTAAG     16500
     TGCCCTCGAG GTAAGTGTTG CCAACCACGG CCGGCCCGCC GTGCCCAGGT CCAGAGACGT     16560
     AAATCATGTC CAGGTCATAT TTCTTGATGA CGCGATTCAG GTGGACGTAG ATGAAATTCT     16620
     GCCCGGGGGT CGTGCCCCAG TGGCCCAACA ACATGTGCTT CACATCCGCG AGCGTCAGCG     16680
     GCCGCTTCAG CAACGGATTG TCGTAAAGAT AAATTTGCCC GACCGAGAGA AAGTTGGCCG     16740
     CCCGCCAATA GGCATCCATG TTGTGCAGCA ATTCCGGGCT AAGCGTCTTT GAGTCTGCCG     16800
     TTGTCTTCAT CGTTCGACTT CCTTCTGCGC GTCAAGCCAA GGGCGCGTAT GACTGAGCTT     16860
     GCAATTATGA TTTCGTCGGT GCGAACGGTG CGCCGTGACT TGAGATAGTC CGGGTAGGCC     16920
     CGTAACGGAC TTCTGCTCGA ACCTTGGTAA CGGCAACTGG CCGTCACATG TCTCCATGGG     16980
     CTCTTTCAGC GTCGTCGCCG ATTAAAGTTC TAAAAGCTTC ACTGGTGGCA GATCCTTCAG     17040
     CCCATCTGAC GGTAGGTGCT TCGGTATGTC GAGTCTCGCC ACACCGATCC GGTTGTCTGC     17100
     CATCCCATAG TAAACGTCGA AGCGATCGGG TGACCCGAGA TCGTCTCGCC GATCGATGCC     17160
     GGTGGGGAAT ACGACGTTGG CGACGATCCC TTGGCGTTCC TGCGGCAATT CCGGTATCAG     17220
     CACCGGCTCC GGCGAACGAA AGCGAATAAC TTGAGGATGC TCCTCCGAAA GCACCAGCAC     17280
     TCCAGCCGAG TAACACAGCA GCTTGCGTGG AAACCCGGGA GCGGCCGAAA GCTCGCTGAC     17340
     GCCGTGGTAA ATTGTCAGCC AACCGTGACG GGTCAGGATG GGTGGGGTAC CACCGCCGAT     17400
     TTTAAGCCGT TCCCAGGCAG CCATTGGGGC GGCCAGGCGG TGATGCGAGC CGAAATGACT     17460
     GAGATGAAAG GGTTCACAGT CTGCCAGGGC CGTCGAGCAA TAGGAAATCC AGATGCTTTC     17520
     GCGGTCGAGA TCCACCAAGC CGGACCCAGG ACGGCGTAAC GTTTCCTCCG GGCGTGTTCC     17580
     TGGAAACAAC GGCCGCTGTA GGATGGCCAT TGAGAGCTGT CCCGATGGAT CTGGTATAGC     17640
     GACAGGGAAG ACGCTGGCGT CCTTGTTGTC CACGCCTTCG AACTCAATGC CCTCATACGG     17700
     TCGGAAGGTA GCCAACCCCA GGCGTTGCCA GCGGAACAAG TTTTCGGATA TTGCCAGCGC     17760
     GATCCGTGGG CCGTTCGGGG AATGCGCAGT GTAAGTCATG ACGTAACGTC GGAGCGGCTC     17820
     GACAAACGTG ATACGCGGAT CTTCGCAGCC GCCGGTACCG TCCGACCGCA GTTCGTAATC     17880
     CATTTCAGGT TCAAGTGCGA TACCGAGTCG CTCGACCCCG ACCGGATCAC CGATCTCATT     17940
     GAACAAAACC CGCGCTATAC CGATGCGGGA GTGGTTACCC CGCGCGACCA GCCGCGGAAA     18000
     AAGGTAAAGC TGACCGTCCG GACCACGCGC GGCGGCTGGG TTCAGGACGC CTTCGGCTTC     18060
     CAGAGGATTA CCTGGCTCCG GTTCCATCAA CAGTCCAAGA CGCCGCAATT GGAAATCACT     18120
     CATTGCGTCG GCTCACTTGG TCGCGCTTGC TGTCTAAACA AGCAATGATG GCTTCGATAA     18180
     CCCGTTTCGT CTCATTGGGA TCCCTGACCT GGATAGAAAC AACCCCTGCT TCCTTGGCCG     18240
     GATAGTCGTT TCCGCCGGGG AACAAGGCAT CCCCGATAAA GATCATCTCG CTGATTGCGA     18300
     CGCCCAGAAT GTCTCGGAGT TTTTTAATCC CGTAGGCTTT GTCGATGCCC TGCTTGGTGA     18360
     CATCCACGGA AGTCGTTCCA CCCAAGCGCA CGGAAAACTC GGGAATAGAG TTATCAAGGA     18420
     ATGCTTTTAT CTGCTTTCGC TTGGAAAAAT CCGGGTCCCA CTTCTTCTTC TCTTCCAAGG     18480
     GAGCCTCCTG ACCTAGCGCG GAGAAAGTGA TCTGACTTTC TCGGTCCTCA ATCGGCTCCC     18540
     CCCAGACCAT TTCGGCGTTG AAGCCCAATG CTCCAACCGC CTGGTGCAAG GAACCAATAA     18600
     TTTTCGTCTT CTCCTCATCG GTGAAGTTTT CCGAATAGAG TTCTTCCCAG GCTGAACCGT     18660
     ATCTGTAGAA CTTCGTTCCG CACGTCGGGA GGAGGGATAG GTTCTCAAGA TTTGCATCGC     18720
     GGGGGAGATT CGAAACCAAT TGCCTTTCGA ATTGTGGCCA GTTTCCGCCG GAAATGACCG     18780
     CGACTTTGAC GATGCTAAGA AGGTCGCGCA GAAGTGCCGA CATTTCGTCA TCAAGCGACG     18840
     ATTTGCTTTC AGCAATTGTA CCATCCAGGT CGAAAACGAT CAGCGTTTTC ATCGATACTC     18900
     CGCTTCACCG CTATCACCTA GGCGGTCATG GAGTCTCGCG CGTCCGTCGG CGGGCTCCTT     18960
     TTCGACAATT TCGCTATCCG CCGCGTTGCC GTTCAATTGA AATACACGGG TAGTACCGCC     19020
     AAGGAACTCG CAGAGCTTGC CGTCGATACA CAAGGAAATC GGTGCCGCTG CATCGTCATG     19080
     CCCGTGGACC GTGAGTGAGT CGCGCGTCAG CCGCAGATCG AGTGAATGCC CGCGGTACCG     19140
     GATAGACATG TCGAGGCGCT CTATTTCCTG CGGCAATTCC GGGTTGAGTC GCAGAACATC     19200
     GCCTCTTACT TCGATACCAG TTGATACGCG CTGCATTAGA TCGACAGTTC CCGCCATGGC     19260
     GCCGAGGTGG ATGCCCTCTG CGGTGGTGCC CTGCTGGATG TCACTCACGT CGCTCTGGAG     19320
     CGCTTCCGCG AAGAAGTCCA TGGCGCGCTG CCGGTCGGAA CGCGCCAGCA CCCAGGCATG     19380
     CACCACACGG CACAGCGTGG AGCCATGAGA CGAGCGCGCG GCGTAATAGG CGACGTTTCG     19440
     CGGGATGGTT TCATATTCGA ACGGATATCC CAGACGCTCG AACAACTCGC CGATTTCCTC     19500
     GGCAGAAAAC AGGTAGAACA ACATCAGCAC GTCGGCCTGT TTTGAGAGCT TGTAGCGGTT     19560
     GGCGCTGTCG TTCTCCATTT CGAGGATAAG ATCGAGACGC TGAATATTGC CGTACCGGGC     19620
     TCGGTAGTCC TCCCAATCAA ACTCACGCAA TTTTTCGTAG CCCTCGAACT GGCTGATGAT     19680
     GCCGTCATCA TGGAACGGTA CATACATCTT GCGGCTGATA TCGCCCCAGC GCGCGATTTC     19740
     CTCCGCTGAT AAACCAAGTT GGGTCGTGAG CTCGGCGCGC CGTACCTTTG ACAGCAGATC     19800
     GTGCACCTCC AGCGCCCGGC ACAGCACCCA TACGGCCATG ATGTTCGAAT AAGCGTTGTT     19860
     GTTGAGGCCG GGCGTTGCCG AATCCGGCGT GCCATCGTGA AACTCGTCGG GACCCATCAC     19920
     GCCGCGGATC TCATAGCGCC CACGCACGTC ATCGAAGGTC GCGATACTCG ACCAGAAGCA     19980
     GGCGATATCG AGGATCAACT CCGCGCCGTA GGAATTGAGA AACTCGACGT CGTGAGTGAC     20040
     CTGGAAGTAC TGCCAGACGT TATAAGCGAT GGCGCTCCCT ACGTGACGCT GCAAGTAGGA     20100
     GTTATCCGGC ACCCAGCGCT GCGAGCGTGG ATTCAGGTTG AGCGCCTGGG TCTCCTCCTG     20160
     ACCATCGCTT CCACTCTGCC AGGGGAACAT CGCGCCCTTG TATCCGGCTG CAATGGCGGC     20220
     CGCGCGCGCT TCGCCAAGGC GCCGGTAACG GTACATCAGA AGTGATCGGG TGATTTCTGG     20280
     CATTCGATAA TTGAAAAAGG GGAAGATAAA CAGTTCATCC CAGAATACAT GGCCCTGATA     20340
     CGCCTCGCCG GTCCAGCCCC GCGCGGGCAC GCCGATATCG ATTCCGATGG AGTTGGGCGA     20400
     TACGGCTTGC AGCAGGTGAA ACATGTCCAA CCGCAGTAGC ATCTGGACGT TCATCCTGAA     20460
     CCCGGGTTCG GCGGGCTGGA TATGTACGTC GAAGCGGTGC CAAAGGTGTC TCCATGCGAG     20520
     CACATGGTCC GCCATCAAGG CATCGAAGCG ACCCACGCGC GCAATAGCCT TGCGTGCCTC     20580
     CAGCGCGCAC TCTGAAATGG CTTGATCGCG CGAGGTATAG AAAGAGGCCA GCTTCTCCAG     20640
     CACCAGCCTT TCGCCTTGTT TGACGTCGAT TTTCAGTTCC TGCCCGATGT ATCCCGGTTC     20700
     TTCGATGACC CGGCGTTGGA CCGTAAGAAT CTGTCCGTCG AGGAACGCTC GCGTTCGTGC     20760
     CGCCTGCGCG ACATGAATAT TCGACTGGCA GGTGCGAACC TGCAGGCACA TGCTGTCCTC     20820
     GTCAACAACC TCGCTCGTCA GCGGTTCCAA GTGCTTGTTG TTGAACTTGC GGTATAGCTT     20880
     CGCGCCCGCG TTGATGACGC GTCCGTCGAT CGCCGAACGC ACCGTGACGC ATGCCGACCA     20940
     GTTGTCGGCG GTCAGCGTCA GTTCCAGCGC GCCAAGATGC ATGCTGCCCA TCGATATCAG     21000
     GCGTCGTTCC TTGAGCGTAC TGCGCCGCCC CTCGGCGTCT TCGAAGCCGA CGCTTCGCAA     21060
     CAGCATGCCG TTCCGCAGAT CAAGCTCCTG GTGGTAGGAC AGGAGTTTGA CGGTTCGCGC     21120
     ATCGAACCAG TCCTGCTCGG CCATGCGAAA CTCGAGCGCG AGCCAGTTCG GGCAATTCAC     21180
     GAGATCCTCG CTCTCGACCA CGCGGCTGGC GATGTTGGTG CGTAACCGAT TGTAGCCGCC     21240
     GGCGAGGTAG GTCCCCGGAT AGTGAATGTC ATTCGCGATC GGCCCGGCGG CGGCGCCTCG     21300
     CGTCGCGAAA TAGCCATTCC CCAAGGTGCA TAAGGCTTCG CGGATACCCT CTTGCGCCGG     21360
     GTCGAAGCCC TCATACGCCA GTGACCACGT GGAAGGGGGT TCCACTGCGA CCTGGACTTG     21420
     CGCCAGATCG GTCACGACAA CATCGGCGCC GGCATCGCGC AGCGCCATCG CATGTCCGCT     21480
     GCGATCCACG CCGATGACGC AGCCGAACCG GCCGGCGTGA CCGGCCGCCA CACCAACGAT     21540
     GGCGTCCTCC ACGACGACGC CACGCGAAGC TTCAGCCCCG ACGCGCCGTG CCGCCTCCAG     21600
     AAAAGCATCC GGTGCCGGCT TACCCGTAAG TTTCAGACGA GTGATGTCCG TCCCGTCCAC     21660
     TCGCGCGTCG AACAGTTGCG TTATACCGGC AGCCTCGAGC ACCTCCGCGC AGTTAACGCT     21720
     GGAGGACACG ACAGCAGTCT TGATCTCCAG CGCCCGGAGT TTGCGCACCA GCGCGACCGA     21780
     GGTTTCATAG GGATCGACGC CGTCCCGCTT AAGGTGTTCC AGGAAATACC GGTCCTTCAG     21840
     ATTGCCGAGT GCGTGGACGC TTTGCACCTC GGCGCCGTCT TCGGGTGTAC CCAGCGGCAA     21900
     TTCGATCCGG CGTGATTTGA GGAAGGATGC CACGCCGTCG TAACGCGACT TGCCGTCGAC     21960
     GTAACGTGGG TAATCGGCGT CGATATCAAA GGGGACGAAT GGCTCGCCTG ACTGGGTGGC     22020
     GTGCTGCTCG AGAAACCCGT CGAACAGCTT TTTCCAGGCC GATGCATGCA CGGTTGCCGT     22080
     CCTGGTCAGC ACTCCATCAA GATCGAATAG AACCGCGTCG TAGTCCCGCG GGGAAAGTGT     22140
     GATGACGACT TGCATCGTGC CTCCGGCTTG GCGCGCGTTT TGCAGTGCTT TCGGACGGCG     22200
     GGCGTCCGAT ACGTCGAACC CGCCAAACTT CGCCTTCCAC TTGTAGCGCG CAGTGTCGCT     22260
     GATACTTTTG CCTGCAGCTC GGCGACGTCA CGGCTCAAGT GGAAGATTGG CAAGACCTAG     22320
     AAGCGCGGGC GATTCCTCTA GAATAAGGAG AGTCGGAATT CTGCGAAGAT AGTCTTGGAA     22380
     CCGACCCTTG TCTTCGAAAC GGTCCCGAAA CGGAGAGGAG GCAAATGCCT CCTTGAAGCG     22440
     GAGCAGAATC CCACCTGCGA TGTAGATGCC ACCCGTTGCG CCTATGGTGA GCGCTAGATC     22500
     GCCGGCCACT GTCCCCAGCA TTGAACAGAA AACCTCGAAT GCTTTCACGC AGGTCGGATC     22560
     GCTTCCCCGC ATTGCCCGAT CGGTCACATC TGCCGGCGAT AACGGATCAG GACGTTTGCC     22620
     TTCTATTGAA CAGAGTGCCT GATAGAGATT CACCAGGCCC GCGCCCGAGA GTGCGCGCTC     22680
     CGCCGAGACA TGCGGCCAAT GGGTTCGAAG TACTTCAACG ATGAGACTTT CCGCTTGCGT     22740
     AGCCGGCGGC AACGTCGAAT GTCCGCCTTC GCCAGGTAGC AAGATCCATC TGCCGGCGTC     22800
     CGGAACCAGC GCGCTAACCC CGAGACCAGT ACCGGGTCCG ATGACGCCGA CCGGGCCGCT     22860
     CGTCTTCGAT TGAGGCGGTC CTATCGGATA GCAGTCGGCT TCCGGGAGAT AAGGAACCGA     22920
     CATTGCGGTA GCGGCGAAAT CGTTGACAAC GACGAGTGAG CTCATACCCA AGTCGGCCTT     22980
     GAGTGCGGTT ATTGAGAAAG ACCAGTTGAG GTTGGTCAGT TTCACCTCAT CTCCGGACAC     23040
     AGGACCGGCA ACTGCAAGCG CTCCTCTGGT GGGTCGCAGG TCGCGAGGCA GCGCAGCCAA     23100
     ATACTCGCCG AGTGCGTCCT TCAAGGCAGC GTATTTGCTC ACGCTCAGAT GCTGAAGCTC     23160
     ACTGTACTTT CCGCGTTCTG CGACAGCGAA TCGGGCGTAG GTCCCGCCGA TGTCGCCGAT     23220
     TACCCGCAAG GCGGTCATGC TTTTCCCCAT TCAGCGTGAT GTATGCCGCG AGAATGGCGA     23280
     TGACTCCCGT GATCGCGAAT GACACGGAGT TCGCGTCTGC ATTGGCCATG GTAATCGCTC     23340
     GTCGCTGCTC GCCGCGGAAA GGAGAGGGAA AGGGAACCAT CGGCGTCACA CAGTTTGAGG     23400
     GTCGTTGCGT TTGTATTCAT CCTTCAACTG GCTTTCCATC ATCGAGACCG AAGAGGCGTA     23460
     CCACTGACCT CGCAATCATG ATTTCTTCGT CGGTGCGAAT GACACGCACC GCGACCCGAC     23520
     CACCGTCAGT CGAAATCAAG GACGCGTTCT TCGCGTTGCG CTTTTGGTCC AGTTCGATGT     23580
     CAAGAAAGCC GAGTCCGTCG CATATCCGCT CCCGAATGAG TGCCGCGTTT TCGCCGATGC     23640
     CTCCTGCGAA GACGAGCGTA TCCAATCCAC CGAGCGCCGC GGCGAAAGAC CCAATCCATT     23700
     TCTTGGCCTG ATAGCAGAAC AGCGCCACGG CTTCTGCCGC GCGAACGTCG TCGGATTCCC     23760
     TTGCGAGCAA ATCGCGCAAG TCGGAACTGA TCTCGGAAAC TCCAAGCAGT CCGGACGCTT     23820
     GGTTCACCAT TTCCCAAAAG TGCGACGCGC TCATTTGTTC GGTGCGCGCC AGGTAGGAGA     23880
     CCAGTCCCGG ATCCAGATCC CCCGAGCGGC TACTCATCAC CAATCCGGAC GTTGGTGTGA     23940
     AGCCCATGCT AGTGTCGATG CTGTTACCGT CGCGCACGGC GGCCAGGCTC GCGCCGTTGC     24000
     CGAGATGAGC CAGGATCACG CGACCCTTTG TTGCCGCCGG GTCGCCGAGA CGTGCGAGTT     24060
     CCTCCATGAG AAATTCATAA GACAAACCGT GGAAGCCATA ACGTCGAACG CCCGCCGCCT     24120
     CGTACCGTCG AGGAATTGGC AGCAGACTGG CGACCCGCGG CATGGTGCGG TGAAACGCGG     24180
     TATCAAAGCA CGCCACCTGA GGCAGTGCAG GGTGGTGTTG ACGAAAGGCC TCTATCGACT     24240
     CGATTTCAAG CGGCAGATGG TCCGGGTCAT ACGGCATGAT GCGGTGCAAT TCATCAAGCA     24300
     ACTCCGGAGT AACCCGCTCT GGTTCGCTGT GCGTCATCCC GTGTACCACT CGGTGTCCTA     24360
     TGGCTTTGAC TGAAGCGAAC GCCTGCTGCG TTTCGAGCCA ATCCAATAGA AAGCCGACGG     24420
     CCGAATGGCG ATCGCTGGCA TCGATGGCGT GACTGTTCTG CGATTGTCCG GTGGCATCCT     24480
     TGAAGGTAAA ATTCGTACCG CTCAGACCGA TACGATCCAC CTTCCCATCC AGCAGCCGCC     24540
     GTAGCGGCTC GCCCACATCA AACAGCGCGA ACCTGATGCT GGACGAGCCG CCGTTTATCG     24600
     CTAAAAGAGA ATACGGCCCG CGGCGTGCCT CCAAGGCTTT GGTGGGTATG GCCAACTGAT     24660
     GAACCTTTCA ACTAACTATC GAGGAGCATG TCGGATCGCC TACCGTCAGC TCAAAGTAAT     24720
     GTTACTCTTC GAACGTCGTT GTTTGGGTTG TCGGTGCAGC GCGCCAACGC TCGCATAATA     24780
     TCTTCGCGTG AAATGATTCC GACCCAGTCG ATGATCCGCT TCAATCACCG GAATACTCTT     24840
     GATACGATGA TCGACTATGA GTTGCAGCAC CCGCGTAAGC CTGGTTGTCT CGTTAACGTA     24900
     GATGAATTCT GGCGTCATCA CGTCAGCAAC TGTTCGATTC ATCAATTCGT CATAACGTGG     24960
     AACCATTTGA CCCGGTCTGA ACGCAAAGCA ACTCAGAAAA TCAAATTTCG TGACTAGGCC     25020
     CAAAACTCGC GCGTGTTCCT CGACCGGATA GGCATTGAAG TCGTTGCTTT CGAACAGGAG     25080
     GTTGAGTTCG CGCATTGTAA CCTGACGCGT CACGGTCTTG ACCGGGCACG TCATATAATT     25140
     CGCGACTAGT CCCTCAAGAA ATTCGTACAT GAACACGATC AATCGCTGGC TCGTTAGAGC     25200
     GGCACGTGCA GAGTCTTCGC GCCAACTACC CTGCCTGGTC GCTCGCTCGT ACCTTAACTT     25260
     CTGGCGTGGG GACAAAGTTA ATTAAGATCA AGGCGCAACC GGGGAGCCAG CTTTAATTTG     25320
     CGGGTTGCAG CAGCAAGTTC GAAAGCCAGG TCTGGTTCGC CCCTGATGAG GTGCGCGGTC     25380
     AAAGAAATTT ACCGAGCTCC GAGCACGCAC TGGCCGATGG CAGGGACTTG AACCACTAAC     25440
     CTGTTCTGAC GGCAGGGATG GTTGACTTGC TACCCACCTG CTCTCATCTT CGAGGAATAT     25500
     CACTCGTTGC GCTTTGCGAA TTTACTTCAG CCGTCTCAAT TGCTTATGCT TTATGCTGGG     25560
     CGAGGCTGAA CTCTTCGCGG GCGGGGGCTG ACTACTTTAT TGCGTGGAGT TTCAGAGCAA     25620
     CCTGTGAGCA AGAAGATCAA GAGAAGGAAT AGGGGAGGTG ACTACAATTC GGCCCTCGTT     25680
     CGATGCCTCA GCTCCGATCA ACGTTTGCGG TTTGCAATCG ACCAAGCTGG CGTCGGAACA     25740
     TGGGACTTGG ACTTGGCGAC GCAGGAACTT TTTTTCTCCG ATAGGACAAG AGCCCTTTTC     25800
     GGTCTGTCTG CCTTCAAAAA CCTATTGTTG GATGACTTCC ACGCTTCCCT AGGGGCGGGG     25860
     TATCGAGGCC AAAGCGACCT CCGGTGACTA CTTAGGGAAT GTGCCTTAAG GTATCGAGCG     25920
     AAATTTCAAT GGATAGTGAT CCCAAGTAGA AACAGCCATC CGCCGACGAG GAGATGGCAA     25980
     ATGTTGACCC AACCACTCAG TGCGCCCGTT ATTCCCACCA AGTTCAGCAA GATACCCAGC     26040
     GCTGCGGCCG ATGAATTTTG TTCGGTCACC GGCCATGCCG GCCTTGTGGC GACGGAATTC     26100
     TCCTACAGCA AAGATGCAGA AATATACGGC GAAGAGGAAC TTGGCGAGTA CGTCTATCAG     26160
     ATAGTCCGCG GCGCCGTTCG AACTTACAAA CTGCTTTCCG ATGGTCGGCG CCAGATCGGC     26220
     GCGTTTCATC TGCCTGGCGA CTTTTTCGGA CTGGAATCAG GTCCGGTCCA TCGTCTAACG     26280
     GCAGAAGCCA TCATCGATAC CACGGTTCGT CTGGTGACAC GTCGAGGGCT AGAAAAGGCA     26340
     GCGGTTACCG ATGTCCAGGT TGCTCGAAGC CTTTGGGCAA TGACGTCCTC AGACCTTCGG     26400
     CATGCCGAAG ATCATATGCT TCTTCTCGGA CGAAAGAACG CGAAGGAACG CGTCGCCACG     26460
     TTTCTGCTGG AGATGGACGG TCGTCTCGCT GGCACGGGGA TGATGGCGCT TCCAATGTGC     26520
     CGGCGGGACA TAGGCGATTA TCTGGGTCTT ACCCTTGAAA CAGTTTCGCG AACGCTTTCG     26580
     CAGTTTCATA GTCAGGAGTG CTGGGGTTTT CGGGGGCCCG CCAAATTTTG CTTCGCAACC     26640
     GCGAGCGTCT CCAGCATATG GATGCGTGAA AATAAGGGGT CGTTCGTGTG CCAGACCGAG     26700
     AAGCGGCTGT TCCATCAAGA AAGGCTCTAC ACGACAAGGA ACGACACCGC ACCGAACGCA     26760
     TCGGCTGGCT GCGCGCAGCG GTGTTAGGCG CGAACGATGG TATCGTTTCG ACGGCAAGTC     26820
     TGGTGCTCGG TGTCGCCGCC GCGCACGGGA GCCGCAGCAA CGTGTTGGTC GCCGGGGTCG     26880
     CCGGCCTGGT CGCAGGGGCC ATGGCGATGG CTGCGGGTGA GTACGTATCT GTCCACTCGC     26940
     AGGCCGACAC CGAAAAGGCC GAACTCAAGC GGGAGCTCGC GGAACTCAAA GCTGACGACA     27000
     AGGGAGAACA TGAGGAACTG ACTGCGATCT ACGTCGCTCG CGGCCTCGAT CCTTTGCTCG     27060
     CGAAGCAGGT CGCCGATCAA CTCATGGCCC ATGATGCAAT AGGCGCGCAT GCCCGCGACG     27120
     AACTTGGGGT CACCGAGACG CTCCGGGCGC GTCCGATTCA AGCTGCGTTC GCGTCGGCTC     27180
     TTAGCTTCGC TGTTGGAGCA GCCATGCCTC TCTTAACCGC TGCCTCCGTC CCGGAGGCGA     27240
     GTCTGATTAT CCTTGTCCCT GCAACTTCAC TAATGTTCCT CGCACTTTTG GGGGCGCTGG     27300
     CGGCGGGCGC GGGCGGCGCC GGTTTGGCGG TGGGCGCAAT ACGCGTCACG TTCTGGGGTG     27360
     CGCTGGCCAT GGGACTGACC GCTGGCGTCG GGGCCTTATT CGGAACAGTA GTGTGAGCAG     27420
     GGCCAACCGA GGACGATACG TTCGTGCTGG GGTGACGAAA TCGAGACCTT CGGGGAAGAT     27480
     CTTGGTCTCG CAAATCGGGA CGATCACGCC GCTTCCACAT CGTTGCATGA TCGGCGAAGC     27540
     CAGATGAAAA CGGTCGACAA TCCCCTCGCG GAAAAACATA CGGACAGCCT CGACAGGTTC     27600
     TGGACCCAGA CGCCAGAAGT TATCTCGACC ACGCTTCATT GCGGGTTGGA AGGCTTGAGT     27660
     TCGAGCGACG CCGAGCAAAG ACTCGCTCAA TATGGACCCA ATAGCGACGC CGAAGCCAAG     27720
     GCCGACAGTC TGTTGCGCGC AATCTTCCGT CGATTGCTCG AGCCCCTGTC GTTAATCCTG     27780
     CTCGCTGCGG GCATCATTTC TGTTGTTACC GGCGATGCGA TCGGCGGGTC AATCATTGTT     27840
     GCGATCCTGG CGCTCTCGAT CGGGCTCGAC ACCGTGCAGG AAGGACATGC GGTCAGGACC     27900
     GCGGATATCC TGCGGCGATC GGTGGCGCTC AAGGCTGAAG TCAAACGCGA TGGAACCTTC     27960
     CATCAGATCG AGGTGGAAAG AGTCGTTCCC GGCGATATCC TGCGCGTGCG GGCCGGGGAT     28020
     ATCATTCCGG CTGACGCGCT GATCCTCCAG AGCACGGCCT GCACGACCGG CGAGGCAGCC     28080
     TTGACTGGAG AACCTTATCC CATCGAGAAG CGCGCTGGCG TAGTCACGGG AACGAACGCA     28140
     GGCGAAGCAT CGAATACATT GTTCCGCGGT GCTGTGGCGC AGACCGGAGA AGCGATCGCG     28200
     CTTGCAGTCA ATACGGGACG CGCGACTGTG TTCGGGGCTG CGGCGTCCGC TCTGGCACAG     28260
     GCTCAGGCAC CTTCCCCTTT TCAGCGCGAT TTACACCAAT TTGGCCTCGT GATAGCGCGG     28320
     TTGACCCTCG CTCTGGTAGT CATCGTTCTC GCGACGCGGG TCCTGTTAGG TCGTCCGGTG     28380
     CTAGATTCGC TGCTATTCGC CGTGGCGCTG GCCGTCGGAC TGACACCTGA ACTGTTGCCG     28440
     ATGATCACCA CGGTCACACT GTCACGCGGC GCGATGCGGA TGGCCGGCCG CAAGGTCATC     28500
     GTCAAGCGGC TCGCCTCGAT CCACGATCTA GGTGCCATGA CTGTGCTGTG CACCGACAAG     28560
     ACCGGCACCC TGACCTCCGC CGAGATTACT CTCGCCCGCA GCCTCGATGC TTTTGGAGCC     28620
     GACGATCCTC GCGCTGCCCG ACTCGGTGCC ATCGCCGCCG ACCTCGGCGG TGATCGCGGT     28680
     TCACTGGACG CGGCGCTGCT CCGCGGTTCG TCGGCGGCGG CGGGGGGCTG GACACTCCTC     28740
     GGCCGGCACG CGTTCGATTT CACTCGCCGG TTGGGATCGG TCCTCGCGGC AGGCCCGGAC     28800
     GGCCAGTTGC TGATCGTCAA GGGCGCCCCA GAGGCCGTGC TGGCACTCTG CACCAAACAG     28860
     CGGCGAGGCA AAGACGTGCT GGCGATGGAT GGAAGGGCAC GGACCGAGGC AATCGACAGG     28920
     GTACACGCGC TCGCCCAGAA TGGACTTCGT GCCGTTGCCG TTGCCTCGCG TCCTTGGTCG     28980
     GAAAAGGCCC ACGAAGTTGA AGTAGCCGAC GAAAACGAAC TGGTATTTGA AGGGGTTTGC     29040
     GCCTTCGCCG ATCCGCCCAA ACCAACCGCG GCGGCGGCGA TCGCACGGCT CGCAAGCGCG     29100
     GGCGTCAGGC TCAAAATCTT GTCGGGCGAC GATCCGATCG TCGTGAAGCG GCTGGCCGGC     29160
     CTTGTCGGGC TCAATGCCGA GAAGGTTCTC TCCGGCAACG ATATCGCCAA ATTGAGCGAT     29220
     GAGGCGTTGG CGGTGCAGGT TCAATCCGTC GACGCTTACG GGCGCCTGGC GCCCGACCAG     29280
     AAGTCTCGGA TCGTCAAGGC GCTTCAGTCA AAAGGCGCGG TCGTCGGGTT CCTTGGTGAC     29340
     GGCATCAACG ATGCGCCGGG CCTGAAGGCT GCGGACATAG GGCTGTCGGT TGAAGGCGCG     29400
     ACGGGTGTGG CACAGGCTGC GGCAGACATG ATCCTGCTCG CGTCGGATTT GGAAGTCGTC     29460
     GCCGACGGCG TCGAAGAAGG AAGGCGAACC TTCGCCAATA TCCTCAAATA TGTGCGGATG     29520
     GGAGCGAGCT CCAATTTCGG GAACATGTTG TCGATGGCGG TGGCCTCCAT CGCCTTGCCG     29580
     TTCCTCCCGA TGCTACCGAC GCAAATCCTT CTCAACAACT TGCTCTATGA CCTGTCCGAG     29640
     CTGGGAATTC CGTTCGATGG GGTGCGCCCA GAGGCGACGG CGCGGCCTCA GGTCTGGGAC     29700
     ATGAGCGGCC TCATTCGGTT CGCGGCGATC ATGGGACCGC TCTCTTCGCT ATTCGATTTT     29760
     CTAACCTTCG GTGCACTGGT GTTTGTGTTC AATGCCTCGC CGGCTGAATT CCGAACCACG     29820
     TGGTTTCTCG AATCGATGGC GACGCAGATC CTCGTCATCT TCATTATCCG CACCAACGGC     29880
     CGGCCATGGC AGGATCTTCC GCGGCCCGCT CTCGCAGCCT CATCACTAGT AGCGCTGATC     29940
     GTCGCGATGG TGCTGCCTTT CACACCTGTC GGCGGCTGGT TCGGCTTCGA GGCGCCGCCG     30000
     CTGGCGATGC TCGTCGGGAC CGGCATCATC GTCATCGTCT ATTTGGTGTT CGCCGAACTA     30060
     CTGAAGCCGC TGGTCGTGCG CTCTCGGCAT TGATCAGCGG CGCCGGCCCA ATGGCGACTT     30120
     GCGCTCCCAC CGGGCCGCTG TTGCTCGCCG CCTTGTATTT CCAGGGTGAC CGACCGCTTA     30180
     TAGCGTAGAG CGGTCGGTCG TCACGCTCAC AACCTGATGT TGATAGTTTC AAATCCTATC     30240
     CCCGCTTTGA ACCTATCTCG CGCCCGAGCT GAATGTTCTG CGACCGAACT AGATTTCGTA     30300
     GCCGGCGGCA GCGAACGTGC TCTCCAGGCG AGATTCCGGG TCGAAACTCC ATAAGAAATC     30360
     AGCGAGCGGC TGATACGAGA AACTGCCGCG ATCCCCGCAG ACCCTGCGCC AGCGCTGGAT     30420
     TATTTTTGGT TAGTTTGGGG CAGAAAACGG AAACGGTCAT TCAGTTGACA GTTTCGGGGA     30480
     CGGCATCGCG ATAGAATGCA CGGCAGCGGC CCCCGCACGT TACACCGCAG GTGTATCGAT     30540
     TGTGTGCGAA AGAGCCGCGA CCACGCGGTC CAGCATTTTG ATGGCGTCCG TCGTGCCATC     30600
     GGCCTCGCCT TTGTCGAAAT CGGCTCCGCC TTGTCCCATT GTATTTGTGA CATGGGCGAG     30660
     GCAGAGAAGC TTTGCGCCCG CCGCCTGGGC GAAAGCGTAG AGTGCGGCTG CCTCCATTTC     30720
     GACGGCCAAT ATTCCTTTCA GCTTTGCCGC TCTGATCGCT TCGGCCGTCT CGCGAAACGG     30780
     TGCATCGGTT GTCCAAGTCG ATCCGACCAC GACCCGAGGC TCGATTCGCG ACGTGGCATC     30840
     GAATGCCTTC GATACCAGCA GAGGGCAGGC TTCGGCAAAT TCGGAAGGCG GAGCATAGTG     30900
     GTAGCTCGTC CCTTCATCGC GCAGCGCGCG ATCGATGATG ATGAAATAGG GTGTCGGCCC     30960
     GCAGGGGACG ATCTGTCCCG CCGAAGTCAG ACTGATCAGC AGGCGACAAC CGCTCGCGAA     31020
     CAGTTCTTCC GCCACCAGAA CGGCAGACGG TGCGCCGACC ACACGTCCAA CGATCCCGAT     31080
     TTCACGGCCG GCGAGCATGA ACGTATCCAG CTCGGTGTGA TAACATGGCC AAGAGGCGAA     31140
     GCGCTTGGCC TGACCCGTCT GCCGAAGTTT GCCGACGAGG TCTCCGTCGG GATCCAGCAG     31200
     GCAGACGGGC GGGACCTGAG AAACGGGAAG ATTCTTTTGT CGCCGCGATT CGCGTAGCAA     31260
     AGCCGATGGC AGGAAAACGG AAGGTGAGGA GGTATTCTTA TTGTCAAGGA TCGGGGGCGT     31320
     CGCCATCGGT CGCACCTTGG TCGATTGAGA AGGAACGCAG TTCATGGACG AGATCGATCG     31380
     GCAAGCCCAC TGGGAAAACG TGTACCGCAC CAAGCGAGAG TATGAAGTCA GCTGGTTTCA     31440
     GGAGAACCCG GCGCCATCCC TGGAGCTTAT TGCACGTGCC GGCTTGTCCA ACGAAGCGGA     31500
     GATCATCGAC ATCGGTGGCG GCGCCTCACG CCTGGTTGAT GGTCTCATCG ACCGCCGGTT     31560
     TCGCCGCATC ACTGTGCTCG ATCTCTCGGC GGCCGCCCTT GCCGACGCGA AAACACGTCT     31620
     TGGCCGCGCC GGCGCCGGGG TAGAATGGGT TGTCGCGGAT GTTACGCGAT GGCACCCGAC     31680
     GCGTACCTAC GATCTCTGGC ACGACCGGGC TGCGTTCCAT TTCCTGACGG ACCCGACTGA     31740
     TCGTGAGGCT TACATTGCGT GCCTCAAAAA GGCCGTCGGC CCAAGCGGGC ATGTCGTCAT     31800
     CGGCACGTTT GCGCCGGACG GTCCGGAGCG GTGCAGCGGA CTGCGGATCA TACGCTATGA     31860
     CGCCGATGCT CTTGCCGCCG TGGTCGGAGC GGAATTTACA TTGGTCGATT GTCGGCGGCA     31920
     CGATCATTTG ACCCCGGGCG GCAATACGCA GCATTTTCAA TTCAGCGTCT TCCAAAGAAA     31980
     TTGAGTCGGT ATCGTATACT TGTCCAGCAT CGTCACGTTG CGTTCCGCCT TGCGGTCGAC     32040
     CGACGATCAA AGCTTGACCA TCCGCAGACG CAGCGCGTTG CCGACCACAC TCACCGACGA     32100
     TAGCGCCATG GCCGCTGCGG CGATGATCGG CGACAGCAAC AGGCCGAACA CTGGATACAG     32160
     CACGCCGGCC GCGATCGGTA TTCCGGCGGC GTTGTAGATG AAGGCGAAGA ACAGGTTCTG     32220
     ACGGATGTTG GCCATCGTTG CTTCCGATAG GAGGCGAGCG CGAACGATCC CCCCGAGATC     32280
     GCCCTTCAAC AGGGTTACCC CGGCACTCTC CATGGCGACG TCGGTGCCGG TGCCCATCGC     32340
     GATTCCGACT TCGGCCGCAG CGAGGGCAGG GGCGTCGTTG ACGCCGTCCC CCGCCATGGC     32400
     GACGATCCGG CCAGCCTTCT GTAGCTTGCT TACGACGGCG CTCTTCTGGT CGGGCAGAAC     32460
     TTCCGCCTCG ACCTCCGAGA TGCCGAGCCG CTTCGCGACC GCATTGGCCG TCGTCCTGTT     32520
     GTCTCCGGTC AGCATGATGA CCTTGATGCC GTCCGCGGCC AGCGCCCTCA AGGCATCAGG     32580
     CGTCGATGGT TTGATGGGAT CGGCGATCGC GAAGAGTCCC GCCAGCTTTC CGTCGACCGC     32640
     GATATTGATG ACGGTGGCGC CGTCGCCGCG GAGCGCTTCA GCCTGCGCTT CCATCGATTG     32700
     GGTTTCGACG CCCAGCGACT GCAGGTAACC GACGTTGCCG AGCAATATGT TCTTGCCGTC     32760
     GACCTTACCC GTCACGCCCT TGCCCGTGGG TGAATCGAAT TCCTCCACGT TTGCCAGCGA     32820
     CAGATCGCGC TCTTTGGCGG CGCGAACGAT GGCGTCGGCC AGCGGATGCT CGCTGGCGCG     32880
     CTCGACGCTG GCTGCGAAAC GCAGCAGGTC GTCCTCCCGG AATCCGGCGG ACGCCACGAT     32940
     GGAGACCACC TTGGGTTTGC CTTCGGTCAG GGTGCCCGTC TTGTCGACCA CGAGCGTGTC     33000
     GATTTTTTCC ATGCGTTCGA GCGCTTCGGC GTTCTTGATC AGGACGCCGA CCTGTGCACC     33060
     ACGCCCGACA CCGACCATGA TCGACATCGG GGTCGCCAAG CCGAGGGCGC AAGGACAGGC     33120
     GATGATCAGC ACGCTGACGG CTGCCACCAG ACCGAACGCC AGACGAGGCT CGGGACCGAC     33180
     CAGGGCCCAG ACGGCGAACG CGACAAGCGC GGCACCGATC ACCGCGGGGA CGAACCAGCC     33240
     CGCCACCTGA TCGGCGAGGC GCTGGATCGG CGCCCGCGAC CGCTGCGCCT GCGCCACCAT     33300
     CTGCACGATC TGCGACAATA CCGTATCGCG GCCGACCTTC TCGGCCTGCA TCACGAAGCT     33360
     TCCGGATTGA TTGAGCGTTC CTGCGATTAC CTTGGCATCG ATTTCCTTGG TGACGGGCAT     33420
     GGACTCTCCG GTCACCAGGG ATTCATCGAC CGATGAACGT CCCTCCAGAA TGACACCGTC     33480
     CACCGGTACC TTTTCGCCGG GACGGACGCG CAATCTGTCG CCGACGTTCA GGCCGTCGAG     33540
     CGGGACTTCG TGATCGGTGC CATCCTCGGC AACGAGGCGC GCCGTCTTCG GCGCGAGATC     33600
     GAGCAGAGCC TTGATCGCTC CCGACGTTGC CTCGCGGGCA CGCAATTCGA GCACCTGGCC     33660
     CAGCAGCACC AGGACGGTGA TCACCGCCGC CGCTTCGAAA TAGACAGCGA CGGCGCCGTC     33720
     ATGGCCGCGA AACGCGGGTG GAAAGACCTG CGGGGCGACC GTGGCGACGA GGCTGTAGAC     33780
     GTAAGCCACG CCGGTTCCCA TCGCGATGAG GGTGAACATG TTGAGGTTGC GGGTCACCAG     33840
     CGACTGCCAG CCGCGCACGA AGAACGGCCA ACCCGCCCAG ATCACGACCG GCGTCGCCGA     33900
     AACGAGTTGA ATCCAGTTCG ACAGGGTTTG GTCGACCCAG CCGTGGCCGC CGACCAGATG     33960
     CCCGCCCATT TCGAGGACGA CCGCGGGCAA GGCGAGCACG AGGCCGATCC AGAACCGTCG     34020
     TGTCATGTCC GCCAGTTCGG GATTCGGCGC GGCGTCCAGC GTTGCCACTT CGGGCTCCAG     34080
     GGCCATGCCG CAGATCGGGC AGCTGCCGGG CCCGATCTGC CTGATTTCCG GATGCATCGG     34140
     ACAGGTGTAG ACGGTGCCTT CCGGAACAGG GTCTTTCGGT GTGGCCTTGG ACTTGTCGAG     34200
     ATACGTTTCC GGGGCGGCCG CGAACTTCGT GCGACAGCCT GCCGAACAGA AATGGTAGGT     34260
     GTGACCTTGG TAATCGAACC GGTGCTTGCT CGACGTCGGA TCGACGGTCA TCCCGCAAAC     34320
     TGGGTCCACG ACCTTTCCGT CTCCCGAAAC GGGATGGTGG CGATGCTCGT GAGCGTCGTG     34380
     ATCATGGCCG CCATGACCGT CACCGCAACA AGCTGCTTTG GTTTCGTCGG GGCCCGGTGC     34440
     CGCGCTTGCC TTCGAGGAGC AGCCGCATTC GCCCTTGGAA TTAGCCTTTT CAGGACTGGT     34500
     CATCTAAGTC TCCTGTGGGG CTTGCCATTC ATACCCTGTG GGGGTATATA GGGCGGATGC     34560
     GCAAAGACAT CAAGACATCG TGCCAGAAAC GTTTGAGCCG GATTGAAGGC CAGGTCCGCG     34620
     GCCTCGCCAA GATGGTGGAG GAGGACCGCT ACTGCATCGA TATCGTAACG CAAATCTCCG     34680
     CCGTTCGTGC CGCCCTGCGC CGCGTCGAGG AAGAGGTGTT GAAGGACCAT GTCGCCCATT     34740
     GCGTCGAGTA TGCGATCGCA AGCGGCGATA AGGCGGATCA GCGCCGCAAG ATCGCGGAAT     34800
     TGATGGCGGT GGTCGGACGG GCGGAACGAT GAACCTCTCG GTTCCTTCTT GGCGGTAGGA     34860
     GGATTCGCGA CTATGATTCC GAATCCGGGT ACGGCAAATC GAAAGCATTG ACGCGTTTAT     34920
     GTTGCTCGGA CTTACCAGGA TGCAACGGCG GAGAGCAGGG TGGTTCATCG CTCTGGCTTA     34980
     TCTGTTTTGC GTGATGGCGC CGACGCTGTC CTTCGCTTTG CCCGGCAGTC AGGCCGCTCC     35040
     TTATTGTCTG ACCGACGAGG ATCATGTGCC GGGCATGATC CATATGCATC ATGAAGGCGT     35100
     GATGCATGTC CACAAGGGCG GACATGACCA ACATCATTCC GGCGTTCAGA CCCACGCGGA     35160
     TTCATCCGCC GATCATGATG CGAAGCCGGT CGCGCTGAAG AGCGACGCCG GTCCGGCTAA     35220
     GGCGCCGCAT TCGGCGGATG GAAAGTGCTG CGGACTGAAG TGCGTCACGG CACTTCCCGC     35280
     GCCGCTCGTC GCCATGACAC AACCGTCGGT GCCGAAGGCC GTCCGGGCGT CCGATCAGTA     35340
     TCGGAAACTG ACGGACAATG CGCCCCCGCA GCGCTATCGT CCCCCCATTT CCTGACCTGA     35400
     CAACAGCATG ACGCTGTGCC GTGCCCCGTG CGGGGCACGC GCGCCTGTGG TCCATCGTCA     35460
     GTTCAGGAAA CTCTTATGTC AGCGCAGCTT GGGGCGACTG TCGCCGCCGT TGGTTCGGTG     35520
     GTGCGCGGAA TATCCGGAAG AAGACTTGGG ACATTCGCAG GGATGGTCGC CGCGGCCATA     35580
     ACGCTCGGCG GCTGCGCGCT ACCCCCGGCG CCGCTGATCG GCAGGGACCC CGCAGATCCC     35640
     GGCGCGAGGA CCGCCGGCGT CGGTTACCGG TCGAGCATCG CGCCTTACAC CAGCTTCCGT     35700
     CCGACGGCGC CTTCGGGTTG GACCGAACAG AACCAGCGCG TCACGCCGTC ACCGAAGTCT     35760
     GGCCACGAGC ATTAGGAGCA CGTCATGAAA ATTATCCGTG GCTTGCTGTC GCATCAGAAC     35820
     CTCCTCCGAA ACAATCGGTC GCCACTGGTG CTGGCCATCT CCCTTGTTCT TTCCGGTTGC     35880
     GCGACCTTCT CGCCGGATCA AGGAATGGGC GTCGTCGCCG ATATCGCCGA CGGCACGATC     35940
     AAGAAGGACG TGATTGCGAT CCGCTCCGTT GACGACGCGC GGCAGGCCGA CGACAACGTC     36000
     AAGCGTCTGC TGCACCGGAC GCTCACCGTA GATACCGCGG TTCAGGTCGC GTTGCTCAAC     36060
     AATCGCGGGC TTCAGGCGTC GTATAACGAG TTGGCCCTGG CCGAAGCCGA TCGTATCCAG     36120
     GAAAGCCTGC CGCCCAATCC GACCTTCTCG GTCTCGCGCA TTTCGGGTAA TGGCGCCACC     36180
     GAGATCGAGC GCCAAGTCGT GGGAGACATC CTCGCGCTTG CGACGCTGCC GTTCCGATCC     36240
     GAGATCGCGA AGCAGCGTTT CCGGCAAGCG CAGCTTCGTG CTGTACTGGA AACGCTTCGT     36300
     CTTGCCGCCG ATGTCAGACG TGCTTACTAC CGCGCGGTAG CCGCAAACGA ACTCGTCGCC     36360
     CTTCTCAGCG GCGCCAAGGC CACCGCGGAA TCCACCGCGC AACTGTCGAA GAAACTTGGC     36420
     GAAACGGGTT CTCTCAACAA GCTCGATCAG GCACGCGAGC AGGTTTTCTA CGCGGAAACC     36480
     ACGGCGGATC TTGCGACGCT GCGTCAGGAA GCAACGAGCT CGCGTGAAGC CTTGGCGCGG     36540
     CTATTGGGCC TGTGGGACGG CGACCTGAAT TTCAAGCTGC CGAGCCACCT GCCGACATTG     36600
     CCGCCACGTC CACGGGCGTT GCCGCGCATT GAGGTCGACG CCGTTGAACA CCGTATCGAT     36660
     CTGCAGGTCG CCCGCATCGA ACTCGATGCG CTCGCGAAAT CCCTGAACCT CACCGAAGCC     36720
     AACCGATTCG TCACTATGCT CGATATCGCC GGCATCGATC GTAAGACTCG AGAACCGGAA     36780
     GGAGCGCCAT TCCGGGAACG GGGATTTGAC ATCCAGTTCC AGATTCCGAT CTTCGACGGC     36840
     GGCGAGGCGA GAGTCCGGCA GGCCGCGGAG ACTTACAACC AGGCCTTCAA TCGTCTGACC     36900
     GAAAAGGCCG TCAACGTCCG GTCGGAAGCG CGCGACGCTT ACCGCACCTA TCGCTCCTCC     36960
     TATGAAATCG CCAGCCAGTA TCAGCGCGAG GTCTTGCCGC TGCGCAAAAT CATCACGGAA     37020
     GAGATGCAGT TGCGCTTCTC GAGCATGCAG GTCGACGTCT TCGCGCTGCT GACGGAAGCG     37080
     CGTCAACGCA TTGCCTCGTT ACGTGCGGCG ATCGAAGCCA AGCGCGCCTT TTGGTTCGCG     37140
     CAGTCCGACC TGCAAACCGC CGTCAACGGC GGCGGCAGCG GAGAAGGTCA ATCGAAATCC     37200
     CCGACGACCA CCGCCCAGGC GGGCGGCAAC GGCGGCCATT GAAGGAGACC AACATGCTAT     37260
     CGCGCAGAGG ATTCCTCGGC ACGGCAGCGC TGGTGAGCGC CAGCGCAGTA AGCGGCCGCG     37320
     TCCAGGCGGC GAATATTCCC GAAGCTCCGA TGATGGACAA GGCGACGATG CAACCGCCGC     37380
     TGCATCCGTC GAGCGGCCCG GATTACCGCC CGGTGGTGAC GTTGAATGGC TGGTCCCTGC     37440
     CGTGGCGCAT GAACGGCGAC TGGAAGGAAT TTCATCTCGT CGCCGAGCCG GTCGTGCGTG     37500
     AATTCGCGCC GGGCATGAAG GCCTTCCTGT GGGGCTATAA TGGTCAGGCT CCGGGCCCGA     37560
     CCATCGAGGC CGTCGAGGGC GATAAGGTCC GCATCTTCGT TACCAACAAA CTACCGGAAC     37620
     ATACCACCGT GCATTGGCAC GGCATGATCG TGCCAAACGG CATGGACGGG GTCGGCGGTC     37680
     TCAATCAGCC GCACATCAAA CCCGGCCAGA CCTTCGTCTA CGAATTCGAG ATGCGGAACA     37740
     GCGGGACCTT CATGTACCAC CCGCACTCCG ACGAGATGGT GCAGATGGCG ATGGGCATGA     37800
     TGGGAATGAT CGTCGTGCAT CCACGCGACG CGACCTTCCG CCCCGTCGAC CGCGACTTCG     37860
     TCTTCATCAT GAGCACCTAC GACATCGATC CCGGCACCTA TCTGCCCAAA GTCTCCGAGA     37920
     TGACCGATTT CAACATGTGG ACCTGGAACA GCCGCGTCTT CCCAGGGATC GATGTGTTGC     37980
     CTGTTCGTCT AGGAGATCGC GTGCGCGTGC GCATGGGCAA TCTCTCCATG ACAAGCCATC     38040
     CGATCCATTT GCACGGGCAT CATTTCGCGG TCACTTGCAC GGACGGAGGG TGGGTTCCTG     38100
     AAAGCGCGCA GTGGCCGGAA TCCACCGTCA ATGTCCCCGT TGGCGCCGTC CGCGCCTTCG     38160
     ACGTGGTGGC GGACAATCCG GGCGACTGGG CGTTTCATTG TCACAAGTCG CATCACACCA     38220
     TGAACGCGAT GGGACACAAT GTTGCGAACA TGATCGGCGT GTCCCCCAAG GATTTAGCCA     38280
     AAGCGGTTGG AAAGCTCGCG CCGGACGCAA TGGCGATGGG ATCGAGGGGA ATGGCGATGG     38340
     GCGACATGGA GATGCCGATG CCGGACAATA CGCTGATGAT GATGACCGGA AGAGGACCAT     38400
     TCGGTCCGAT CGAAATGGGT GGGATGTTTA CCGTTATGAA GATCCGCGAG GGGCTCGCGC     38460
     GCGACGATTA CAGTGATCCC GGTCCCTACG AGTATCCCGA AGGCACGGTC GCGCACTTGG     38520
     TCGATGCGCC CGCCGGCCAG GCTCCGCGTC AAGGCAACCC AAAAAAGACC GATCAGCCCG     38580
     ATGAGATGAA GGGGATGAAA GGCATGGATA TGAAGGGAAT GAAGGGCATG TAGACGCCTT     38640
     CTTTTTTGAT TGTCATCAAA CGTTCGACAG CTACCAACCA ACAATAACTT CATTCATCCG     38700
     ATGCATGTAC ACGGTGGTCC ATTCGAGGTC GTCGCGGTCG ATGGCGTGAC GCTGAACGAA     38760
     AGCGCGCGTT ATCAGGCGGA TACCGTCAAC GTCGGCCCGG GCCAGCGCTA TGATGTGATC     38820
     TGGACCGCCC GTAAGCCGAG CAAGTGGCTG GTGCATTGCC CCATTCCGCA CCACACCTCG     38880
     AACAACAACG TCGAGCAGCA CGGCGGCGGG CTGATGCTGG TTCTGAATGT CGAGTGAGCG     38940
     GTGGATTCGG TTTTGCGGCT TTCCGCCGAA GTGGTCGCAT CCGCTTCAGG GGAGTCACAA     39000
     AACAAGCTGC TCTTTTGCAG CCGGTCTCAT CAAATGAATT ACCGAATTGA AAAGGAGCTG     39060
     TCTTCGAAAT GACCAAATTG GTTGGTGCCG CGATCCTCGC GGTCGTGATC GCGCTGGCGG     39120
     GAGCCGGAGC CTTCGTGTTT TCGGGCGTCT ACGACGTTGG AGCTGATACC CCGCATTGGA     39180
     CGCTGACCAG AAAGATCATG GAAATCGTCC GCGACCGCGC CATCGCTGTT CGTGCGAAAG     39240
     ATATCCAGGT CCCGGACCTA ACGGGCGAGC AACTGATCCT GAAAGGCGCG GGACAATATG     39300
     CGGCGATGTG CGCAGACTGT CACCTCGCGC CCGGCAAGTC GGAGTCGGAA ATCCGGCCGG     39360
     GCCTTTACCC GAAGCCGCCA AAGCTCTCCG AACATCCTTT CGATCCGAAA ACCGTGTTCT     39420
     GGGTCACCAA GCACGGCTTG AAGATGAGCG GAATGCCGGC GTGGGGACTC GGACACAACG     39480
     ATGCTACACT CTGGAGCATC GTCGCGTTTG TCGGGAAATT ATCAGGGATG TCGGCCCAGC     39540
     AATACAAGGA CATCGTCGCA AAAGCGCCTC CCGACGAAGA GATGGAATCC ATGGGCCAAG     39600
     GTGACGGTCA CACGCACGCC GGCGGACATC ACGAACACAA CGCAGAGCCA TCGAAGGAAG     39660
     TCAGTCCGAA ACCTGACCAT CATCACTGAC GGTTGGAGGC CGGAGGAACG CAAGAGGATG     39720
     GAGACATTGA ATGAATCCCA TCATTCGTGC GCTATAGGCT GCGGGGAGAG GCGCATCCAT     39780
     CTCTCGAAGC GTGATCCGAA TTTCGGTAAC GGACTGCGCA ATGGGTCGTG TGCAGCAGAC     39840
     GTCCAACCGC ATAGGCCATG CAAACGTCAA CGCATCTTTT CCCTCTCCGC TCGTTTTCGG     39900
     GTTTGTAGCA CCAAACGATA TAGCAGTAGT GCTCCCGTCT AATGTGGAGA CAGGAACGAC     39960
     ATGCCCCCGC CGAAGTCCAA ATTCACGTGC CTACCCTGTA TAAGTTTTTT ACATTTGAAG     40020
     TGTTGGAGCA GTGAGAGTTA GGCCTCATCC AAGTGAAGGG AGAACGGGTC TGCTGCAGAT     40080
     GGCAAACGGC TGGATCGCGA AAGACATAAC CGTTGCGGTT GTACCTAATC TCGAGCGGCA     40140
     TACGCTGAAC GGTAATACGC AATGACACTG GCGTTCGTGA CGACGGCACA ACACCACAGA     40200
     AGGCTGACGT GAAGCCGAAA ATGGCTTGCG AGGGTGACCA GACAGTCTTC AACACCAGAT     40260
     GTATCCGGCG CTTGTCCATT CGTTCGATAA AGTGCTAAGT TTTTAGGAAG CGCTCGGTGA     40320
     GCTTTGGTGA ATTTGCCCCA TGGTTCGCAC CTCATTTGGT GAGGCTTAAA ACACATCACT     40380
     GCCATGGCCG TCCTCCACGA GAGAACAGAA TCACACTCGC GAGGTTTTTG GAATCCCCGT     40440
     CGCGCTACCA TTAATGGGGT GGACTCTAGA TAATGCGATC CGCACTGGCC AAGGGGTGCC     40500
     GGTCGATCAA AAGACCGCAT CCCCGCAGGC AGAGTTCTTT CACCCTGATG GCAAACGATA     40560
     CGAGGCGTTC CCCCCGGCCG CCGAGCCCGA CGGGGCAACC GCGCTTTATC GCTTCATGTT     40620
     GCTATTTGAC ATACCCGAGC CCATGTTGCC GCCCATCATA TCCGGATGCT TCTTCATCAT     40680
     GGCCATGCAC TTCTTGTTCT TCATCATGGC ATCTTCGGAC ATCGACTGGC ATTTCTTCAT     40740
     GATCGTCATG TCGCTCTTCG ACGTGGCCGC GTAGGTCGCG CCCGAGGCAC TCGTTATAAA     40800
     GGCAACACCC AAAACTACAG CCGCTAACCG CTTCATCGCA AATCTCCCGA TGGATCTGAT     40860
     GGACCACTGG CCGATGTGCC TAGCACCCGG TGTCCTGATA AGCGGCCGCC TGCAAACATG     40920
     TTCCAAGCCG GCCGGGAAGT CGGTGACGTT ATTTTAAGGA GTCTGGCGCG CTGGCGCGGA     40980
     GGTACGCACC TCTTCCGGCT GCGGACGGCC GGTTCGACCC AACCCGGGTA CTTACCTGCC     41040
     GAACCGGGTA CTTACCCGCC GAAGGTCAGC GAAATGACCG ACTTCAATAT GTGGACCTGG     41100
     AATAGTCGCG TGTTTCCGGG GATCGATCCG TTGCCGGTGC GGCTTCGCGA CAAGGCTTGG     41160
     GTTCGTATGG GCAATCTCAC GATGACCAAT CATCCCATTC AACTGCATGG TCACCACTTC     41220
     GCGGTGAGCT GTACTGACGG CGGCTGGGTG CCTGAGAGCC GATCCAGGAA GAATTTGAGT     41280
     CAGATGAGTC GGTTGTGATT CCATGTCCCG GAGCGATTCG TGACAGGAGC ACACGATGTG     41340
     GAAGCCTGAA CACCGTCTGA CGGCCGACCG GCGCAACCTT CGGTATCCCA GTGATTTGAG     41400
     TGATGCGGAG TGGGTGCTTG TTGCTGCAAT GATCCCGCCG GCGCGACGAG GCGGACGCCG     41460
     CCGTTCGGTC GATGTCCGCG AGCTGTTGAA CGCAATCTTC TATGTGCTGT CGACCGGCAG     41520
     CCAATGGAAG GCGATGCCGA AAGACCTGCC GGCCAAGAGC ACGGCGCATT TCTACTTCAT     41580
     GTTATGGGAT TGGGACGGCA CGTTGAATCG TATTCACGAT ACACTCTATG TAGCGACACG     41640
     CGTGAGAGCG GCGGTGCAAA ATTAGTCCAC GGTAGCGGCG GGATGGTCCC GCTTCGGGCG     41700
     GCGTAAAAGC CGGCCACCTA TTTTCCTTCT GCGACGAATG CAGGAGGGTT GGGGATCTAT     41760
     ACCGTGGAAT TATATCTGAA GGTTCGTCTG GCCTGTTCTG AAGGAATGAG CCGGCGTCAG     41820
     GCTGCAAAGC ATTTCAACAT ATCGCGCGAT AGCGTGGCCA AGATGATGTC GTATTCGACG     41880
     CCGCCGGGCT ATCAGCGTCA GTCACCGATC CGGCGGCCTA AGCTGGATGC GTTTGTTTCG     41940
     ACGATCGATC ACTGGCTTGA TGAGGACATG AAGGTGCCGC GCAAGCAGCG CCATACGGCC     42000
     AAGCGGGTGT TCGACCGTCT TTGGGGCGAG TGCGGGTTCA CGGGCGGCTA CACGATCATC     42060
     AAGGATTACA TGCGCGAGCG GGATCAGCGT CGCCAGGAGG TGTTCGTGCC GCTGGCGCAT     42120
     CCGCCAGGGC ATGCGCAGGC CGATTTCGGC GAGGCGATGG TGGTGATCGA TGGCGTGGAG     42180
     CGGAAGGCGC ACTTCTTCGT GTTGGATCTG CCGCATAGCG ACGGCTGCTA TGTACGGGCC     42240
     TATCCGGCGG CAGTGTCGGA GGCCTGGGTC GATGGCCACA TCCATGCGTT CGCCTTCTTC     42300
     GGGGCCGTGC CGCAGTCGAT CGTCTACGAC AACGACCGGT GCCTTGTGGC AAAGATCCTG     42360
     GCTGACGGCA CGCGCAAGCG GGCGACGCTG TTCAGCGGGT TTCTGTCCCA CTACCTGATC     42420
     CGGGACCGCT ATGGCCGTCC GGGGAAAGGC AACGACAAGG GGAACGTTGA GGGGCTTGTT     42480
     GGCTATGCCC GTCGCAACTT CATGGTGCCT ATCCCGCAGT TTGCGACATG GGATGCGTTC     42540
     AACACCTGGC TGGAGGCTCA GGTATCCCCT CATTCACACG CATGAGAACG TTTGATTTAG     42600
     CGCGGCGTGT TGATTGATGT ATTCGCTAAA CCGCGCGACA AGCGGGCGCA GGCGGACATC     42660
     CGGCATGTTT GGGATCAACT CGTAGAGCAT GCATCCCTGG CGGAACAGCG AATGAGTTCG     42720
     GCGCTTGGCG GTGGCGACCT TGAGATGGCG ATCCATACCG AGACTCTCGC CCGCTGCGCC     42780
     GAGCAGCGTC AAAAGCACGA TGGCGAAGGC GTTCAAAAGA AGAAGCCTGT CGCGGCGTTG     42840
     CGGATCGGCG ATGCGAAGAA CGCCTAACCC CATGCCGAAG CGAAGGTCCT TGGTGTCGCG     42900
     AAACCCCGGC TCGATCGTCC AGCGCCGGGC GTAATGGTTG GTGATTTCGC GCGCCGTCGC     42960
     TTCAGCGTTG CTGGCGGCCA GACACCAGGC CGCTTTCATG TCCCTGGCGT GCACACAGAC     43020
     GACCGCCCCA ACCGGCGCGA GTACGTGCAG GTCCTGCGTC TCATGGAAAG CTTCGAGCTT     43080
     GCCGATCTGC ATGCGGCGGT GAAGCAGGCC CTCCAACTCG GTGCGATCGG CTTCGACGCC     43140
     GTCAAGCATT TGATCCTGTG CAGGGTGGAA CGACGGCCGC CGCGACGGAC CTGTCCATCT     43200
     ACCCATACCT GCCGAGGGCG ACGGTCGAGA CGACATCGGC GAAGGCCTAT ATGCGACTGC     43260
     TTTCCGCGCA TGGGGAGGAA GCGGCATGAG CACTGATGTG CCCGAGATCC TGCTCTCCCA     43320
     TTATCTCAAA ACCCTCAAGC TTCCGACCTT CCAGCGCGAG TACCAGAAGC TGGCTCGGCT     43380
     ATGCGCCACC GAGGGCGTCG ATCATGTCGG ATACCTCACC CGGCTTTCCG AACGGGAGAT     43440
     GATCGAACGG GACCGCCGCA AGGTCGAGCG CCGCATCAAG GCGGCAAGGT TCCCGGTCGT     43500
     CAAAAGCCTG GACAGCTTCG ACTTCACCGC CATCCCAAAG CTCAACAAGA TGCAGGTGCT     43560
     GGAACTGGCG CGTTGCGAAT GGATCGAGCG GCGCGAGAAT GTCATTGCGC TTGGTCCCAG     43620
     CGAGCCGGCT TCATAATGCT CACCTGTCCA TGTCGTTAAA GTTCAAGAGT TTTTTGCAGC     43680
     GGGTTACTGG ACGGCGGACG TCTCAGACGG CGGGCTGTCG CCGCGCCCTT CACGTCGTTT     43740
     CGGTCCAAGT CGGCGGCGTG GATGATCCAA GGCGCTCCCT TACAGAGCTG ATTCGCCGAG     43800
     AGTTGACCAT CTTTGATCAG ACGGCGCACG GTCGACGGAC TAACGGATAG AGCTGCCGCA     43860
     GCCTCGTCGA GCGTGACCTC GCCGCGCTCC CGACGCTCGC CTTCCCGATA GGTTGGAATC     43920
     GTATTGTGAC TACGCAGGCT GCACACCCGC GATTGCGTCC AGCCGTTGCC GCGTCCCGTC     43980
     GTTTTGCCGG CCCGATTGAG CACCGAGGCG ATCGCCTTGT CCGGCATCTG TCGTGCCAGC     44040
     ACGCGCACGA GATCGATGGT CTCGCCTTCG ACGCTCCAGC GGTGTTGGCC CGTGCGGTTC     44100
     TTCTTGACCT TAAGAGCCGA ATGGTCGCCT CCGTGCCAGC GGATGACGAG ATCGAGCGCG     44160
     TTGTCCTCGA CGCGGACGAC GATCTCGTCG ATCACCGTCC GCACGATGCG TTTCTTTGCC     44220
     TCTGGTGTCA CGCCGGCGCT CGTCCATGCC CTTTGCAGAT CGGCACCGAG CATCATCAGC     44280
     CGCTCGCGAT CGGCAGGCGC CGGCTCGGCA GCGGGTGATG CCGTCAGTTC CTCAAGCTCC     44340
     GCCTCCAAAT CGCGGGCGAT AGTCAGTCGC TCATTCCATC GCGTCTCCAA CTCCGAGGCG     44400
     ACCAGGCGGT TGTCGGGATC AACGGCATCA TACTGGCGAC GCGCGCGGCC GACCTCGTAG     44460
     CGAGCCTGCT CCAATGCCAG CGCGATCTGT CGTCGCTTGT CCTCGTTTGC GCGACTGCGG     44520
     AGTGCCTGTG CCGCGAGCGC GGCCTCGATT CCGAGCGGTT GCAAACGCAC GATGACTTCA     44580
     GCACCGATAT CCCGGTCAAT GCGCATGTCT CCGAACGAGA TGCAGCGATC ACCGCCGTGA     44640
     TTGATAAAGC CACCCTGACA GTGATAGCGG CCCGTATTGC CATTGGCGCC AGAGTAAGCG     44700
     ACGTGCAGCT TGCGTCCGCA ATGACCACAA CGCAGCAGGC CGGCGAGCAG CGCCTCACCC     44760
     CGGCGCAGCG CACCGCGGCT CATGGGGTTC TTACCATTGG CGTTGTCCGC AATCAGGCCC     44820
     AGGTTCCTCT CGTAGTCTGC CCAGCTCAGA TAACCCTCGT GGTGGTTCGG AATCAATACC     44880
     TCCCAATCCT TGCGTTCCTT CTTGAAGCCG CGCACCACTC TTTTGCGGCC GGCTTCAATG     44940
     CTAACGCGGC TGCCGGTGCG CCCAAAGGCA TAGGCGCCAG CGTAGATCGG GTTGGTCAGG     45000
     ATATGCAGAA TCGTGTTGTA CACCGGCAAC TTCCATTCGA TCAGGCGGCC CTCCGCACCA     45060
     TAGGTGACAG CGGGCAACGG GATGCGCTCT TGCCTGAGCC AGAGGTGCAC CTGACGCACC     45120
     GATTGCATCT CGGCGAACCT GGCGAAGGTG AGCGCAATCG CCTCCGTAAT GCGCCGATCC     45180
     GGATCCTTCT CAATGCGATT GTTGCCGATC CGCACGTAGC CGATGGCAAC CGTCATGAAC     45240
     AACTCGCCGC GGCTCGCCTT CTGCTTCAGG GCCTCAAGCG AGCGCTGGCG CAGGACTGAC     45300
     AGCTCCATCT CGCTCATGGT TCCCTTCATG CCGAGGAGCA GTCGGTCGTT GGGATGGCGA     45360
     GGATCGTAGA CGCCGTCCTC GCCGAGAATG AGCGTGCCGA CGAGACCACA GAACTCCAGC     45420
     AACGTGTGCC AGTCGCGGCC ATTGCGAGCG AGTCTCGATG CCTCGATCGA GACCACGGCG     45480
     CCGACTCGTC CTTCGCAGAT GGCTGCCAAC AGCTTCTCGA AGCCGGGCCG CGCGACGCCA     45540
     CCGCCGGAGC GGCCGAGGTC GTCATCAATG ACGGCGACAT CGTTCCAGCC GAGCTGTCGC     45600
     GCCCAATCGG CAAGACCGTA CTGGCGACGC TGACTCTCCA GGTTGTTGGC GAGCTGGCCG     45660
     GCGGTCGACT GACGAATGTA GACGATGGCC TGACCTAACG CTTTCAGCGA AGGAGCTTCG     45720
     TCCGAATCGC CGTGGCAATG GCATGAGCTT TGCTGACTGC ACCAAGCTTC GCGCGCGCCG     45780
     CCATGATATG CTTGGTCACG GTTGATCTTG AGATTCCAAG AATCGCCGAA GTTTCCCAGT     45840
     TCGTCTTTCC CTCGCCCGCC CAAAGCAGAC AATCCCATTC CCGTGCGGTC AGATTGCTAC     45900
     TGACGCGTTG CCAGGTCGCA ATGCGATGGA GATGCCGGCC CAAGGCGTAG CTGGCCGCAA     45960
     AGTTCAGCAC TGAGAGATCG GCCGAAACCG GAAGCGTTCC CGGTCCGCCG AACGACAAAG     46020
     ACGCAATCTC ACCGTCTATT GTCGAAATCG GCACAACGTA ACCGTCGCGT AGTCCGAATT     46080
     CCGCGGCTTC GCCTCGTATT AGCCTAACAT TCCTACGCTG AGGGCAGCTC TCGTAGCCCT     46140
     CGTGCCAGGT GAACGGCGCC CGTTCATGAA AAAGGTGCTG AATGATCGGA TCGCGAAATA     46200
     CGTATCCCTT CCTGCTGTAG CGATCTAACC ATTGCGCTGG AAAGCGCTGG AACAGGATTC     46260
     GTGAGCGAAG TTCAGCCAGT GGCGCTGGGC GTGTCGGCAC GATGCCCCCG AAGAGACCGG     46320
     TAAAGCCGAA CCCCGCCGCG AGCCCCAGAA GGCAATCTTC GATTTCGGCC GCAGTTCTCG     46380
     TCTGCTCCAC GGCCTCGATA AAGCGGACGG TTTGGCTTAA GCGGTCCGAC AATCGCTAAG     46440
     GTCTCCTTCC TTGATTCACG GACGGAGCCA TCGACACCCC GCTCTGCGAG CGTGAGTAGA     46500
     GTCGGCGCCG CCGTGTCGAC CCTTGCGGGA GCAGCCCGCC GAGCGGCCAG TCGCTATCAT     46560
     CGAACAATAC ACGCTCGGCA CCTCCGTCGA GATCGTCGTA GGTATTTGTC TGACCAGGAG     46620
     CTGCTGAGTG GCATACGTCG CACGCGGTCA TCCCCAAAGG ACACTAGTCA AAGGGACATC     46680
     GGACGTATAT CTTATCAGAC TATGGGATGC AATGCCGCAC AGATGCGCTT TGGCCTGGCG     46740
     CCGCGACTTG GGGATCAGGA GTCTCGTCGA TCTCTCGAGG GAATCCCACT GCGAAGGCGA     46800
     CGGACAGGTT GACCCTCGCA CCTTTATCGC GGGAATATGA GGATGTCGGC CCGGAGCCCG     46860
     CCGAATAACG AATAAGGTGA ACCATGATGC ACGATATGGC GCCAGGGATG ATGTGGGGAA     46920
     TGGGACTCAT CGGGCTGTTG GTGGTGATCG TCTTGCTGCT CGCAGCGGCA GTTCTTGTCA     46980
     AATACCTGCT CTCGTCCAAC AAGGGAGGAG ATCGATGAAG GGACTGTAGA TGTTGGTTTT     47040
     CGCTGGCGTC GCCGTTGCTT CGGGAGCGGT TGCGCAGTTC GGTGACGTCG TTCGGCGCAT     47100
     GGTCTCCGCG CTGGGTCTCA AGCCAGTGCG ATGTGGATTG CTGGGTGCAA AATGCCCAGC     47160
     GCACCGACGA TTGCAATAAC CGCCACTCCC AAAATGATCT CGAGAACACT GTTGCGCGTG     47220
     AGCCGACGGA GCGCATCGAT CTGCATGTCA GTGCGCGAGA GGGGAGCAAG TTGCGGCATC     47280
     AACCAAAACC GATTTGCCGC CGCCAGCAAC AGCATGACTG CGAACAAGGC AGTTTTGAGA     47340
     ATCACGAGAC GACCGTATTC AGTGGCCTGC AGCGCGTAGA ATGAGCCGAC GAGAATGCAT     47400
     GCATTGACGA CGCCGGTGAT CAGCAAGACC CCGACACTCA GGAGGCCCAG TGTTGAAAAA     47460
     CGTTGCGTTG CGTGGCGCGC AAGAGATGTC CAGACGAAGT CTTGGCGGCG TCGAGCCACG     47520
     GCGAGTAGCA TGGCAAGCGG CACGAGCGCC CCAATCCACG CCGCGGCGGC CGTGAGATGC     47580
     AGCACGTCGG CCGTCAGATG GAGCAAGCCT ATCAGACCTA CGCTGGACCC CGCATGTCCG     47640
     GCCCATGCCA GCGCTGCGAT CAAGCCGAAT GCCGAGGTCA GCGCAGGCCA GCGCGTCCAC     47700
     GGCATCCGGG AGCAGGCCAA ACAAGCGGCA AGAGTGCTGG CAAGCGCCAG ACGGATTTCC     47760
     GAGACCAGCC CGAATTGGGT CTCGTTCAAC ACCGTCGACA GGATGTCGGC CGTCATGGCT     47820
     TCGCTGAGGG AAAGACCGCT CATGGCCGCG GCCTCCAACA GAACCCAGAT CGCGCCTGAG     47880
     ACCGCGGCAA TTGCCAGGCC GATCCATGCG ACACTGAGGC TTTGCATCCG CGCAGCAGTG     47940
     GCGGGCGCAC CCGAACCCAA TGCAGGCTCT GCCACGGCAA CCCGGAAAAG CATGCTTCCG     48000
     GCAGTCACGG CCGTGGCGGT GAAGTGTATC GCGCGTACGA CGATCAACGG ATCGTTTACG     48060
     GTCTCGAGCC AATCCATCAG GTCGCCATAC CCTACGGGCT GACCTTGAAC GTGAAGTCGC     48120
     CGTCCGCCCT ATGCGTGTCG ACTGAAAGGA CGCGCCATTT GACACGGTAT GTCCCGGCCC     48180
     CAGTGGGACG CAGCGAAATT GCCATCCGAT TGCCGCTGAC CCGGGTTTTG CCGGTATCGA     48240
     CGCGTTGACC GGCGGAGTTG GTGACAGTGA TCGTGCTGAA AGCCGTCTCC AGCTTTTGGG     48300
     TAAACCAGAG CGTAACCTCG CGCGGAGCCG TCGCGACTGT GTTGCCGACG CGCGGTTCGG     48360
     CATGATCGAG AGAAGCATGT GCGCTGGCGT CTCCTGTCGC AAGCAGGATC AACAAGGGAA     48420
     CCATTGCGGT GAGAGCAGTG CGACGCATGA TCAATTTCCT CCGAACGGTC TGGCGGGTTG     48480
     CGCGGCATTG CCGAAGATCG GCTTGCCAAT GCCACGCGGA TCGAGGTCGT CGAGATAAAA     48540
     GTGCAGTTGA GCAATCGCGC CAACCGTCGA CCCGCTCTGT CGGTTGATCG GGATCAATGC     48600
     CTCGACGCCA ATCTGAAAGG TATTCCCGAC CCAGATGAAT CCCGGGTTGA TCGTCCCCGT     48660
     CGTCCCCGTC GCGGATGTGA AGGTATTCCC CACCGGGGTC TGGAACGTCG CCTCGACAAG     48720
     CGGGATGAAC CGATTGATAA AATCCGGCAA TCCAAGATCG ACGACTGCGG ATTTGAGGTA     48780
     CGGCATGCTG TATTGCACCG TTCCGCCCCA TGCCAACACG CGCGGGTGGA ATTCGGTATC     48840
     GACCCTTTGC TCGCCGGTGT CAGGATCGAT TCCCAGGACG GTCGTGGAAC GTTTGCCCGG     48900
     GATCGCGTAG CCGACCTGCC CGGTAACTGC GATCGGCCGC AGCCACGACA TCGTATCGGG     48960
     AAGATCGCCG AAGCCTTTGC CGAAATACAA AGTCGGGGTG TAGGTGTTGA ACTGCTCCGC     49020
     GCCGACGCTT TGGGCACTGG TGCGGCCCCA TTCTACGCCA AGACCCACCG ACATCACGAA     49080
     CTCATGGGCA GGGTCCTTGA AAAGGCGGTA TTTGAACGCG GTCTCCAGAT TCTGAAACCC     49140
     GCTTGCACCC ATCCCGGTTG GCCAGCCTGG CGCTCCAAGG TGCGTGTATG TGGAGCCGAA     49200
     TGACACCGCG AACGCCTCGG TAATTCGTTT GGAAAACTCG CCGGAGAAAT CGCGTTGTTT     49260
     GATTGAGGGA TCGTCGCCGG TCTTGAAAGC CGATACCGTC GGCAACGACA GTTCGTCGTT     49320
     GACGCCTGGA TCATCGGTGC CGAGCGTTGC TGGAAAAAAG CGGTTGCCGA CGATTTCATG     49380
     GGCAATGCTC CCGGTCGGAG GGACGAGCGC AATTGCGAGC CCCGGCAGGG CTGCACGCAA     49440
     AAGATGGGAA GACATTGATA TTTCCCTGCT AACGTTGAAA CAATGCATGG GGCGCGGTAG     49500
     CCAGCCGGTG TACAGAATAA TCACTTTTTG TGTTATTCGG TCGCATAAAC GGTTGGCACC     49560
     GTCCCATCCT TGGCGACGGC ATAAATCGTA AACGGTCCTC TCTTCTGGCC TACCATGCCT     49620
     GGAGACCCGG TCGGCATGGC CGGCAGCGTG ATGCCAGCGA TCGTGGGCCT TTCGGTCAGC     49680
     AGTTTCCGGA TCGTTTTGAT CGGCACATGT CCATCAACGA CGTAACCATC GATGAACATG     49740
     GTATGACAAC CCTGCAGGTT CTCCGGAATC CCGGCGTTGA GACTGATCTG GGCGAGGTCA     49800
     TTGGTGGGCT TGACGTCGAC TGCAAATCCA TTGTCGCGCA GGTAGGTGGC GTAGCCTTCG     49860
     CAGCAGCTGC AATCGGGATT TTTGTACAAG GTGGCGTGGA GCGTCTCCGC ACGAGACGCA     49920
     AGCGGCAATC CGGCGAGCGT CGCGGCCGTC GCCAGGCAAA ACAGTCGTCT GTTCATGGTC     49980
     GTTCTCCTTG ACCTTCACTC TTTCAACTCT CCCTTTCATA AGCGCGGGTG TTCCGCGCCG     50040
     TGACGGGGAG GGGAGGTGTC TTGTCAAGCA CCTCCCCTTG GCGGCGGACA GGATCCAATC     50100
     CGTCCCGTCA GGGCGCCGGC GTGATCGACT GGACGCTATA GGTGCCGCCG GAGCCGCTCA     50160
     GGGTGAAATT CACCTTGTCG CCGGTCGTCA CCTTTGCGAG ATCGACGGAC GGTGCAACTG     50220
     CGAACTCCAT CTTCATGGCG GGCCAGTAGA TAATAGTTGT ATGTCCTTGC CCTTGAGCCA     50280
     CGTTGTCAGA TCGTCCGCGA CGTAACTCGA TCCGTTGTTG TCGAGCAGAT GCGGGGTGAC     50340
     CTATTTTCAA TAGTCCTCGG GATAGTACGA AGTCGGATTT CGGCCGCACG TCCCGCCAAT     50400
     TCCCGATGCT GATGTCCTAC ATTGCTGAAG GGTTGCAAAT TGGCAATTGC CTGGAAAGCC     50460
     CCATTCTCCA CCCTTTAAGC AGTAGGCGCC GTTTTGAGCC AATGCCGGTG CGCGACGGAC     50520
     GTCCGGCGAG ACGTCGTGCG TCGAAGAATG CGGCATCTCC GCAAGCGCGG CGGACGCGAG     50580
     CAGCGCGGTC GTTGCAAAGG TGATGAAGAG CTTCAACATT GTCGTTATCC TTCTCATTGT     50640
     CGTTATCCTT CTCAAACGCA CATCGGAAGG CGGCCAGTAT GCCTTGCGAT CCGATCATGC     50700
     CTGCCGCGTG CGTCAAGGCG CCGGTGTGAT CGACTGGACG GTGTAGGTGC CGCCGGATCC     50760
     GCTCAGGGTG AAATTGACCT TGTCGCCCGT CTTCACCTTT GCGAGATCAA CAGAAGGAGC     50820
     AGTCGCGAAT TCCATCTTCA TGGCTGGCCA GTTGATGGCG GGGATTGGAC CATGATCGAA     50880
     TGTGATCTTG AGGTTCGCTG CGTCGATGGC CGTGACTATG CCAGTGCCGG TTCCGGTCGC     50940
     AGTCGTTGCC TTTTTCGTAT CGCTCATCGC CGGCATTTTC TTCATATCGG ACATGCCCGC     51000
     GCCGTTTTGA GCGAACGCGA CGCCCGTCGG CAGCGCCAGT GCCGCGCCGA GCAGCGCGGC     51060
     GGTCAGAACT CCAGCAGGGC TGGCCCAGTG ATAGCTGTCG ATGAAATGCA TGGATACTCT     51120
     CCTGTTTTGG TGTGACGGTT GTTGAGCGCA GGGCTCGGGG CGATTGAACC GATCCCACCA     51180
     GGATCGTCTT CGCGCCCATT GCCGCCGTTT CCGGCGCGCA ATTCTTATGT TGCCGCTCGG     51240
     CGTCACTGCA CGTTCTCCGC ACGATGCAGG TCGAGCTTCG GCGTCGAATC CCGCCGCCCG     51300
     CCGCCTTTCT CTTCGCCGTC CTGCGGCGCC GCGGGCAACC CGAACCCCTT GACGACCGCA     51360
     AAAATGGCGG GAATGACCAC GAGGGTCAGC ACGGTTGATG AGGCCATGCC GCCGATCATC     51420
     GGGACGGCGA TCCGCTGCAT GACCTCCGAA CCGGTGCCTG TGCTCCAGAG AATCGGCAAC     51480
     AACCCCGCCA TGATGGCGAC AACGGTCATC ATCTTGGGCC GCACCCGGTC GACCGCGCCG     51540
     AGCATGATCG CGTCGTACAG GTCGGCACGC GTGAACGGCC GTCCCGCGGC CGCGCGTTCC     51600
     GCCTTCAATT CGGCCATGGC CTGCTCGAGG TAGATCAGCA TGACGACGCC GGTCTCGGCC     51660
     GCGACGCCCG CCAGCGCGAT GAAGCCGACG GCGACCGCGA CCGACATGTT GAATCCGAGC     51720
     CACCACATCA GCCAGATGCC GCCGACCAGC GAGAACGGCA ACGACAGCAT CACGATCAGG     51780
     GTGTCGGCCA ACTTTCGGAA ATTCAGGTAG AGCAGTAGGA AGATGATCAG CAACGTCACC     51840
     GGCACGACGA TCTTGAGCCG CGCTTCGGCG CGTTGCAGGT ACTCGAACTG TCCGCTCCAG     51900
     GAGACGTAAT ATCCCGGTGG AAACTTTACC TTCTGCGCGA CCGCGTGCTG TGCCTCCGCG     51960
     ACATAGCCGC CCAGATCGCG ACCGGTAATG TCGACGTAGA TGTAAACCGC AAGTTGCCCG     52020
     TTCTCGGTGC GGATCGACGT CGCGCCGCGG GTCAATTTTA CGCTGGCGAC CTGGCCGAGC     52080
     GGGACGCTTC CGCCGGACGC CAGCGGCACC TGGACGTCGG TGCTGATCGT TTGCGGGTTG     52140
     GAGCGCAGGG CGCGCGGATA CCGGATGTTG ACGGAATAAC GTTCCCGGCC TTCGACCGTC     52200
     GTGGTGACGG TTTCGCCGCC GAGTGCCGTC GAGATCACGT CCTGGACGTC GCTGATCGTC     52260
     AATCCGTAGC GTCCGAGCGC CATCCGATCG GGGATAATCT CGAGATAGTA TCCGCCGATC     52320
     ACGCGCTCGG CGTAAGCGCT TGAGGTACCC GGCACCGATC TGACCACCCC TTCGACTTCG     52380
     CGGGCGATCT TCTCCATTTC CGCAAGATCC TTGCCGAAAA TCTTGATCCC GACGGGGGTG     52440
     CGGATTCCGG TCGACAGCAT GTCGATGCGG GCGCGGATCG GCATCGTCCA GGCGTTCGAG     52500
     ACCCCCGGAA ACTGGAGCGC CTTGTCCATC TCGGCCTTGA GGCTGTCAAT CGTTACGCCA     52560
     GGCCGCCATT CCGACTTCGG CTTTAGATTG ATGATGGTCT CGAACATTTC GGTGGGCGCC     52620
     GGATCGGTCG CGGTCGAGGC GCGGCCCGCC TTGCCATAGA CCGATGCAAC TTCGGGAAAT     52680
     GACTTGATGA TGCGATCCTG GGTCTGCAAC AACTCCGCGG CCTTGGTGAT GGACAGGCCG     52740
     GGCAGCGTCG TCGGCATGTA CATCAAGGTG CCTTCATTTA GGCTCGGCAT GAACTCGCTG     52800
     CCGAGTTGGC GGGCGGGCCA GACCGTCACC GCAAGCGCAA CCAACGCAAG CATGATCGTC     52860
     AATGTCTTGG CGTTGAGAAC CCACCGGATC ACCGGTCGGT ACACCCAGAT CAGGAACCGG     52920
     TTCACGGGAT TCTTGTGTTC CGAGATGATC CGCCCGCGGA CGAAGACGAC CATCAGGGCA     52980
     GGTACCAACG TGATCGAGAG CAGGGCGGCC GCGGCCATCG AAAATGTCTT GGTGTAGGCG     53040
     AGCGGCCCGA ACATGCGTCC TTCCTGGTCC TCCAGGGTAA AGATCGGCAG GAACGCGACG     53100
     GTGATCACCA ACAGACTGAA GAACAGCGCC GGTCCGACCT CGCTCGCCGC ATCGATGAGG     53160
     ATTTGTGTTC GCGGCGTTCC GGGCTCCGCG CGCTCCAGGT GCTTGTGCGC ATTTTCGATC     53220
     ATGACGATCG CGGCGTCGAT CATGGCGCCG ACCGCGATGG CGATACCGCC AAGGCTCATG     53280
     ATGTTGGCGC CCAGCCCCAT GAATTTCATG GCGGCGAAGG CCATCAGGAT ACCGACGGGA     53340
     AGCATCAGGA TGGCGACGAG CGCACTGCGC AGGTGAAGCA GGAAGACAAA GCAAACCAAG     53400
     GCAACGATGA TGCTCTCTTC GAGCAGGGTT CCTTTGAGCG TCTCGATGGC CGCCTTGATC     53460
     AGTTCGGAGC GATCATAAAC CGTGACGATG TCGACGCCCT TGGGCAGGCT TGAGGCGATC     53520
     TCTGAAAGAC GCGCCTTGAC ATTGTCGATG ACGGTGAGGG CGTTGGCGCC GAACCGCTGC     53580
     AGTGCGATGC CGCTGACGAC CTCGCCGTCG CCGTTGAGTT CGGTAATTCC TCGCCGCTCG     53640
     TCGGGGCCGA GTTCGACGCG AGCAACGTCC CGCAATCGAA GCGGAGTCCC CGCGTCGGTC     53700
     TTCAGCACGA TGTTCTCGAT GTCCTCGATG CCCCTGAGGT AGCCGCGGCC GCGGACGACG     53760
     AATTCAAACT CGGACAGTTC TACGGTGCGC CCGCCGACAT CCATGTTGCT GGCCCGGACG     53820
     GCACTGCGGA GCTTGTCCAG GGAAATGCCC TGGGCGCGCA GTTTTTGCGG ATCGACGACG     53880
     ATGTTGTACT GCTTGACGAA GCCGCCGACG CTGGCCACTT CCGCGACGCC TTCGGCTTTG     53940
     GAAATGCCGT ACCGGATGAT CCAGTCCTGG ACCGACCGCA GTTCGGCGAG GGTCATGTTC     54000
     TTGGCCACGA CGGCGTATTG ATAGACCCAG CCCACGCCGG TTGCGTCGGG CCCAAGAGTG     54060
     GGTGTCACGC CGGTAGGAAG CCGGCGCGCT ACGGTGTTGA GATATTCCAG CACGCGACTT     54120
     CGGGCCCAAT AGGGGTCGGT GCCGTCCTCG AAGATGACGT AGACGAAGGA CACGCCGAAA     54180
     AATGAGAAGC CCCGCACCAC CTTCGATTTC GGCACCGTCA GCATCGCCGT GGTCAACGGA     54240
     TAGGTCACTT GATCTTCGAC GACCTGCGGC GCTTGCCCAG GATATTCTGT GTAGACGATC     54300
     ACCTGCACGT CGGAGAGGTC GGGGATGGCA TCGAGCGGCA GGGTGCGCAG CGCATAGATG     54360
     CCCGCCGCGA TCGCGAACAC TGCCCCGATC AGGACGAGCA TCAAATTCCG CGCCGACCAG     54420
     GCGATCAGGC GGGCGATCAT TTCGCCTTCT CCCCGTCTGT AAATGCCTGC AAGGCGGATT     54480
     TCAGGTTGCT TTCGGCATCG ATCAGGAAGT TGGCGGCAAC GACGACGAGG TCGCCTTCGC     54540
     CGACGCCCTC GCGGATCTCA GTGTAGTCCT CGCCGTGCGT GCCGACCTTG ACTTCACGAG     54600
     GTTCAAAACG GCCTTCCCCT TTGTCGATGA AGACGATCTG CCGCGCACCC GTATCAATCA     54660
     CCGCACCATT GGGCACCGCG ACCACGGGCT TTTCCGCACC GGACGCGATT TCAACGTCGG     54720
     CGAACATATC GGGAAGAAGC ACGCCGTCGG GATTCGGAAG TTCGATACGT GCCTTGGTGG     54780
     TGCGGGTTTC GGTGTTGACC TGGGGATAGA TCAAGGCGAC CGATCCCTTG AATTCCCGCC     54840
     CCGGCAGGCT GCGCAGCTTG ATGGTTGCCG CCGCGCCAAC CCTCACCGCG TCGATATCCT     54900
     GTTCGGCGAC GTCGGCGAGC ACCCAAATAA CGGACGTGTC GGCCATCCGA AACAGCACGT     54960
     CGCCCGGCAT TGCGCGCATG CCCTCGACCG CCGTCCTTTC CAGAACCACG CCATCGCGAG     55020
     GTGCTGCCCA TGTAATGGTC AGTGGCACCG TCTTGGTGCG CTCGATATCG GCGATCACGT     55080
     CGGCAGGCAC CGCAAGGTTC TCGAGCCGCT GCCGCGCGCC CTCGGCCAGT TGTTTGCGTC     55140
     CCGCGAGGCT GGCTGTTCGA CCATCGTCTC TGATGATGGA TAAATACTGG GCGCTCGCGG     55200
     AGGCGACGTC CGGCGAATAA AGCTTGAACA AGGGTTGTCC CTTGGTGACA TGATCGCCTG     55260
     TCGTGACGTT CGCGACGCTT TCGATGAAGG CCTGCGCCCG CAGTGAAACC ACGACCACGC     55320
     GCCGCTCATC GAGCTTGATC GTGCCGGGGG CGCGGATCGG TCGTATCACG ACCCGGCGCG     55380
     AGGCAGGTTC GGAACGCACA CCGGTGCGCT GCAATTTCGC CGGCGAAATC TGGATCGTGG     55440
     AGGCGTCCTC ATCGCCCGCA TAAACGGCGA TGTAGTCCAT CCCCATCGAA TCCTTTTTCG     55500
     GGACGGAGGA GGTGTCGGGA AGGCCCATCG GATTGCGGTA GAAGAGAATT CGCTTGGCTC     55560
     CGGAATTGGC GTCCTGGGCT GGCGCCGCAG TTTCCGGAGC ATTGTCGAAG CTGACATCTT     55620
     CGCTGGCATG GACGGCGACA TACGGGCGCC TGTCCGGCGT TATCCTGGCG TCCTTGGAAT     55680
     AGAGCGCCTT GCCGTCGGGG TCGCGGTAGT AAATGACCGG ACCGGTGGCT CTGGGCTTGA     55740
     CCGGTTGAAT ACCGAGGGCC GTTGCGAGGC GAGGCGGCAC CCAATCAGGC AACACTTGAC     55800
     TGGTGTGGCC GAGCCGATAG CCGATCCCCA ATGTTGCCGC GAGCGCGCTT ATCGCGAACA     55860
     CAATGAGCGC GACCCGTTTC GCGGTCGATC TTCCGGCTCG GGCGCGGCGC GTTAGATGTC     55920
     CATCTTCGAA TGGACGGTCA TCCGTAAACT TGTCCATCAA TAGTCTGCCC CTGACGCTGC     55980
     TTGCGCGGAA GAATGCAATT GGACCCCATG GCGACGCCCG ACGAAAATCG CCTCGGGGAG     56040
     GCGGTCGCGA GCCGTCGCCT ATGTCCAGGA TGATCTGGCG ATTCTTCAAT TCCGATGAAT     56100
     CGTTGCCCGG ACTCGAGGCC GTTCGCCGGC AAGACGAGCT TGCAGACGGA CCATCGGTTA     56160
     GTTCGCGCCG AATACCGAAC CGGTTACAGG CTCACGCCGA TGTGAAAGAC CCACTTGAAT     56220
     GGTCGTTCGA TGCCCCGAAA GCCGATTGAT GCCGAGGCCG AACGATTCAT GGGCGCCCTT     56280
     CCGAATGCGC AAAGTTCATC GATCGGCATG ATAATCGGAC GGCGGCTGTT TCAGCCGTGA     56340
     CGGTCTTTTT GTTTCGGTGC ATTTTGCTTG TCGTGACGCT CGTTGCTGGC CTTCATCATT     56400
     TGATTGCAGC TTTCCATCAT CTGCTTCATT TGACTCATCA TGCCCATCAT TTCCTGCATG     56460
     CCTTGTGAGC CGTTGCCCAT CATGGGTTGA TTGGTTTCCG TCGGCGTCTT CGGTGGCGTG     56520
     GACGTTTCGT CCGCCTGGAC GGCGGCGGAA GCCGCTAACG ACGCAATCAA TGCGAGCGGG     56580
     ATGAGAGTGG TGATCTTCAT TTGGTTGCCT TTCAAAGAAT GGCGCGCGTC GGTGGTCAAC     56640
     GCGTGCTGCG GTGCGGTTTG GAGCAGACTG CGACGCTTGG GCGCTCACCC AGGAAAGCGA     56700
     GCGTCATCTG TTAGTTCGGG AAGAGAGTAT GTTCGGTTAC AAGCTCACGA TCTCGTGAAA     56760
     TCAGGCGGTC GACAGGAAAA GTCCATCGGC GTCGACGAAC CCGAGGTCAG GTATCGTCTT     56820
     CGGCACTTAC GTCCGCTGGT GGCACGCACG GCTTTCCGTC TCGAGATGAA GCCGAGCTGG     56880
     AATCCAAACA CGCGGTCGAG GGTTTCCGCG GGTCGGATTC GCGCCGCCTT CGCGAGTTCC     56940
     GCGACCTGAC GAGTGGTCAG TCGGTCTACC AACGCAGCAA TTTGGGCCCG AGTACGGCGC     57000
     CGGCGACCGT ACATAAAACG ATTGTTCCAC CATACCAGAG CGCAATGAAG GGAAGCAGGT     57060
     CATCCATGCA ATGCAGAGCG TAGGCGGTTG CGCTGACGCC GCCCGCGACG AGTCCTGCAA     57120
     GCGCGCCGGT GCGGACCAGG TCGGTAGGCG CGGCGAGGCG AACCGCCGAC ATGATGGCGG     57180
     CGAACGGCAC GACCGCGACC GTCGGGATGG CGATCAGACA CTCAAGCCAA TAGCTGCCGA     57240
     ACACCATGGT TTCCCAGTGC GACCGCGGTG CCGTGGCCAG GCTGATGGCC GCGAGGATCA     57300
     TGACCGCGAG AAACGGCAGG ACGGTGAGGG CGAACCGGAC CCGAAATTCG CCGCCGGGAC     57360
     GGATGTACTT GACCAGGTAA TGCGAGGCCA AAATCACGAC CGACAGGCTG AAGGCGAGTT     57420
     TTGCGACCAG GAAGACTTGG GCGTGCATCT CGTTGAGGTC GGTGCGAACG CCGAGGACAA     57480
     AAACCACCGC CAGCAGGGAT GCCGCGGCGC CAACCAAGAT TGCAATCCGG ACGTTTCGGA     57540
     CAACTTCTCG CGTATCGACC GGGTCGACCT GCGAACTGAG CATGGAAATC AATTCATTGG     57600
     TTTTCACGCT TTGGTCTCCC GTGCAATCAA TGCGGTGAGG ATCTTCAGCC CACGGTGAAT     57660
     GTTGACCTTG ACGGCGGATG GCGACATCCC GCTACGATCG GCGGCCTCGG TCACGCTCAG     57720
     GCCGTCGAGC TTCACGTATT GGAGCGAAAG TCTCATTCGT TCCGGTAACC TTTCAAAGAG     57780
     CTTGGCGAGA TCGAGCTGGC TTTCGGCGGC GGCGTTGTCG TTGGATGCCA GCATGTATTC     57840
     GGCGTTTTCC AAGGGCACGT CCGCCGTCGT GCTCCTGGTG CGTCGCAAAT GGTCGATAAG     57900
     CTTATAGCGG GCAATGGCAT ACACCCACGG CGTCAGCGGT TGCTCCGGAT CGTAAGTGTG     57960
     ACGTTGCGTA TGGATGACGA TTAATGCCTC CTGCACAAGG TCTTCAGCTT CCTCGGCCGT     58020
     GCGTCCGGCT CGTGCGAGCT TGTTTTTGTA ATAGCTTCGC AGGTGTCCGC TCAAAGCCGT     58080
     GAGTAGTGAT CGATGCGCAT TGGAGTCGCC TTCAAGACTT GCCGCCATCA GCGCTTTGAG     58140
     GTCAGACTCC TTGGTCATTT CTCCCTCTTT GAATTCGAAT GAAGAATGCC CACGGTTACA     58200
     CTCTCACGAG ATCGTGAGGC CCGCGCGGCG CGAAAGCCAT GCCCAATCGC GAAGTGGGGA     58260
     TCGGATGGAA ATGCGTCCAT TGATCAAACC GTTCGGACTT CAAAAACTCT GCTGGGAGTA     58320
     TAGCTTGCAT CTGACTGCGC GGGGGTTGCG GATTCGCAAT GTCTCGGGCC GTCAGATGAA     58380
     CCGTTAGCGA CCTACGTTAA CACTATCTTC CATCTCACAG GCCAAGTCAG GCGACTACGT     58440
     GGCGCCCGAC CGACTTCGGC ACCGACGAAA GCTGCTGATC CGGCGTCAGT CGGGAGGCGG     58500
     GTTGAATGCA GGTGTGGATG CGAAGTCGGC CGGAAATGAT ACCGTTCCGT CCGATCTCCC     58560
     AACCTCTTTC CTTTCCCGCA ACTTCCGTCT GCGCGGCGAG GAATTCAACC GCGCTCACAT     58620
     AGTCGTGACC TGTAACCGGC GCAGCTTCGT TTCCGAATTC ATTCATGTGC GGTCCATTTA     58680
     GGATCGGACG GCTGAGGAAT CGTGGGAGGT AAAAATGCGC AGATCAAGCC TGGTTGCATT     58740
     GTTGTCGTTG TTATTGGTCG CTTCAGCATC GCCAAGCTTT GCGCGCGCGA CCGGGACCGA     58800
     GGCACGCTTG GGTCCTCAGA GGACCTCGAC CGCGGAGCGG ATGGCACCTG TGGTGCCCCG     58860
     CACCGATCGG GCCGCTGCTC CACGTCCGCG CCCGAAAACT TGCAACTATC GCGGAGGACC     58920
     CAAAACGGGT ATCTGGTCGT GCGAATAATT TTCCCGGCCT CACAAGGGCA AGGCCACCCG     58980
     CAGCACGGGG CGGGCTGCCT GACTGTTCCG GGAAGAGCGA TCGATCGGTG CGATCCCGAC     59040
     CAAAAGACCC GCGTCTTTTT TGAGAGCATG CCGCAACACC GCGCAGGGTA TCAAACCAAA     59100
     GCGATGGGAT CATCGCACTC GGGTCTTAAT GATCGAGAAC CCGATTCAAC GTCCGCTCTT     59160
     TCGCGCAACC ACTCGTGGCG TAATCATCTG ATTTTGAACG GGATGATGAT GTCGCCGCCG     59220
     AACGTGAATT GCGAACGCTT CGTTCCGGCG CCAAATGGCG TCGTTCCGTT CAGCGAGGTA     59280
     TCGTAACGAA TTTCGGGCCT GACAACCAGG CCGTCGAGTT CTTTGGGCAC GGGGGGCTTG     59340
     ATCGCGAGTC CGACCGTCAA GGCGCCGTAG GTGGTCGCGC CGCCGCCGAT CGCCGTACCC     59400
     AACGGATTGC CATGCTCGAG CCTGACAAAG TCCAGGTTGC CGGGGAATGC GGCAACGAAG     59460
     AAACCACTGT TGTCGCGCCA GACTTCTCCG CGTCCGGTGA TCTTGAGCCA ATCGTTGAGG     59520
     GCATAGGTGA CGTATTGCGC GACGCCGCCC CCGGCCGCGT TGAAGCCTTC CTCACGAATA     59580
     TAGTTCAGGT CGGTGGTGAG CGTGAGCTTG TCGGTTGCCT TCCAGACGAT CGTCACATCG     59640
     TTGAGATAAC GCAGAGCCCT ATTCGGATTG ACACCCGCAA GCACGGCCGA CGAGACATTG     59700
     GGATTTTCCG GGCCGATGTG GGTCGTCGCC AGCACGGTCA GCGCGCCGTC CATCAAATTG     59760
     AGTCCGATCC CACCGTGGAA TGCCGCGGCC ATGTTGTTGT CGCCGCCATT GAAGCGGTCG     59820
     AACCTGTTGC CGAAGGTCGT ATTCACGCCG GTGTCGATGC CAGCATAAAC ATCGAGGATG     59880
     GGGGTTACAT GCGTGGTTGT CATGATCCCG GTGTGCTTGA ACGGAATGCC GAAATTGAAG     59940
     ATGTAGGAGT GCGAGTAGAG CGCATTGTCC GGCGCGTAAA TAACTTCGGC GCCTTCCAGG     60000
     GTTACGTATT GTCCGACCTT CACATCCACG CCACCCGACG TGAGCCACGG CAAATGAAAC     60060
     AGAGCGTGGG CCTCGACGAT GTCAAACTGA TTGCGGCCGC TGATCGATTG ATCGAACTCA     60120
     CCCAGAAAAT GCGTGTACCG GGCATCCGAG CCGTACATCG CCTGGAACTT GAATCCGAAA     60180
     TCGTATCCGC TCGCTTTGGG ATCGAGCGGA CGCTGAACCG TCAGCAGCGC CTGGTTCATC     60240
     AACAGGGAAT TGGCCTTATC GGTGAAGAGG TGGCCAAAAT TAATGCCGCC GGAAGGCCCC     60300
     TCATTGAAGG TGATCCCCGC TTGCACATGG CCGGTTATGG TGACGGTATC CCACCAGGAC     60360
     GGCAACGCGG GTACGGAAGT GCGCGCCTTC GTCGTCAAAT CTGCACCCGC CGCGCCGCCG     60420
     GCCGAAAACA CCAAAACGAC CAGTCCGAGC AGTACACCCT TCCGCATTGT AGGCTCCCCG     60480
     CGCGACTACT TGCAATTTCG TCCTGTCTTG GAATTCAACA AAGCTTATCA CGCTCCTTTT     60540
     ACGCGGGGCG GTGATGGATC ACCCAGAGCT CGACCGCGCC AATGGCTGCG ACGACGATCC     60600
     CCACCACGAG ATGCACCTGC ATCGCCATGG TATCGTCGTT GAAGTTGAGG ACCCACGGGC     60660
     ATATTGCCAA CCACGATCCG ATCGTCAGAT TGATCCATTC TTCCGATTCG AAAAACGCCG     60720
     GAATTGAAAC GGTGTCAAAA AGGTCGGCAA TCGAAAAGAT TGCGACGACG CCAATGGCGG     60780
     CGCCGGCCAT CCATGATGTG TGCCATCCGA GTTGCGATTT GAATCCGAGT AACCAGGGCG     60840
     ACAAGATCAG AAAGCCGCCC AATGCGAGAT TGATGAAATC GACGAAAGCT TCGGTTTTCC     60900
     GGTTTCGCTG GAACATGGCG ACCTCGCTTC GTGAAGGCCA CATCACACTA TTGTAACGAC     60960
     AGTATAGTCT CGTTCGACGG AAATGTGCCA GCGGTTTCCG CTTAGGAGCC CAGAGGACAA     61020
     CGCCATATAG CATGCTCCAT GGCCTAATCG TTCGCGGGGC TGGAGAGGCC GGCATGAGCC     61080
     AAGCCGGCGC GGGGCGTTCC TGCGATGACG GGTTTGAAGC CGATGTTCAA AGAATCCGAC     61140
     GACGCCCTGT AACCATGCGT TCGCTCTGTT CGAACTAACT TAATAACAGG CGCGCGAGGA     61200
     GCGATCGAGG TTCGCGAAAA GACGGGCCGC GAGCGGTGAG GACGCATAGC TTTGTCGTTT     61260
     CGGGCGGGAG CCGAGAAAAG AAACGATATG CACTGCTTCT ATTGTTCCGA CTCATTGATT     61320
     GAAACGCGAG GTCGGGCATC GCGTTGAGGC CATCGGATGG CCGTCCATAA ACGCGGCGAT     61380
     TGCAGAGACA AACGCGCGCG TCAGGAGACG GGGCGTTTTG GCCGATCAAG AATCGGTATC     61440
     GGTACGAGGC AGATAAATGA ACGAAAATAT ACTCTGGGGA GGTGCCACGA TTTCAATCGT     61500
     TGTCGTATCG TGGTGTTTCT ACCGCCTTGT CGTGCCGAAG GGCTGGCGGG AGTGGACTCG     61560
     CGCTGGAATC GTGCAGGCAT TCGTCATCGC ATTTTATGCC GAGATGTATG GATTTCCCCT     61620
     CACGATTTAC CTATTAGCCC GAGTCTTCAA TCTGGACGTC GCGGGAAATC TTTGGGATGG     61680
     CAATCTCTGG GTTTATCTGA CGGGCAGTTG GTGGGTAATG CCAGCTTCCA TGGCTCTCGG     61740
     TTACACTGTT GTCTTTTTTG GAGCCGCTCT GATCATCGCC GGCTGGCGTG AAGTGTATCG     61800
     AGCGAGAGCG AGAGGGCGGC TCGCCAGGGG TGGCCCTTAC AGCTTGATGC GCCATCCACA     61860
     ATACGCTGGC ATCTTTCTGG CGCTGTTTGG CGAAAGTGTT GTGCATTGGC CAACGCTATT     61920
     CTCACTGACG GCCTTCCCTA TCATCGTCGG CGCGTACTGG CTCCTGGCCA GAATGGAGGA     61980
     GAAGCAGATG ATCCAACAGT ACGGTGATAA ATATCGGAGC TACCAAAGAC GGGTGCCGAT     62040
     GTTCTGGCCG GATCACCGCG GTTGGCGCGT AGCCTTTAGA AACTACTCGT TTCGACGGAT     62100
     GCTTTGAAGG CGGCAAAGGA CCGCTCAATC TGACCAGTGT TGTCGTCCAA TGGAGCGTCG     62160
     AGGCCGAGAA CCAGCACCCT GACCTTCCAA TTGTTGGAGA GATTACATTG TCCTCTTGAA     62220
     AGGAGATGAA ACAATGGAAC TGAATAGAAA TCTGACGACC CGATCTTCTG GCTCTCCGGC     62280
     GGCAGGCAGA AAGCGAGGTT GGCTCAGTGG ATGGAGCGGG CTTGCGGTCT GCGCGGTCGT     62340
     TTTCGTCGGT GCGATCCTTG TGTTCAGTGG CGCGTTCGGC ACGCAGAGCG CTGGAAAACT     62400
     GCTGCCACTG CTGTTCTTGC TGCCGTGTGC AATCATGATG TTCATGTGCA TGAAAAATAT     62460
     GGGTGGCAAT CAGAACGACA CGGGCAGTTC AAATGTCAAA ACTGGTGTTC ACAAAACCGA     62520
     TTCTGACGAC AGACATTGAC CCTGAGGCTC AGGAAAAACG TTGCCGGGTA AATTGTGGCT     62580
     GTCGGTCCGG AGAGAAGGCG TCGTTTCTCG TGAACGCGCG ATCCTAGTGT CGTTTGCGAC     62640
     ATTACCTTTC CACCCGACCG AGCATCAATC ATTGCGTAAC CAACCTGCGA GAAATTGTTC     62700
     GCGATTTTAT CAGCGCAGAG CAATGAAGCC GCCGTTGCCG GCGATCAGTA GGATATCACG     62760
     GCCAGCTATT GACACTTCAA GTGAACGTTT TTGCGACTGC CGATCCCCAC GTACCCGCCG     62820
     TTCTTACCTT TCGTAAGAAA AGTCGGGTCG CTCCAGGCAA GTACGGTTTT GGAGCGCACT     62880
     TCAGCATCAT CGCTGTCAGC GGTCTCGATC ACATCGCTCC CGGAGTGCCC TAAAAATACG     62940
     AGCGATCGTG GCTTATCGAA CGTCTTGGAC CAAGACGCGA AGTACGCAAT TGCCGTCATT     63000
     ATCGAAAGTC CAGCTACACT GACGAGGATT TGTGCCAACA CGGTCTGCGA GCCTGACTCC     63060
     AATACGAAAT GGGCCAAGAA TGACAGGATA ATTCCTGAAC AAAAGACATG GAGAGACTGT     63120
     TCTCCGCATT TGATCAGAGG TTGAAGAATA CTGCATTGCA AGCCGCTCCA GTTCACGGGC     63180
     AGAAGCCGTG TCGCCAACAG TGCAATGAAC GCAAAATGGA TCACGCGGTA AGGAGCGAGG     63240
     TCGGTCTTGT CATTTGGATT GAATGCGTCA AAGAGCCATT TTGGAAATTC ATTCGCCAGA     63300
     TTCGGGATAT GACCGGCCAT CGTCATTGCG AATGAAAATA GCAAATAGAC GACTCCAACA     63360
     TAAAGAAGAC TTCGTGAACG AATGAGACGG CGTGATCGCT TTGCGCCGCC CACAGCAAAC     63420
     CATGCGCCAA GAACGAACAG CAGCTGCCAC GTAAAGGGAT TGAAATACCA TGCTCCTTCG     63480
     GGGTAGGCGG ACAAATTCCA GCCGAAATGT CGCGCAGCGA GGTAGAGATA CAATGATCCC     63540
     AACATCGTAG CATCGGGCAA CCGCAACATG AGCCATAAAA TTGGCAAGAT ACCTGCCAAA     63600
     AGGACAATGT AGAGGGGGAG AACGTCCATG TTAAGGGGCT TGAAACGGAG GAGCAAGCCC     63660
     TGGGTAAGGA CGTCGAAAGG GTTGCTCACC AAACCGGCAA TATTGAATTC ATTTATGAGC     63720
     GCAGGATTAT CGTAACTTTG TGCGATATGG CCGATCATGG CCGCATACAA CACAAACAAG     63780
     AAAATGTGAG CGACGTAAAG CTGCCAGACG CGCTTCATCA ACCAGGACAT TCCCGCAACA     63840
     AAGCCGCGCC GCCGCATAAT ATTCGTGCAA ACCAGCGATG TCATATATCC TGACATAAAG     63900
     ATGAAAAGCT CAGCCGCATC ACTGAAGCCG TAGTTTCTGA TCGTGATCCA CGCGACAACG     63960
     TTGTTTGGAA TATGATCAAG AAAGATCGCC CAGTTAGCGA TGCCGCGAAA CAGATCAAGA     64020
     CGATGATCGC GTCCGCTGAT TGGAAGAGTG TTGTTTGCTG GCGTGTGTAC CATTTTAACT     64080
     TCCGACTGCT TGCGTGCGGG GGCCCTGTTT GCGCTCGAAG GACTATTCGA AGAAGCGGAA     64140
     TGCATTTGGA GAACCGATGT CGGGGATCCG GGCGCGTTGT GGAGGGATCG TTTTGTAAGT     64200
     AGGTCGGTGT AGCCCGAAAA TTGTGTTTGG CTCGATGACG ATAGCCCCGT TATCCAGAGT     64260
     GATAACCTTA TGCACCCGCT GGAAGGCTAA CCCTCACAGC GGTCTCGCGA TGTAGTCTGT     64320
     CAGCGCGGTG ATTTGACAAT CCCCACAAGG AAGTTCGAAG AGATCACCGT GTTGGTTACA     64380
     AGTTCACGCT GATGTGAGCG GCAGGGCGAC TCTCTCAGCG GAAAGTGGTG GTGATAAATT     64440
     GATGTCCTGG AATTGTCTCG AATGACGGGA CACTCGATCA GCGGGCGACC GATCCGCAGC     64500
     ATCTGGTGCC CGGGTAATGA AAAGCCGTTC GACGGCAGCA AGGAGGATGG GTGATCGTGT     64560
     CGCGGTGATC TTCGCCGAGC CGGGAAAGAC CGACAGGCTT ATCGAGCAGC ATTGCTAGAC     64620
     CAGATGGTGA GGTCGGGCTC CCGTCGATGC CCAGCTTTTT GTCAGGAAGG CACCGCCGTT     64680
     TTGCAATCGC GCCGGATTGT TCCGCGAAAT GATAGAAGAG ATGTTGCGCA TGACGCCGCG     64740
     TCACAAGACC GATTCCGACA TCAGTCAAGA GGTAGGGCTT CGTCGCGAGA CGATCGTAAG     64800
     CGCCCTCGAG AGGCACACAT TGGCGAAAGT TGGATTATGC CGCCCCGGAC GTTCAGCGTT     64860
     TCGGCGCCGA AGGAAAGCCG GCGCTGGTCG TCGCATTCGT CAGATCGTTG ACCTCTGCCC     64920
     GCGCATCATC GAACACAACG ATTGCGGTTT TTTCCTTAAA CGAAACGGTG ACTTTTGAGA     64980
     CGCCGGAAAC CTTCTCGATG GTCTTCTTGA TCATGTAAGG ACAGGCTTCG CAGTACATGT     65040
     TGTCCACCGC CAGGGTGACG GTTCGTTGCT CCGCCATTGC CCCGCCGGAG GAAATGATAA     65100
     GCAACCCGAG CGCGAGCGAA GTGGGGAACT TCGTCATTGA TCTCTCCATC ATGATGTCAG     65160
     CACGGGCCAA AGGACGTTGA ACGCGATCGC AGCGACAACC AATATCGTCG CGACGACGAG     65220
     CGCGGGATTT ACGAATTTGC TCGCCGATCG AATTGAACAT GCTGCATCTC TTTTTTGGTT     65280
     CGATGAGCGA TGCCACAGCC AGTATCCACA CCCAAGACAG GCAACAGCTA GGGCAATGAA     65340
     GTAGGGCTGA TAAGGGGCGA GCCGAACCAG CGTGCCTATC CATGGAGCGC TGGCTCCCAG     65400
     GGTAAAAAGA AGCAGCGGCA ACATGCAGCA CGACGACGCC GCGACAGCGC CCAGGACACC     65460
     ACCCGCCGCG GCGGCATTTT GCAGGCGCGT TACGTCGCGA GAACTATCGG ATTCTCTGCT     65520
     CGTCATGAAG CCAGCCTGTC AGACCGCCAG TTCGGGAATC CAGATGTACA CCGCGTTCAA     65580
     CATGTAGAAG CCCATTGCTA TCAGGAGCAC GCCACCAGCA ATCTCGAAAC CTCGCCGGTA     65640
     TCGGGCAAAG TGGCTGAGGT TTTCAAGCCA ACTGACGGCG AAGGCGCCGA TGGCGATGGG     65700
     CACGGCGCGG CCGAGAGCGA ACGCAAGAAG CAACACCACT CCAAGCCAGA CCGACCCGAT     65760
     TCCCGCCGTG ACACCGAGCA AAACCACCAA GGTTGGCGTG CAGATTGGGC ACACCGCGAT     65820
     GGCGAACGGG ATTCCGAGAA GGAAAGCTCC CCACGCGGCG GCTGGGCGGC TTGCTCGAAA     65880
     ACCGAACGAT GGCAGCGGTA TCCGAAGCCA ACCGACCCAC ATCAGGCCCA GGATGATCAA     65940
     CAACGGTCCG AGAAAAAGCC CCCAGCCTCG TCCAGCAATA TCCGCGGCCC ATTTCCCGCC     66000
     CAATCCTGCG ATCAGGCCGA GAAGCACATG GGTGAGAACC ATGCCCAGGA TGAACATGGC     66060
     ACCGAATAGG AATGCCTGGT CCTTGTTCCG ACCCTTGGTG ACGTAGGCGA GCGAGACTGG     66120
     GATCGAAGCC AAAGCAACGG GATTAAAGCT GAATACAAGC CCGGTCAGAA ACGCGACGCC     66180
     CGCGGCGGCG ATGCCCGCAT GCTCCACTGC CAGCCGTAGC GATTCCGTAT CCATCATTCG     66240
     CGCCCTTTAC TTCGCTCGAT CAGCGCCGTG CGCAGTTGCG CTACAGTCGG CATTGACGTG     66300
     AAAATGAGTT TTCCGTCGAC CGCGATGGAT GGGAGCGTCA GCACGCCGAG TTCGACCGCA     66360
     TAATCGAGTT CATCGAGAAC ATTCAATTCT CGCCACACCA GATTCTTCAC CGCTTCCTGA     66420
     GCGGTTGTCC GGAGCCTGGC GTGCGCAGCG ACGCATTCGG AGCAGCCGGG GCTATAGAAC     66480
     ATCTCGACTT TCATGGATTA ATGCACCGGT GTCTTGACGT TGGCTCGTTC CAGAGCGGCG     66540
     ATAATCGTGC ACTCGTTTAC TGGCTGGGTT TCGTTCGCGC AGTCGGCAAT CAGTTCATCG     66600
     AGCGCCTTGG ACATCGCCTT CATCGCGCGA ATCTTGCTTT CGATCTGCAA TTTTTTTTCG     66660
     ACGGCTCGGG TGCGGACGTC GCCGCAACAG GCCTTGTCGC GTCCCCGCAA GACGAGGAGA     66720
     TCGCGTATCT CCGCGAGCGT GAAGCCGCAG TTCTGGGCAT GCTTGATGAA GCGGATGCGC     66780
     CGTGCTGAGT CCTTGTCGTA CAGCCTATAA CCAGCGGGAC TTTTCCCTGC AGGCTCGACC     66840
     AAGCCTTCCT GTTCGTAATA GCGCAACGTG TCGTTGCTAA CGCTTGTGAG GGAAGCCAAT     66900
     TTGCCGATGG TGAACATGCA GTCTCTCCAG CGTGTGTTCT AGACCCCGGA GTATACTCCA     66960
     GGGTCAAGCG CATCATTGAG GCATCAGCCG CCTGCCGCGC GTCGGTCTGG ATATGGTATC     67020
     CAGGCCAGCC TGCATCACCC TTGGGTGGAT ATCGTTGGGC GGGCGGACGG GACCTCGGAA     67080
     CGGAACAACG CCAAGGACAA CAAGGCGAGG ATCATCTCGA CGACTGCGAA CACGCCCAAC     67140
     GCGGCCGCGA AGTTGTAACG GAGCAGTTCG CCGAAGATGA GGCTTCCGAG TCCGAATCCG     67200
     ACGAAGAGCA TGAAGACATT CAATCCCATC GCCTGTCCGG CACGTTTGCC GCCGAGCGAG     67260
     GTAACAATTC CCGCGAAAAG TGGTTGGGTC ATGTCGTAGC CCAGGGACAG CACCATCGCG     67320
     ACGACAGGGG CGAGGACCAT TGGGAAGCCG AGCATCAGTG CCGCCGCCGC AAGAGTACTC     67380
     AGCAACAGAC CAATGGGTAT CAGTCTGGCG CGGCCGAAGC GATCCGCCGC CCGACCGATC     67440
     AGCGGCCCGA AGAGGAGGCC GGGCACGCCA TAACCGAGGA GCGCGAGGCC AATTCCGATG     67500
     GGCCCGACGC CGTATCGCTG CTCGAAGTAC ACGCCAAGCC AGGTGAAGAC GCCGGAATGG     67560
     AATATCGAGT TGATGAGGAC ATAACCATAG GTGCGCTGCC CACGCGGCGT GCCGAGGAGA     67620
     TCCTTGTAGC CGCGGACCAA ATCCCGGAGC GTGCCGGTCA CCGATTGAGC CGTGGCAGCA     67680
     ATGACGGATC GATAGGGCAG AAGGACAAGC AGTAGCACCG CGCCGACAGC CCCGACCACG     67740
     ACGAACAAGC CTTGCCAGCC GACGAACGGC ACAATCATCG CGCCCAGTGG CGAACCGAAG     67800
     GCCATGCCGC CAGCCATCGC GCCGAACAGC CAACCGAGCG GTCGGCCCCG CTGTTCGTAG     67860
     GGATACAGCC GTCCTACCAG TGCTAACGCA AGCGGAACGA CGCCGCTCGC GCCGATTCCA     67920
     GTCACGGTCC GCCACAGTGC GAGCTGCTCA ACGGACTGCG CGGTCGCCGT CAGCATGGTG     67980
     AGCGCCGAGA AAGCCATCAA GGACACGAAC ATCACGCATG GATAACCGAG CCGATCCGCC     68040
     AGAATGCCGT ACGCGAGGGT CGCGATCCCA TAGGGGATCA GGTAGGCGGG CACGATGAGC     68100
     CCGACGGTTT GGACCGAGGT TCCGAAGGCA TTCGACAGGG CGGGTATAAT CGGCGCCACC     68160
     ATGTAGGCCT GAAAGAAGAT GATGAAGGTT GCCGCGGCGA GCATCCGCAG GAGGCGCTCG     68220
     CGCCGGTGAT CGTCGATCGC GCCCGGCGCC GTTTGCCGCA CTCTCACAAG ATCATCCTGT     68280
     GCCATGTCAC GCCGCCTGCG ATGTTGTGCG AGCAATCGGA CGCCCGACAC TCCGGATTGC     68340
     ATCAAAAAAG AGCCGCGGCG TTCCCCATAG CGAGTTGATG AAAATCGCAG TGACGCTGAC     68400
     GGCCATCGCC ACCATCGCCC ACACCGGATG GATCAGGCCG GTGGCAGCAA GTGGAATGCC     68460
     GAGGCCGTTG AAGAGAAAGG CGAGGGCGAC GTTCTGAACC ATCTTGCTGT AGCTCCGGCG     68520
     GCTGATATCG CGGGCGACCG GAAGCGCATC GAGACGATTG GACAGGATGA TGATGTCCGC     68580
     CGACTCGATC GCAATATCGG TGCCGCTACC CATGGCGATG CCGATATCAG CTTGCATGAG     68640
     AGCGGGGGCG TCGTTGATGC CATCGCCGAC CATCGCGACC CGGGCGTTGA TCTGAAGCTC     68700
     TCGGACGATT CTGGCCTTGT CCTGGGGCAA GACCCCTGCG TGAATCTCGT CGATGCCAAC     68760
     GTCCCGACCG ACCCGCTGTG CCGCGCGCTC ATTGTCACCA GTGACGAGGA TCGTCCTGAG     68820
     GCCTGCTTTG CGCAGCGCGG CGATGGCCGA GACGGCGTCC GGTCGGAGTG CATCGCCCAA     68880
     GGCGACAATG CCCAGCGCGT GTCCATCCCG AGCGACGGCG ATCACGGTGC GTCCGGCGGC     68940
     CTCCAGGCTG TCAATGGCCT CACGAAGAGG CGTGAGGTCA ATATCGCGGT CGGCGAGGAA     69000
     GCGCGGACTG CCGACGAAGA CTTCGCGGGC GTCGATGCGT GCAACGATAC CCTTTCCGGG     69060
     GAACGCCTCG AATGACTCAA CGTCCCGAGG CGTTGCGCCG TAATCGAAAG CCGCCTTGAT     69120
     CACCGCCCGT GCCAGCGGAT GCTCCGAGGA TGCTTCGGCG GCAGCGGCAA TGGCAAGAAG     69180
     CTCCTGCTCA CCTACATCCA TGGCTCTGAT CTCGCGCACC GTTGGACGAC CCTCGGTGAG     69240
     CGTGCCTGTC TTGTCGAGGA TGATTTTCGT CACCGTTCGG AAGCCCTGGA AGGCTTCGCC     69300
     AGTCCGCATC AGGATGCCAC GCTCGGCGGC CTGACCAGCA CCACGTACGA TGGAGAGCGG     69360
     CGCTGAAATG CCGATGGCGC AGGGATATCC CATCACCAGG ACACTCAGAC CAGCAAACAC     69420
     GGCACGTTCT ACGTCCACAT AGCCTGTGCC GAGCCAGGAG CCGATGAGCC AGCCGATGAA     69480
     AGCAAGGGCG GCGATCAAAA GAACGGTCGG CGTGTAAACA CGCAGCACGC GATCAACGAG     69540
     ATGAAGAAGG CCGGGCTTCA GCGCCCGTGC GTCCTCGACG TGACGGATCA CCTGATGCAG     69600
     GAAGCTGCCT TCTCCGATCG CCGTGATCCT CAGCAGGAGG GTGCCCGTGC TGTTGATCGA     69660
     GCCGCCGATG ACGGAATCCC CCTCGGTCTT CTCGATCGGG ACAGCCTCGC CGGTCACCAA     69720
     TGATTGGTCA ACGCCGGAAT GACCGTCGAC CACCGTACCA TCTGCGGGGA TGCGCTCGCC     69780
     GGGGCGAATC CGCACAAGAT CTCCGATCCT CACCTCATCA ATCGGCAGTT CCAGTTCCTC     69840
     GGTGCCGCGC ACGACGCGCG CGGTCTCAGG CTGCAGGTCC AGCAGGCGCT TCACCGCCTG     69900
     GGAACTTCGC GTCTTCACGA TGAGCGAAAG CCACTCCGAG AAAATATGAT AGGTGCCGAC     69960
     CATCACCGAA ACGGCGAAGA AGGCCGCGGT GGGATAGCCG GGCCGATCGA GGATCAGCCC     70020
     GATGATACCA CCAGCTATCC CTGCGAACGC GCCGATCTCG AGAAGCACGT GCTGATTAAG     70080
     GATGCCACGG CGAAGCGCCT GAACGGCCAT GTAGAGAATG TGCCGCCCCA CTCCGAAGAC     70140
     AAGCATCAGA GCCAAGGCAC CCGCAAGCCA AGGTGCTGCG TCCGTCAGAT ATCCTTGCAG     70200
     ATTGAGGTAA AGCAGGCTCA GTGCCATGAC CGTTAGGCCC AACGCGGCGC CGATGGCGGT     70260
     CCACAATCCG CTTGATCGCA ACACCAGGAA GACAAACCCT CCAAGACTGA GGCACACCAT     70320
     GGCCGGTAGA AATCCGATCC AGCCCACAGC CGGATCGGCA ATGATGGGAA TCGCCGCGAC     70380
     ACTGAGAACA ACCGCGAGAA CGAAACGCCG GGCCTCGCGC AGTAGGTCGT GCTCTTCCTC     70440
     TTCAAAGGCC CTGAGCTTGC GAGGGTCGGA AATCGTGTAG CCGATGTCGC GCAACGTTTG     70500
     GAGCAGATGT TCGGGACGCG CAATTGTTGG ATCGTACTCA ACCAGCGCCT GTTCATGCGT     70560
     CAGGCTCACG GCCACCTTGT CGACGCCGGG CATGCGGCCG AGCGCTTTCT CGATGGTGCC     70620
     GGTGCAAAGC GAGCAATGCA GCCCCCCGAT CCGGGCGCGA ATCTTTCTGC GATTTGGTCG     70680
     CGTTGATGGT TCCTCCGTCC AAAGCGCGAA TGGGGAGTCG GTTGCCGTTG AAAGAGCCAT     70740
     CGGAGTCTCC GTGAGTGCGC GAGCACGCGC TGAAATGGGA AAGCGAGACG GGGCCGCGAT     70800
     GACAATTATC CGCGTGCTAC GACCCGAAAG CCGGGTTTTT GAATCGTATC GACGAGCCGT     70860
     TCCTCCTCGA CGGATTGGGG ATCGTAGAGG ATGCGTGCCG ACCCCTCGTC GAACGACACC     70920
     TCGGCCACTC GTACCCCAGG TTCCTTTTCC ACGAGCTTCT TGATCGTGTT GGCGCAGGCG     70980
     TCGCAGTTCA TGCCTTCGAT TTTGAATGTC GTCGTTTTCA TCGGGTGCTC CAATTTGAAA     71040
     TATTGCAGGA TTGGAGCGAT GCTAACCCTT GGAGGTACCT CCTAGGTCAA GCGACTAAAG     71100
     CTCGATCTTC TCGATCGGCT GACCTGTGGT CACAGCGCGT GGCCCAATGA TAGCGCTTGA     71160
     CCCCGTCGAT CCAGGTTTGC GGCGAGGCCA AGGCGTCGAC AGTCAAGAAT CGTGCGACGC     71220
     CGCCCAGCAC GACCCAAATT TGGAACCGAT AGATTTTCGA CGAAGACGGC TAAGCCCGCT     71280
     TCCGGGAAGC CTTTGGTTGC CGTGCGGAGC GCTTCTTCGG AGATGCCTTT TTGGAAGCGG     71340
     TTTCGCAGTC ACACGAGGCC CCGGTTGCGT TCGGAATGCC GCACAGTTCG GGATGTCCAT     71400
     TGCAGCAATC GTCGATGAGA AACGAGATCA GTGACTGCAT GCCTTTGACG TCCGAACGGT     71460
     AGATGATGGT TCGACCGTCA CGCGAACTGC GAAGAAGTCC GGCCCTGACC AGGATGGCAA     71520
     GGTGGGTAGA CAACGTGTTG TGCGGTGCGC CAACCGTTTC GGCGATGACG CCTGCGGTAA     71580
     TTCCGACCGG TTCATGTTTC ACGAGCAACC GAAAGATCGC AAGCCGGGTT GGTTGAGCGA     71640
     GTGCCGCCAG CGCCGATATC GCGTGCGGTT CCGACAGGTC TTGCCCCGGA CTAACGCGCG     71700
     TCGCGTGACT TGCGACCGCG AGCATTGCGT TCCTCATCAA ATCATCCTGC TGCAGTGCAT     71760
     CCAATCCTCC TCACCTTTTT ATATGACAGG CAGGTGACAA GCTAGAACGT TTCCATTATT     71820
     AAATATGTCG AGACGTCTCG ACATATCGTA ATCATATTTC GAATGTGATC GGTAACAACG     71880
     AGTGGGACGC TCGGGCGGTA GGCGTACCGA CCCAACCTCG AGGAAACCCC ACCGGTAGGC     71940
     GTATCGGTGC GTTCCAGGAG AACGGCAATG TCTCACTGCG ATCATTTGGT CGATGTTGGG     72000
     CGCCGCAAAT TTCTGAGCGG AGCCGGTCTC GCTGCCGCGG GTGCTGCAGC TGCGACCATG     72060
     GTACCAGTTC ATGCTAAAGC CGCGCCTGGT TCTGCGCGCG TCGATTACCC TTCAAACCGT     72120
     CTTGCCAACA TCGGCGAGTT GAAGCCCAAC GAGGCATTCA ACGTGGCATA CCCCGACGCG     72180
     GATGCGCCCG GGGTCCTTCT CAAGCTGGGC AAGCGCGTTC CGGGCGGTGC CGGACCGGAC     72240
     GGCGACATCG TGGGGTTTTC CACGATTTGC CCGCACAAGG GTTTTCCCCT CAATTACAAT     72300
     GGCGTCGACA AGACACTGAA TTGCCCTGGC CATTACTCGC GCTTCGATTG CGAATCCGGC     72360
     GGCCAGCAAG TGTGGGGCCA CGCCACGCAA AACCTCCCGC AGTACATGCT TCGCATCGAC     72420
     GGCAAAGGCG ACATCTACGC CGAGGGTGTG GACGAGCTTT TGTACGGTCG TCTGTCCAAC     72480
     GTGTTGTGAG GGAGAAATAT CATGGCCTAC AAGCGTCAGA TCGATCGTCT CCCGATCATC     72540
     CCGAAGGATG CGAAGGAATT CAACGTCACT TGTCATTACT GCATCGTTGG CTGTGGCTAC     72600
     AAAGCCTACA CTTGGCCGAC GAACAAGCAG GGCGGCACGG CGGCGGACCA GAACAAGTTC     72660
     GGCGTCGACC TAGCCAAGCA GCAGGGCGCG GATACACCCA ACTGGTATGC GCCTTCGATG     72720
     TACAACATCG TGCGCCAGAA CGGCGAAGAC ATGCACATTG TCATCAAGCC GGACCAGGAT     72780
     TGCGTGGTGA ATTCCGGGCT CGGGTCGGTG CGTGGCGCCC GCATCGCCGA GATGAGCTAT     72840
     TCGCAGGCAC GCAACACCCA GCTTCAGCGC CTCACCGACC CGATGGTCTG GCGCTACGGC     72900
     CAGATGCAGC CGACGGGGTG GGAGGATGCG CTTGACCTTG TCGCGCGCGT AACCGTCGCA     72960
     GTCATCAATG ACATGGGCGA GGATGGACTC TTCGTCTCCG CGTATGACCA TGGCGGCGCC     73020
     GGCGGCGGTT ATGAAAATAC TTGGGGCACC GGAAAGCTCT ATTTCGGAGC CATGAAGGTC     73080
     AAGAACATCC GGATCCATAA CCGACCCGCC TACAATTCCG AGGTTCACGC CACGCGCGAC     73140
     ATGGGCGTCG GTGAACTCAA CAACTGCTAT GAGGATGCCG AACTCGCCGA CACCATCGTC     73200
     GCCGTCGGAA CCAATGCACT CGAAACCCAA ACCAACTATT TTCTCAATCA TTGGGTGCCG     73260
     AACCTGCGCG GCAGCTCCGT CGACAAGAAA AAGGCCGAGT TCGGCGCGGA GCCAGTCGAT     73320
     CGCGGACGCA TCATCGTCGT CGATCCCAGG CGTACAGTCA CCATCAATGC CTGCGAAGCC     73380
     GAAGCAGGCA AGGACGGCGT GATGCATCTC GCCGTCAACT CCGGCACCGA CCTCATTCTC     73440
     TTCAATGCAT GGCTGACCTA TATCGCCAGC AAGGGTTGGA TCGACAAAGC TTTCATCGAC     73500
     GCTTCCACCA AGAACTTCGA CAAGGCGCGG ACCGCAAACA ATGTCAGTCT GGATGAGGCG     73560
     GCGAGGGTCA CGGGCCTCAC CGCCGACCAG ATCAGGCAAT CGGCAGAATG GATCGCGCAG     73620
     CCAAAATCCG GCAACGCACG TCGGCGGACG ATGTTCGCTT ATGAAAAGGG CTTGATCTGG     73680
     GGCAACGACA ACTACCGGAC GAACGCAGCT CTAGTGAACC TGGCGCTCGC GACAGGAAAC     73740
     GTCGGACGCC CCGGCGGTGG CTGCGTGCGG ATGGGAGGCC ACCAAGAAGG CTATTCGCGA     73800
     CCCTCGGACG CGCATGTCGG CCGTCCGGCA GCCTATGTGG ATAAACTGCT GATGGAAGGT     73860
     AAAGGCGGCG TACATCACAT CTGGGGATGC GATCATTACA AGACCACGCT CAACGCCTTC     73920
     AAATTCAAGC AGACCTACAA GAGGCGCACC GACATGGTGA AAGACGCCAT GATGACGGCG     73980
     TCATACGGCG ACCGTGCCGC GATGGTGAAT GCCATCGTCG ATGCAATCAA GAAAGGCGGG     74040
     CTATTCGCGG TCGATGTCGA CATCGTGCCA ACCAAGATCG GCGAGGCGTG TCACGTCTGG     74100
     TTGCCTGCCG CCACGTCCGG TGAAGCCAAT CTCACCTCCA TGAATGGCGA ACGGCGCATG     74160
     CGGCTGACCG AAAAATACAT GGACCCTCCC GGCCAAGCAA TGCCCGATAG CCTGATCGCG     74220
     GCACGGATCG CGAACCACAT GGAGCGCGTC CTGCACGAGC AGGGCAAAGG CAAATACGCC     74280
     GACCAGTTCA AGGGGTTCAA CTGGAAGACG GAGGAAGACG CCTTCATGGA CGGCTATCAT     74340
     GGTCACGAAA AGGGCGGGGA GTTCGTCACC TATGAGCGTC TACGCGTGAT GGGAAACAAC     74400
     GGCTTCCAGG AGCCCGCCAC GGCCTTCAGG GACGGCAAGA TCGTTGGGAC CAAGCGACTG     74460
     TTTGCCGACG GGAAGTTCAA TTCCAAGGAC GGCAAGGCGA CGTTCATGGA AACCCAATGG     74520
     CGCGGATTGC AGGCAGCAGG AAAGGAAGAG GAGCGCAAGA AGTGGCCGTT CCTCATCAAC     74580
     AACGGACGCG CTAACGTCGT GTGGCAAAGC GCCTATCTCG ATCAGAAGAA CGAATTCGTC     74640
     ATGGATCGCA TGCCGTACCC GTTCATTCAG ATGAATCCGC AGGACATGGC GGACCTCAAG     74700
     CTCAATCAAG GCGATCTGGT TGAGGTCTAC AACGACAACG GCTCCACGCA GGCCATGGTC     74760
     TATCCGACAG CCAGTGCGAA ACGAAAACAA ACGTTCATGC TGTTCGGTTA TCCGACTGGG     74820
     GTTGTTGGCA ACGTCGTGTC CGCCGGGGTC AACGAGTTCA TCGTCCCGAA CTATAAGCAG     74880
     ACCTGGGGTG GTATCAGGAA GATCGCGGAT GCTCCGGAGG GCGTGAAGCA CCTGAGCTTC     74940
     AAGTCCGACG AATACACGGC CTGAACGATC CTCCCGCATC CTTGCCTGAG CGGAACGCCG     75000
     CTCGGGCATT TTTTTGAAGC TCAATGCCAA AAATCAAGCA ACGTGTCATG TTCGACCCCG     75060
     TTGTCGCGGG TGCTCGAGTC ATAAAACATA GCCTCAAGCC GTTGGTAGGA GGGGATTTGC     75120
     GGAGCTTAGA ACGCGCTCGT CCGCCTGCCC ATTCCAGTCC TAAAGTGCTT GATCGAGACT     75180
     CATGCGCTTT ACAAGCTTTT CGGCCGTTTC CTTGCGTTCG CTGTAGCGGT CCGTGAGATA     75240
     TCCGGAAACG CCCCGCGTCA ACAGCGTGAA CTTCACAAGC TCCTCTATGA CGTCGACGAT     75300
     CCGATCGTAG TAGGGCGATG GCTTCATCCG CCCGTCCTCA TCGAATTGTT CATAGGCCTT     75360
     GGCGACCGAC GACTGATTGG GAATCGTGAT CATGCGCATC CATCGGCCGA GGACACGGAG     75420
     TTGGTTGATA GCGTTGAACG ATTGAGAACC GCCGCACACC TGCATGACGG CCAGTGTCTT     75480
     GCCTTGCGTC GGCCGCACCG CGCCGAGCGA CAACGGAATC CAGTCGATCT GGGCCTTCAT     75540
     GATGCCGGTC ATCGCGCCGT GGCGTTCCGG ACTGCACCAG ACCTGACCTT CCGACCAGGC     75600
     CGACAATTCG CGAAGCTCCT GGACCTTCTC GTGGGTCGCC GGGGCGTCGT CCGGAAGAGG     75660
     GAGGCCAGAA GGATCAAAAA TCCTGGTTTC CGCACCGAAG GTTTGAAGAA GACGGGCGGC     75720
     TTCCACCGTG GCGAAACGGC TGAACGATCG CTCGCGCAGT GATCCGTACA GTAGAAGAAT     75780
     GCGCGGACGG TGCGTTGGCA TTGGACGATG CAATAATCCG GCATCGGGAA GGGAGAAGGC     75840
     TTCGTCATTG ACGTTTGGCA AATCTTGCAT CTCAGTTCGC ATTGATGATC TCACCGTCTT     75900
     CCTTCACGAA CCGTCCGATG TGCGGGTTCG GAAGAATGGA AAGCACCTCT TCGGAGGGGC     75960
     GACAGAGCTT GACCCCCTTG GGCGTCACGA CGACAGGGCG GTTGATCAGA ATGGGATGCG     76020
     CAATCATGAA GTCGATCAGT TCGTCGTCGG TCCACCTAAG ATCCGCCAGT TCGAGATCGT     76080
     CGTAGGGCGT ACCCTTTTGG CGAAGCAGGT CGCGAGGGGA AATACCCATT CGGGTCATCA     76140
     ACTCGATCAG CTTTTCGCGC GACGGCGGTT GCTTCAGGTA TTCGATGATT TCCGGCTCGA     76200
     TGCCGCTTTG GCGGATCATC GCCAAGGTGT TGCGGGACGT TCCGCAATCC GGATTGTGAT     76260
     AGATGGTGAT GGTCAAAGGA TCGCCTCCTG GGCGAGTTGG GGTTTGGTTT CGTCCGCACG     76320
     CAGGAGCCAG CCGATAAGAG CCATGCCGAC CAAGGCGCCG CACAGCTCCG CGATGATGAA     76380
     GCCTGGAAGA TCAGTCGGGC GGATGCCGGA AAACGTGTTC GTGAACGCGC GGGAGATTGC     76440
     CACCGCAGGA TTTGCGAACG ACGTCGAGGC CGTGAACCAA TAGGCCGCCG TGATGTAGAG     76500
     GCCGACCAGC CACGGGACGG CGGTGCGCTG GAAGCGGATT CCAGCGACAA TGGTCGCGAC     76560
     AAGACCGAAC GTGGCGACGC CTTCGGCGAG CCATTGCCCA CCGCCCGTGC GGACCTTGGT     76620
     CGAGGCTTCC AGCAAGGGCA GCGCGAACAT GGCGTGTGCC ACGATGGTGC CCAGGACACC     76680
     GCCGACGATC TGGGCTCCGA CGTAGCAGAC ACCGTCGCGC GCACTCATTT CCCGCTTCAA     76740
     CGCAAAGACC AGCGTTACCG CCGGATTGAA ATGCGCTCCC GAAATGGGGC TGAGGATCGT     76800
     GATCAGCACG ACGAGGATCG CTCCGGTCGG CAGGGTGTTT CCGAGAAGCG CCAGTGCCGT     76860
     GTCCTTGGTC AACGTCTCCG CCATGACGCC GGAGCCGACG ACTGTTGCCA CCAGAAGCCC     76920
     GGTCCCGAGC GCTTCCGCAA CCGCTCTGCG CGACAGGCTG TAGGTTTCCA TCAGATCACC     76980
     TTTCCTTGTC CGAATGTCGA ACCGTCCAAA CGCCCGATCT CGCGCAACTT CGTACCGAGC     77040
     GAAAGCTGAT CGATGCTTGC CAGCGGAAGA TTGGTGAACA GGCTGATGCG GTTTTTCAGA     77100
     TAACGAAACG CGGCAACGAA CGCGGCTTCT TTCTGGATGT CGGTGCCCTC GATAGCCGCA     77160
     GGATCTTCGA TCCCCCAATG CGCAGTCATC GGTTGTCCCG GCCAGACTGG GCAACTCTCG     77220
     CCAGCGGCGC TGTCGCAAAC CGTGAACACG AAATCCATCA CCGGGGCGTC CGGCACCGCG     77280
     AACTCTTCCC AGCTTTTGGA ACGCGCACCA TCGGACGGAT AACCGAAACT GTTCAGTACG     77340
     CTCAACGCAA ATGGATTGAC CTTGCCCTTG GGCTGGCTGC CCGCTGAGAA CGCGCGGAAA     77400
     CGGCCGTTGC CGTCCTTGCT CATGATCGAT TCCGCGAGGA TTGAGCGGGC ACTGTTTCCG     77460
     GTGCACAGGA ACAGCACGTT GTATATCTTG TCCGACATTT GAGGGTTCCT TCGTTTCGGG     77520
     AGAGGGGCCA GATCTTCGAT CAGCGGTGCA CAGACCTCCG TGCGCCCGCC GCAGCAATCC     77580
     TTGAGCAGGA AGAGCGTGAC TTTCCGGAAT GCTTCGAGAT TGGCGCGGTA CACGATCGAA     77640
     CGGCTTCGGC GCTCCCCGCG CACCAGTCCA GCCCGCGACA GGGTTGCCAG GTGGGTCGAC     77700
     ATCGTGTTCT GCGGCACGCC CGCGAGGCGT GCGAGTTCCC CAGCGGCCGC GCCACCCGGT     77760
     TCGCGCTCCA CCAGCAGGCG GAAAACGTCC AGACGGGTCG CCTGGGCGAG GGCGGAAAGT     77820
     GCCGCGATCG CAAACGAGGT ATCCATATGT CGAAATTTCT AGAAATAACG AGGAATGTCA     77880
     AGCGGGATCG TAGATATTTT GATAATTCTA GAAATACGGT TGACTCGGTC GTCGGAGACT     77940
     ATAACGTGTC CCCATGAAAC TTGATGATGC CGCAACGCGC CTCGAAGCCC TCGGCAATCC     78000
     GACACGGCTC AAGATCTACC GCGCACTCGT TCGCGCCGGA ACGGTCGGCA TGCCCGTCGG     78060
     TCGCCTGCAG GAAAAGTTGA AGGTCGCCCC TTCGACCTTG TCACATCACA TCAAGTCGTT     78120
     GGTCAGCGTC GGCCTCATTC GCCAGGTCCG TGAGAGCACG ACGCTCGTTT GTCATGCCGA     78180
     ATACGACGCG ATGCACGCTC TGGTGGATTT CCTTGTCGCT GAGTGCTGTG CCGACGAAGC     78240
     GGGATGCAAG GACGCGAAAA CGGCCGCATG AGTTTTTTTG ATCTATAATT TCTATTATTC     78300
     TAGAAATATG GAGAATGAGA GTGACATCCT CGAAAATCGT TGCTGTCATC GGGGGAGGCC     78360
     CCGTCGGCCT TGCCGCCGCT GCTCACCTGA TGGAACGCGG CATGACGCCG ATCGTGCTGG     78420
     AGGCCGGAGA ACAAGCTGCT CACGCGGTCC GGCAGTGGCG GCATGTGCAG TTGTTCTCGC     78480
     CGTGGAAATA CAACATTGAC GGTGCTGCCG CCCGTCTGTT GGCCGCTACG GGGTGGAATT     78540
     CACCTGATCC AGAGGCCTAC CCGACGGGAG GCGAGTTGAT CGAGCGCTAC CTCGATCCTC     78600
     TGGCAACCAA GACACCCTTG AGGGACGTCA TCAGGACGTC AAGCCGGGTT ACGGCTATCA     78660
     GTCGTGTCGG ATTCGACAAG GCAAAGACGA AGGGACGCGA GAGCGCGCCA TTCGAAATCC     78720
     GCTTTCAGAA CGGCAAGGGA CCTGAAACCC TGCGTGCCGA TGCCGTGATC GACGCTTCCG     78780
     GAACGTGGTC TTCTCCAAAT CCGGCAGGCG TGAATGGGCT TGCCGCCATC GGTGAGAGGG     78840
     AATGTGCGGC TCGGATCACC TATGGGATGC CGGACGTCCG CGGGACGGAG CGGGAGCGCT     78900
     ATGAGGGCCA GACTGTTGCG GTGGTGGGGG CAGGTCATTC TGCAATCGGA ACGCTGATCG     78960
     AATTGGCCCG ACTTCGCGAC AATGCGCCTC CAACCAATGT CATTTGGCTT CTCCGCGGCA     79020
     CCGATCCGTC AAAGGCATTC GGCGGGGGCG CCAACGACAA GCTCGTCGCT CGCGGCGAAC     79080
     TGGGAGCGGC TTTCGCCGAT CTCGTATCGA AGGGAGCGAT CCAGGTGGAG ACAGGTTTTG     79140
     GCATCACGCA TGTTTCCGCT TCCGGAGAGC GGCTACGCAT CGGAGCCGGT TCGGCATGCT     79200
     GCGGCCGCCA CGTCGTCGTC GATGAGTTGA TCGTGGCCAC GGGATTCCGG CCTGATCTCT     79260
     GGTTCCTAAG TGAGATGCGG TTGCGTCTGG ATTCCGCGAT CGAGGCACCT GTCGATCTGG     79320
     CGCCGCTGGT CGACCCGAAC GAACACAGCT GCGGGACTGT GCGCCCCCAT GGGGCGCGAG     79380
     AACTTCGGCA GGATGAGCCC GGTCTCTATC TGGCTGGCAT GAAATCCTAC GGACGCGCGC     79440
     CGACGTTCCT GATGATTACC GGGTACGAAC AAGTCCGCTC CATTGCGGCA GAGATCGCCG     79500
     GTGACCATGA AGCGGCTGCA CGGGTCGAAC TCGATCTGCC GGAAACAGGC GTTTGCACCC     79560
     GGGGTGGCGT AGAGGTCGGG ACCGCGTCGG CGGGATGTTG TGGCGGTCCG GCGCCCGTCG     79620
     GTGCGGATGC CTGCTGCGCT GAGGATGCCG ATGCGAAGAC TGCGGGGAGA TCCGGGTGCA     79680
     GTTGCTCGTG AGGATGACCG CGTGAGCGGC CGCCAGCTTC CGGTCATCTT CGCGCTTGGG     79740
     ACAACGCAAA CCCTCGCGTG GGCCTCCAGC TATTATCTTC CGGCGATTTT GGCTGATCCA     79800
     ATCGCGCGAG ACCTCGGCAT CTCGAGCAAC TGGTTCTTTG CCGCGTTTTC CGCCGCCTTG     79860
     GTCATCTCCG GATTGCTCGG GCCGCGTGTC GGACGTCAGA TCGATCTGAT CGGGGGACGG     79920
     CCAGTCCTTT CCGGATCGAA TTTGATCTTC GCTGCTGGTC TGGCGTTGCT TGGGGCATCG     79980
     ACGTCGGGTT GGATGCTCGG AGCGGCTTGG TTTCTGCTCG GCATCGGAAT GGGAACGGGG     80040
     CTTTACGATG CGGCATTCGG TGCGCTGGGG CGCATCTATG GCAACGATGC CCGACGCGCG     80100
     ATCACGGGAA TTACGCTGAT CGCGGGATTT GCCAGTACGG TTGGCTGGCC GCTCAGTTCG     80160
     TTCGGGCTTG AGGCGATCGG ATGGCGAGCC ACGTGTTACG CCTGGGCCGT CGCGCACCTT     80220
     CTGGTCGGGT TTCCTCTCAA CCTCCTCTTT CTGCCGAGGG TTACGACGGC AAAGCGTAAC     80280
     GAGGCATCGA CCGTCAAACC GCACATGCCG ATCGACCGCA CCATGATCCT GCTGTCCTTG     80340
     GCGTTCGCGG CAGCATGGAC GGTCACCTCC GCGATGGCGG CACACCTGCC GCGTATCGTC     80400
     GAGGCGTTCG GTGCAACGCC AGCGCAGGCT GTTTTTGCGG GGATGATGAT CGGCCCCGCC     80460
     CAGGTGGCGG CGCGTGTCCT GGAAGCGGGC ACGCTGGGCA GATTCCATCC GTTGTTCTCG     80520
     ACCCGGCTTG CCTGCATCAC ACATCCCATC GGCGCCTGCA TAATCGGAAT CTTCGGAGGC     80580
     GGTGCCGCGG CGGCATTCGC CTTGCTTCAC GGGGCAGGCA ACGGTTTGCT CACGATTGCT     80640
     CGAGGTACAC TGCCGTTGGA AATCTTCGGT CCCGAAAACT ACGGATATCG CCTCGGGCTG     80700
     CTCGGTGCGC CGTCCCGCGT TTGTCAGGCC CTGGCTCCTC TGGGCTTTAG TCTGCTGATT     80760
     GATCCACTCG GGGGAGCGGT TCTGATTGTA TCGTCGTTGC TGAGTCTGGT CGCGTTCGGT     80820
     GCGCTGTTAT TGCTGCCAAG GCATGCAACC AAGGACACCG TGGCCGAAGA GGCGAAAAGC     80880
     TGATGGCATT GCGACCCCGC CGTCAATAAC GTCGGGCGCT GGTAAGCAGG TTAGAAATTT     80940
     GATTCGCATA AGATGGATTA TGGAATATAT TCCTAAATTA AAAAAATGTC AGAACATGTC     81000
     GGAACAGCCA TTCCCGCAGA CCCGGGGCAA CACTTCGTGG GCTCGCGCTG AGCAGGAAAA     81060
     GATCGTTCGC GAGCTAGAAA TGGCATCTTT CAATCTATCA AAGGGCAACG GATGGCCTAA     81120
     CGCTTCAGCG AAGGAGCTTT GTCCGAATCG CCATGGCAAT GGCATGAGCT TTGCTGACTG     81180
     CACCAAGTTT CGCGCGCGCC GCCATGATAT GCTTGGTCAC AGTTGATTTT GAGATTCCAA     81240
     GAATCGCCGA GATTTCCCAG TTCGTCTTTC CCTCGCCCGC CCAAAGCAGA CAATCCCATT     81300
     CCCGTGCCGT CAGATTGCTA TTGACGCGCC GCCAGGTCGC AATACGATGG AGATGTCGAC     81360
     CCAAAGCGTA GCTGGCCGCA AAGTTCAGCA CTGATAGATC GGCCGAAGCC GGAAGTGTTC     81420
     CCGGTCCGCC GAACGACAAA GACACAATCT CACCGTCTAT TGTCGAAATC GGCACGACGT     81480
     AACCGTCGCG TAGTCCGAAT TCCGCGGCTT CGCCTTGTAT CAGCCTGACA TTGCTTCGCT     81540
     GAGGGCAGCT CTTGTAGCCC TCATGCCATG TGAACGGCGT TCGTTCATGA AAAAGGTGCT     81600
     GAATGATCGG ATCGCGAAAT ACGTATCCCT TTCTGCTGTA GCGATCTAAC CATTGCGCTG     81660
     GAAAGCGCTG GAATAGGATT CGTGAGCGAA GTTCAGCCAG TGGCGCTGGG CGCGTCGGCA     81720
     CGATGCCACC GAAGAGACCG GTAAAGCCGA ATTCCGCCGC GAGCCCCAAA AGGCAATCTT     81780
     CTATTTCGGC TGCGGTTCTC GTCTGCTCCA CGGCCTCCAT AAAGCGAAAG GTTTGGCTTA     81840
     AGCGGTCCGA CAAAGGCTTA AGTCCTTCTT TGCCTAATTG GGGGCCGTGC TCGTCCTAGC     81900
     GGCATTGGAC AGACGGAAGT TGGGTGGACG TCGCGATCGG CATCGTTCCG CTCATGGTGG     81960
     TTGCTGTGAA AGCGTTGACC AAAAGAATGA ATCCTTGTGG CAAGAATGCG GCCTGTCTGT     82020
     CGGCCTCATG TTTCACGAAG TGACTGAAGC GACGCCGTGT TTCTGTATCT TCGTCAACCG     82080
     GGCGCGGTGG CAACCGAACC TGAGTGATAC GCGTTCATCA GCGGTCATTA TATCATGTGA     82140
     CCGGCTGTCA TCAGCCCGAT CCGACTGCCG AATGGATCGT CCGCGCTTGA AGAGGTGCGC     82200
     GGGCTTGGGC ACTTCGAAAA CGCCAAGCAT CTCCGCTTAG ATGTGCGAGA GCTATATTCG     82260
     CTCCAGCAGG CATCGCGACC TGCACATCAC CTAACCGATC GTTCCACATT GCGTGCCGCT     82320
     CCAAACTCGA TGACGATGAA CATCGCTACC GCAAAAGCGG TTTCTGCGCA TCAAAAGTCG     82380
     AGGTGTTTAC GGTTTCGTGT CATCGCCAAA GGAGCGGTGC AATAATGCGA GAGTGTCGGC     82440
     TGCCTCACGC GTTTTGGATC CAGATGAGGT ATCCAAGACA CGCATCATGG CGGAGAACTC     82500
     TTCGTCCTGG CGAGCCTCGG CAGACTTCAG GATATTGCGA ACGTCACAGC TTTCTCCCGG     82560
     CGGAGCGGGT GGCGCGATAC CAAGTGACAG AGATTTCGAT TCAGGCTTTG CCGTTCGTCG     82620
     CGCGACCAGC GTGAGCGGCG CGGCCGGGGC TTGAGGCCGT TCTGTTGCCG TCGCCTTGTT     82680
     GGATGCCGAT TTTGGAGGGC GCCGCGACTT TGTCTTTCGT GGAGTTGGTG AGTTCATTTC     82740
     CATTGGGGCT GGGCCGGCAT CCGCCAGTTT TTTCGTTTGG TCGGGCATCG GATTGATCGC     82800
     GCCGCCGAGA GACTCGTCCT GCCAGTCTCG CAACGCCGGC AAGACTGGCG GCGATCCCTT     82860
     GGCCTTCTCG TAGAAGGCCC TGTATGGCTT ATCGAGATAA TGCCGGATTT TCGTCAATTC     82920
     AAACGATCGT GAGTTCTTCA CCATCAGGAT CGAGAGCCGC GCTGACATTT CCCGAAGCTC     82980
     GAGCGGACTG CGAAGCGGCC GGGGCGTATA ATGCGGCGCC CAGACGCGCG GTGCGAAGAT     83040
     CCCCTGCCCT GGCCGCTGGA TCGGCGTCTT ATAGACTTGC GTAGTCTCCC CGAGCATCTC     83100
     GGACACGAAG TCTGAGGTTT CGAGGTCGTT GATCTGGATG AAGAGTTTGA TCTGCGAGCC     83160
     GGATACCGTG GTGATGCGTG TATTCTTGCC GTAGAGTTCA TCGAGCTGCG CGATATCCTG     83220
     CATGACAATC GCCATGCGAA AGCCGTAGCC GGCGCTGATC GTGATCTTGG AGATCAGAGA     83280
     ATCCATCCGC CCGACATGGT AGAATTCGTC GAGCATCAGC AGCACCTGGT GTGGTTCGTC     83340
     CGCGCCTGGA ATCTTCACCA TCATCAGGTC GTGGATCTGC TGGAACAGAA TCCGGATCAG     83400
     CGGCCGGAAG ATCGAGAGCT CCGCGATGGT GCAGCCGATG AAGATGGTCA TCGGCTGACG     83460
     GCGCAGTTCG CGGATGTCGA AGTCGGAGGT CTCAGTCGCC GCCGAAATCA GCCCGTTGTT     83520
     CCACAGCGAC GTCGCCATAT TGACGTTGAA CACCGCACTG TTGCGGGTCT CCGGCTCGAG     83580
     CGCGATATAC TGGTTAAAGC TGTCGACGAC CCAGGTCGGG AGATGCTGAC ATTCGGTTTT     83640
     CACGATGGCG CGCAAGACCG ATGAAATGTC CTTGCCCGTT GTGGTCATTC GCGCGACGGT     83700
     GCGCATATGC TGTGCGCCGG CAATCAAGGG CGACGACAGG ACGTAGCCAA TCAGCGCCGA     83760
     GAGCAGGAGA CGGCCGGCGC CCGCCCAGGT ATCGTCGGCC TTCTCAGGGA TCACGAACGA     83820
     CGCCACCACC AGGCAGTCCG TCGCCATCCG CGCGTCCCGC CGGACAAAGT CGAGGGGATT     83880
     GTAGCGATGG GTGTCGTTCG AGCCGGGCGA GAACATGAAC ACCTTGTTGC CCATGGCCGC     83940
     ACGATGATTG GCCAGCGCGT CGAAGTTCTC GCGCTTGGGA TCGAAGAACA CGGCCGAGCC     84000
     CTGCCAGAGG TAGCCATTCG GAAGGACGAA GCCAGTGCCT TTGCCCGACC GTGAGGGGCC     84060
     GACGACGAGA ATGTGTGCCG GTTCGTCCGA GCGGATGGTC GCCCCACCCA ATGTCCCCAG     84120
     GACGATGCCC TGCTTCGCCG TGAGGCCTTG CCTGGCTGCC TCCATCAGCG TGCCGAAGCG     84180
     GGCTTCGCCG TAGGGCATCT GCCGGCGATT GATGACCGCA AACATGACCC CGGCGATGGC     84240
     GAGCGCGCCA ACCGCGGCCA CGGCATAGCC GGCGCGGATC AGCGCTTCGA GGCGCATGCT     84300
     TGGAAACAGC AGCCGGTCAT AGAAATGACG CCAAGCGATC AGAAAGAAGT CGACGGAGCG     84360
     ATCGGTGTTC TGCATCCGGA ACAAAGCCCA GCGGGATGCG CCTTCGCTGG GAAACCGGCT     84420
     CGGCGCCCAG CGAAGAGCCA CGACAACCTC GTAGGCCATG CTCCACAACA GCCAGAAGGC     84480
     GAGCAGCAGC AGGACCGCGA TGCCGATCCT ATAGGCGACG ACGCGCGCCA TGACGGCCTT     84540
     TCCCTCCGGT CCGCTGCTCC CGCCATTCCG CCATGCGCGA GAAATGCACC GCCGACGTGC     84600
     CGCGCCAGCC GCCGACCTTG GTCTGCTGGA TCACGATTGG CAGCACCGAC TTGATGTAGC     84660
     CGACGATCTC GTCGCGCCGC AGGCCTAATC CCGCCTGCAT CACCATCAGC GCGAGTTGCT     84720
     CGAACGCGCC CGCTGGGCTG TCGGCATGCA CCGTGGTGAT GCTGCCGGGA TGGCCGGTGT     84780
     TGATGGCGCG CAGAAATGAA TAGGCCTCGG CGCCGCGGAT CTCGCCGAGA AAGATGCGGT     84840
     CGGGCCGAAG CCGCATCGAG GCCTGCAGCA AGGTTTCGAC CGTGACACGC GCCTCGCCCT     84900
     GGTCTCCTTT GGAGGCGACC AGCGGCAGGT AGTTTTTCTG AATCGGATTG ACCTCCCGCG     84960
     TATCCTCGAT GGTGATGATG CGTTCGTCGA CCGGCACTTC CTTAAGAATT GCGTTCAAAA     85020
     ATGTTGTCTT GCCGGAACTC GTCCCGCCCG ACAGAAGGAT CGAATAGCGG TTGGCGACCG     85080
     CCAAGCGGAT GAAGTCCTCG ATCCGGCCAG CATCGAGGTG TTCGCACAGC CGACGGTCGG     85140
     TTTCGGAGAG GGCGCCCTCG CCCGCTGTCG ACACTTTTTC GAAGGAGCCG AGCTTGCGGT     85200
     AATCGTCGAG CCGCATCTCC TTGATCACCT GCTTGCGGAT CGCGAACGCG CCCCCGGCGG     85260
     TGGTCGCCGG CGGCATCACG CCCTGGAAGC GCTCGCCGGT CGGCAAGGCG GCCGACAGCA     85320
     GCGGATGCTC CTCATTGACG CTCTGACCGG AATGGCCGGC GACGCGCTCC GCGAGGTGGC     85380
     GCAGCGCGTG CTCCGTCAGA TGTGGGACGT CATGGCGTTC CATCGCCGAC TGGCCAAACC     85440
     GCTCGACCCA GACCTCACCC GGCCCATTGG CGCAGATCTC GACGACCTGA TCATCCTTGA     85500
     GCCACGGCCG GATCGGTTCA AGGGCCCGAT CAATGAAGAC CGTCAGGCTT CGCGCCAATG     85560
     CGTTCACGTT TCAGCTCCCT CAAGGCTTCC TTGACCGGGT CGGAATAGAG CGCGGAGAAG     85620
     TCGAGGTCGC GCCGCACGAA AACAATGATC TGGGTACCCT GGTCGAGGTA GATGGTGGGC     85680
     GGGATGTTGA TCGAGTTTCG CAGCGCCTGC TGGGCAATAT TGGTGAGGGT CTGCGACACG     85740
     TTCTGCGCGG CGATCGCGCG CGCCTGCAGG CTGAGCTGGC TTTGATTTAC GCCGGTTTGC     85800
     GTCTGCGTGA CGATCCCGGT CACCGGGTCG GTCGTTGTAA TGATGGAGCC GTTGCCGTTG     85860
     GTGTTGGTGT TCTGGCCATA GGCGCTAAGG AATTGCGACA CCCCACCAAC GACCGACAGC     85920
     ATGATCGCCG AACCGAAGCG CTCCAGATAA TGGTTGTCGA CGAAGCCGGC GTTGCCCGCG     85980
     CGGCCGAGAT CGTCCGCCCC GTTGGAGCCG AGCTGCACCG AGACGCCGTC CGACCGCAGC     86040
     ATGCGTGTCC ACACGACGAA CACGCGGGTC TGACCCTGGG CGATGCCCGA CTTATATTCG     86100
     CCGACGAGAC GGCTGCCGGC CGGGATCAGC ACGCGGCGAC CGTCGAAGGA CCAGACGTTC     86160
     TCGCTGACGA CCGCACGGAC CATGCCGGGC AGATCGCTCT GGAGCGCCGT CTCCAGTACG     86220
     CCGCGGATCA TCGTGCCCTG CGCGACCAGC GCATCGATCC GATTGTTCTT GGTGGCGCGC     86280
     GAGACCTCGA CGCCGGCAGC TGACACCGAG GCCAGAAACC GGCGATTGGG ATCATCGTCC     86340
     GGACCCGCTG CCGCCTTGCT CCCGTCCTCG GGATTTCGTG CGGCGGCCGC CGCCGCATTG     86400
     TCGGCGATCA CCTGGGGCGC GCGCAGGCGT TCCCATTTCC GCCTCTCTTC CTGACGCAGG     86460
     CGCTCGAGTT CGGCGAGACG GCGCGCCTCG TCGTCGTTCG GGGGCGCTGC GGCGCGCGGC     86520
     GGTTCAGGTG GCGGTGGTGC CGGAAGCGCC AAGGGAGGTG CAACCGGGGG AGAAGGTGGT     86580
     TCGGCCGGCG CCTGTGGGAT GACGATCATG CCCTGGTTGG TTTGCGTCCG CGGCGACGAC     86640
     AGCGAGGGTG CGGGAAACTG TGTCGTTGTG AACTCCTCCT TGTCGGGCGT TGTCAGCGTC     86700
     GGCGCGCGTC GCGCCACCGA GCCGTAAATT ATCCAGGCCG CCACCATGAG CGCGCCGATC     86760
     GGCACCCCAA ATTTCAGGAA GCTGCCGAGC GCGGTGCGGC CGCGCGCGAC GGAGGTCGCG     86820
     GCCGCCGCCT CCAGTTCGAA CGAGCGATAG TCGTCGGCGC TCGGCATTGC GCGTCAACCT     86880
     CCCAGATTCG TTGCCGAGCC CACACGCTGC GGCGCATAGG GCTCGAGCCC GTTCGGCTCA     86940
     TGCACATTGT TCAGACGGCG GTTGAAGACG CAGGTCGATT CCTGGCCGTT GCGCAGCGTC     87000
     CACTGCGGCG ACACCTTGTC GACGATGACG TAAGGCCCCT CGGTCCGGAA ATTGACGAGG     87060
     CTTTCATTGC GGTCACCATC GACGATGTAG ATCGCCGGCG TCTCGCCCTC GAAGCGGAAC     87120
     CAGGTCTTGG TCCCATCGTC GAACGCGGCA ACCGGCTTGT TCACTGACGA GCCCTTGTAG     87180
     CCGTAATCGC TGTTGGCGTT GGCGATGTTG AGATCCTTGA GATTCGGATT GGCGGCGCGC     87240
     TCCTTGGCTT CAGCCAAGAG CTTCGCGCTG GCCTCGTCAT CCGGAAACCG GAATCGCACC     87300
     GCGTAGATCT GCCCTGCCGG CGGCCGCGTG TTCGAGCGCA GCAGGAACGA ATAGATGCGC     87360
     TTGTCGGTGA CGACGTTGAG GTTCGACTGG GCGTTCTTTT CAACCGGCTT GACGAAGATG     87420
     ACGTCACCCT TGCGGTTCGG TTCGACCTTC CAGGCGATTG AATCCCCGAG CGCCAGCGTT     87480
     TCGATCTTCT CGTCGGGCTG TAGCTCGATC ATCGTCGAGG TGCCATAGCT CGCATCGATC     87540
     GCGGTTACGT TGTCCTTGTT GTAGACGACG TCCCGCACTC GCGAATCGAC GCGACCCGGC     87600
     CGCGGCAGCG CCTCCGCGAA GGCGGCGCCG GCCGTGATGC AGAGTACGAC AGTTAAGACG     87660
     GCACAACCCT TGATCATTGC TGCGCACCTA CCGTTCCCGG TGAGGGCGCG GTCTCCTGAT     87720
     CGCGGCGATA CTCGAGCACC TGGAAACCGA GGGGATTGTC GAACCGCCAT TCGTTACGCA     87780
     TCGGCGCGGA GGTATAGCGG AAGCGCACCA GCGACACCCA GTTGCGGGTG ATGATGTTGG     87840
     TCGAGGACTT CTCCTCGGTG GAGAAACGCG CGAGCGCCGT GCGGTTGTTC GGAAAGGTCA     87900
     CGGACTTGAT GTTGACGGCG ATCACGGTGT TCGAACCGAA GACTTTCACA GGGTTGCTGG     87960
     GATTGGCGGG CGAATAGATT TCGGTCAGTT CACGGCTCGC ATCGCCACTG GCCAATAATT     88020
     GCGCCAGATC GAAATTATCT TTCAGCGCCT TCGGGTCATA GGTCTCGCGC GCCTTGATGT     88080
     AGCGGACGAC ATTGAATGTC GTGACGGCCT CGTCCTGGGT CAGCGGACCC TCCGCCATCG     88140
     GCCGCTTCAC CTCGACGAAG CCGGTGGTCT TGTCGACCAC GACCATGTAC GGCTCGTAGG     88200
     TCTTGAGCGG GACCAGCAAA GCCAAGGTGC CGAGTGCGCC GACGGCCACG ATTGTCATGA     88260
     CCGCGGCGAC GATCCAGGCA AGCGCCCGCG AATTGCGATT TCGGCGCGCG ATATCCCGCT     88320
     CCCATGTCGC GCCGTCGGCG TAATAGCGCG AATCGACCCG CGCGGACTCT GAGGCTGTTG     88380
     TCTCCGTCAT GGCCGGCCAC TCCCGCTCGA CGCCGGCGGA ACGTTGGGAT TGCGGAGCTG     88440
     GTCGGCCAGG CGCCGGAATT CCGCCGACTG CGCCCAGGAG GCTGCGCGCA AGCCAACACG     88500
     CGCGCGTTGA CGTGACGCCA ACTCCTCACG CCGCGACGTC GAGGCGGGAT TGAGCGGATT     88560
     GCGGAAGGCG AGGCGCGCTC GGTTTGCGGC CGCGCCAAGC CGATAGCCGG TTGCGGTCGC     88620
     AAGCACCGCG CCGATGCGAG GCGCGAAGAT CGGAACGCCA CCGGCGATAG CCGCCGCCAT     88680
     ATTGTTGATT TGGCTCAGCA GTAGGATGCC GATAATCGCG AGCAGCACGA CCGGGCCGAT     88740
     GGTTGCCCAG GTCGCCGACT TGGAATTGGC GACGCTGTTG AGCGTGTCGA TCGTCTGCTG     88800
     GATCAGCGAG ACGTAGAAGG CCAGAAATGC ATAGACGAGG ACCTGCACCA GGAAATACTG     88860
     GACCAGCGCG CTCAGCCACC CACTGAAGAA CCGCGTCGTG ACGCCGAACA GCAGCAGGAT     88920
     GATGAACAAG GGTGCCAGCG CTAAAAGCAG CCACATGAAC ATCTTCGACA GCACGATGAG     88980
     GAAGATTGCG AAGCCGATCA GGATGGCCAT CACCACGTAG AAGACGGCCG CGAAGATGTA     89040
     GGGTCCCCAA TTGGTGATGC CGGCGTTTTG CAGGAATGCC TCTGTGGCGC TGTTCGTGGT     89100
     ATCCCACATG TTCTGCAGCG CCGACTGCAC GCCATTGACC GAGTTCAGAT TCGCAGACGT     89160
     GCCGGTGTTG TTCGCCGACG TGACCGCGCT CAAGAGCGCA TTGCCGATCG CCGACGGGCC     89220
     GTCGTTGAGA GCGTTATAGG CCAGTGTCTG GAAGTCACCC CACTTCGTCG CCATGGTGTA     89280
     AATCAGCACC GCGCGGAACA GCCGGAAGGC ATGATCGGCG GGACCGCCGG TTGATGTGCC     89340
     TTGCCAGATG CCAATACCCC AGAAAATCAT GTAGAGCGTG AGCAGCGAGC CGGCGACGCT     89400
     GGTCGCGCCG CCCGAGGTCG CCGCATTCGC CAAGGCCTGG TAGGCGGTCG ATACATAGTT     89460
     CTGACCGAGC TGGTCGACCG ATTGCAGAAG CGAGGTAATG CTGAAGCTGT TTCCCATCGC     89520
     CCCTCTCAGA TCGGCCGCAT CGGCCCGCAG CGGTCGAGGC TCTTGAACGC TTCGGGTTGC     89580
     GTGGGCGCCT GCATGTCGGC GTAGCCCAGC GGCGTGCCGC CCTCATCCGG CGAGCAGGGC     89640
     GCCTTCAGCG GCTTGTATGC GCATCCTGAG AGCGCCGCGG CGACGAGCAC CAGAAGTGCG     89700
     AGAGCGGCGG TTCTCACTGT GCGGGCGCCT TCGGTTGTGT GAACGTCATG GCCCGTGACG     89760
     CGGCTTTCGC CGCCGCGCTC TGATCTCCGG TGGTGCCGGA CTCGGCGGAC GGCGTCGGGC     89820
     CGCGCGAAAC CACGAAGCGG CCGATCGCGA AAGCGGCAAC GGCGACGACG ATGATCAGAA     89880
     TCAGATTGCG CTTCGACACG CTTCGCCCTC CCTTGCGGTT CACTGCTGCG TGAATTTCAT     89940
     GGCGCGCGCC GCCGACGACT CTGCTGCGAT CCGGTCGAGG TTGGCCTGAT TGGCCGCGGC     90000
     TGCCGCGTTG TTGACGACGC CATTGAGCTC GTTGATCGTC TGCCCCGTCT GAATCTGCAC     90060
     CTGGGTGTTC TGGTCGACGC TGCCTTTCAG GTCCTGGGCC TTGCCGATCT GCTGGCCTCC     90120
     CTGCGTGAAC GCCGAGGACC TCTGCTGCAC CGCGCCCTGC GTCGAGTTGA TGAGCCCCGA     90180
     CAGCGTCGCC GCGACGTTGA CGGAGTTCTT GTAGGCTGTG TCCGCGGGAT GGCTCTGGCC     90240
     GTTGACCAGC CCCGTGATCG TCTGCACGAG CTGCAGGCCA TTGATGAGCG TCGAGACGAT     90300
     GTTCTGCGAC GCCGAACCCA TACCGGCGAA GGACAGCGCG CCGCCGGAGA TCACGGAGCC     90360
     GAGCGATGGC GCCTGCGCCA TCGAGAAGCC GCCACCGAGC GCCATCTGTG CGAGAGTGCC     90420
     TTGCGCCTGC GACGACCTAT CCCCGGTCAC CGCCTGCAAC GTCTTCTGGG TGAACTGCAG     90480
     GATCTGCTTG TCCGCAGTCA GGATCTGCTG CGTGCTCGTG GCGATCTGCT GCGCCTTTGC     90540
     GAGGTTGGCG TTATCGAGGA CCGGGACCTG CGCGGCAGCT GGCGGCACGC CGGTGGCGAT     90600
     CAGCGCGGCC AAAACGAGGA GTACGAATTT CAGGCGCATG AGGACCTCCC TAGCGGCTGT     90660
     TTGAGGCGAT TGCGGCGAGC CCCGCCGCGA CATCGTCGGC AGTGAAGGCG TTCAGGCTTC     90720
     CGGCAGCATT CGCTGCGCTC TGTGCCTGAG ACAGGTAGAA GACGACGTTG CCGTCGCTGT     90780
     CGACGTAGCG CGCAACGATG CACGCGGGAT CAGTCGGGGA GCCGGCCGGC GTCGTCGAGC     90840
     ATGTCGACGG CGCGCGGCAG GGGTTGGCCG CGGTGCCCGC CCCGATCATG CCAAGCGGAC     90900
     AGGCAGGGCC TTGTCGGGGC GTCGCGCCGG CTGTCGCCGT GGCGCGCATA CCGAGTGCAG     90960
     CGCGGCTCGT GTCGCTGGTC AGCGCGAGGT TGAGCGCGTT CAAGGCCGTG ACCCAAAGGT     91020
     TGGCGGAGCC GATCGCGCTA TTCCACGCCA GGTTATTCTG AAGCCGCGCG GCGCTGTTCA     91080
     TGTCGATCGC CGCCATCACG GTTGTGGCCG TCCCGACCTG CTGGCCTGCC GTTTTGAACG     91140
     CCGTCTGCGC GGCGCTCAGG GTCTGGCGAG ACGCATCAAG CCCGGCGACG ACGTCGCCGC     91200
     TCGATTTGAA AAGCGTCTGG TTGTTGAGAG CGGCGCCTTG CGCCGCCGTA TCGGGGGCCG     91260
     CCGGCTGGTC GGGCGCGTAG GACTGGATCG CCTTGCTGCC TGCACCGCTC TGCGGCTGGG     91320
     CGGTTGGGTC GGTGACGCTC GCCTTCTTGC CGGTCGTCAC CGCGCACTTG ACGCCACTGT     91380
     TGGCGTCCTG GCGCTGCGTC GTCACGGGCA CCAGCTTCAC GGTCGTGCTG GCGGTCTGCG     91440
     AGTGCTGCGT CAGCTGCGCT GCGTCGTTCA CCGGAATGCT GGCAAGCACG GGGGCGGTCA     91500
     TCGCTAAGAG CACCACTGTA GTGGCGGCGA TTGCGCATCT CATCCCTGGG CCCTCCCCAT     91560
     GAAGATCGGT AGCCACGCCG CCGGGTCGTC GCCGACGCGC GCCCGCAACG CATCGAGTTC     91620
     GGCGACTGTC TCCGTGCGCC CGGACAGCAC TTTGATCAGG TCCGGCATGT TGGCGAGGTT     91680
     GAGCTTCGCC ACGACACTGT CGCGCCCATG CTTGATCAGG AAGGAGCGGC TCTCCGGTAC     91740
     CGTGCCTCTG ATCCACGCAA CCTCCCGGCC GGAGAGGCGG AAAGCCTGCT TGTAACTCTC     91800
     GTCGTCCGCT TTCGGGTTTG GGAAAAAGAT GTTGGTGCTG GTCTGCTCGA TCAGCGTATT     91860
     CGACGCCTTC GAGCGCACGA TATCGGCCGC CGACTGTGTG CCGAAGCCGA CGATGCCGTT     91920
     CTGCTTACGA ATCGTCTTGA GCTTGTCGCG AATAAAAAAC GCGAACACCT CGTCGTCGAG     91980
     CAGCCGCCAC CCTTCGTCGA GGAAGATCAT TACGGGGTCG CCTGTCAGCA ACTCGTCCGT     92040
     CCGGTGGAAA ATATACATCA GAGCTGCGGT GCGGACGACG GGGTCGTCGA GCACGCGCGT     92100
     CATGTCGAAA CCGAACACGC TGGAGAGCGA AAACCTGTCC TCGTCATTGT TGAAGAGCCA     92160
     GCCGCGCTGG TCGGGGCGCA TCCAGCTCTC GAGGCGTGCG AGAAGGTCGC CCTCGCCTGC     92220
     CCGGATGCGG CCGCGCAGCA GCGTCGAGAA AGCCTTCAGC GTGCGGCCTG CCGGCCCTGC     92280
     CGCGAGCGCC GACGCGATCG CGTTGCGGAT CACCTGCTCC TCCGAGGCGC TGAGCTCGCC     92340
     CCCTTTGCCG GGTCGCAGCA TGAAGGCGAA GAGCTGGTAG AGGAACTCTC GGTTCGGCGC     92400
     CGAGTCCGGT AGCGAGAGCG GATTGAAGCC GGTCTGTTCT CCGGGCACGA GTGTCTCATA     92460
     TTGGCCTCCC AGCGCACGGA TGAAAATCTC GGCGCCGCGG TCCTTGTCGA CGAACAGGAG     92520
     CTTGGGCCGC GGCTGAATGC GTTGTGTCTG GGCGGCGATG AATGACAAGA AGACGGTCTT     92580
     GCCGGACCCG GTCGGGCCGA CGACGGTGAA GTTGCCGATG TCGCGGACGT GATGATTATA     92640
     ATAGTAGGCC GTCTGCGACG TTGTCTCGAA CACGGAAATC GCCGGGCCCC AGTGATTGCC     92700
     AGCCGGCCGG CCGCTCGGGT AGTTGTGCAG CGAGGTGAAG CCCGCGAAAT TCTTCGACGA     92760
     GATGACGCCC TTGCGCGCGA TGTAGGTGAA GTTGCCCGGC AGCTGCGCCC AGAACGCGGG     92820
     TTCGCAATTG AGATCCTCGC GCGTCCAGAT TACGGAGCGA TCGGTCAGCG CGGCGCCTAC     92880
     CGCCGTGACC GCTGCGCCGA CCTCCGCAAG GTCGCGGCCG AGGCACATCA CGGTCATGTG     92940
     GTGCTCGCCG TAGATCGCTT CCGACGCGAG CAGCTCGTCG CGAGCGTCGT CGAGATGCTC     93000
     CGAGACAATC GAGCCCGCCT CATCGGACAT ATCGACTTGG CGCGATACAC GGTCGATCTG     93060
     CTTGGCCGCC TCCGGGCGGT CGACGATCGC GAAGCTCTGC GTCGCGATGA ACTCGTGCGG     93120
     CACGCGCAGG AGGTTGTCGA AGGAGCCGGG TCCCGTCTGA GCCGGGTACT CGCGGATCGA     93180
     CACCATCGCC CCGAAGCGCG TGTCCTCGGG ACCGGCTCCC CGCACCTCGA TGGCGTTGTG     93240
     TCCGAAGAAG ATGCGCTTCA TCGACAGCGC GTCCGCGAGG TTCATGCGTG GCAGATGCAT     93300
     CGGACGAGGA AGGCCGCCGT TAAGCAGCAG CGTGAGGAAC TCGAGCGGCT CAGAGAACCA     93360
     GACACCGTCG CGACGCACGA CGCCGAGCTG CCGTGCGCCA TAGCCGGCGA GGTTCTCGCG     93420
     CACCGCGGTC GCCGCGTCGC GGAGCTCCGC CAACGCGGTC TGCATGGCGA CTGATTCGCC     93480
     GGCTACGTCC TTGCGACCGA GAAGTCGCGT CAGCATCGCA TCGAACGTGC CGGCTTGCCC     93540
     CTGCAGCGGT CGACGTATGA TGGTGAGATA GATGTCGTTG ACGAACATGC GCCGTTTGGA     93600
     GAGCGCGGCG TTGTATCGTT CGTCGAGCTC CCGGCACAGC GCGTTGTCGA AGGTCGACAC     93660
     GATCCGTGGC TGGACCTCGC GCCGGACGAT GTGGGAGACG AGCGCGAAGC GGGAGTTCGC     93720
     GAGCGTGCGA ACGACGTCGT TGCGGCCGAG AAGGCGCGCG TTGACCTCGC TCATGTCGGA     93780
     TGTCTCGAAG GAATACCCGT CGAGTTTGAG GGTTGTGAGG ACGAGGCCGT CGCGCGTCTT     93840
     GATGATATGG TCGTCGACGT GGCGGGTGTA GGGGACGTGG GAGGCGACGG GGCGCTCGCG     93900
     CCGCGACACG GCACCGAATG TCAGTTCGTC GAGTAATGCG CGCGCCACCA TTTCCGAGTC     93960
     CTCACGCCGA ATAGCTGTCG GCAGCCCAGA AGGCGCGCGA GCGCGGCGGG CACTTCGTCG     94020
     ACTTTACGAA GAGGATCTCA AAGATTCGAT CGTCGCGGAG CGTCATGACA TAGCCGAACA     94080
     GGTGGAGTGG GATCGCGACG AGGAGCATGA ACAGGTTATG CGTCACCAGG AAGCAGACGC     94140
     TCGAGACCAC GCCATTGAAC ATGAAGTACA TGTACGGCAC GCCCATCAGT GTCGGCGCGC     94200
     GTGTGAGCGC CTTGACGAGC GGGCTGATGA GCGGGTCTTC GAGTTCGTCT CCTGTCATTG     94260
     CCCAACCGCC GACTGGAAGA ACTGCACGAT CTGGGCCGAG CCGAACACGA GCACGATGCC     94320
     GAAAATGACG CTGCCCGCGA TGCCCCAGGT CAGGCGCCCG GACCACGCGA AGAATCCGCA     94380
     GGCGATCACG GCGAGGGTTG CGAGCGCTGT TGCAATCGGG CCGGTGAGTG CGGAGACCAG     94440
     TTGCGTCAGC GTCGACTGAA CCGGCTGCAG CGTGCCGCCG CTCGACTGCG CGGCTGCCTC     94500
     AACAGCACTC AGAGCGAGAA GCACTCCGGC GAGCGGCGTT CGTGAGAGCA TTGTCTTCAT     94560
     CCAGTCCTCC GTTCTTAGTC GACGTGCATG ACAAAGCCGT TATCCCACCG CGTGCGGTCT     94620
     TTGGGGGCTG GCTTCGGTGT CTTGGGCGGC GCGGTGGCCT CTCGCGGCTC GATCAAGTCG     94680
     GGCGCCTCTA GCGTCCGGGA CGCAGATCGA AGCGGGCCGC GTGCCGCGGC TGGGCCGAGC     94740
     GCTGGCCACG CGTAGAAGTC GTTGAGGACC TGTGCGACGA AGCGCACCGT CTCGGGATAA     94800
     GGAGGAACGC CTCGGCTTTG CTCGACGGCG CCCTCTCCGG CGTTGTAGGC GGCCAGGATG     94860
     AAGAGCGGAT TGCGATATTT CTCGTGCAGC GCGCGAAGGA AGCGGATGCC GCCGCGGATG     94920
     TTTCCGACGG GATCGCAAAG GTCGACCTTG AAGCGCTGCG CCGTCTCCGG CTCGAGCTGC     94980
     ATCAGCCCGA AGGCACCCTT GTCCGAGAGC GCTACGGAAT TGAACTGGCT CTCCGCCTTT     95040
     GCGACGGACA GTACGAAGTC TGGATAGAAG GCCTCTTCCG TCGCGATGCG TGTGACGAGC     95100
     GCGCGGGCCT CCTCCGGGAC CATCGCCACG GCGTCGGGGC AAGGCGAGGC GACCTGGGAC     95160
     ACCTGGGCAG CGCCGATCCG CTCTACCGAA ACGGGCGCGG CGCCGAGCGG CAGCACGTGT     95220
     CCTGAGGCGT CGACAGCAGC CAGCGTCTGC GGCCTCGCGT CTTGCGCCGC TGCGCCCGCG     95280
     AGACTCGCCA GGACGCCGAA CCCGATCGCT GCGACGCGAA TCAACATGCC ACCCCATTTC     95340
     CATTTTCCAA TAGACAATAT ATTGAATGTT GATATCTTGG CAACTGAATT GGACTCGGGT     95400
     CGTCCACAGG CTGGCTGCGG AGGATGGATG ATGCGTCGTG GGGCGCTCGT GATAGCGGTG     95460
     GTGGGCCTCG GGTCAGGGCT CGACATGCCG CCCCCCGCGA CCGCGCAGGA CGCCTCGTTC     95520
     GGCTGCAAGG TGCTTCTGTG CGCCGCGGCG CCCGCGCCCG CGCCCGGCTG GGCTGGGATT     95580
     CCCTATTGCG TGCCGGTGAT GCAGACGCTT TTTCGGCAGC TGGCAAAAGG CGGCGGATGG     95640
     CCATCTTGCG CGGAAGGCAA CACCAGCGGC CATGGCTACG AGCCCTACCA GGCCTGCCCG     95700
     TCTGAGCTAA CGCCGGTTCA ACTAGCGGCT GATGGCGGTG CCGGCCTCGA GCGCGCTTCG     95760
     AACGGCGGCC TCTGCGCCGA CCTGTCGAGG CCGCAGCAAG TGTGCTCCGG CGGAGACGGC     95820
     GGCTGCACCG CGAGCTATCC AACCACGCCG CGCGAAGCGC GCAGCGACCC CTATTTCGTC     95880
     GACATCACAA CCGCGAACCG AAGCCAGCGG TTCTACTTCT CCCTGCAGGG CTATTAGCGT     95940
     GCGCTGGTCC CACGCCCTTG CCGTCGCGCT CGCGCCGCTC GCGGTGCTCA ACGGCGCGTC     96000
     GGCGCAGACC GCACCCTCGC GCTGGTTCCC GGTCCCCGCG AGTGCGGTCT ACCTGACGGG     96060
     CGACAGCTGG TCGGACGCCG GCACCATCTA CCGGCTGTAC GGGGTGCAGT CGTGTCTGCG     96120
     CGGGACCAGT TTCACCAATG CGCACGGGAT GCGGCGGGAC TGCGGGGAGG CGTCGCTCGC     96180
     GATGCTGGTC GCGCTGACGC GGGATCTGCA GCCGCGATGC TACGACGCGG CCGAGCAACC     96240
     GCAGACGCAG ACGGTCTTCG TTTTCTGCGT CGCCACCCGA ACTGTTGGTT CGGGCCAGGG     96300
     CTCACGCATC GACCTCGGCA CGGCGCTGAT CGCGACGGGC TTTGGTTTTG CCGCGTTGAA     96360
     GCCGGATGGG CAGCCCGTGC ATGCGCCGTA CTTCGTGGCG CAACTCGTCG CTCAGCGCGC     96420
     CAAGGCAGGC CTTTGGGCCT TCGCCGACAT GCCGGAGCCG AACGCCATCA TCTTGCGCAC     96480
     TTTGCGCGAG GGAACGCCCT CGCCCACGCC GGCGGCGCCG CAACTCGCGA CGCCATGAGA     96540
     ACGACTCACA ACACAGGAGA GAGCGAATGA GAACCACCAA CCTTTTTATC CTGCGAGGCC     96600
     GCGTCGGGCA GGCGCCGAAG GCCTTCAACA AGGCCGCCAA GATCAATGTC GCGACGGACC     96660
     GCGCCTGGAC CGACGGCAAG GGCGAGCGGC GCGAGGAGAC GGATTGGGTG ACCGTTACCA     96720
     TCCTCAACGA GAAGGCGGCG GAGTGGGCAA TCGCAAATGT CGCCAAGGGA GACGCCGTCT     96780
     ACGCCGAGTG CCGCATTGCG GACGGATCGT ACAAGAAGGA CGGCGAGACG GTTTACACGA     96840
     CCGACGTCAT CGCCAACGTC TTCCACAAGC TCGATCTCGG GCAGCGCAAC GATGCCGCCG     96900
     CCTAGCGTCG TGCTCGGGGT GGTTTCGGCG CTGGCAGTGC TGAGCGCGTC AATGGCGCTC     96960
     GCTCAGACTG GCAACGCGCC GCCGGGCGTC TACGAGCCGA AGGCCGTGGT CCAGTCGCCG     97020
     CCGCTGCGCG TCGAGGTGAT CGATGGGACG CGCTTCCGCG ACGTGGAGAG CAAAGAGGTT     97080
     TATCAGCTAT ATGGCATCGA CACCTGCGCG CCTGGTCAGA CGGCGCGACT CAAGCGACAG     97140
     CCATGGCCGT GCGGAACCAT GGCGACAGCC TGGCTCGTGA CCGCCACCCT CAACGCCTGG     97200
     CTCGCATGCA GGACGCTGCG CGACGAGGCA AGCGAGCACC TCGCTCGCTG CTCCTCGGCC     97260
     GGTCACCCTG ATATCGCCGC CGACATGGTC CGCGACGGGA TCGCGGTAGC GCGCCTGCCG     97320
     ACGCCTGAGG ACCCGGGCGT GCGTGCTTAC GCCGCTGCCG AGCAGGATGC GCGCAAGGCC     97380
     TACCGGGGCC TGTGGTCGAG CACATTCCAG ATGCCCTGGG ATTGGCGCGC GAAGACCGAT     97440
     CCATCACGAG CCGCCCAACG CGGAGCAACA CCGTGATCCG CCGCGCTTAC TCACTTGTCG     97500
     CGCCGCTCCT CGCTGTCCTC GCCGGCTGCG CCGCACCGAC CGCGCCGGTT GTTGACGTGG     97560
     TGACGCCGGC ATCGGAGCCG CTCTACAGTC CGGGGCGCGT CAAGCCGGGG CGGCTCGAGT     97620
     ATGCGCCGGA CCGTTCGACG TTCGCGCCCG TGCTGACCGA GCGCTTCACC TACCCCACGC     97680
     AGCCGGAGGC GAACGCGGCT TACCGCAGGC TTGTCGCCAG CGCACCCGCG CAAGGGCACT     97740
     ACCCCGCATC CGTCTGGCTA TTCGGCTGCA AGCCCGGCGG CCTGGACGAG GAGACGGCAC     97800
     GTGTCACGCG TTATCGCAGC CCCGTGGTGC ATTGCGCCAC GGACTACCTC GACGCTGCAG     97860
     GCGGAAGGCT GCGGCGCGAG ACGGCGAACT TCTATTATTA CGGCGTCGTC TGGAACATGC     97920
     AGCCGGTCCA CCCTCCTTTG ACCGCGGCGC CTTGGTTTAA TCGGGAGGCT TCACCGAAAG     97980
     ATTTTTGGTG GTGGGTGCCG GGCCGACCCC GTTACGAGTA GGGTCGCGCC GTGGAAGCAT     98040
     CGGTGGCATC GACACATCAA ATACAATATA TTAGATGTTG GGAGGCAGCA GCGAGTGCCC     98100
     TGCCCGCCCG CCGGGCCCTT TGCTCTGTTG CCGCGAGCCT GATGATGATG ATGATCGAGA     98160
     TCGTCGGCGC CGTCGAGGCG CGGCCATTGA CACCAGACCC CGGCGCCTGG CGGCCGATGG     98220
     CTTACGCCGA CCTGCAGCGG CCTTCCGCGC AGGCCGCCAC CTACCTCGAC ATCTGGAAGG     98280
     ACGCCGTCGA CTCCAACAAC CGCGCCTATG CGGCGGCGGG AGACCGACGC TTCACCGCGG     98340
     GCAACGCGCC GGCGACGGAA GCTCATTTTG TGATTTGGAG CACGCGCCGC TCGGTTGTCC     98400
     TCAGCGTCCT CGATACAGCG CCTGGATGCA CGGTGAAGCA GGTGGGCGTC CACGCGCACG     98460
     CGACCGTCAA ACTCTGTCCG ACGCGGGTCG CGATCTACGA GGGCATTCAG GTCCGCACGA     98520
     TGGACGCGGG CCGCTCGTGC TTCCTGGAGC TCGCACCGGG TGCGCCGCCT GACCCCGCCG     98580
     CGTCGGTTGC CTACGCGTCT TACGATGTCG CAGCCAGAAC GCTTAAAACC GGGATGATCC     98640
     TTGACCACCG GGCTGTGGAG GGGTGTTCAC TCGACATCCC GCTCCATCGC CAATGACTCG     98700
     CCTCGAAGAG GGAAAGCCGC AAATGCAGTG CCGCCGCCTC CGTTTTCTCA CCGCCTGCTT     98760
     CCTCGCCCTC GCCTACGCCG CGCCCGCAAC GGCTGCCGAA GCCGCGTTCG CCTACAAGAC     98820
     GTCTTACCGG AACGTCGCCG AGGACCCGGA CCATGTCTGG ACGGGCACCG CGCTCGCCCC     98880
     CACGGCGAAG GGAACGGTGA CCATCCACGA GTACCAGCTG CGCACGGCCC ATGGCGACTG     98940
     GCTGATCTCG CAGATCTGGA ACGAGGACTG TTCGTCGGGC GCTTGCCCCA CGCGGCTCGT     99000
     CAGGATCGGA GAGGACGGCC ATCGAACCGT TGCCGTTGAC GACATGATGC ACCAGGTCGT     99060
     GCCGCCCGAT GACCCGCGCT TCGCGACTAC GCCGATGTCG GACGCGCAGA AGACGTTCGC     99120
     GCGGCGACCC TTCGCGCTAA GCGAGGACGG CAAGACGCTT GTAAACGGCG ACTATAAGTT     99180
     CGAGGTCGCA GGGGCAAAGC CATGACGATC CGCGCGGCCG TTCGCCAAAC GCTCTTTGAC     99240
     GCCGCGCTCA TTCTCTGCCT TTCCGCCGCC GCGGCCTTCG CAGGACAGTC TGCCGCGAGC     99300
     CTGACGGCCG CTGGCATCCC CTCAAATTGC GCGGACTTCG CAGCGAAGGT ATCGAGCAGC     99360
     GAGGGCAATT TCGGCACCAC CAATCAGTAT GGCTGCCTCG GTGCGTTTCA ATTCTGCCCG     99420
     GGCACCTTCG AGCGCTATTA CAACGACAGC GCGCAGAGCT TTCTCAACAG CCCATCCGCG     99480
     CAGACCGCTG CATGGACGCA GTACGAACAA AACTCGTGGA GCCAGGCGCA GAAGAACGGT     99540
     CTGACCTCGC TTGTCGGCCA ACAGGTCTGT TCAGGGGGAA AGTGCGCCAC CATCGATCAA     99600
     TCGGCGATCC TCATGGCATG CCAATTCGGC TGCGGCCCGA AAGGCAAGCT CGCCAACTAC     99660
     GCCGCGGGCG GCGATTGTAG CGCGCGCAAC GTCAAGGACG GCAATGGCGT GAGCGTCTGC     99720
     ACCTACCTGA TGCGCGGCGC CGGCTATGAC GCTTCGTGTT TTACCGGACA GCAGTCGACC     99780
     GTCTGTGTGC AGTCTCCCAG CGGTCCCGGC GACTTCCCGA CTACGACGGG AATCGCCGCG     99840
     AATCCGCCGG CCGCCGACAG CGCCTCCGTC GTAGTGTCGC CGAGCGACGT CTAGCTGTTC     99900
     AAATAACACG CCGGTGTTCG CTGCCTCAAC ATGGCGCTAT ACGATTAGGC CGAAGGACTG     99960
     AGACGAAAGT CGGCGACGCT TGTTTCGGCG GGCTGGGACG TTGCGCCGGC GAAGCCCGTT    100020
     GAAGCGCTGG CCGACCGGGT GATTGCGAAC TTGCTGATAT CGACGCAGCT CGAACGCGAT    100080
     ACGCCGAGAC CGGTCGGCTT CGCCCCCCCC CGGCGGCACT GATGACGCCT AACGAGCGGC    100140
     TCGCCGCTAC GAAGGGCACG ATCCGCTCTC GATCAAGATC GAGAGCCTTA ACGTAGTTAT    100200
     ATTGGCGTCC ACAATGACGA TGATCGCCTT GCGCCAAAAG CTGACCTTGC AGAGTTGCTA    100260
     CTCAAATATC GCATTAGGGC CGGGAGCAGA CAGTCCGGTC ATGGAGAAAT CTGGCGGTAA    100320
     GCGGCCATTC TCCAATCGAC CTAATCTGGG TCATTCCACG CCTACTCAGC CTTTCCTGGA    100380
     AGCGGCCTTC CGTTCATATG GCACACGCCC GTGCGAACGA CTGAGTGTGG GACTTAGTGC    100440
     TCGGTCGGCT TTGGAGCGAT AGGGTGAGGA TATCAGACAC CGGGCAGCCG TGTAACGCGT    100500
     CGTCCGCAGC TGCCAACGTT GTTGACGTTC ATGGCCCCCT ATCCGATCGT CGGAACCGGT    100560
     CTTTCGTTCA TGTGGATTTC GCACACTTGA ATGCCCAGAC TTGTCTGGGA GGCTGGCAGG    100620
     TTTGGCCATG CAGCATCGAG AAATCGGCCA TTCGCCTGCG ATGAATTCCA AATAAGATCT    100680
     GCTATCCTCC GATCCCGCCG CTCATCCAGT TCGGCGGACC ATGTCCAAAA GGCGTTCAAA    100740
     GAACTCAGGA AGCGCCTCAT CAGGGGCGAG GGCGTCGGAG ACGATGGGCG AGATTCCGCG    100800
     GCGCGCCCCG GCTCCGCAAT GGATCGAGCA AATTTCGTCT TCGGTCGCTT CCTTGAATGG    100860
     CGGAACGGCA GGTTGATTTC GGAATGCGCG GCCCAGATCG GGCGAGATAA TGCCGCGTAC    100920
     ATGAAAAAGT CCTCAAATCG GATCGTACGA TAAGACAAAT ACAACTTGAG AGGGCGACGA    100980
     ATATCGTTCA ATTTCTCATC CGAGCGGGGG GAATAAGGGC ACGATGGCAT TCAATGAAGA    101040
     TCGTCTCATC CTGAATCTGA CGGATAGCGA GCTCGAAGAC CTGATCAAGA AGTGGGTTGC    101100
     ATGCCTCAAG GACAGCTATG TCGGGTTCGA ACGCCCCACG CAATCTGCAG ACATGGGCCG    101160
     AGATGCTGTC GGCTTTCTGT CACCGCAGCG GTACGATGGC GAATGGCATA ATTATCAGTG    101220
     TAAGCACCTC AAGGCACCGC TTGGAAAGGC GGACTTCACG ATCGAGCTCG GCAAAATCTT    101280
     CCACTATGCT TGCCGAGGAG AGTTCACGCC CCCGACGAAA TACATCTTCG TTTGCCCCAA    101340
     CTCTGCGGTG AGAGACGTCA AGAAGGTCAT CGACAGGCCA TCCTTGATCG CCGATTTCGT    101400
     GGTGGAGCAC TGGGATAAGT ATTGCCTCAA CGGCATATCA AAAACCGCCT CCCCGCTGAC    101460
     TCCGGAGATA GAGGCCGCCA TCCGAGCATA CGCGTTCGAA CACGTCGAAC TATGGAAGGC    101520
     GAGCGAGCTT GTTGAGCAAC CGCGGATGCG GGCGGTGCTC AACGAACACC TGGACATTGA    101580
     TCCGGGCGAG GCTCCCCGTG TTCATGTCGA CGAGGTTCCG GAAGAGGTCG CCGACGAAGA    101640
     GATGGCCTAT GTCACCCAAC TCGTGGCGGT GTTCGCTGCT GAAAGTGGGA CTGCGTTGGC    101700
     GGACTATGCG GCGGTTGTGG TGCACGCCAC TTATGGTCCG CAAATCGTCA ATGCCCGCCG    101760
     TCGCTATCTT GAACGCAAGG CGTTTCGGCG CCATTTCCGT GACAATCTTC CTGCAAACCA    101820
     GATCGACAAT GTCGACGAGG ATGTGCACGA GACCGTGATC GATCGATATC ACGCGTTGGA    101880
     AAGAGCGCGG CTCTTCGAGA GGCTTAATGA AGTTATGAGT GCGGCCTCCA CAGTACAGAT    101940
     TACAGGCCCC CTCGGCCGGC ACAATCGCGT AACCCCAAGC GTAAAGCAGG GCGTCTGCCA    102000
     TCATTTTGCG AACGTAGGTA GAATGCCTTG GGCATGAGTG TGCTCGTGAC CCCGCCGCAG    102060
     TTGTTCAACA CGCCCCTCGA AGCCGGCGTT CGAGCGCTGC TGGTCCTCGA TGCCTTCGCG    102120
     CCGCAAGCTT TCGACCTCGC CACTCTGTCA CTGCTTGACT ATTATGTAGT TCACACCGGA    102180
     GATGCCGGCG GGCCTCCTAG CATTCATCCC GAAAATGCGG CGCGCGCGGG CGAATATTTC    102240
     GTCCGGCGTC ATCTCGTCGA AGAAGGGCTG CTCCTCATGG CTCGGGCATC GCTGGTGGAG    102300
     CAGGTATTCG GAAACGACGG CATCACATTT CAAGCCCATG AAACCGCGAC CGCGATGATC    102360
     GACTTGTTCG GGAGCTCCTA CAATCGCCGC CTAGCCGAAG CGGCACGTTG GCTGGCCGAA    102420
     GAGGCCACTG CCCAAGGAAA CGACTGGTTT TTCCAAAAAC TCAGGGACAG CCTAGAGCGT    102480
     TGGTCACATG AGATTGTCGG AGGGGCCAGC GACAATGGCT GACCGTCGCC GAATTATCAT    102540
     CGACAAACTC GCCTTCACGG GCCCTGAGCG CGGGCCGATA GAGGTGTCAT TCCAGTCTGG    102600
     AGTCAACATC ATTTGGGGGG CGTCCAACAG CGGGAAGTCG TTCGTACGGA AGTCGATCGA    102660
     CTACCTTCTG GGAGGCGACC TTCCGACACT CCCTCCTGAA GGCCAGGGGG TGGACAACTA    102720
     CCTTTTGTGG CTGACGCTTC CCGGTGGCCG GCCGGTCACG CTGCGCGCCT CGGCACTGGG    102780
     CGGCGACATC TACAAAGCCG AGGGCCATCT CTATGCTGTT GACCAGAATT CGCCGGGGTA    102840
     CGAATCCTTC TCGCGCAAGC ACGTCACTTC CCCGAACATC TCGCGTTTCC TGCTTTCTCA    102900
     GGTGGGTTTC CGCGAAGCCC TTCTTCTAAA GAACGAACGG GCCGAAAAGT CACCCTTCTC    102960
     TCTCCGCCTG CTGATGCGAT ATCTTCTCGT GGATGAAACG AGAATGATCG ACGAGAAGAG    103020
     CCTCCTGCTC GCCTATCACA TAGCGATCAC TTCCGAGGAC AAGAGCCTGC TTAAGTTCCT    103080
     GCTGACCGGG ATCGATGGGG CGTCGATTCC GCAAGTACGC TCTGGCGACC AGCTGAAGGC    103140
     GGCAAAAGAG GCAAAGATCG AACTCCTCTC GCAAATGGCC GACCAGCTGC GCAAACTCAT    103200
     CGACGATACA GTTGAAACCG CAACTGTCGT TGCCGAGCTC ACCCAAGCAG AACGCGAAAA    103260
     AGCCGAGCTC CTAGAGGTTG TGAACGAACG CCAAGATAGC CTGGATACGC TTTCCGCAGA    103320
     GGAGAGGTCA CTCGCTGCAG ACATTCGAGC CTATCATGCC CGCATCGCGG AGCTCAAAGC    103380
     TCTCATCATC CGGTTCGATG AACTCGCGAG CGTCTACGCG TCTGATATCG AGCGTCTCGA    103440
     TGGGTTGGAG GAGGGTGGCT TTCTCCTGCA GCGTTTCGCG ACGATAAATT GCCCGCTTTG    103500
     CGGAGCGCTG CCCCAACACC AGCAGCACGA TCATGGCCTT GGCGGGATTG AAGAGCAGCG    103560
     TCACGCCGTC GAGCTAGAGA TTGATAAGAT CCGTGTCGAA GCGCGCGACC TCGCCGCGGC    103620
     CATTGCCGAT GCCAAATCAG AAATAGATAG TGTCGAGAAC CTGATCGCCA TCGCGGAGCA    103680
     AGAACTCGAA AGGCATCGGC TCGCACGCAA GGAGGCCGAG CAACAGGAAA TCAGCGCACG    103740
     CTCGATCTTC AAAAGCGCCA GCGAGCGTTG CGAGAGGTTC GAGGTCGACC TGGATAATCG    103800
     CCAGCGACTG TCCGAACTCG AACAACATGT GGCCCGTATC AACGCCGAAA GCGTGAGGTC    103860
     GCGTCCACGT GCCGACGGGC TCGACGTCAA TCTCGACCTC TCGACGAGCG AAGCGCATGA    103920
     GCTCTCAACC GCCGTACGCG CTGTCCTCAC GGCATGGAAT TATCCTGGAG CCCAAGCCGT    103980
     ACACTTCGAA AAGGGCGATC AGGACATAGT CGTCGATGGC AAGCGCCGAC GCGACAATGG    104040
     CGCAGGAGTC CGCGCACTGC TGCACGCCGC CTTCAAGGTT GGCGTGCTAG TCTACTGCAT    104100
     TGAAAAGGGA AGACCCCATC CGGGCTTTAT AATCCTGGAC TCGCCGCTGC TGGCCTATCG    104160
     CCCTGCCGAG GAAACTCGCT TTGGGGATCT TGGCGATGAC GATCTCGCAT TGCGAAACGC    104220
     CGACGTTGCC ACCCATTTCT ACCGACACCT GAACGGGCTC TCTGACAAGG CGCAGTTCAT    104280
     CATAGTCGAG AACCACAAGT CTGATCAGGA CGTGGTCAAG CCGTACCATA ATTATCAGTT    104340
     CACCAAGAAC CCTCAGGCCG GCCGTATAGG TCTTTTCGTC TAGTTGGCAG AATAGAGGAT    104400
     CGCAGCCCAT GGCCAACCGG CTGTTCATCA TCGGAAACGG GTTCGACCTC CATCACGGGA    104460
     TACCCTCCCG CTACTCCCAG TTCGGCGAAT ATCTTCTCGC TGTGGATCCG ACGGCATGGC    104520
     AGATGATCAA CGAGTACCTT TATGTCGATG AGGACTTCTG GGCATGCTTC GAAGAGCGCC    104580
     TGGCATCATT CGACGAGGAC GCCGTCATCA ACCATGCCGA ACAGTTTCTG GTGGGCTACG    104640
     GCGCCGACGA CTGGAGCGAC GCCTATCATC ACGATTTCGA GTATGAGATC GAACAGGTCG    104700
     TAGATGCCCT CTCGAGAAAG CTACGCGATC ATTTCGCCGC CTGGATCCGC CAACTTCCGC    104760
     CGCCTATCCC AGACACGTAT TCACCAGTGC GATGCATAGA TCCCGGCGCG CTCTATCTCA    104820
     CTTTCAACTA CACTCCTACG CTCGAGGCCA CCTACGGCGT GCCGTCGGCG AACGTGCTGC    104880
     ACATACACGG GAACGCTACT ATCCCGAGCG ACCAGATCGT GCTCGGCCAC GGCTGGGAAC    104940
     GTCTGGAGGA GGAGAAGCTG TCGCCCAAGG TCCACGAGGA CACGGACACG AGGGTCGCTG    105000
     GCGGCTATCA GCTGATCGAC GGCTACTTCT CCGGCACCTT CAAGCCGACC GACGACATCC    105060
     TCTGCCGCAA CGCCGCCTTC TTCAGCGGTA TCACCAACAT TGATGAGGTC CTCGTGCTCG    105120
     GTCACTCGCT CTCGGACGTC GATGTGGCCT ATCTCCACGA GGTCATCCGG AGCATTCGAC    105180
     CCTACGCCAC ATGGACGGTA AGCTACCACG GGAGTCCGGT CGGAGAGGTG GAGCGCATGG    105240
     GGAGGCTTGG CGTTTCACCG GCGCTCTCGC GGTTCTGTCC ATTATCGCTT TTGTGAGCCC    105300
     ATGGGTTAAA TTGCTCTGGC TTCAACGCGC GAGGAGCGAA CAGGCAATGT CGGTGATTCA    105360
     CCTGACCTGT ATAGGCCTCA GCCTCACAAC CTCGAGGCAC GCGAAACTGA GGATGTAGGG    105420
     GTGACCGCTG ATGCACAGCA TTCCGTCCGC ATAACGAGCG GCAATCCTGC CCTGACCGAC    105480
     CTGACGCTCT CTTGGCGGAC GGCCGAGTAT GGCGCCGAGG ACGGCATCGG GCCGATGGGC    105540
     TCGTTGCACG AAGCCGGTGA CGCGCTCGTT GCCGTGGCGC GCTTCGAGGA GGACGGCGTG    105600
     ACGATCCTGG GCAGTGGGGT GATGGTGGCA CCCGGAATGC TGTTGACCGC CACCCATGTG    105660
     CTCGACGAAT TCCCGGCGGA TGGGCCCGGC CCCGTTTTTC TGACCTTTCT TCCCAGCGCC    105720
     AAGCGAGCAT GGCTCCCCCA GGACGTACGA ACGATCTCGC GGCCGAGCAT TTTCGACGCG    105780
     GAACGGAAAA TCAGCTCCGA TCTGTCGCTG GTGAGCTGCA CATTAAATTC GGAGGCTCAT    105840
     GCGGGCCTGC CGCTCATGCT GGCGCCGATG CAGATCGCGC TGCCTCTGGT TGGCGACCGG    105900
     CTTTGGGCGA TGGGCTTCCG CCACCAGGGC ATCGACAAGC AGGCTGCGTT GGTGACGCCG    105960
     CTGGTGTCGT CAGGCTTGGT CACCGCGGCC TTTCCGATGG GGCGGGGCGA ACGCATGGTC    106020
     TCGCCCTGCT TCGAGGTCGC CATGGAGACG GTAGGCGGCA TGAGCGGTGG CGCGGTCGTG    106080
     AATGACAAGG GCTATCTCGT TGGTATCCTC TCCTCGTCGT TCGAAGGTGG TCCCTCTTAT    106140
     GTCACGCTGA TCTGGGATGC GATTCGCATG CGGGTCCGAG GTTCCGTCCC TAGGCTACAG    106200
     GTCAACGATA CCGTGAGCGT GATGGGCGCG AACGAATGGG GGCTCGCCAA AATCAAGGGC    106260
     AGTGTCGAGC GCGACCCGTT CGGCGACGTC CGCATCGCGC TTTCCGACGA TGAGATGGCG    106320
     CTCTTCACCA CATCCCTTTC GCGTGCAGAA TGGACAGAGG TGAAGACCTC TGCCCTGAAC    106380
     CGTGAACAGC TCGAGGATTT CGAGGAGAAT TGGGGCCGCG AGCTGGAAGA GGCCGCCGTC    106440
     GAGATTGTTC TGCAGACCCT GAACGGCCTG CCTGTATCGC GGATCCAAGA GTTTCTCGAA    106500
     GATTCCGATA TCCCAGAGGA CTTACTCACC GCCATCGAGG GCTTCTCCGT GGAGGATTTT    106560
     GACGGCCTTG AGGACATTTC GATCACATCG ACCGAAGCGA TTGATGAGAC GCGCTTCAGG    106620
     CTGGACTATT ATTTCGACAT ACCGAGCTTG ATCTGGACCG TCGAAATGGA CGCTGGCTTC    106680
     GCGGATGCCC ATGCGTCGAG CTTGGACGTC CGGTTCTTCA ATCGGCGGGT CGAGAATGGC    106740
     ATCGCCAGGA TGGAAATGGC ACAGCGCCGC TATTTCCGCG GCTCCGCCAT CTTTCACCGT    106800
     GATGCTGAGA TCTTCACCGA TGCGACCATC ACGCTGAGTG CGATAAAGCC TCGCCGGAAG    106860
     GCCTAGCGGA AAGAGGCCAT CCCAGGCTGA CGACCACCCC ATCGCTGGTG GGCCCGGCTG    106920
     GTTCGGTCGC CATGTCGCTA GCGAACTGGC GGATCGACCA TTGCAACCTA AGCTGGAGCG    106980
     CAGCTTGCGC GGCTTTGCTG TTGAGAATGG ACTGACCACT TTCGGCTACT CGGAGGCGTA    107040
     GCCATCAGGA AAGCTGACGG TCGGCACCTG GGGATCGAAA ATCGGAGGCT GAGCGGTCGA    107100
     TATGGGTCGC GAGCTGCCGC GTTGGCCTGG CACGATCAAC GGCAGCTATT GCGTTCGGTC    107160
     TTCCTGAAAC GGTCAGGCAG GAATCCACCA ATGTCAGAGC TGAAGAGCAA GGGCGCTAGG    107220
     CGCAGGAAGC GGCCATCCAG TATCGCCGGA TGACCGCACC CGATTTCAGA TTTCAGTTCG    107280
     CTCGGCCAAG AGCAGCGCAT CCTCGACGTC TACACCGAGG TAGCGCACGG TGTTCTCGAT    107340
     CTTGGTGTGG CCGAGTAGGA TCTGTACAGC GCGCAGATTG CCAGTCGCCT TGTAGATCAT    107400
     TGATGCTTTC GTTCGTCGCA GCGAGTGGGT GCCATACTCT GCTCGTCGCA GACCAATCGC    107460
     AGTTAATAAC CCATTTCAGT TCTCCTTGAC CTTGATTGAC CTATGGAGAA ATGAAAACGC    107520
     CCGAGCTACA GCTCGGGGCC GTAAGCTACC TATCCGGTTT CAGGCGCGAC ATCAGGAAAG    107580
     CTGACCTTCA AGCTGCGAGA CAGCGGTAGT CGCAAGCCCC TCTTTCCAGA CCAAACAACC    107640
     CGCTGTGGTT CTCCTCGAAA GTTACCATTG TTTCCAATCG GTAAAATTGA CCTGACCAAG    107700
     GCGCCATCCC TTCGAATGCA TCCCCATCAT TTTGGTGCTA ACGGAGGGTG TGGGGCATGG    107760
     GGGTGACTCA ATAACGTGAT TCGATTTCGT CGCCTAAAGC CTGTTCATCT CAATTCCTGG    107820
     TTGGTTGATC AAGGCATTCC CCAGACGCAT CAACGCTACC GATTGCGGGT CTGGCGAGAA    107880
     GTTCACGCTG CCCTCGGCCC ATTGCGTGAT GAACTGATCG CCTACGTTCA GGAAGCTTTG    107940
     GACGATGCCC GGCGGCGTAT TCGATCCGGT TTCCAGGATG ATCTATCGCC CTTCAGCGGT    108000
     CTGGTGCATG ACCCTGCCGC ACATTATCCT GCAATGCTCA ATCGTATATC GCTTCAGGGG    108060
     TATCTTGGGG AAACACTTGG CGTGCTCGCG GTGGAGCACT TCGGAGCGAT CGGATATTCG    108120
     AATTGGATGG TTCCAGCTCT CCTATTCCGC TTTCACGATC AGGAATTCCA GCATCTGGAT    108180
     CTGATCAATG AACGCCTTCT GGCGGGTGAA GCACATGAAC CAGACGCCGA CAAAGAGAAG    108240
     CGGCCAGGTC GGACGGGCGA CGACGGACTG GCGTTTCGAG TAGACGAAAA TGGCGTGATT    108300
     ACCGACATTC TGACACTCGA AGCCAAGTGC CTCACGACCA ATAATACTGG CATCATGAAA    108360
     GACGCACACG AAAAGCTCAT GGTAGGCGGA AACCGGCCCA GCGGTGTGCG CGAACTGATC    108420
     AACCTTCTGA CGGAATATGA CACGCCTGAA GCCGAGGCCT GGCAACAGGC GCTGCTTCAA    108480
     TTCTATAGGG ACGGTTTCCG CACGGCAGCT CGCCACGATG GGCTCGCTTA TGCTGTCGGT    108540
     CACTCTCCTA AACAGCCCGC TGACCGGATC GCCTGGCTTC CTCCTGAAGC GCCTCATCCG    108600
     GCATATACGA TACAGCGCAA CCTCGAAGCG ATGGAGTTTC AATTCGAGAA CTTAGATGCC    108660
     GTAATCGACA TATTGTATCG GGGCGCTTGA GATGGCAAAC GCAGCTACTA TCGCCATCGC    108720
     CCGCGAAATT CGAGAGAACT TGGCAGGCCA AGCCCTAACG GCGCGCCAAG CCAAACTCTA    108780
     CAGCCAACGG TTACGCCGCG ACATGGGCCG TGATGATTTA GCGAGTTTCG GAGCGGGAGA    108840
     CATCGCCGGT TATCTCGAAG AAGCGATGTT GCTACTGGAA AGCGGCTGGT TTGAGCGAAG    108900
     CGCGGACATT ACCTCGCCTT GGCGCACCTC GATCAAGCGT GCGGCAGAGA TCATCGAATG    108960
     GCTTTCGCAA TCCCGGCTAA AGCCGCCGGG CGCTCCGCTA CATCTGTTGG CTGCCGCAGC    109020
     CTATCAATTG GCCGATTATC CGGCGATGGC GCTGGGACAT TTACGGCGAC TACCGGAGGG    109080
     GGAGCCGCTC TCAGAGCTGC TCCGCCAGTT CGTTCGCGCA GATTTCCCGG GCGCGTTCCA    109140
     GGCGGCGCAG ACGTTCTGGA ACAATTATCG TGGGTTGCGG GCCGAAGGCC GCATCGATCC    109200
     TAATGACCTC GAAGTCGCGG CAGTCCAACA TACAGTCATG TGTGTCGGGA CGATCTGCGC    109260
     GTTTCTTAGA ACGGGCGGGG ATGTCCCCGT CGAGCGCGCG GTGATCAAGC TGGAAGCGCT    109320
     CGCCCTAGGA TTCCTGCATA GTCGCGATTC CTATTCCTAC CTGCTGGCGC GGTTGACGGC    109380
     GGCTAGCGCA AGGCGGTTTA TCGAAACCTG CCTTTGGCCG CAGATCGATC GGCTCCGCCT    109440
     TACGTCCAGC GGCCCGGCCG GCAATGCTCT AATCCAGTTT GCGCGCTCGG CCTTTGCCAA    109500
     CAAGCGAGCA CTCGTCTGGC CTGCGCAGGC GGCTGGCATC GCGAAGCTGC GCGACAACAG    109560
     TTCGTTTGTA CTGTGTACGC CAACCGGCTC AGGGAAAACC ACGGTCGCCA CCCTTGGCGC    109620
     GGTACAAGGC CTGTTCGCCG ATCCCCCGGT CGGAGGCGCT GCTGGAAATC TCGTACTTTA    109680
     CCTCGTTCCA TCCCGCGCGC TCGCGGCGGA GGTGGAGAGC CGCCTCGCCG AGGATCTTCG    109740
     TGGGATTGCA GCGGAGCCGG TTGTGGTTAC GGGCCTGTAT GGAGGTGTCG ATTGGGGGCC    109800
     GACCGACGCC TGGATCCAAA CCGATCAGCC GACCGTGGTC ATATGCACGT TTGAGAAAGC    109860
     CGATGCGCTC CTGCGCTATT TGGGCGTTCT GTTCCTCAGC AGGGTTCGCA CGGTCATCAT    109920
     TGATGAAGCC CATATGGTGG AGCAGGATGA GGCCCGGCTG ACTGGGCTGG GGGACGGGAC    109980
     ATCGCGCGCC TTCCGGCTTG AGCAGCTCGG CACACGCCTG ATGCGCGCGC GGGAGGAGCA    110040
     CGACTTCCGC ATTGTCGCGC TGTCGGCGGT CGCGGCACGG GCAGCGCCAG CCTTGGCCCG    110100
     CTGGGTCTCC GACGCGCCGG ACGCCATTCC CACAAGCTCA TCCTATCGCA GCACACGGCA    110160
     GATGCTGGGG CGTCTTGAAG TACGCCCAGC CGGCCAGTTC TCGATCCGTT ACAGCCTGAT    110220
     GGATGGTCAT TCGCTGAAGT TTGACGACGA ACGGCGGGAT GACTCGCCGT TCGTACCCGA    110280
     TCCATTCCCG GCTGTTCCGG GGGGTATAAA TCCGCAAGAT GGACCCGAGG TACGGATGCG    110340
     CGCGCCCACG CTGTGGGCGG CGCTCAACCT GGCCGCAAAA CGGCCGGACG GCTCATTGCC    110400
     TTCGGTCCTC ATTTCGTTGA CACAGAATAT CGACACCTTT GCCGCGACGT GCGCCGATCT    110460
     CTTGGACAAA TGGCAGGACA CCGCACTTCC AGATTATTGG GCGATTGAGG AGGACAACGA    110520
     GGTTTGGGCG CGCTGTCTGG CGACTGCGAT CGACTATTTT ACAGCGGATT CAGTCGAATA    110580
     CCGACTGCTA GCGCGCGGCA TCGTGGTGCA TCACGGCAAG ATGCCGGGCC TCCTCGCCCG    110640
     GCGGCTGAAG ACTGTTATTG ATCGCGGTTA TGTTCGAGTC ATCATCGCCA CTTCGACCCT    110700
     TTCGGAAGGG GTAAACATTC CGGTCAATTT CCTGCTTATC CCAAGCGTCT TCAGAAGTAA    110760
     TGCCGAGTTG CCGTTGCAGG AATTCAGCAA TCTGATCGGC CGGGCGGGAC GGCCCGGTGT    110820
     CGCAACAGAA GGCAGTGCGC TCGTTGTCCT GCCCGAACGC ACTTACGAGA ACCGGTTCCG    110880
     GCGGATCGTG CCGACCTATA ACCGACAGTG GAACGGATAC GAAAGCTTGG TTGCCCAGCT    110940
     TGAGGCTGCG ACCGCGGCAG TAGGCGATCT CATCCCGGAC GATCAGGCAT CAAGCCCGCT    111000
     TGGCCATCTG CTGCGCGAAT TAGAGCATGC ATGGAAAGCG TTAGTGGGAG GCGGGACCGA    111060
     GACCGAATTT ACCGCTTGGC TTGAGCAAAC GGCCGTCACT GAGCAGGCTG CATACCCGCC    111120
     GTCCAGCCAT GATTATCTCG ATTCACTGGA CGCATTTTTG ATCGCGGCGA TCCAGGAGGT    111180
     CGAGGAGCTC AGGGGTATCG AACTCGACCC TGCCCAGCTT GAGGCGGAGT TGGCTAAGAT    111240
     TTGGCGACGT ACCTATGCGC ATGCTGCTTC GCATGGTGAG GCGCATCTGG CGACGATCTG    111300
     GCTGGCCCGC GGTAGAGCCG TAAAGACCCA GTATCCCGAT GCCGATCAGC GGCGACGCTT    111360
     ATATAAGACG AGCCTGACGC CCCGATCTGC AAAGCTATTG CTGGACCGCG CGGAGGCAAT    111420
     TCGCGTGAAG CTATCGGAGG GCCGCGATTA TGCGAGATGG ACTACCGAAG AGCAGTTCGC    111480
     CTTCATCCGC GATGTGTTGT CATTTTTATC GGAAATTCCG GTTTTTGCGA TAGAAACAAA    111540
     ACTCGGCAGA AAGAAAAAGT TCGATGATTG GCCTATGTTG CTTCGTTGGT GGCTAGCCAA    111600
     GCCGACGCTA GTGCGACAAC CCCGCCCGAA CGAGGTCACG AATTGGTATG CCTTTGTGGC    111660
     GAACAACTTC ATTTATCGCG GAACTTGGGG ACTCGGTAGT GTCATCGGCC TATTGCTGGA    111720
     TACGACCGAG GACGGACAGC CCATTCGCGC GCTGGAAATA ACCGACTGGC CCATGAGCGG    111780
     TTTGCCGTGG ATCGGCTTCT GGCTGAAAGA GCTTATCAGC TGGGGTACAC TCGATCCGGT    111840
     GGCTGCTTTT CTCCTCGCGC GTGGCGATGC CGTTGATCGT CCGCAGGCTG AGCTTGATGC    111900
     GAAGACCTAT TACGAAAGCC GTCCGGAGGG CGAGGATGCC AACGCTGTTC TCGACCCTCG    111960
     GACGATCCGT GCATGGGTGG AAGCTAGGCA GCCCGCACGC GCAGCGCGGA TAGGCACAAC    112020
     GACGATAGCG ATTAAAGTGG AATGCGTTCG TCCCGTCGAG GCGTATCGGC AGCAACGACT    112080
     AGTCGTATTG CCGCTTGTGG AGGCGGACGC GATTGTTTGG CTTGACCCCG CCGGTTATGA    112140
     GGTGGCGCGA AGCGTAAAGC CAGGCGATTG GCCCGAGAAA CCCGCCCTGC TCCAGTTTGA    112200
     GCTTCTGGTG GCTGTATCCT CCGTCATCGG CGAGCCGTAT CTGCCCCACC GTTGATCCTC    112260
     CGCCATCAGA GCAATGAGTT TAGCTGCACA AATCCTTGAG GACCGCCAAG GCATCGGCTG    112320
     ACTTTGAAAC TACCGCGCAA GCATATTTCC GGTCCAATGC GGTGTGGCCG CCGCATATCA    112380
     GGGGTGCGGA GTGTCTATAT CTCCGACATT GTATGCGCGG CAGTGCGATG TCCGCTTTCA    112440
     GAACTGCCAG TCAAAGGCCC AATGACGGAC TTGAGGCGCA AAGCTGGCGT CACCGTTTGG    112500
     CAGCACAACC TCAATCCGAA GCAGTCCTTG CCATCTGCGT CCTCGATTAA GTCCCCGCCA    112560
     TTCGCGCTTA GTTTATCTCC GTCGGATCCC GGACGATGAA ATCGGAGAAG GCGTGCAGCT    112620
     GTTCCTCGGT CGCATCACAA AGGCCGCCAC CCCTATAATG TGCGTGCACG AGGGCCCAAA    112680
     AGACGACCTC GTCGGACCGC CCGGCAAAAA GCGCCTTCTG TAGCGTGCGG CTGATTAGCG    112740
     TCACTGCGCG AGCGTGGTCG TAGCGTGTGT GGAGTTCGTC GGCGACGATC TTCGTATGTG    112800
     CAGTGTGGAT CAACGGGCGG GCCTCCTCTC ACGTTGAGGT ATCGCTCACG CAGCCGTAGG    112860
     CAACATGGCA TCGGGCAAAA CGCGATCGTC ACAGCCGCGC GCCTGCCGGA TTGCGGCGAG    112920
     CGTCTCGCGG TTGAAAGACA TGCGCAGGGC GACCGCCTCG TCGCGGCCGA CGCGTTTGGG    112980
     AAAACCCAGC GTGCGCACGA AGAAGCGCAG CTGCATCGCG ATCACCATAA GCCGCCAGTC    113040
     GATGGCGACC GTCACCGTGT CGACCTTGTT CACCATCCCC CACTCGACGA CACCCAGTGC    113100
     CAGTTCGAGG AAGGGCGCGT CGCCGTGCGG CCGCATCTCG CGGCGTCCTG GCGCGACGCT    113160
     GAAGCGCGTC CACTCGTACA CACGTGGACC GCGCGGCGGC CGATGCCGGC ATAGGTCCGT    113220
     CAACACGTCG CTAAGTAAAT GCGGCCGTGT CGTCGGCAGC AGCCGTTGGT ACCCGACGAT    113280
     GTCGTCGCCG CGCAGGCAAA TGTGGTGGAT GGCATGCGCG TCATCAAAGC GGTCGCGTTC    113340
     GCGCCCATCG GGCTGACGCA GGTCCTCCCA GCCCTTTTCG TCAACGAATA CCGTGTGGCG    113400
     GAAACGGAAA GCCCGGTCCA TCAGCGCCGC ATGGCGACTG ATGTCCGAGC CGGGGATGAC    113460
     CATCAGCATC GCAAACTCCT CGGCTTATCG GAGAAGCCGA GTTGGCCACG CTGAGCCCGG    113520
     TCACGGTATG GTCATAAAAG ACCATTGCAT GACGTTATAC AGCCGTCACC GCCGGCTCCA    113580
     TCGCATGAAT GCGTTTCAGA GAGGTGGTGC GCGTCTTGCG TGCGATGTTT CGCGGCTCAG    113640
     TCGGCCGCAA CGAATGCAGA CGGGACACTC GGCCGCTGGA TGCGCATGGT GACAATCCCC    113700
     AACCAGTCTT CCGTCGCGAA GGCTTACGAG GAGTTCGACG AGGCGGGACG GATGAAGCCG    113760
     TCCTCCTATT ACGACCGAGT GGTCGACGTG ATGGAGGAAC TGTTCAAGTT CACACTGCTG    113820
     ACCCGCGACC TCTCTTCCTA TCTCACCAAC CGCTACAGTG AACGCAAGGA AGCGGCTGAC    113880
     AAGCTATCCG AGCGCGTGAA GCTGGCAGCG ATCTGACCGG CATGGCTATT TCGATGATCG    113940
     TGGGGATTCC GAACTCGATC GCCTGCATCA GGCCCACAGG ATGTGCTGCT CAAAATCATT    114000
     GGACATGTTC GAGAGAGGAA TTGGGCGTCA CCCCTGCGGG GTCGGGCTGG CGGCTGCGCT    114060
     GAAGCCCTTC AAGCGGGTCA TCCCCCTCGC GGGCTGCCAT CCCTGACGCA AGAGCTTCGA    114120
     GCCTGCCAAC GGCGACGACG GTTGATCCGA TCTGATCCGG TCGGTCGCCA ACCACGTCGG    114180
     GACGGTCATC TTCGGTGCGT GCCAGCGCGG CGCCCGCCAA CAGAGCTTCG CAGTTTCCAT    114240
     TTCGTACAGC CGGTTCGAAC GCGTTGATGA GCGGCCTTCT CCAACCCTTG GCGAAGAGAC    114300
     AACCATTGTT CATGCCTGTC GATCAGGGCG GCATGGACCC GCAGAGCAGA GATGTTCGGT    114360
     TCTGCAATCC GTGCTTCCGG GAAAGGACCG GCCCCGCTCT CGAATAGGCT TTCCTTGGTT    114420
     CAGGCGCGGC CTTCCACGAT CAACCCGCAA GGGGTTCGCT ACGCAAGCGT GCGACCTCTT    114480
     CAGCTGTGCC TGCGAGGTGA CCGCGGCCGC CCCTGAACAC GTCGGCGCCT GTCGAGCGGG    114540
     GGATGGTCCC CGCCCCAAGA CGGGAGCCTC ACGATGTCGC ACAATCTCGC CCTCGCACAG    114600
     AATCACGCCT TCGATCTGGC CCGCACGCTG ATGGTGCCGG TCGTTCTCTT CCAGGTTGAT    114660
     AACGAATTCG GCGTCATGGT TTCCAGTGAA TACGACGGCG AAGAGGATGC CATCGTGCAT    114720
     GAATACGATC CGTGGTGCCC GGCTCATTGA GCCGGGTGAC CGGTGCCGCT GGCGCCGTGC    114780
     CGGTCGCAAG GGAAGCTTCG CCGCGGCCGG AGTCCGACAT GTTGGACGGC TTGTCAGCGC    114840
     GCCCTTGCAT CCGGCAGGCT TCGCGGCCGG TCGGTCCCGT TCCCGAACAT GAGGAACAAG    114900
     AAGAGCCAAC CGAAGAAAGG GCCGGGTCGC GCGCTGAGCG CGCTCGGTGC GGAGATATGG    114960
     AAAAGAAGGA CATTGAAGAG CTGCGCGCCA AAGTGGCCTG CGCGGCCGTA CTCGAAAAGG    115020
     ATGGTTGGAA AATCGACCTG AAGGAGAGCA CGCGCCGCGC ACTCAAATAT CGGCGCGATG    115080
     CCAACATCAT CATCGTCATC CACGAGGGGC GCGGCTGGTT CGATCCGCTG TCGCCCGCCA    115140
     AAGGGGATGT CTTCGACCTC GTCGAACATC TTGGCGCCAG CGGATTCCCT GAAGCCTGCG    115200
     ATCGCGTCGC CGCTCTTGTC GGCTTCGTTC CAAGCTCGCC GGTGTGGACA CGCGTGTCCA    115260
     GACCCCCGGC GCTCACGTCC GTCGCCGACC GTTGGGCGTG CCGGACAGTC CCGAGGCCCG    115320
     GTTCGGCGAC CTGGCGCTAT CTCGCCGATC TGCGCTGTAT CCCTGACACC ATTATCGCGG    115380
     CAGCGGTGGT TCAAGGTCGA CTGCGCGAGG GTCCGCAGGG CAGCATGTGG GCGGCGCACG    115440
     ATGACCTCGC CGGCCGCGTC ATCGGCTGGG AAGAGCGTGG CCCGCGGTGG CGCGGGTTCG    115500
     CCACCGACGG GACCAAGGAG CTGTTTCGCT TTGGGCCAAT CGGCGCCCAG CGAATCTGCA    115560
     TCACCGAAGC CGCGATCGAT GCCCTGAGCC TCGCTGCGAT CGAGGTCCTG CGCGACGACA    115620
     CACTTTATGT CAGCACCGGA GGCGGCTGGT CTCCGGCGAC CGATGAGGCC ATCCGCGGCT    115680
     TGGCCGGCCG CGTGAACACC CGGCTTGTTG CCGCGACCGA CAACAATCGG CAGGGCGACG    115740
     TTTACGCCGA TCGGATTCGC GCCATCGCGG CGGAAGCGAC CGCGCTTTAC GCACGATCGC    115800
     GTCCCCGCGC CGGTGACTGG AATGAGGATC TGAAGGTTCT GGTCATGCGA CTGGAGATAG    115860
     AGCCTGTCGC AGCCAGCGGG TAAGGTCGCC GATGCCGCCT GCCGGTCGGC GCGTCAAGGG    115920
     AAGCTTCGCC CGCTTGAGCA GCGGCCCTTG ACCCGCGGCG CCGGAGAGTC GGCCGCCCCA    115980
     GGGTGTTCGC AACACCTAAA GGGAAGGACC AACCGATGGC TCTCAGGACC ATTGAAACCA    116040
     CCTATCGCCT GCCGGTTTTC CGGCACAAGA CCTACGAGGC CGAGACGCTG GCGCAAGCCT    116100
     GCCGGCTCGC GATCGAGGAT GACAACTGGG ACGATGAAAA GCGGGACTAT GAGTCCGCAG    116160
     GCGAAGTCTA TGTGACGGGA ATCTGGTCTG GCCCAGACGC GGCCTATAGC GGCGCCTCCC    116220
     AATCGATCCC CTCGCACTAC ACCGAGACGC ACCAGCGGAT CGTGCAGCAT TTCGAGGTGC    116280
     TGCTCGGTCT CGTCAAGGTT CTGGCGAAGC AGGACCAGGA ATCGCCCGAT CCCAACTTCT    116340
     GGCGCGAACC CGCCCAGCCC GCGATCGCCA AGGCCGAGGC GATCCTCGCA GGCGCACGCG    116400
     ATCCCGACAT CGTCGGAGAC GCGCCATGAC GGGATATATC GTGAAGATCG GCTTCTGGCT    116460
     GCGGGCCTAC CATAGCGTCA GCATCGAGGC TGAGTCCGAC GCGGAGGCGA TCGAAAAGGC    116520
     CAAGGCCGCC GCCAAGAGCG CGATGGACTC GACCGCGCAG CCCGAGCACA TCGATGTCGA    116580
     CGAACGACGC GAAGGCATCA TTGCGTTCAT CGACCGGATC ACGCCCGGTG GCAGAGAGGT    116640
     GGTGATCGAG GACGTCGCGT TCGACGATGA TCGGATCCAC CCCGCCTGAA TCCGAGCTTG    116700
     CATCGTCGCA TCGCCGGGCC CCGCGCGCTT TAGCCAACAG CGTCGACACG CCGCCGTTCA    116760
     AAACCCTGCC TCACCATCGG CATCCTGGCC GCCGAGCGTC GGACATCCGC TGGACGCAGC    116820
     GCATTGCCAG TCAACGGGCA AGCCGTTCCC GCATCCAATC TGATGCGTGA CAGGCAAAGC    116880
     CTGGCTGCAT CCGACCGCGT CCCCGACGCA ACGAGGTCAG GAGCGAAAGG CGATGTGCAG    116940
     GGTTCTCAAC GAGCATCACG CGGGCGTGCC GGCGGGCGCC GTCTATATTG GCCGCGGCTC    117000
     GAAATGGGGC AATCCGTTCC GGATTGGCCC TGATGGCGAC CGGGCGGCCG TCATCGCAAA    117060
     ACACGAGCGC TGGCTCGCCG ATCAGCACGA CCTCTTGCGC GCGCTCGACG AGCTTCGCGG    117120
     TCGCGACCTC GTCTGCTTTC GCGCCGCGCG CGTGCCACGG CGATCTCCTG CTTCGTCTCG    117180
     CAAATGCGTC GAGCGAAGAA CGGATCGCGT GGTGGCGCGG CGTGACGGCC GCTGCGTGAA    117240
     CGCCAGGGGG CGGGCCTTTC ATGAAATAGG GAAAGAACGA AGGAACATGA AATCGCTGCC    117300
     GCATGCCCGG CCGACGCGTC AAGGGTGCGC TGCGCCCGCG TGCCGCGGCC CTTGACCCGC    117360
     CGGACCGGAG AGGCGGCCGC CGGAGAGGTG TGACGAAGGA CTGAAGTGAT GAGGAGATCA    117420
     GGCGGATCGC TCGCGCTTCG GCCCGGCCAG GCTGAAAGGA GCCGCCGATG CACACCTCAC    117480
     CCACCATCCG CAAGATCTTC GAAGGCGTCG CCACGCGTCC CGACATGTAT CGCATGTTCA    117540
     ACCGCCATCG CGGCGATCCG GCGGTGGCCG AAGGCGATGC CCAGCACCTC TTCGCCGGCG    117600
     AGTGGTTCGA AATCGCCGAG CGCGAGCATG ACTACATGCT CGAGATCCTG CCGCCGCTGT    117660
     GGATGCGCAC CGACATGTTC GCGATGCGCG AATTCATGAC CGGCAATGTC ACGAGCGTCT    117720
     TCTTCGCGCT CTGGATCGAC GGCCGCAAGC GCTTCTTCCA CGGCTATTGC GATCTTTCCG    117780
     ATCGCCGATC GCCTGAGTGC ATGAAGCAGG TGATCGTCGA TCGCGAGTGC CGGCCGATCC    117840
     GCGCCATGAC GCGCGAAGAG CGCCTCGAGC ATATCTGGTC GAGCACCCAT GATGATTATC    117900
     GCGGCTACGC CAGTGAACGC TGGGCGGTGC ATCTGCGCGG CAAGCGCACG GTGCTCCTTT    117960
     ATGGCGGCCC GCTGGGCACG GTGCTGAAGC TGCTCGGAGA CCTGACCGAG GCGGAGATTT    118020
     CGGCGAAACT GCCAGTACAT CTGCGCCACC TGCCCGACGC GGTCGCCGCC TGAGCAAGGG    118080
     AGCAGTCCCA TGCAGGGAGC CTACGACCGT CTTCGCGTCC ATGTCTTCGC GTCATGGCGC    118140
     GATGTCGTGC GGGCCGCGAA CACCCGCATC GCCAGGAAAC ATCGCCGCGG CGCGGCGATG    118200
     AGAGAAGCGC GCAAGCGCTT CTATCGCGAA ATGCTTGGTT GCCACCAAAG GCACCAGGAA    118260
     CTCGTCCTCA CCTTCCGGCT CTGAGCGCGC TCAGACCCCC TCTCCCCTCA TCGCGAGCCT    118320
     CGTCATCAGC CCGCTGTTCC CGACGGCAGG ACGACGTCGC GCGCCCGAAC AGCAGGACTT    118380
     CATCGTCATG ACGCAGAAAG ACCCATTCAC GCTTGATCTC TTCAACAACA CCTCCCTGTC    118440
     GTCGGGCCTC GGTCTCGGCG TCACGGCGTT TGCGACGTCC GTTGAAGGTG AAGACCCGGA    118500
     TCGCGATCCG TCTTCACCAT CCTCGCCCGC CATCTCTCCT ATGACAGTCG TTCAGTCGGA    118560
     AACCGCGCGT GTCGCAGGCG AGAACTTCTA TCTCGCCGAT AGCCGGGGCC TGGCGGCCTC    118620
     CTGGCGCGAC CGCGCGCGCG ACAATCTGGT CGCTATCCGT CTCGCAGCGG ACCTCGAAGC    118680
     CGAACAACAC CCGGCCACGT CCGACGAGCA GGCGCAACTC ATCCGTTTCA CAGGCTTCGG    118740
     CGCTTCGGAG CTCGCCAACG GCGTGTTTCG CCGCCCCGGC GAGGATGGAT TCCGCAAAGG    118800
     CTGGGAAGTG ATTGGGCAAC AGCTCGTGGA GCTTGTCGGC ACGGCCGACT ACGCCTCTCT    118860
     CGCCCGTTGC ACCCAGTATG CTCACTTCAC GCCGGAATAT ATCGCTCGTG CTGTGTGGGC    118920
     GGGCGCTTTG CGCCTCGGCT TTCGCGGCGG CCGGGTTCTC GAGCCCGGCA TCGGAACGGG    118980
     TTTGTTTCCT GCGCTGATGC CGAAGGCACT TCGCGACGTC AGCCATGTCA CCGGCGTCGA    119040
     GCTCGATCCG ATCACAACGC GGATCGCCAA GTTGTTGCAG CCGCGTGCGA TGATCGTGAA    119100
     CGAGGACTTC GCACGCAGCA GCCTGAAGCA GCATTTCGAT CTCGCGATCG GCAATCCGCC    119160
     CTTCTCCGAT CGCACCGTGC GCAGCGACCG CGCGTTCCGC TCGCTTGGCC TGCGGCTCCA    119220
     CGACTACTTC ATCGTAAAGG CCATCGACCG GCTGAAACCC GGCGGCATCG CCGCGTTCGT    119280
     GACATCGCAC GGCACGTTGG ACAAAGCCGA CGCCACGGCG CGAGAGCAGA TCGCGGCGAT    119340
     GGCCGATCTC CTCGGTGCGA TTCGCCTGCC CGAAGCCAGC TTCCGCGCCG ACGCAGGCAC    119400
     CGACGTCGTC GTCGATATCC TGTTTTTCCG AAAGCGCCGG AATGGGGAGA CCGTTGCGAA    119460
     CGACGCGTGG CTCGACCTGT CCGAGGTCCG CGCGGCAACG GAGGACGAGG GCGCAATCCG    119520
     GGTCAATCGG TATTTTGCCG AACGTCCCGA CATGGTCCTC GGTGAGCATG CGCTGCGGCG    119580
     CGGCGTCTAC GGGCCCGACG AGACTTATAC CTGTCTATCG CGCGTGGGGA GCGATCTCGA    119640
     GACCGCGCTC ACCGCCGCCG TCCTCCAGCT TCCGGAAGCA GTCTACGACG GCGAGCCGGA    119700
     GGCGGTCCGT TCCGATCACG CCGAGCCGTC CGCCGCCACG GGCCGCGAAC CGCAGGCCTC    119760
     TGCCGTTCGC GAGGGCAGCT ATTTCGTCGG AACGAATGGC GCCCTCATGC AGGTAGTCGA    119820
     CGGCGTGGCG GTGACCATCA CGGTCAGAAA GGGCCGTTCG ACCGATGGCA TCTTCGAGAA    119880
     ACACGCCCGC ATCATTCGCA AGCTCATCCC GATCCGCGAC GCCGTTCGTG AAATCCTCAA    119940
     ATGCCAGGAG ACCGATCAGC CCTGGAAGCA GGCGCAGGTG CGTTTAAGGA TCGCCTGGTC    120000
     GAGCTTCGTG CGCAACTTCG GGCCGATCAA CACCACGGTC GTTTCGTCGA CCGAGGACGA    120060
     CGAGACCGGC GAGGTGCGCG AGACGCACCG GCGACCGAAC CTCGCTCCCT TCACGGACGA    120120
     TCCCGACTGC TGGCTCGTTG CGTCGATCGA GGATTACGAC CTCGAAACCG ACACCGCAAA    120180
     GCCGGGGCCT ATCTTCACCG AGCGGGTTAT CGCTCCGCCC CCTGCGCCGA TCATCACTTC    120240
     GGCAATCGAC GCCCTGGCCG TCGTGCTCAA CGAGCGTGGT GCCGTCGATC CCGACCACGT    120300
     CGCTGAGCTC CTCCATCGCG AAAGCGACGA CGTAATCGCC GAACTCGGCG ACGCGATCTT    120360
     TCGCGACCCT GAGACCGGTG CCTGGCAGAC CGCGGACGCC TATCTCTCCG GCGCGGTGCG    120420
     CTCGAAGCTT GTGGCCGCGC AGGCAGCCGC CAAACTCGAT CCGATCTTTG CGCGCAACGC    120480
     CGCCGCATTG GAACGCGTCC AGCCCGCGGA CCTCAAGCCG TCCGACATCA CCGCGCGTCT    120540
     CGGCGCTCCA TGGATTCCGG CCACCGACAT CATCGCCTTC GTCAAGGAGA CGATGGAAGC    120600
     CGACATCACC ATCCACCACA CGCCCGAGCT CGCGTGCTGG ACGGTGAACG CCCGACAGTT    120660
     GTCGTGGACG GCGGCGGGGA CCACGGAATG GGGCACGCAT CGTCGCCACG CCGCCGAGCT    120720
     TCTCTCGGAC GCCCTCAACT CGTCCGTCCC GCAGATCTTC GACATCGTGA AGGATGGCGA    120780
     CAGCGAGCGG CGCATTCTCA ACACGGTCGA CACCGAGGCA GCGAAGGAGA AGCTCCAGAA    120840
     GATCAAGACC GCGTTCCAAG GCTGGATCTG GGCCGACCCC GACCGTACCG ACCGGCTGGC    120900
     CCGGCTCTAT AACGACACGT TCAACAACAT CGTGCCCCGT CATTTCGACG GATCGCATCT    120960
     CCAGCTTCCG GGCGCCTCTG GCGCTTTTTC TCTTTATGGG CACCAGAAGC GCGTCATCTG    121020
     GCGCATCATT GCCTCGGGCG CGACCTACGT CGCCCATGCC GTCGGCGCCG GCAAGACCCT    121080
     CTCGATCGCG GCCGCGATCA TGGAGCAGCG CCGGCTCGGC CTGATCAACA AGGCGATGCT    121140
     CGTCGTGCCG GGCCATTGTT TGGCGCAGGC AGCTCGCGAA TTTCTCGCGC TCTACCCGAA    121200
     CGCCCGCATC CTCGTCGCTG ACGAGACGAA CTTCGTGAAG GAGAAGCGCC ATCGTTTCCT    121260
     GTCGCGGGCC GCGACCGCGA ATTGGGACGC GATCATCATC ACCCATTCCG CTTTCAAGTT    121320
     CATCCCCGTC CCGTCCGTCT TCGAGCAGCA GATACTGCAG GACGAACTCG AGGCCTATGA    121380
     GGAACTGCTG ACGCGGATCG ATTCGCAGGA TCGGCTATCG CGCAAGCGCG TCGAGCGCAT    121440
     GAAGGAGGGC CACAAGGAAC GGCTCGAGGC GCTGGCTTCG CGCAAGGACG ACCTCCTGAC    121500
     CATCTCGGAG ATCGGTGTCG ACCAGATCAT CGTCGACGAG GCGCAGGAAT TCCGCAAGCT    121560
     CTCGTTCGCC ACGAATATGA CGTCGTTGCG TGGCGTCGAC CCGAACGGCT CGCAGCGCGC    121620
     GTGGGACCTC TACGTCAAAT CGCGCTTCAT CGATATGAAG AATCCCGGCC GGGCGCTCGT    121680
     GCTCGCCTCC GGCACGCCGA TCACCAACAC ACTCGGCGAA ATGTTTACAG TGCAGCGGTT    121740
     GATGGATCGC GCGGCGCTCG AGGTGCGCGG CCTGCACGAA TTCGATGCGT GGGCGTCCAC    121800
     CTTCGGCGAT ACCTCGACCG AACTCGAGCT GCAGCCGTCG GGCAAGTACC GCCCGGTCAC    121860
     GCGCTTCGCG CAATTCGTCA ACGTGCCGGA ACTCATCGCC ATGTTCCGCT CCTTCGCGGA    121920
     CGTGGTGCTG CCGGATGACT TGCGCGCATT CGTCAAGGTG CCGACGATTG CCAGCGGCAA    121980
     GCGGCAGATC ATCACGGCCC AGCCGACGGC GGCCTTCAAG GCCTATCAGC GACTCCTCGA    122040
     CGAGCGTATC ACCGCGATCG AGGAGCGCGA CCGCGCGCCA GAGCCAGGCG ACGACATCCT    122100
     GCTCTCCGTC ATCACCGACG GCCGCCACGC GGCGATCGAC CTGCGTCTCG TCGACTCGAC    122160
     GCAGGACAAC GAAGAGGGCA ACAAGCTCAA CGCCCTCATC GCCAACGCGT TCCGGGTCTG    122220
     GCAGGAGACT GGCCACCACA CCTTCCGGCT CAAGGACGGC CAGCCCTTCG AGAAACCCGG    122280
     CGCGGGCCAA CTCATCTTTT CCGACCTTGG CACGATCTCG GTCGAAGCCT CGCGCGGCTT    122340
     CTCGGCCTAC CGCTGGATCC GCAACGAGCT CGTGCGGCTC GGTGTGCCAG CGCCCGAGAT    122400
     CGCCTACATG CAGGACCACA AGAAGTCCGA GGCGAAGCAG CGCCTGTTCA ACGACTTCAA    122460
     CGCCGGCAAG GTGCGCATTC TACTCGGCTC GTCCGATACG ATGGGCACCG GCGTCAACGT    122520
     GCAGCTCCGT CTCAAGGCGT TGCATCATCT CGACGTTCCG TGGCTTCCGT CGCAAATCGA    122580
     GCAGCGCGAG GGCCGGATCG TGCGCCAGGG CAATCAGCAC GACGAGGTCG ACGTCTTTGC    122640
     TTATGCGACG CTCGGCTCGC TCGACGCCAC CATGTGGCAA AACAACGAGC GGAAGGCTCG    122700
     ATTCATAGCC GCCGCGCTGT CGGGCGACAC CAGCGTGCGC CGGCTAGAGG ACCTCGGCGA    122760
     GGGACAGGCC AACCAGTTCG CCATGGCCAA GGCGATCGCA TCCGGCGATC CGCGCCTCAT    122820
     GCAGAAGGCG GGACTCGAAG CCGAGATCGC CCGTCTCGAG CGGCTGCGCG CCGCCCATAT    122880
     CGACGATCAG CACGCCATTC GTCGACAGAT TCGCGACGCC GGGCGTGAGA TCGAACTTGC    122940
     TACGCGCCGG ATCGGCGAAG TCGGGCAGGA CATCGAGAGG TTCATTCCGA CCGCCGGCGA    123000
     TACCTTTGCC ATGTCGGTCA AGGGCCAGCA TTTCGCCGAG CGCAAGCTCG CGGGTCGCGC    123060
     TGTGATGCAG GAGGTCCTGA CACTCGTGCA GCTCCAGCAC GACGGCGACA TCGCAATCGC    123120
     ATCGATCGGC GGGTTCGAAC TCAGGTTCGA GGGGCAACGC CTCGGCCACG ACGGTTACAC    123180
     CTACACCACC ATGCTTCAGC GAACAGGAGC GGTCTTCGAG ATTGAGCTTT CAATGACGGT    123240
     GTCACCCCTG GGCGCGGTTG CGAGGCTGGA GCATGCGCTC TCAAACTTCC ACGGCGAGCA    123300
     GGAGACCTAC CGTCGTCGTC TGCTCGACGC ACAAAAACGG CGCGCGACGT TTTCCGCTCG    123360
     GGTCGGTGAA GCTTTCGCCT TTGACGCTGA ACTTGGCCTC AAGCGCGAGG CGTTGGTCGC    123420
     GCTCGAGGCA GATCTCGCCG CGAGCGGCGC CGAAGGGGAA AAGGAAAAGC CGGGAGTGGC    123480
     AAAACGCATC GCCGCATGAG GGGTTGAACA AGCCTTTCGC AGAGCGATCG GCGTGGCGCC    123540
     GCTGACGCTC AACCGACCGC CTCGCGATCC CGGCCACGGC GCGCTCGCAG GGCGCTGAAG    123600
     CACCCCGCTC CCGCCTGCCG GGCAGGGATG CTCGCCGGCA GTTGCGCCGC CCCGCCCGCC    123660
     CTGCGGGCTG GAGGGGGTCT TCGAGAAGAA GACGAGAGAG GGACCGCCGG AAAGCTGCGG    123720
     TCCGCAACCC CGAAATGGAG AAATACCATG AGACTGATGA CAGTCGATCC GCGCGCGCTT    123780
     AAGCCCAATC CGGATCCGAC CCGACGCACG CCAGCGACAC CGCAGGCCGA CGCACTCTTG    123840
     CTGGCGACGA TCAAGGCGGT TGGCATCGTG CAGCCGCCGA TCATCTCGCC GCAGCAGGAC    123900
     GGCGGCAACA GCTTTTACAT CCAGTATGGC CATCGTCGCG TCTCCCAGGC GATCGCCGCG    123960
     GATCTCGCCG AGATCGAAGT GCTCGTCGCC GATCCCGAGA CGGACAAGGA TGCACTCCGT    124020
     GCCCTCGTCG AGAACGTTGC GCGCGAGGGC ATGAACCCGG TCGACCTGTG GCGTTCGATC    124080
     GAGCGGCTGG TCGGGCTCGG CTGGACCGAG GAATCGATCG CCATCGCGCT CGCCCAGTCC    124140
     GTGCGTCAGG TCCGCAAGCT GCGACTCCTG GCGAACGTCC TGCCGGCGAT GCTCGACCAA    124200
     ATGGCTCGCG GGGACATGCC GAGCGAGCAG CAGCTCCGCA TTATCGCGGC CGCGGCCGAC    124260
     GAGGAACAGG GCGAGGTCTG GAAGAAGCAT AAGCCCAAGA AGGGACAGCC GACCGTCTCC    124320
     TGGAGCGAGG TCGCGCGCGC TCTGACACGC ACCCGCATGT ATGCGCGTGA CGCGAGCTTC    124380
     GACGATGATC TCGCCAAAGC CTACGGCATC GTCTGGCAGG AGGACCTGTT CGCGCCGGCT    124440
     AACGAGGACA GCCGGTACAC GACCGATGTC GAGGCCTTTC TCGGCGCCCA GCACGAATGG    124500
     ATGGCCAATC ATCTGCCGAA GCGTGGCGCC ATCATCGAGG TCAACGAATG GGGCCAGCCG    124560
     AAACTGCCGG CGAAGGCCGA GCGCGTGTAT GGCAAGCCTG GCAAATCCGA CCACGTCGGC    124620
     ATGTATCTCG ACCGCAGTGG CAAGGTCGAG ACGGTCGCCT ATCGGGTCCC GAAGCCGGAC    124680
     AAGAAGACCA AGGGCGCCCC GGCCGAAAGC GACGACGCAG CCGCGGTGGC GAAGCCAAGG    124740
     CCAGACGTGA CGCGCAAGGG GTGCGAGATG ATCGGCGACA TTCGCACCGA TGCGCTGCAC    124800
     GAAGCGCTCG GCCGTGCGCC CATCGAGGAG GACACTCTTC TTGCCCTGCT CGTTCTGGCC    124860
     TTCGCCGGTC AGAACGTCAG CATCGCCTCG GGTGCATCGG ACAATCCCTA CGGCCATGCA    124920
     CGGGTCGAGC GGCACGTCGT TCGGCTCATC TCGCAAGAGG GCAAGCTCGA CTTCGACCGG    124980
     GAGACCCTGC ACCAGGTCGC CCGGTCCGTC CTGAGCGATG TGCTTTCGTG CCGTGAGAAC    125040
     CGCTCGGACA GCGGCGTCAT CGCGCGCATC GCCGGCGAAG CGATCGGCGC GGACGCCTTC    125100
     CTGCCGAACA TGGGCACGGA GGAATTTCTG TCCTGCCTCT CGCGTTCCGC GCTCGAGGGC    125160
     GCCTGCGCGG GAACGTCCGT CCTGCCTCGC CCTCGAGTCA AGGACACCAG GGCCGAGCTG    125220
     GTGAAGCACT TCGCCGATGG CCAGTTCGTT CATCCGAGCG CGCTGTTCGC CCCGCCGCTC    125280
     GAGACCGTCA CGGCGTGGGT TGGACGCTTC TCCGGCGACA CCGATCCGGA CGATGAACGC    125340
     GATGGACCGT CGGACGAGTC CGACGCCCAG GCCGAGGACA CAGGGGCGGA CGACGACACG    125400
     CCCGCTGGCT TCGCCGAGGC CGCCGAATAA CGGCTGTCTT GCCTTTTCCA ACGATCCCCG    125460
     CCGCCGGCCC CCAGCCGGCG GCGGTTCTGT TTCTCCATCA CCGACAGGAG GACATCATGT    125520
     CCGCGCAATC GATCTATGAC CAAGCGCCGA TCGGCGCGCT CATCCGCTAT TCGGATGGCA    125580
     CGCCGCGGCC GCCGCAGCGA TTCAAGAACA AACTTGCGGC CTGGGAGAGC AACAACAATG    125640
     TCGGACGTCT CGTCCGCAAA GCCGAGTCCC ACACAATCGG CAACCACACG ACACCGGCGA    125700
     GTTTCACTCT GCACCAGGGC GACTTCGGCA GCGCCGGCGT CGTGGTGCTC AAGGTCTTCA    125760
     AGACCTTTTC CGTGGGTTCG CCATTGGCAT TCACCATCGT GGAACGGCCG GCGCCCGGGA    125820
     TGGTGCGTGT TCTTGATCGC ACTGGTGGGC GCGCCGAGCT CCTCCACCTC GCAGCCGATC    125880
     GCGCGGCGGC GCAAGCCTGG CTCGCCTCGC ATCGCTATTC CGATGCCGTG CTCGACGAGG    125940
     TCATCGATGA CGATACGGCG GCAGGCTCTG GCGAAGGGAG GGCGGCATGA CCGCGCCTCG    126000
     GACCTGTGAT CAGGCCAACC ATCCCACCCC CGCCGCGGCG GGGGTTTTGT TTACCCGAAC    126060
     CCATGACGGT CTTCTCGTCG CCAAGATCCG CGACAACGCC TTCGCGATGA TGCCAGCCAG    126120
     AAACGACCGG TATTATCTCG CCTCCGCCTG GCGGCTGTCG CGGCCGATGG AAGAATGGTC    126180
     ACGCGGCGAT TTCTACGGTC ATGGCGGCGA ACTCGCGGAC GAAGCCGCTT TCCGCGCCCG    126240
     CGTCCATGAG AATGCCGAGC ACCAGCGCCA GCGCGCCGCC CTCGGGCGTC GAGAAATCCG    126300
     CAGCGGGGCG AACACGCCGT GGGGCGCTTC GCAATGCGTA ACCGTCTACG CGGACGGCGT    126360
     CGTCTCTCAC TCAACCGCCG GACACGGCGG CTTTCATCTC GATGCCGCGC GCAATGCAAA    126420
     GGTACACCCT GCCTTTCGCG CGCGTGGCGG CTGGTACGAA GAGGATTGCG CGTGGGCGAC    126480
     TGTCGCGCAA GCGTTTCCGG AATTGTTCAC CGACTTCGAA CGGCGTTGCG CCGATCAAAC    126540
     CATCCGCGAC TGGTATCCCG ACGCCTGGGA GACGATTCAC GGACGTCCAC TTCTGCCGGG    126600
     AGAATCTCAC GAGAAGGATC GCCAGGCCTT CGAGCGAGAT CATGCCTCCG ACTGGATCGT    126660
     GATCTCGGCG ATCCGCTCCG ATCACCATCG TGGCATGACA GAATGCGTCG CCACGCTCGG    126720
     CGGCGATCGC CGTGCGGCCG AGCAGCGGCG CTATCTCGTG CCGTCCGACG AATATCACCT    126780
     CGGCCGATTT GGCTTCGTGA TCAATGAGGC GCGCCACCGA CTCTACGGCG GTCCTTCCAA    126840
     CTTCGTCGGA TGGAGGTGAC CCATGCCTTG GCGCCTCATC GCCAAAGCCT TCGGCTGGCG    126900
     CACGGCCACC GACGAGGACG GCGCGACGCC CATCCTCGTC GTCTGGCATC CCCGCCTCAG    126960
     ACGGCATTTT ACCGGTTCCG AAGCCTGGAA GCGCGCCGTG CGTCTGTCTA TCCACGCGCC    127020
     GCAACCTTAC CCGGTCGACG CCGACAGAAA GGAGATTCAG TCATGAAGGC CTACCTTGTC    127080
     GCCGTGAATC TCCTCGTGCA GGCGCATCAT CGTCCCGAGA GCGCCATCGC CGACGCGCTC    127140
     AATGGCATCT TGACGCCGGA TATGCACAAA CATGCCGGCA GCAATTCAGC GCTTATCGAC    127200
     TGGGCGATCG CCGGTGACGA CATTGCATCA TCCATCGCCG GGGTCTCGTT CTCCGATGAC    127260
     TACATGCCGG GCGTGTCGGC CTTCCCGTTA TGGCCCACGG GGACGGTGCG ATGAACGAGC    127320
     TCCCGGAACG ACGCGTCCTG CTCGCGCGCA TGGAAGTCGC GCAAGCCGAG ACGCAGCGCC    127380
     ATCTCGGCAT CATCGAGCGT CAGATCGCAG CACGCGCCGA ACGTCTGACG ATCACCGATC    127440
     GGGCGAAGCG CCGGCACCAC GGCCGTGGCG CATCGAACTG GACAAACGCC GATGAGCGGC    127500
     TGTTTCAGGA GCATGTCGCG GAGCTCACGC TGGCCCGTCG CGTCGAGATC GACGCCCTCA    127560
     CGCGCAAGCT CGAACGGCAG GACCAGGCGA TTGCCGAGTT TCGGTCGCGC CAACACGCTT    127620
     ACGCTGCATG GAGGTCAGCA GCGGAAGCGC CGGGCTCTTC AGGGTGCGAA CGGAACGTGC    127680
     GAACGCTTGG TGCTGACGAG GAGGGCTCGC CGGTCTGACA CGACCTCTCA CGGTTTTGGC    127740
     CGCAGCCCAG CCCTTGGCCG TCACCCCCTC GATTTGTGCT GCGGTCTGAA CCGGCCGCGG    127800
     TCCGCTTCAA GGGCAAGTCG CAAGCGAGCG GCGGCCGCCG TCTCGTCATG GGGGGCCGCG    127860
     TCCTTCGCAG GCCTGAAGGC CCGCTCGTCC GCAACCCGCC CATGCTCGCC TTGGCAGCCA    127920
     CCGCCCCCTG AAGCGGACCG CTGAAGCCGG TTCCGGTCGA CCGCACCCGA GGGGGTGACG    127980
     GCCAAGGGCC CGATCACTTC CCAAGGCGAA ACCGAGAAAG GATCTCATCA TGACCAAGAC    128040
     CGCCCGTTCC CCTCGCGCCT CCGCCCGCGT CATCCCGCTT CGCCGCGCCA CGACCCTCGA    128100
     AATGGTCCGC CTCGCCTGCC CAGACTCCGC CCAGGCGCTC CGCATCTCCG AGAGCTTCGG    128160
     CCTCGCGATC CTCGACAGCG ACGGCATCCG CGACCTGCAC GAACGGCTCA TCGTCGAGAC    128220
     CGCCGACGCC CTCAAGGACG GGCTCAGCGA CCGTGCGATG GAAATCCATC TGCAGCGCAT    128280
     CGTCGGCTCC TATGTTGGCT CTGCCCACGG CGCTGGCCAG TTCTACTCAC GCGCCGTAAC    128340
     CGAGGCGCGC GACGCGACCG CCAAGCTCGC CAACGACCTG CGCGACGAGG ATCTTGACGG    128400
     TCCGGTCGGC TTCGACAGCC AGTCGCAGCG CAAGCGCGAG TTCGCCGCCG ACATGGGCCT    128460
     GCAGGCACAC GCACTCCGCA TGGCGGCCGA GGGCGCCGTC GCGGCCTACG AGCAGGTTAT    128520
     CGGCGAGGCC TGGAAGCCCT TCGAGCGGCA GATCGAACAC GCCGGTGAAA CCGTCACCAA    128580
     GAAGGCGGCC GTGGCCCAGA TGGCGGCTTT CGAGTAGCCG TCACGGCGGG GCTTCAGCCC    128640
     CGCCTTTTCG ACGTCGCAAC TTCGTGGGCC GGTCGTAAGA CCGGCCCTTT TTTGTCGCTG    128700
     GCGGAATCAA GCAAAATAAG AACCACGCAT CGCGCCAGTC GGCCCCTCCC GGTCCGTGGT    128760
     CCTGCGGCGG ATGTGCGCAC GCGCAACGGC TTCGCCGTCC TCCGCTGCGC TGCGGCCCTG    128820
     TCGGGTGCGC GAGCGCCTTA TCCGCCGCTG CGCCCCCCCG CGAGGGGCCG CGACTGGCGC    128880
     GGCCTTCGAA ACGGAGGTCC TGGAAATGAG CAGGAAGGAA GACAACCCGC GCGCCGACAT    128940
     TTACGCGCGC ATCACCGATC GCATCGTTGC CGATCTCGAA CGCGGTGTCC GTCCCTGGGT    129000
     CAAGCCATGG AACGCAGCCA ACGCGGCTGG ACGCATCACG CGGCCGCTAC GCCACAACGG    129060
     CATGCCCTAT CAGGGCATCA ACGTCGTGCT GCTCTGGTCG GAAGCGGTCG CGCGCGGCTT    129120
     CACGTCGCCG ATCTGGATGA CCTTCAAGCA GTCACTCGAA CTCGGCGGTC ACGTCCGCAA    129180
     AGGCGAGAGC GGAACGATGG TGGTCTATGC CAACAAGATC ACCAAGACCG AGACCGATGA    129240
     GCATGGCGAC GAAGTCGAAC GCGCCATTCC ATTCCTGCGC GCCTATACGG TGTTCTGCGT    129300
     CGATCAGATC GAGAATCTGC CGGATCACTA TTATGGGCGT CCGGCTCCGA GCATCGCGCC    129360
     GGCGCAGCGT CTCGCGCAGG TGGACGCCTT CTTCGCCAAC ACCGACGCGA CCATCCGGCA    129420
     CGGCGGCGAC AAGGCGTTCT TCGCCCCGTC GCTCGACCTC ATTCAGATGC CGCCGTTTGA    129480
     AAGTTTCCGC GATGCCGAGA GCTACGCCGC CACGCTCGCA CATGAATGTG TACATTGGAC    129540
     TGCGCCGGCG CATCGCGCCA ATCGCGATCT CAGCCGCTAT GCGAAGGATC GCAGCGAACG    129600
     CGCCCGCGAA GAACTCGTGG CGGAACTTGG CGCATGTTTC CTCAGCGCCG ATCTCGGCAT    129660
     TGTGCCGGAA CTCGAGCCGC GCGCCGATCA CGCGAGCTAC CTGGCGTCGT GGTTGGAGGT    129720
     CCTGTCCAAC GACAAGCGTT TCATCTTCAG CGCGGCCGCG CTCGCGCAGC GCGCTGTCGC    129780
     CTACCTGCAC GATCTTCAAC CGAAGCCGGC CGAGATCGAC GAAGCAGCAT GAAGCGCTAG    129840
     CGCTCCGCGC GTTGGTCGCG TGTGCTTGAT CGTTCATTTT TCTCGAGATC AATAAGGCCC    129900
     CGCCGTGCGG CGGGGCCGCC TTATTGCGTG CATCGTCATG CGTATGCCGT CGACCGGAGA    129960
     TGGTGGTCCT TCCCGCCACC TGGCCGAGCC GTGCCGGCGA GATCAGGTGG GTACGTGTCG    130020
     CCAGGCTGTC CGATCTGTCG GGCTGTCCTA GGCCGACGGT CTTCCCGCCG CGGCCGAGTC    130080
     CTGGTGCCTC CCGATCTGCC GTCCGGGCTC TCTTGTGATG GCTGGGCCGG AGAACCCTTC    130140
     AGCGGTGTGT ATGCGAGTCT CTTTCATCGT GCCCGGGACC GTCGCCATGC GGTGTGGCGT    130200
     GCCTGTCGCT CAGTCGTGTC CGCATCGTTC GGCCTGACGC GCCCAATGCG TCCTCGATTT    130260
     GGCATGTCTA ACCGAAGGCC GTCGTCGCTG CGCTCCGTCT CGCTCTCAAG ACCGCAACGG    130320
     CCGTTCTCAG CTTTCTTCCC CTGGCCGCTT CGCGTCCATT CCTCGCGAGA CAAGAAAGCC    130380
     TCGCCCTGGC CGCCCTCCAC TGCGTTGCGG CCCTTCGGGT GCAGCCCGAT CGCCTTCGGT    130440
     CAACGACTGC CATCGAGGTC GCGATGGTCG CGGCCCGAGA AACGAAAGAG AGCACGAACA    130500
     TGGCTACCAT CGGCAACTTC ACCGTCAACG GCAACGGCTT CGTCGGCACC GTCAAGACCC    130560
     TCGCCCTCGG CACCGTGAAG GCGAAGATCG TCCCGGCCGA GCGCAGCTCG GACAAGGCCC    130620
     CGGACTACCG GATCTTCGCG GGCACCATCG AGTTCGGCGC CGCGTGGAAG AAGAAGTCCC    130680
     AGGAGCAGAA CCGAGACTAC CTCTCGGTCA AGCTGGACGA CCCGAGCTTC CCGGCTCCGA    130740
     TTTACGCCAC GCTGGTCGAG GTGGAAGGCG AGGAAGGCCA CTCGCTCATC TGGTCTCGTC    130800
     CGAACCGCGA CTGAGCGAAC AGTCCGGCCC CGCCGTCGAT CGGCGGGGCC TTTCCATGGA    130860
     GGCAGTCCCG GCTTCGAAGA ATGACGCGGA TCGTAGCGCT GCACCGGCGC CCGCCGGATG    130920
     GAGCGCGCGC AGAGACTACC GCTTTCGATA TTCTGCTCTT GCTCCCATGC GTAAGCCATC    130980
     GTTAGGCTGT GTTCTTATGA AGAAGATCGG ATTCTTGTCG TTCGGGCACT GGACGCCTTC    131040
     GTCGCAATCG CAAACGCGAT CGGCGGCCGA CGCGCTGCTG CAATCCATCG ATCTGGCCGT    131100
     CGCGGCTGAG GCGCTTGGCG CAGACGGCGC CTATTTCCGC GTTCACCACT TTGCCCGCCA    131160
     GCTCGCTTCG CCTTTCCCGC TACTGGCGGC CGTCGGCGCC AAGACCAGCC GCATCGAGAT    131220
     CGGCACGGCG GTCATCGACA TGCGCTATGA GAACCCGCAC TACATGGTCG AGGATGCCGG    131280
     GGCGGCCGAC CTCATTGCCG GCGGGCGGCT GCAATTGGGG ATCAGCCGGG GCTCGCCCGA    131340
     ACAGGTGATC GATGGCTGGC GCTACTTTGG CTACCAGCCG GCAGAAGGGC AGAGCGACGC    131400
     CGATATGGGC CGGCGTCACG CGGAGGTGTT CCTCGACTTA CTTCGCGGCG AAGGGTTTGC    131460
     GCAGCCCAAT CCGCGACCGA TGTTTTCAAA TCCGCCGGGC CTGCTGCGTG TCGAGCCCCA    131520
     TTCAGATGGT CTGCGCGGCC GCATCTGGTG GGGAGCCAGC TCTAACGCTA CCGCGATTTG    131580
     GGCGGCGAAG CTCGGGATGA ATTTGCAGAG CTCGACCCTC AAGAATGACG AGACCGGAGA    131640
     GCCTTTTCAT ATGCAGCAGG CCGCCCAGAT CCGGGCCTTC CGCGCTGCCT GGAAGGAGAC    131700
     CGGCCATATC CGCGAGCCGC GAGTCTCGGT GAGCCGCAGC ATCTTTGCGC TGCTGGATGA    131760
     TCGCGATCGC GCCTACTTCG GTCGTGGCGG CGAGGAAAAG GACCAGGTCG GCTTCATCGA    131820
     TGAGAAGACA AGAGCGATCT TCGGTCGAAG CTATGCCGCC GAGCCGGACG TCCTCATCGA    131880
     GCAACTCAAG ACCGACGAGG CGATTGCCGA GGCGGACACG CTGCTCCTGA CCGCGCCGAA    131940
     CCAATTGGGC GTCGCCTACA ATACGCATGT GATCGAGGCG ATACTGGCCC ATGTCGCGCC    132000
     GGCGCTCGGC TGGCGCTGAC GCCGGCTTAT CCGCGCTTCA GAAGACGCGT GCGGCTTCCG    132060
     ATCGATCGAG CGCTTCCAGG CGCTCTGGCG TATCGAGCAG CTTCCTCGCG CCCGCGGCGA    132120
     TCGCCTCGGC GATTGTAGGA TAAGTTTCGG CCGAACTCAT CGAGACGCCG TCGAGAAACG    132180
     TTACCGTCGC CTGATAGCCA TTGCCCTTGG GCGTGGCCGA AAGCGTAACC GCCGGCATGG    132240
     TGCCTCCGTA TCCACCGTAT TTGATGTTGA AGATTACCGT AGAAACAACG CTCGCGACAC    132300
     CATGGTGGAA GCACACAAAA GCGGCGTCCA ATTCCAACGT GGAAAGCCTA GTCAGGCGCT    132360
     TGCAAAGTTC GAATCATATC GTTGCTCTCG AAACAGCCTG TATTTCTTGG GTAAAGTAAG    132420
     CGATGCATAT GCGTAGCTTT CATGGAATCG AGCGTCTAGT CTGCCGGCTG CTTCCCCTCC    132480
     TCGATTGCTA CGGTAATAAA ATCCTGAGCT TCAGTAACAC CTTCAGCGGC CGTTCGAAGG    132540
     ATTCGCTCGG CCATCTTCGC TTTGGTAGCA GGCGTGCGGT GGGCCGCGTC AATCTGATCG    132600
     ACAGCAACGT TCAGCACTGA GCGCATGGTT GAAACAAGCT CAGGTGCGAA TTTCTGCGGT    132660
     GACAACTTTA GCATACACGA ACTCCCTCAT GCCGACCGTT TAACCCCCGG ATGAGTCAGG    132720
     ACCGTGACGG TAAGAACACA AACCAGTCAC TGTGCACCGT GGGTGAACTG GAACCGAGCA    132780
     CGTTTTGCAC TGCTGGTCTC ACTCAATAGC GCGCGCATGA CGTCGCCTCG CGCGCCATGG    132840
     CCGACGGCGG GGCGGGACGG TGCGATCACA GTGAAAGCCC CGCCCATCGA TTCGGGCGGG    132900
     GCTTTTCCAT GGAGGCAGTT CAGGCTTAGA AGAATTACGC GGATCACAGC GCTGCACCGG    132960
     CGCCTACTGG ATGCAGCATG CGCAGAGACC GCTGTTTGAA GTGTGGGCAA GTGCTCAATT    133020
     CGCGCGTTAG CCTATCACGC TCGCGCGCAA CAAGTCGCAA AGATTCGAGT GCGGGTGCAT    133080
     TGTGCAAAAC GTATGTGCGC GACAGTCAGG TTGCATCGAT ATAACTAACG CCGGAACGGT    133140
     CGTTACGGGG CGGAGGAATA GCATGAAGAA TCTAATCGTC TGTTGCGACG GTACGGGAAA    133200
     CGAGATCGGT GAGAACATTT CGAATGTGCT GAAGCTTTAT CGTGTGCTCC GCAAGACGGA    133260
     CAAGACCGAT CCCCGGCAAA TAGCGTTTTA CGATCCCGGT GTCGGTACGC TTGCGCGCCC    133320
     GAATCCGTGG ACCAAGCTCA AACAGGACAC GGTCACCGTG CTGGGCCTCG CAACCGGTTA    133380
     TGGTCTCGAC GACAACGTTC TCAAAGCTTA CCGTTTCCTG ATCAACAATT ACGAAGAAGG    133440
     TGACGACATT TTCCTGTTCG GATTTAGTCG CGGCGCCTAT ACGGTGCGGG TTCTGGCAGG    133500
     ACTTATCCAC AAGGTCGGCC TGCTCGCTCC ACAACAATGC AATCTAGCCG ATGCCGCGCT    133560
     CACAGCCTAC AAACAGGCGA ATTCAACGAT CGTTGAACGG GATGAGCAAA AAGGCCCGGA    133620
     CAATACATCT GTCGATACGG AAGACGAACG GCAAGCGCCG CCGGCGGCGC GTGATGATCC    133680
     GGCCTCACAA TTCGCGCGGA TCGTTTCGAC CCGATGGCCT ACAATCAAAT TTCTTGGCGT    133740
     TTGGGACACC GTGGCAAGTG TCATCGTGCC ACGTCCTGAC CGTTTTTATG CTTTCAGTCT    133800
     CCAAAAGCTG TCGTTCACGC AGGTCAATCC GAGTGTGAAG GTGTTTCGCC ACGCCATCGC    133860
     CATCGACGAG CGGCGCAGGA TGCTCCGCCT TGAGCCGTGG AAGGAGACCC AGACGTTTAT    133920
     GCACAATCGC TTCAGTGCGA CGAACAATGC CGAGCCGCAG GATTCGCTTC AAGTGTGGTT    133980
     CGCGGGCGTG CATGCCGATA TCGGTGGAGG TTACGCTGAG AAAGAAAGCG GTCTTTCGAA    134040
     GTTCCCGTTA CTCTGGATGA TCGAGGAGGC GGTCAAATAT GGCCTTACGG TTAGCCGACA    134100
     AACCGTCAAT CAGCTGGCGT GGGGTATTCA ACGTAGAGGA AGCCCTTTTA GCTATGTGGC    134160
     ACCCGACATC AGGCGTGATC CACATCAATC GATGACGCTT GCGTGGCGCA GTCTGGAGTG    134220
     GATACCGAAA GCAGACAGAT TCAAAGAATG GAAGGATCGC CGGTCGTGGC TCCGCCACTA    134280
     CATCCCGAGC GCAGAGCCGC GCGTAATTCC TGATGGCGCC TACATTCATG AGTCCGTCAT    134340
     CGATCGTATG AAGGCGGTGC CGGCCTATTC CCCGATCAAC CTGCCGTCGA GCTGTGAGGT    134400
     AATCCCGCTG CCTTCCGGTT CAGATGTATT ACGATGAGGG CGTACCGAGC ATCGCCGTGC    134460
     GACGATAGAT CAACCAGGCG CTGTGTCCCG AAGCATCGTG AAGCTTTCCG TGATGCATCT    134520
     AAACGGCAGG CTTTGGAGTT GCTCGAAGCC AGTGCCCAAG CGTCAAAGCT TCATGCCCAT    134580
     TAAAGAACGT CTCGAATTTG AAGAGGTGCC GCTCGTCAGA GGCATCGGCA AGAATGACCT    134640
     CTTTCGCCCC GAGACCTCCG CCGCGCTGTG CGCCGGCATA GCTCGTTACG ACGCGAAACA    134700
     AATCCACTTC GCCTAACCCA CCGAAACGTT GGACGAATGC TGGCGATTGC ACGCAATAGC    134760
     GACAAGGATT TGCAGGGTCG AAGTCTGCCT TTCGCTTGAT CTGGTGCGGA TGTCCGGTCA    134820
     CAAGGGCGAC CATCGGCCGG CCGCGATGTC CCTGTTCGAT GAACCGCCAG AGTGTCGAAG    134880
     TCATTGTGTT GCCGAAGCGC TCGCTGAGCT GTCGAATGTG CCCAAGAGAT GGCTCGGAAT    134940
     CGCAGGCGTC TGAGCGGAAC CTCTCCGCGA GGAAGAGAAG TTGGCCGGCG GCGTAGTTTG    135000
     CTTCGGCCTC CATGATTGCG TGGCAGGTCG GAGTGAGCGT TTGTTCGGTG TCCCCGAGCA    135060
     TCATGCCTTC ATGCCAGGGG ATGATATCGT GCCCGACCTC GTGGGCTTCG TTCCAACGAT    135120
     GCTTGAGTTT CGGGAGATCC TTGTCGATAA GAATCCGCTT TTGATCGGGC AAGTAAAGCG    135180
     CCTTAAGACT CAGGCTCCGA ACGGCTTCCT TGAGCAAGGT GGGCCGCAGG AGAACCTGAA    135240
     GTCCAGCAAC TTTCAACCGG CTAATCGTCT CACTTAGCAG ACCATCATCT GTCGTGCTGT    135300
     AATAGTATCG ATCAAGTCGA AGCAAGTCGC GCACGACTGC GAGATCAATC GGCGGCTCGG    135360
     GGTTGCCAAG GCCCCGCAGG ACCTTGGCAA CCTGTGCGTC GATGTCAGCA ACAGTACGGG    135420
     CGCCAAGCTG GAGATTCTTC ACTTGCTCTG CTTTACATCC TGTCGGCTCA GCACGGCAAC    135480
     GAAGGCATCG AGCGCCGCAT TCTCTTCCCG GCTCAACTTC TGTACTGATT CCGATCGCGC    135540
     GGCGAACCTG ACTGCCTCTT GGCTTAGGCC GCTGTCATTT GCGGCCGAGA GGCCGGCGAG    135600
     CTGCATCAAC CGCTGCTGCG ATACATTGAA AGTTTGCGCC AACCGATAAA CGGTGCGCGG    135660
     CTCGGGAATG TAATGGACGT CGCCTTCGAT CACGAGCAGT TCGCTCGCAT CGAGCTCAGC    135720
     CTCTTCGGCT AGGCGCTCCA TTGAGAACCC GCGCTGACGG CGCATCAGAT TGATGAATCG    135780
     TCCGAAGGCG ATGCGAGCCT CCTCGCGCGG AGCCGACACG CCAGCGATAG GCCGATCGTC    135840
     CAGAACAGGA TCGCGCGCAG CAAGACCGGC GCCGATCACG TCGGCGCCTT CAAGCCGGGC    135900
     GCGGTCAAGC CACCATTGCT TGCTTCGCTC GATTCTCATC GACGTCACTC CTCGCCGAGA    135960
     AATGACCGCG CGCGTTCGGC GGTCATCTCG AAATATCTCA GGTTCTGATA GGCACCGTCG    136020
     GGACCGAGGT CCGACATACG ACACCGGTCA CGATAGAAGG CTTCAGATTG CGGCAGCGAA    136080
     TGGAGACCGA TCCGACCACG ATACCCCTCC TGCTCACTAA GCGCGATGGC GGCCGTGAGC    136140
     AGAGCCATGC CGACGCCTTT TAATTGCGGA CGCTGCTCGA GGTCGGGACG GTTCCAGGGC    136200
     GCGACCTCGA GATAGTCGAC GTAGACTAGA GGCTTGCCAG TCTGCGACGG CTCTCGGGCT    136260
     ACTTTTCGCA GATCGAGCAA CATTAAGCCT TGGGTCACTC CACCGCAGAC GATGCAAAAC    136320
     CCAGGGAACG CCAGGAAACC TTGAACGCGC GCCGTCTTTT CTCGCCAATC CCAATGCCAG    136380
     CTTTGCGGCC ATTGAGCCAT AGGGACGCCT TTGCGTCGCA ACTCCTGGAG TACCTTGATA    136440
     AGCGCCGGTT GCCACTGCGT TTGCCAGTCG CCGAGTTGAG CTTCCTCGAT GGCATCGCGC    136500
     AACTCCGCCT CGACGCCCTG CCCGCTCACG CCATCGAGCA GGTAAATGGT CGAGATCTCC    136560
     GTCACAGGAG CATCAGTTCC GCCTTCTCCT TCGTCGTGTC ATTCTCGAAA AGGAATTTCT    136620
     CTCCTCGTTC GAGCCTTGCC TCGACGGTCT GATAGAGGCG CAGAGCCTGG CGGATCACCG    136680
     CCGTCTTGGT GAGATCCTTG CGCGCCGACA ATTCGTCCAG CACGCGCATC TCGGCGTCGG    136740
     TGAGGTTCAG CGTCATCGTC TTCTTCGCTG TCATCTCGTC CTCCGTCATT GTGACAACAT    136800
     ATAGAGAATC AGTATGTTTT TGTCAACGTA AAATAGCTAG TGCGTAGCTA TTGAATAGCT    136860
     AATTTTTAGC TACTATATCA CTACCTCAAC GTGCCGCTGC CCTTGGGTCG CCGGCCAAGC    136920
     AGGAGTTGGG CATATGGGAC GGCAGCACGT CGGCCATAGC GAGATCGCCA CCTTCGCGCA    136980
     GGACAAAGTG AACCTGCCGA AGGTCAAGGC GGATGAGTAT CGGGCGCAGG CCCGCCGGCT    137040
     TCGTGAGAAG CTGGAAGGTT ATCTGGGTGA ACATCCGGAT TTCACGCTCA AGAAGATGAT    137100
     GCTCTCGGGC AGCCTGGCGA AGGGCACCGC GCTGCGTTCC CTCAACGACA TCGACGTCGC    137160
     CTGCTACGTC AGCGGCGCAG ACGCACCTAA GGATGTGCGG GCGCTGCTCG ATTATCTGGC    137220
     CGAGCGGCTT CGCAACGCCT TCCCTAACTT CAGCCCCGAC CAGGTGCAGC CGCAGACCTA    137280
     TTCCGTCACG GTCTCCTTCC GCGGGACCGG GCTCGACGTG GACGTGGTAC CGATCCTCTA    137340
     TGACGGCGAC CCGCAATGGT ACGGGAACCT TATCAGCCAG GATGATGGCT CGTTCTTGAA    137400
     AACGAGCATT CCGCTCCATC TGGACTTCGC CGCCAAGCGC AAGCGCGCCC AAGAGAAGCA    137460
     TTTCGCGCAG GTGGTTCGGC TCGCGAAGTT TTGGGCCCGA CGCATGAAGC AGGAGCGCGA    137520
     TGGCTTCCGC TTCAAATCTT TTATGATCGA GATGATTCTC GCCAAGCTCT GTGACGACGG    137580
     TCTGGATTTC TCCGACTACC CGGAGGCGCT CCAGCACTTC TTCACCTACA TCGCTCGGAC    137640
     CGATTTCCGG CAGCGCATCG TGTTCGGTGA CTATTACGCC GTTTCGTCGG TGGGCACGTT    137700
     TTCCGACACG GTGCAGATCA TCGATCCGGT GAACGCCGTT AACAACGTGG CGCGCCTCTA    137760
     CACCATGGCG AACGCAGACG CGATCGTCGA TGCCGCTATC GATGCCGGAG ACGCGGTCGA    137820
     CGCGGCGCTC GCCGCTCCCA ACAAGCAACT GACCGTCGCC TATTGGCAGA AGGTCTTTGG    137880
     CTCCTCCTTC CAGGCGTGAG GTCACTGCAT GTCCTACAGT TTGAGCTATA CCGAGAGTTC    137940
     GACCTTCACG GTCACCCACG CCCGGCACAT GGTAGCCAAG GTCGCGACCG ACCTCAAGCG    138000
     TATGCAGCGC TTCTACGGCA GCCCGTCCGA TGAGAGCATT ACGAACTACG AAGCCGAAGC    138060
     GACCGAGATG ATCAGAGCCG GCTACCTCGG CACGGTCACC TACGGCTTCA GGAAGGACGG    138120
     CAACTGGATC GAACCGACGC TGCGCTACAC CGCCCGAGAT CTTGCCGGTG CCTCGGCCAA    138180
     TGACGACGAT CCTGGCCGTA TCCGACCTGG GGCGGACATC AGCGGCGCGT CGTTCTACAG    138240
     CTATATGACC TACAGCGCCG CGTGGGACCA GCTGACCCAG ACGCAGCGGG ACGCATTCAA    138300
     GGCGACGCTT CCCTTCTCAC GCAATGGCGC CGCCGAGCCG GGCGTTTCCG GATATCTCGA    138360
     CAACGACCAC TCCTATTCGT CCGGCGGGCG AGCCCTCGAT CGCGCCTGTG TCAGGAGCTT    138420
     CTGATGAACA CCAAGCCCAC TTTGGATGAG CTCTTCGAAC GGCGCATCAC CTATCCCGAT    138480
     TTCGAACCGC AATCGCGGCT CGCAAGGCTG GTCGGTCTTG ACGATCAGAA GAGTCGCCTC    138540
     GCCAAAATCC TTGGCCTTCT CGTCAACCCC AGTGGGCTGG CGGAGTGGGC GCAGCGGCAT    138600
     CATCCTGGCA CCCAGGCGCT CCTTGATGCA GTTCTGCGGC GTCCGCCCCT GGTGGTGCTC    138660
     GCCGGCGATG TCGGATCGGG CAAGACCGAA CTCGCCGAGA CGATCGGCGA TGCGGTCGCG    138720
     CGGCAGGAGA AGATTGACAT TACCCTTCTG CCGCTGAGTC TCTCGACCCG CGGTCAAGGC    138780
     CGCGTCGGCG AGATGACGCA ACTCCTCTCA GCCGCGTTCG ACTACACGGT GGCCGAAGCG    138840
     TCCCGGCTGA AGTCCGCCTC CGGCAAGGCG CGTGGAGCAG TCATCCTTCT CGTGGATGAG    138900
     GCCGACGCGC TTGCCCAGTC ACGCGAGACG GCGCAGATGC ACCACGAAGA CAGGGCCGGC    138960
     GTGAATGCGT TCATCCGCGG CATTGACCGC ATCGCCAACG CCAAACTTCC CGCAGCAGTT    139020
     CTGATGTGCA CGAACCGCCT GAGCGCACTC GACCCCGCGG TGCGGCGGCG CGCGGCCGAT    139080
     GTGCTTAGTT TCGCCCGTCC CGGTGACGAG CAGCGACGTT TTGTCCTATC GAGCCGTCTC    139140
     GAACCTATCG GCCTCGGCCG TCACCATATC GACGCTCTCG TCATTGCCAC CGGGCCGCAG    139200
     CGCAGTGCTC GGGATTACGG CTTCACCTTC TCGGATCTGA CCCAACGGCT TCTGCCATCG    139260
     ATCGTCCTCG ACGCCTATCC TTCGCGGCCG GTTAATGGTG CGCGCGCGGT GGAGATCGCC    139320
     AAAGCCATGA CGCCGACACC TCCCTTCCGA GACGGCGAGC CAGTGGCGTG AGGAGAGGTC    139380
     GATGACCCAA GCGGTGACTG TCCGGCGCGA CGGCGATACC TTTCAGGCGC GAATCTTCTG    139440
     GCTGCACGCC GCTCGCCTGC TCGATCCCCA AAGCCCGGTC ACGCGGGTGG GCTTCGAGAC    139500
     CGGTCCGAAG AGCTTCGACG ACATCTGGGT CGAATACGAT CCGGCACGTA GCGCGCTCGA    139560
     TCAGTATGGC GACCCACTGC GGCGCGAGCA CATGCAGTGC AAATGGCACG TGACGCCGGA    139620
     CAGCTACGGC TATTCCCATC TCGTCGATCC TGAATTTATC AATGCCAATG CGCGCTCGCT    139680
     CTTGCAGCGG GCGCGCGAGG CGCAACTCGC CTACGCCCCC GCAGGGATCG GCGTCCGGTT    139740
     CAAATTGGTG ACGAATTGGC GCCTCGACCG CGCAGATCCT TTGCGCGAGA TGGTCGGCAA    139800
     TCGCTCCGGC GCAATGCGCC TCGACCGGCT CTACGGCTCG CTGACGGACA ACAGCAAGGC    139860
     GGGCGCGGTG CGCAAGGCTT GGCGCGAGCA TCTGGATATC GACGAAGAGG AGCTTCGGCT    139920
     CCTAGCGCGT ACACTCGCGT TCGGCGAGGC GACCGACACG CTCGACGCCC TGCGTGATCA    139980
     TCTCGACATC CTGTTCGGCT TGGTCGGGCT GCGCCGCATT CCCGCGAACC AGAGCGCGTT    140040
     TCCCTATGAC GACGTCGTCT TTCAGTGGAT GGCGCAGGGG CGCCTCAATT TCGATCGCGC    140100
     GGCCTTCCGA GCGATCTGCG CGCGCGAGGA CCTGCTCGGC CCAGCACAGA GCGCGCGGCG    140160
     CGTTTATGGC ATAAAATCCT TCGAGCACGC CTTCGATAGG CTTGAGGAAC GCTGTCACTC    140220
     GGTCCTCGAC CTTATCCCGG CCTTCGACGA ACGCTACATC CGCAGCGACA GTGATTGGGA    140280
     GACTATCCTC TATCCCGCGC TTCGGACCTT TCTGCTGGCG GCGGCCAAAG ATCCCCCTCG    140340
     CCTGCGGCTC GCGCTCGACG CTCATGTCAC CTTGGCCTTT GCCGCCGGTT CGATCATCAA    140400
     CATCAAGTCG GGCCGCCAGG TCGAACTGGA GCAGCGCAGC ACGAGCCGGC GCGTTTGGGC    140460
     TGCCGACGAT GCGATCTCCG ATCCAAGCTG GCCGCCCCTC ATCGCGGAGT CCATAGAGCT    140520
     CCGTCCGAAT CAGCCGGACC TCGCCGTCGC GCTCGGTCTG ACACATGACG TCTCGGCGGA    140580
     CGTGCGGCGG TACTGCGAAG CAAAGCTTCC CGACGTGGGG CGGTTACTGA TCCTGAAGCC    140640
     GAGCACCGGC TCCGGCGCCC AGGCCGTTGC GTGCGGGCGG CACGCGTTCG AGCTCGCTGA    140700
     CGGGGCGATC GACGCAGTCC GTTCTGCAAG GGCCGAGGGG ACACGACTTA CGCATCTGTT    140760
     CATCGCCGCA CCCAACGCCT TCACCTTCTT TCTCGGTCAG CGCCAGACGG CCCTCGGCTC    140820
     CGTCCGCCTG TACGAGTTCG ATTTCGATGG CGGACGAGGC CGTTCCTATG CGCCCGCACT    140880
     CACGTTGCCT TTAGCTCCTC CCACGAAAAA AGCGATTTAG CAGCTTCCCT AAGCTCACGC    140940
     CATCGGAAGG CATTGTACTG GACGTCGCTA TGACGCCCGC CGTCATCCGC GACGGGAAAA    141000
     TCAAGAGCCA CATGCTCTTC AATGCCGGCG TCCTGCTTCC GCTCGAAGAC GAGCTGGGGC    141060
     ATTCTACGAA CAAGCCCTCC ACACGTTGGT CCATGAATAC GCCCATGTCG AAGTGACGGA    141120
     ACGGTTCAAT GCGGCGGTTT CCGGTGTGCT GCTACAGAGC AAGCCGCCGA ACGCGGATGC    141180
     GCATTATTGA TGGGAGATCA TCAAGGCGTG TTGGGATGAA TATGCGGTGA CGCAGAGTCC    141240
     TGGATCTCGA TGCAGGCCTG GCTGCTCCAG TTGCGGCGAC GCGGAGTCAC GGTCTTGGTC    141300
     GTGCATCACG CCGGCCGCGG GGGCAATGCG CGCGGTACGT CCAAGCGGGA GGACGTGCTC    141360
     GACACGGTGA TCCAGCTCAA GCACCCGGAA GACTATGATC CCGCCGAAGG AGCGCGCTTC    141420
     GAGGTGCACC TGACAAAGGC GCGCGGGGTG TTCGGCGAGG ATGCCTTGGC CTTCGAGGCA    141480
     AAACTTGAGC TGGACGACGA AGGGGCGGCC CGGTGGGTCT GCACCGATCT CAAGAGCGAA    141540
     GATGCAGAGG AGGTGCAGAA GGTGCTGGAG CTGTCGGAAG CGGGTAAGAG CACCCGCGAG    141600
     ATCGGTAAAG AGCTTTCGAT GAGCAAGTCT AGGGTTGACC GGCTGTTGAA GAAGGCCAAG    141660
     CGCTCGAAGA AAGCCAAGCC GGCGGAAGCG AAACAATAGC GACCACTGTC CCGCTGTCCC    141720
     GCTCCCCTAG GGTGTGGGAC AGTGGGACAC CTCCGACGCC CAACAGTGCA GTACCAACTC    141780
     GATTTCTCAG AATTTCCTTG AATTACCGCA GCCGTTGAAG TCTATGAAAG ACCTATGTTT    141840
     TCTCAGAAAT CACAACAAAA AAAATAATGC CCTTTTATGG AGAGGGAAAG TTCGACCGCA    141900
     TTTACACCAG CGGTCCTTTC CGGCATCCGC TCGGGCGGGG GCAATATGAA CGCCGTCGAG    141960
     ATTGAAGAAG CCATATCGGC CCTGGCCGAG CGGCCGTTCG ACGGCGGCGA GTTCCCGTTC    142020
     GCTTTCCTGC AAGCCTTCGG CAATAAGGAA ACGACGATCA AGAAGCTGCG GGCAGGCGCG    142080
     TCGAATAGCT CCGACCTGGG CGGCGTCCTG CAACGGAACC ATATTCATAT CGCCGTCTGC    142140
     GCGCCGGGCG CGGTCACCAA GACCTTGGCA GCGCTGAAAG CCAGCCCGGC CACTGCGAAG    142200
     GCAAAGGCGC GTTTCACCCT CGCGACCGAC GGCGCAGACT TTGAGGCGGA GGAGTTGGAC    142260
     ACCGGCGAAA CCGTCGCCTG CGCCTATGCC GACTTCCCCG ATCATTTCGG TTTTTTCCTG    142320
     CCTCTCGCCG GCATCACCAC CGTCAAGCAG GTCCGCGAAA GCTCTTTCGA CATCCGCGCC    142380
     ACGAGCCGCA TGAACCGGCT CTATGTCGAG CTTCTGAAAG ACAACCCCGA TTGGGGCACC    142440
     GCCGCGCGCC GTCATGACAT GAACCATTTC ATGGTGCGGC TGATCTTCTG CTTCTTCGCC    142500
     GAACGCACCG ACATCTTCCA CGGTATCGGC CTGTTCACCG ACACCATCGC TCGGATGAGC    142560
     GCCAAGGACT CGTCGGACAC CCATAAGGTG ATCGGCGAAT TGTTCCTCTC CATGAACACC    142620
     AAGCGGGAGG ACCGAGCGAG CGTCGGCATT CCCCGATGGG CCGACGCCTT TCCCTACGTG    142680
     AATGGCGAAC TGTTCTCCGG TAGCGTGGAC ACGCCGCGAT TCAGCAAGAT CGCCCGCGCC    142740
     TATCTTCTCC ATATCGGCAG TCTCGACTGG ACGAAGATCA ATCCGGATAT CTTCGGGTCG    142800
     ATGATCCAGG CCGTCGCCGA GGACGAGGAA CGGGGCGCGC TCGGCATGCA CTACACGTCC    142860
     GTGCCGAACA TCCTGAAAGT CCTCAATCCG CTGTTTCTCG ACGATCTGCG CGCCCGGCTT    142920
     GCGGAAGCGG ACGACAATCC CCGCAAACTG CTGAACCTCC GCAATCGCAT GGCGAAAATC    142980
     AGGGTCTTCG ATCCGGCCTG CGGTTCCGGC AACTTCCTTG TCATCGCCTA CAAGGCCATG    143040
     CGGGAGATCG AGGCTGAGAT CAACAGGCGG CGCGGCGAGG CCGACCGGCG CACGGATATC    143100
     CCGCTCACCA ACTTTCGCGG CATCGAGTTA CGCGACTTCC CGGCCGAGGT TGCGCGCCTT    143160
     GCCCTCATCA TCGCCGAGTT TCAATGCGAT GTCCTCTATC GCGGGCAGAA GGAAGCCTTG    143220
     CAGGACTTCC TGCCGCTCGA CGCACAGAAC TGGATCACCT GCGGCAATGC TCTGCGGCTC    143280
     GACTGGCTGA GCATCTGCCC GCCGACCGGA ACGGGCGTGA AGCTACAAGC GGATGACCTG    143340
     TTCAGCACGC CGCTCGATCA GGCGCAGATC GATTTCGAGA ACCAAGGGGG CGAGACTTAC    143400
     ATTTGCGGCA ATCCTCAGTT CAAAGGAGCG CGAAAGCAAA GTCGGGATCA AAAAAATGAC    143460
     CTCTCGCTCC TGTTCCACGG AAATATCGAT TACAAGGACT GCGACTATGT AGTTGGCTGG    143520
     TTCATCAAAG CGTCAGAGTA TTCGACAACT TGCGGAGCCC CGTTTGCCTT CGTCGCCACG    143580
     AACTCGATTG CGCAAGGGGA ACAGGTCGCA CATCTGTGGT CGCGACTGTA CGCAAAGAAC    143640
     TTACATATTT TCTTTGCTCA TCGAACGTTC TTGTGGCGGA ATAATGCATC GAATAACGCC    143700
     GGTGTGCACT GTGTAATAGT CGGCGTGAGC AATAGAGCTT CCGGAGCGAA GTTCATTTAC    143760
     GAAGCTGATA CGGCTCGTGA AGTCAATTGT ATTGGGCCTT ACTTAATCCC TGGCGATGAA    143820
     ATCTTCGTCG AAGCCGCAGA CTCGCCGGTG TCGTCCGATT TGCCTCGTAT GATTAGCGGC    143880
     AATATGGCTC GTGATGGCGG CAATCTGATT TTGTCCCGGG ACGATACTGA GGCGCTGCTA    143940
     TCGGCCCATC CGCAAGCGGT CTCGCTCATC AAGAAGCTTG TCGGAACGAA AGAGATAAAT    144000
     CAGGGCAGCA AAAGATACTG TCTCTGGATA ACAGATAAGG ATGTTCAGCG AGCTAAGGAT    144060
     ATTCCTGAAG TCGCACGGCG AATTGAACAA GTGAAAAAAG AGCGAACCGC ATCTACTGCA    144120
     AAGACGACCC GCGGCTACGC GAACATCCCC CATAAATTTG CACAGAGATG TCACCGAGAC    144180
     GAGTCTTGCA TCGGTATTCC CAAAACGATC ACTGGAAACG ACGCATATTT GACGCCGGAT    144240
     GTATTCGGAT CAGATGCCGT CATTAGCGAC CTTGCCTTTG TAATATATCC TATGGACATG    144300
     GTTGCTTTTT CTATCATCTC AAGCTCTCTG CACCTCATCT GGTCAAAGAC GGTAGCAGGC    144360
     GGAATGCGAG ACGGGCTCAG ATACTCATCT CAGCTGGCCT ATCATACCTT TCCAATCCAC    144420
     AGGCTCACGG AAAAAAACAA GGCCGACCTC AGCCGCTGCG CCGAGAACAT CCTGCTGGCG    144480
     CGCGAGGCGA ATTTCCCCGC AACTATCGCC TACCTCTATG ACCCGGAGAA TTTGCCGGAC    144540
     GATCTGCGCG CGGCGCACGA GCGCAACGAC GAAGTGCTTG AGCGAATCTA TATTGGCCGT    144600
     CGTTTCCGCA ATGACACGGA GCGCTTGGAA AAACTGTTTG AGCTTTACAC CAAGATGATC    144660
     GCGTCGCCGG GAGCCGCGGC GAAGAAGAAA AAGACGGAGG TAAGCGCGTG ACCGACCACG    144720
     AGAAAACCGT CCCTTCCGTT TCGGTTTCCT ATGCCCGCAA CGGTTCATCG ACCAAGGCCA    144780
     ACGCGCTCGG CATGCGGCCG ATGCAGGAGC GTGCCTATGA GCGGCGCGGT GAGCAATATC    144840
     TTCTCATCAA GTCGCCGCCG GCATCTGGCA AGAGCCGGGC GCTCATGTTC ATTGCTCTCG    144900
     ACAAGCTCGC CAATCAGGGA TTGAAACAGG CCATCATCGT CGTGCCGGAA AAATCCATCG    144960
     GCGCGAGCTT CCATGACGAG CCGCTGACCA AGTTCGGTTT CTGGGCGGAC TGGACGGTTG    145020
     CGCCCAAATG GAATCTCTGC GACGCGCCCG GCTCCGACAA CGGCGGCAAG GTCAATTCTC    145080
     TCGGCGCGTT CCTCGACAGT GACGACAAGG TGCTGGTCTG CACCCATGCC ACCTTCCGCT    145140
     TCGCGGTGGA CAAGTTCGGC GTCGAGAAGT TCGACAGCCG GCTTATCGCG GTGGACGAGT    145200
     TCCATCACGT TTCGGCCGAC CCGGAGAGCA AGCTCGGCCA GCATCTCGGC GCGCTCATCG    145260
     TCCGCGACAA GGTGCATATC GTCGCCATGA CCGGCTCATA CTTCCGGGGC GATGCCGTGC    145320
     CGGTACTGGC CCCGCTGGAC GAGGCCAAGT TCGATACCGT TACCTATACC TACTACGAAC    145380
     AACTCAACGG CTACGAATAT CTCAAGCAAC TCGACATCGG CTATTTCTTC TATTCCGGTT    145440
     CCTATGCCGA CGACATACTG AGCGTCCTTG ACCCGAATGA GAAAACCATC ATCCACATCC    145500
     CAAGCGTCAA TTCGCGTGAG AGCACGAAGG ATAAGATTAG GGAGGTGGAA CACATCATCG    145560
     AGGCGTTGGG CGAGTGGCAA GGCATCGACC CCGCGACTGG GTTCCAGTTG GTCAAACAAC    145620
     GCGATGGCCG CGTCCTGCGC ATCGCTGATC TGGTCGACGA CGACCCTGCG AAGCGCGAAA    145680
     AAGTTTCGGC TGCACTTAAG GACCCCGCGC AGAAGCACAA TCGCGGCCAT GTGGATATCA    145740
     TCATCGCGCT CGGCATGGCC AAGGAGGGAT TCGACTGGGT TTGGTGCGAG CACGCGCTGA    145800
     CCGTCGGCTA TCGATCCAGC CTCACCGAGA TCGTGCAGAT CATCGGCCGC GCGACCCGGG    145860
     ACGCGCCGGG CAAAACCCGC GCCCGTTTCA CTAATCTGAT CGCCGAGCCG GACGCCTCCG    145920
     AAGAGGCCGT CACCGAGGCC GTCAACGATA CTCTGAAAGC CATTGCAGCC AGCCTTTTGA    145980
     TGGAACAGGT GCTCGCGCCA CGCTTCAACT TCACGCCGAA GAATCCCCAG AGCGGCCCGG    146040
     TTGACGGCTT CGACTATGGC GAAGACGGCT ACGATCCGAG CAAGGGTAAT GTGGGCTTCA    146100
     ATGAGCAGAC CGGGCAGTTC CATATCGAGA TCAAGGGCCT TGCCGAACCC AAGAGCAAGG    146160
     AGGGCGCGCG CATCTGCACC GAGGATCTGA ATGAGGTCAT CGCCGCCTTC GTGCAGGACA    146220
     AGACGGCCAT CGAGCGCGGG CTATTCGATG AGGAATTGAT TCCGGAGGAA CTGACCCAGG    146280
     TGCGCCTGGG GAAGATCATC AAGGACAAGT ATCCCGAACT GAACGAGGAA GATCAGGAGG    146340
     CCGTGCGCCA ACACGCCATC GCCGCCCTCA ACATCACGCA GAAGGCCAAG CAGATTGCGC    146400
     TTGGCGGCGA CGGGGCGGGG ACCGGCGGCG ATGACCAGCC GAGCGCCAAC ACTGCGCTGA    146460
     TCGACGGGGT GCGGAAATTC GCGATGGACG TTCGCGAACT CGATATCGAC CTGATCGACC    146520
     GGATCAATCC GTTCGGCGAA GCCTATGCCA TCCTCGCCAA GACCATGAGC GAGGATAGCC    146580
     TGAAACAGGT CGCCGCGGCC ATTGCCGCCA AGCGCACTAG CCTAACGCCG GAGGAAGCCA    146640
     AAGAGCTTGC CATCCGCGCA TCTCGCTTCA AGAGGGAGCG CGGTCGGCTG CCCTCCGTCG    146700
     ATGCCCAGGA CCCTTGGGAA CGACGCATGG CCGAGGGGGC CGTCGCGTTC ATGCGCTTCA    146760
     AGAAGGAGGG CCGCTATGAC GGATGACCTC GATCTTGACG AGCTGGCGGC GGACCTCGCC    146820
     GACTTCGCCC CGCAGGACAA GAAAGGCGGC CGTAGCGCAC GCGAGCAACG CATCATCGCG    146880
     GGCTTTGAGG AAGTCCAGCG TTTCGCCGAA GCCAACGGCC GAGCGCCAGC GCATGGCGAG    146940
     AGCAACGACA TATTCGAGCG GCTTTATGCC GTGCGCCTCG ACCGTCTGCG CGGGCTGGAA    147000
     GAATGCCGTT CGCTTCTCGC CCCACTCGAC AAGCAGGGCC TCTTGGCGGG CGTGGTGACG    147060
     CCTGCCACCG AGCCAGTCGA AACGATAGGT GACGATGAAT TGCTCGCCGA ACTGGAAGGC    147120
     ATGGGTGGCG CGTCCGACAT TACCGAGCTT CGCCATGTTC GCACCGCCGC CGACAAGCGC    147180
     GCGGCCGAGG AGATTGCAAA CCGCACGCCC TGCAAGGACT TCGACAACTT CAAGCCGCTG    147240
     TTCGTTCAGG TAAAGAAGGA CCTCGACGCC GGCATACGCC AGACACGGCG ATTCCAAACG    147300
     ATGGCCGAGA TCCAGCCCGG CGAATTTTTC ATAGTCGGCG GCCAGATCGC CTATGTCGCG    147360
     GAAGTCGGGG CGGAATTTGT GACAGAGTAC GACCGGCGCG ACAGCCGGTT GCGCGTGATC    147420
     TACGACAATG GCACCGAGAG CGACGTTCTA TTGCGCTCAT TGCAACGTGC CCTCCACCGC    147480
     GATGAGGCGG GCCGGCGCAT CACCGACCCC ACGGCAGGGC CGCTGTTTTC CGGCGAGAGC    147540
     GGAGACGGCG ACTTGGCCAG CGGCACGATC TATGTGCTGC GTAGCAAGTC AGACCATCCG    147600
     GCCGTCGCGG CCCACCGCGA TGTGCTGCAC AAGATCGGCG TCACCGGAGG CGACATTGCG    147660
     CGCCGTATTG CCGCCGCAAA GCACGACCCG ACGTTTCTCA TGGCCGACGT TGAGGTGATC    147720
     GCGACTTACG AGCTGTTCAA CGTCAACCGC ACACGCCTTG AGAACCTGAT CCACCGCGTT    147780
     TTCGACTTGG CGCGCCTCGA TATCGAAATC AAGGATCGCT TCGGACAGCC AGTGATTCCG    147840
     CGCGAATGGT TTCTCGTGCC GCTGTTTGTT GTCAACGAAG CGGTCGATCG GATCAGGGAC    147900
     GGAACGATCA CTGACTATCT GTACGATCCC AAAACAGCAG CGTTGGTGCG AGTAGATAAG    147960
     GCTAAGGGGG GCCGCCGTGA ACGAGATCAA TCACGAAAAA CGTAATCGTC TCACCAAGGC    148020
     GCGTACACCA AACAAAGCAG AGGAAGGCGG CGTGGCCGGT GCAGCCGTTC CGGGCGAGCG    148080
     CGAGAGGGAT TGGGCCCGAT TGCAGGAGCT GAAGCGCAAG CATCACCCGA CGAAGCGCTC    148140
     AACGCCGCCC CGCGAACGTG CAAAGGCTCG CCGCAAGCTG CTCAAACCAG GACGCGGAAA    148200
     GAAATAGTGC TGCATCTGCA ATCGACGGCG CGGAATTGAC GTAACAAACG CCGGCCAGTG    148260
     TACTGTCGAC ATCTAGATCA AGGCTGACGA GATGGTTGAT TCATTTGATG ACAAGGCATT    148320
     GATTGAAGCG TTCAACGGGC CGTTTCGAGC GTACCGAGAC GAGCCATGGG CAGTGGAATG    148380
     GAGGCAGAAA TACGTCGCCC ATGTCGAGCT AGTGAGGAAT GCCGACAAGG AGCAATGGCT    148440
     CGATCCCGCA TTCCAGCGCA GGCTCTGGGA TGAGAATCCG ATCTCCAACA TCGGGCCGGG    148500
     CACTTCGGTC ACGGTGGAAG GAGCATATTC CGACGTCGCG ATCTCGCTTG AGCTTCTTCA    148560
     GTTCCGGGAC GCACCGATCG GCAGCGATCT CGCCGAGCGC GGGAAGAGGC TCCAGGACAT    148620
     GTTCGACCAT GTCCTGGCCA AGGTTTATCC GGCTCACGCC AAGCGCCGGC CCAAGGCGCG    148680
     CCTGGTCCGG CTGATGGCCG CGATGTTTCC GCGCGACATG ACCTGTCTGA TGGATGCGCC    148740
     CAGAGTGTGG GCGACGCAGC GCCTGATCAT GGCGCCCCGG CTCGTCGGAG GATTCATCGC    148800
     GCAGCATCCG GCAGTCCGTC AGCGGATTCG TGACGCGATC GGGCCTGCAT CTGACATCGC    148860
     CGGCGAGGTC GACCAGTCGA TCTTCGCGTG GTTTCTCTGG AACAGATATT TGAACCGTCC    148920
     CGACGAAGGG GCGATCACGG TAGAGGCGGC GCAGCCGGAG GCAAGCGACA TACCGCCCTT    148980
     GTCGCTATTG CCGGTGAGCG CGCAACGGCG AAGCCTAGCC TGCATGAAGG GGGCGGTCGG    149040
     CGTGTTCGTG GCCGTTGTCC GGGAAGCGGA GAACGGGATT GCACGGGACG ACCTCGCCAG    149100
     CGTGATTCTG TCGGAAGCGC CGCAGCTCAA TACGAACAGT GCCGCCAACG TGATCTCGCA    149160
     GGCCACGGGC GGACTGGGAC TCATTCATCT CGTCGACGGG GCGTACCGGC CGACGCAGCG    149220
     CGGCCTTGAA CTGCTGTCCG CGAACGAACC GGCGGAAGTG CTGCGCGCGC CGCTGGTCGG    149280
     TCGTGTCTTC GGCATGGGGC ATCTGCTGCT TCAGCTGTCG CGCCACCCCG AGGGGATGGG    149340
     GGCGACTGAT GCGGCCAAAT GGCTGCAATC GCTGGTACCG ACCTGGACCA CGACGATGCC    149400
     GGGGTCGCAC ATCATCGCGT GGGCCAGAGT AACCGGTCTC GTGAGAGCCG AAACTGTTCA    149460
     GGGCATCAAC CGTCTCTATC TGACGGATGA CGGTCAGGAA TATGTATCCG CCCTGCCGCG    149520
     GGATTTCGAG GAGCGCTGGC GGATCGACGT CGCGGCCGAG GCACTGGACG ATGGAGCTCC    149580
     CGAGATCATC GCGGAAGAGG CGAGCTCGGG GGCGTCCTAT ACGGTTGAGG CCATTATAGA    149640
     TGAAGGCTGC TTCCTGGAGC GCGCGACGCT CGAACAGGCG ATCGACCTGC TGAAGACGAA    149700
     GAAGAACCTG GTTCTGCAGG GGCCTCCGGG AACGGGCAAA ACCTGGCTCG CCAAGCGCCT    149760
     GGGATACGCA CTGATCGGCG AGAAGGACCC TTCGCGACTG ATGGCGGTGC AGTTCCAGCC    149820
     CTCGCTGTCC TACGAGGATT TCGTCCGCGG CTACCGCCCG AACGGAACCA CCGGCCTGCA    149880
     ACTGGTCGAT GGCGCCTTCT TGGAAGCGGT TGCAGTGGCG AAGGCAGAGC CCGCGAGGCC    149940
     TTATGTTCTG GTGATCGAGG AGATCAATCG GGGTAACCCG GCGCAGATCT TCGGCGAGTT    150000
     GCTCACGCTG CTGGAAGCGG ACAAGCGCAG CGAGAGCGAG GCGCTCCGGC TGGCCTATCC    150060
     GATCTCGCAG ACAGAGCGGG TTCATGTGCC GCCGAATCTC TATGTCGTCG GGACGATGAA    150120
     TCTCGCCGAC CGTTCGCTGG CGCTGGTCGA TCTCGCGCTG CGGCGCCGCT TCGCATTCGT    150180
     GAATCTCAAT CCCAATTTCG GAGCTGCTTG GCAGCAATAC TGCAAGGCGC GAGGCGCTCC    150240
     GGATGAGCTG CTGCAGGCCA TAGGGCAGGC CATCGTCGCG TTGAACGAGG TCATTGCGGC    150300
     GGACCAGTCG CTCGGTGCTC AGTTCAGTGT CGGTCACAGC TTTCTCACGC CGGCTGAGAA    150360
     CATGGATGCC GCGCGATGGA AGACATGGAT CGGTAATGTG ATCCTGACTG AGATCAAACC    150420
     GCTGCTGCTG GAATATTGGT ACGACGCGAG GGCGAAGGCG GAGGATCATG TCAAGACACT    150480
     GCAGGCCTGC CTGTAGGGAG GGGTGCAGAT GTCCGATCAG GTCTGGCGCA GCCAAACAGG    150540
     CATTCCGATC CGGAACCTCT GGCTGTTGCT CGTCTATGCG TCCGGTCTCG CCGAGTTCGA    150600
     GAGCCAGTGC GGCGCAGGCA CGGATGATGA TATCGAGCTG GCCGATATTC TCGGCCGCCT    150660
     GCTGGTCAGG CTGGCCAAGC GGCGGCTGAG GACCAATCTG TCGCGTGGCT ATCAGCGCAG    150720
     GCAAGCCGTC ATTCCGCGGG TCAGGGGGCG CGTGGACTGG TTGCAGACGC TGTCCCGCCA    150780
     GCATCTGCAG CGCGGGCGCC TCGCATGCCG GTTCGAGGAA CTGTCGTTCG ATACGCCGCG    150840
     AAACCGGCTG GTGCGCTGCG CTTTGATTGC GATCGCCGGA CGGGTGCGGG ATCATGCCGT    150900
     CGCCGCCGAT TGCCGCCGGC TCGGTGACGA TCTCGGGCGG CTGGGCATTG CGGCGTCACG    150960
     GCCGACCCAG CAGGAGATGT CCGCAGACAC GATCGGAAGC CATCAATCCG AAGACCGCTT    151020
     CATGATCAGC GCGGCCAGGC TCGTGTTCGA AATGCTGCTG CCGAACGAAA CGCCTGGTGA    151080
     CATGAAACTG TCGCGGCTCA AGCGGGACGA GATCACCCTG CGAAAGATCT TCGAGAAGGC    151140
     GGTCACGGGG TTCTATCGGC ATCACTTGCG TGCCGCCGAT GGCTGGTCCG TGCGGGAGCA    151200
     GAATTATCAG AGCTGGCAGC TGGAGCCGGG CCGATCCGGC GATGTGGGTC TGTTGCCGGG    151260
     AATGAAGCCT GACATCATCC TGGACAGAAA GCAGGACCGC AGAATCGTCA TCGATACCAA    151320
     GTTCACCAGC ATTCTCGCGA AAGGCATCGC CGACAGGGAC AAGCTCAAGA GCGCCAACAT    151380
     CTATCAGATC TACGCCTATC TTCACTCCCA GCGGGGCCGC GGACGCCTGT GCGACAGGGC    151440
     GGAAGGCGTG CTGCTCTATC CCGCGCTCGA CCATGATGTG GATGAGACAT TCACCATCCA    151500
     GGGCCATGAT ATCAGGTTCG TCACAGTCGA TTTGGCTCTC AAGCCTTCCG AGATCTTGGA    151560
     TCGGCTCCAC TCGATCGCTC AGGATGGTGA CTGAGGGGCG TCAGAATCTG GCTCATCGAG    151620
     ATCGCATCCC GACGCAGCGG AATCCAGCGT GTCCGGCATA GTCGGTTTTA GTATGCACCG    151680
     ACGTGCCGCA AACTGTTTGT GGAATCGCAA GACGGTCTGC TGACAGGATA CCCGTCCGGC    151740
     GTGTAGTGTT TGATGGGGGC GACATGGCAA CGGACGAAGA AAAAGAGCAC GTCTTCCAGG    151800
     CGATCGAGCA GGCCGTTGAC ACCATCGTTT CGGAGGTCGT GGAGGGGCAT TATGAGGCGC    151860
     TCACTCAGGA GCCGCAGCTC ACCTCGAAGA TCGCGGGTGC GATCGAGCAC ACGATCAAAA    151920
     TGATGGATGT CGGAGACCTG AACGTCCAAG TAGAGGTGCG GGACTTCCCG GCTCAAGGCC    151980
     GCGGAGCGCT CGAAGGGAAG GTGGGTGCCG ATGTGTATAT TTCGGTGGCT GTTATCCCGG    152040
     AAGATCGGAA GGACGTAAGC AAGGGGATGC TCGCCCAGGC CAAGTGGGAC CACTCTGCAA    152100
     AGGACCCAAA GCTGCCGGAG CAGATCGGCA AGATGACGGA GCGCTCCAAG TCCTCATCGT    152160
     ACGTGTGGGT TTACGGTCCG AACGGCGTTA CCTGCTATCC TGCCGGCGAC TATCTCAATC    152220
     CGCACCCGAA AGGAAGCGGC GGCCAGTCGG TAGGCTCATT AATTGCCAAT GGCTTGCGAT    152280
     GCGAAGAGGG CGACCGGAGC ATTGGTCGAG ACCTCACTAA GCCGCTGATC ACGTCCCTGA    152340
     ATGAGATCAT GGAGGAGCTT GGTGTTCAGA CGGCGGTTTC CTTCACAATC CGAGAGGGCA    152400
     GCCGTAGGCG CCGCTTCTAT CGAAGAAGGC GTGGGAAGCG GGCATAATAA AATGGGCACC    152460
     ACCGTTGAAG CGCGGGGTAA TTCGCTTTTT GCTACTCGCA GAGACCCGGC ATGGGGCCCC    152520
     AAACTAGGTG GGGTACTTTG CCATAAAAAT TTCGAAGACG GTGGAGGGTG CGAGATGGCA    152580
     GCCAGCGCTT ACCTATTGCT TACCCGAGTG TTTTGCCGTC AAAGCGATAT TTCTAAAAAC    152640
     CCCTAGAAAT ACTGGCGCAC CCGACACGAT TCGAACGTGT GACCTTTGCC TTCGGAGGGA    152700
     CGAGTTCTTC AAAGGATTCC CCAGGCCCGA TATCGCCCTC TCCCGGTGGC CTCGCGCAAA    152760
     CCAAGCTCGG CCACAAGGTC CTGCGCGGCG CGCGGCGTGA TCTTCAGCTC CGCCGCGATC    152820
     ATGCCGGCCG AGACGATCGG CCGGGTGAGC ACATACTCTA GGAGCGCGGG CAACCGGGAG    152880
     GTTGAGCGAC GGCCATCAAG CTTGCGGGTC AGGAGAGTGC GGGCCATCAG CCAGCGGTCG    152940
     TGCTCTTTGA GCCCGGCCGC GGCGGCGGCC GCGATCGCCT CGAGCCCGAC GGCAAGGCGC    153000
     CCGGCGCTGT CGCGCGGTCG TCGCCGCTCG CGCGGAATGG CTTTGAGTCC GTCATGGAGG    153060
     CAGGCCAGGT GCGAGCGCGT CTTGCCGCGC TGGCGCAGCA CGCTAGCTGC GAGCAGACGT    153120
     CCGATCCAAG GGGTGTGCTG CAGCGGCTCG ATCGCGCTCC AGGCGTCGGC GGCGATCGCC    153180
     GCCGCCAGCG TCGGCGGCAG CGTGCGGGTC TGGTCGATGA CGGCGCGCCA GGCATCGAGG    153240
     CGTTCCTCTT CGTCCCAGTC GAGGTCGTAG ACCAGCGGGT GCCGCTCGGG CGGACGTCTG    153300
     GCCTGCGTCG CGATGTCGCC CGCAAGCGTT CGGTCGGCCT GCGCGATCGC GGCGTCGACG    153360
     GCTGCGAAGA CGTCGGCCAG TTGGTCGTCG GGTGGCGTCA GGCGAAGCGG TTCAGCTGTC    153420
     TCCGCCGCGC CATCCCCGTC CATGTCGAGC GCGTCGTCCC CTTCCTCTTC CCCGTCGCCA    153480
     CTCCCGTCTT CCCGGTCGCA CTGCCCTCCC CTGCCGAGCA GTCCCGCCAA GCCGGCGGCC    153540
     GACAGCGCCC AATCCGGCTT CGCCTCGGCG ATGCGCCGTC GCGTGCGCAG CACGGCGTGG    153600
     GCGCGGGTGA GCTCAAAGGT CGGGGCGCGG ACGTCCATGC CGGCGTCGTG GAGCACGAAA    153660
     TCGTCGAGGT GGACCAGCGC GCCCTCCAGC CACAGGCAGG CCGCGGCGTC GGTAAAATGA    153720
     GTGCGGGCGA TCCATCCTTC TCGGATCGGG CTCTTGGCGA GGCGCTCGTC GAGGCGCGCC    153780
     AAAGAATCCT CGGCGGCGGC GAGCGGTGTC GCTTTCCCTT GCCGATTGCA ACTGTGGATC    153840
     GTCATGTCCT TGCCGAGGTT TAGCCTGATT TCGGGGCTCG GATTTGTCCT TGCGATTTCG    153900
     ACCTGTCGCG TGAGGGATTT CACATGGCGG CATCGGGTTC TGGCTGCGGC TCCCGCAGCG    153960
     TGGCGATTGC GCGAGATGAT GCCTGGGCGC AAGCGAAGCG CCAAGTGCGC GAACTCGATC    154020
     GGATCCTTGA TGGGCAAGGT CCGCGGCAGG TGTCGATCGC GCGGGCGGCG GCTGAGCTCG    154080
     GACTCACGAC CCGGCATATC TACAATCTGC TCAAGCGCTA TGCGCCGGAT CGGCGGATCA    154140
     CAGTGTTGCT GCCGCGGCGG GACAGGCCGC GAGCCACGCG GCTGACGGCA CCCGTCGAGG    154200
     CGGTCATCGC AGAGGTTCTG CGCGAGCAGT GGCTGGTCAA GGAGGGGCCG GAATTGCGTC    154260
     CCTGCGTCGG CGAGATCCGG GCGCGGTGCT GTGAGGCCGG CGAGCGCCCG CCCTCTTATC    154320
     GCGCGGTTCA GCGGCGCATT CCGATGCTGT TCGAAGATCT CGCGATCGCC AAGGGCCGCT    154380
     CCGCCAACCC CAGCCATGCG CGGCGATTGA AGGCGCGACC CGGCTATATT TCGGCGAGGG    154440
     GTCTGCTCGA TGTTGGCCAG ATCGACCACA CGCCGGCCGA CATCCAGTTC GTCGAGGTGA    154500
     TCGACGGTGT CGGCGTCGTG GTCGGACGGC CCTATCTCAC TGTCGTAATC GATGTCTTCT    154560
     CGCGTGCCAT TCTCGGGTTC TGCCTGACCC TGGAAAAGCC GAGTTCACTC TCGGTGGCGC    154620
     TTTGCCTGCA ACAGGCGCTG ACGCCGAAGG CCCCATGGCT CGCGGCGCAT GGTCTTGGCG    154680
     AACACGACTG GCCGATGTCC GGCCGGCCAC GCGTTCTGGT GGTCGATCGC GCCAAGGAGT    154740
     TCAAGGGCCA TGCTTTTGCC CGCGGCTGCG ACGATTTCGG GATCACGATC CGCCCGCGGC    154800
     ACAAGGGGAA CGTTCATCAG GGCGGCGTGA TCGAGCGGCT GCTCGGCGCG CTCAATACGG    154860
     TGCTGCGGAC GCTGCCGGGC CAGACCGGCC GCTCGGTCAC GGAGCGCGAC CACTATCCCT    154920
     CGGAGGCCCG CGCCCGGCTC AGCTTCGCCG ATCTCGAACG CTGCGTCGCG CTCGCAGTGC    154980
     TCGAGCACAA CGCCAAACCG AACGAGAAGA CCTTGGACAT TCCCGATCAG GTCTGGCGCG    155040
     CCCATGCCGC TGGCTTGCCG CCGCATCAAG ACGACCCCGA CCAGGTGCTG ATCGCCTTTC    155100
     TTCCCGGCGG CGATCGGCGG CTCACGCCTC AAGGCGTCAG CGTGAATGCG ATCGACTATT    155160
     ATGCCCCATG GCTGGGCGAA CTCGTGCCGC GGCGCGACCG GGTCGGCAAA CTCGCGATGC    155220
     GCACCGATCC GCGCGATCTG AGCCATATCT ATCTGCGCCA TCCCGACACC GGAGCCTTCC    155280
     TGGCCGTTGA GCGGCGCGAT GGCCGTACAG ACGCAGTTAC GCTGTGGGAG CATGAGCACG    155340
     CTCGCGCGAT CAGGCGCGCG CTCGGCGGTG GACCTGAATC CCGGATCGCG CTCCGGCGCG    155400
     CGCTCCGGGC GATCGCGGAT GGCGCGATGC GCCCGGCCGT CGAACCTGAC ACGCCAAAAC    155460
     CGGGCAAGCA CGCGAGACGA CAGGCGGCGC GGACGGCGCT TGCGCATGCC GCACCGAAAC    155520
     CGCATCAGGC GCTGGCCTCA CAACCGGCGC GTTTTCCTGA CCACCCCGTG CGTGCGCGAA    155580
     ATCCACTGCC GGTCGAGGAC TGGTGAGCCA TGGGCGAGCA TTTGACCGAG AGCTTGCGAC    155640
     CCTGGCTTCA AAAACCCGCC TCCGAGCGCA TCGCCCATCT GCAGGCCCCA CGCTGGATCG    155700
     GCACGCAAGC GGCGCGGGAC GCAATCGACC TGCTGCAGGC AGGCCTCGAT CGTGCGCCAG    155760
     CATTGCGCAC GCGCGGGGTG ATGCTGATCG GGCCCTACGC CAACGGCAAG AGCATGATCG    155820
     CCGAACGCTT CGCGATCATG GATCGCCGCC GCGCGGATGC CGCGCGAAAC CCGCGACGCG    155880
     TCGTGCTGGT CCAGACGCGC GAGGGCTCTG GCCTGGTCAA TTTCTACGCG GGCATCCTGG    155940
     CCGCGCTGGA AGCGCCGCAG ATCAAGGCGC GCGACACCTC GGCAAAAGCC GATCAGCTCG    156000
     ACCGTCTGCT TCGACAGTTG AAGCCCCGCG TGATGATCTT TGACGAATTC CACAATTGCC    156060
     TGAGGGGCCG CCGCCGCGAC ATCGAGGCGA TTTTCGCGGT GCTGCGGCGG TTCGGGCGGG    156120
     ACTATGATCT CTCGCCAGCG CTGGTCGGCG AGTTGTCGAT CTTTGACCAC GTCATGCTGA    156180
     CGGCCGAGAT GGCGAGCCGG TTCCAGCTCG CGCCGGTGCC GCGCTGGAGT TATGACGAGG    156240
     CCTATCTCTC GCTGCTCGAC AGTCTCGAGG CGGCGCTGCC GCTGGCGCAG GCCTCCGGGC    156300
     TTTCCGACGC GCCGACCGCA AAGCTGATCT TCGAGCTCTC GGATGGTCTG ATCGGCGAGA    156360
     CCGTGGCGAT CGTCACGACG GCGGCGATCG CCGCGGTGCG ATCCGGGGCC GAGCGTATCA    156420
     GTCGCGAATG CCTGCGTGAT CTCGGCTACA TCCCGCTGTC GCGACGGCGC CAGTCATTGG    156480
     CCCGCGAGGT GCTGGCATGA GACCGGCTGC CGTCGAGATC GAGATCACGC TGCAGCCGCG    156540
     CTATCGGTCA CCGTCATCGC GACGTTGGCC CGTGATGGTC GCGCCGCGCC CCGACGAATG    156600
     GCTGCCGGGC TGGCTGATCC GGTTTGGCGC GGCCAACGGC GTCCCGGCGC ACGCACTTGG    156660
     AGCGCTGCTG GGGCTGGAAA GCGGCAACTG GGCGCGGAAC ATCGAATGCG GGATGTCGCC    156720
     GGCGATCGCC TGCGACCTCG AGACGGCAAG CGGGCTGTCG GCCGCCATGT TGCCGACGCT    156780
     TGTCCTTCCG AGGACAGACC ACATCCTGAT GCTCGCGCCG CGCGTGAACG TCTCATCGTC    156840
     AGCCGTGGGC CGGCGCCAGG CGACGTGGCT GCAGCTTTGC CCGCGATGCC TCGAAGAGGA    156900
     CGAGGCGCCC TATCTTCGCA GCCACTGGCG GCTCGCGACC AGGCTGATCT GCCAACATCA    156960
     TGGCCGGCAG CTGATCGACC GTTGCCCAGC CTGCCGCCAG GGTTTTGCGG TCTGCGAAGC    157020
     AGCCTCGCTG AGCCCGTTCA TCACCTGCAC GACCTGCGGC CAGGATCTGC GCGCGGCGGC    157080
     TGGCCCTCAG CTGGGCACGT CGACCTTGCG CATCGCGCTG GCGCTCGAGC GCGCCAGCCG    157140
     GATCGCAGGC TTCCACCATC GGTCCAAAAT CCTGGCGCTG CCGCTGGAGC TCGATCCGCC    157200
     CCTCTCCCGG CCGTTGACGC AGCTTTCAGG GATGGTGCGA GCCCGCTGCT TGAGCTTTGC    157260
     CAGGCCGCGC ATTTTGGCGC TGGCCAAGAC GCCTTCGCCA CTGCCGCCCG TTTCGCCGCG    157320
     AACGACTATG CATGACCTGC TGACAGCCTA TGCGGCGGTC GCGATCCGGC CCCATGCTCA    157380
     GTCGGCGGGC AAGCGATCGG GCGCGCCGAA AACCTGATCG CGCGAGTCGT CATCCGAGTC    157440
     GTCGCCGTCG GCGAGAGCGT CGTCGAGCGG ATCGACCAGC GCGATGTCTT GTGCGAGATC    157500
     GAGCAGCCCG GCCTCCTGCA TCGCCTCGAT CTCGGGCAGG TCGCGCAGGC TGGCTAGTCC    157560
     GAACACCGAC AGGAATGTCG GCGTGGTGAC ATAGGAAAAC GGCGCGCCGG GCTCGGCCAT    157620
     GCGCGGCCCG GCGCCGATCA GATCGAGGCG TTTGAGCTTG GCGATGATGT CGCGGCTGAT    157680
     CGCCTTGCCG AGCAGCCGCG AGATGCTCGA CCGGGTCACC GGCTGCAGAT AGGCGATCGC    157740
     GCTGATCACC AGGCTTTCGG TTTTGGACAG ATCGGGCGGG CCGGTCTCGC GTCCGCCAAG    157800
     CACAGCGCGG ATGGCCTCGG TGAACCGCGC CTTCGAGCGG TGCTGGAACC CGCCGGCGAC    157860
     AAAGACAAGC TCATAGGGGC GCGGCTTCAG TTCGTCGCGA ATGTCGGCGA TGAGCTCGTC    157920
     GAGCACGCAA GCCCGCCCGA TGAGGCGGGC CAGCGTCTCG CGCGGCACCG GGGTCGGCGA    157980
     GGCAAAGATC GCCGCCTCGA CCCGGCCCAT CCATTCGCGC CAGCGCAGCT CCGCTGGCAG    158040
     ATCGGCCAAT TCGGCATCGA ACCCATCAGC GGTCGCTCGC TTGGCCATGG CTCAGCCGGC    158100
     CCCGTCACAC GATCGGCCCG AGCGGTGCGG TTTTGAGGCG CCGGGCATGG TCACAGCCCG    158160
     TACAGCCGAA ACGTCGGCCG GTCGGTCAGA CGTTTCAAAA CCCCCTGGGA GGCAAGCGTT    158220
     TCGCAAAAGC GCCGCGCCGC CCGGTCGGAT CCCAGGCCGG CCCGGCCGAC CATCCGCCAG    158280
     GGCGCAATCG CATCGTCGGC CAGCACCAGC GCCAGGCCTC GACCCTGATC GCGCGTGCGC    158340
     AGGCGCCTGG CCGCCACGGC CAGCGCCGCG GCGCGCCGGG CCAGCGTCAC GGCCTCGGCG    158400
     TGACATGCGC TCACGGCAAA AAGCAGCACT TGGTCGCAGA CCGCCGACCA GTCCGGCCGG    158460
     TCGGCGCGCG GCCGGCGGCC CTCCGGGCCA GGCCGCAGCG CCGGCTCGAG CACGATGCCG    158520
     GCATGGAGCA GCAGCGGCGT TGTCCAGCCG AGTTTTTGGG CGAGCGCCAG ATCGGCTTCG    158580
     AGCAAGGACA CCAGTTCGGC GGCGACGGGC GCGCCGCGCA GTTCGGCCTC GAGCATTGGC    158640
     AAAACCTCGC CGGCGTGTCG GGTCGGCCGC GACGCGAACT GACGCAGCAG CCGGTGCAGG    158700
     CGACCGGCGG GCCCCGGATC GTCGCCGGAA CGGGTCAAAT GTTCGGCGTC GCGCAAGGCG    158760
     GCCGCGTCGG CCTTGAGGCG CAGCAGCCGG GCGGCGACGC TGGTCGCCTT GAGCGCCAGG    158820
     CGGGCGCGCA GGACGCCGAG CCAGGGCGCC TGGGTGCGGA CGATCTGGTC GAGCGACAAC    158880
     AGCGCCGCGC CGGCCGCGAA GGCCGCGTCG CGGGCGCCAC CGCCGGCGCT TGGACCGGCG    158940
     CCATACCCCA CCCAGCGCGG AAGCGGCTGT GGAATCAGAG TGCTGGCGAC GACGTCTCGA    159000
     TCGTCGCCGG GGTTTGCCAC GCGCGTCCGG CGCCGCCGAT CGGGGGGTGG AATCACTGCC    159060
     GCGTCCATCG TCGCAGCCTA GCCACAACGG CGCTAATGGC GCAAGATCGA CTGTTTTCCG    159120
     CCGCTGCCGT CAGAGCCAAT CCATATCCGA TAAGCTTGCC TTATCGGACA CGATTCGATA    159180
     CCCTGGCAAA ATGGCCGCTG CACCCGAATT CGAACCGCAA AACCAGCCCT CCAGCCCACC    159240
     GGAAGACCGT GCGGCGCGCG CGCCGGCGCG GCGTGCGACG CCGCAGCTGT CGGGTTTTGA    159300
     TGGCAGCGGC GGCACCCCGC TGCCGAGCCC GGAACTCGAA CGACTGGCCG GCTCGGCGCG    159360
     CGGCTACGCC AAAGCGAAAG ACAGCGCCCA CACCACCCGC GCCTATGCCT CGGACTGGAG    159420
     ACAATTCGAA CGCTGGTGTC GGCGCCAGGG TTTTGAGGCC CGCCATCCCG ACCCGCGCGT    159480
     GGTCGGGCTG TTCATCGCCG CCTCGGCCGC CGGCACGGGC ATCGCAAAGG CCGCCGTTTC    159540
     GACGATCGAA CGCCGCCTGG CGGCGGTCAC CACGACCTAT CGCAGCGCTG GAACGCCCCT    159600
     CCCCCGCCAG GATCGCCATA TCGTCGACGT CATGGCCGGC ATCCGTCGCA GCCACGGCCG    159660
     GCCGCCGTGC CAGAAGGAGG CGCTGTTCGC CGAGGACATT TTGGCGATGA TCGCGATGCT    159720
     GGAGCAGAAT CTGCGCGGCT GGCGGGATCG CGCCATCCTG CTGATCGGAT TTGCCGGCGG    159780
     CCTCCGCCGG TCCGAGATCA CCGGGCTCGA TTGCGGTCCG AAGCAGAGCG ATGACAGCCG    159840
     CGGCTGGATT GAAATCCTCG ATGGCGGCGT CGTCCTCACC ATTGATGGCA AGACCGGCTG    159900
     GCGCACCGTC GAGATCGCCC GTGGCTCGTC GGACCGCAGC TGCCCGGTCC AGGCGCTCGA    159960
     GACCTGGCTG AAGCTCGGCC GCATCGTCGA CGGTCCGGTG TTCCGGCCGG TAACGCTGGC    160020
     GAATGGCGGC ATGCAATCCG GGCGTCTCAG CGATCGCCAC GTGGCGCGCC TGGTCCAGAA    160080
     GCTGGCCCTG GCCGCCGGCG TTCGCGGCGA TTTGCCGGAG GGCGAACGGG CGCTCGCCTT    160140
     CGCCGGCCAT TCACTGCGCG CCGGCCTCGC CTCCTCCGCC GCGGTCGACG AAGCCCATAT    160200
     CCAGCGCCAA CTCGGCCACG CCTCGGCCGA GATGACAAGG CGTTACCAGC GGCGGCGTGA    160260
     TCGGTTCCGC GTCAATCTGA CGAAAGCCGC TGGCCTGTGA GCGGACAGCG CAACGGGATC    160320
     AAGGGTTCGG AGCGCCCGGA CCTGAAACCG AAAGGGGACT GCAGGGCTTC CCCGCCCCCT    160380
     TAAGTCATTC AAGTTGAAAT CAGGAAGGAG AAGCGACAAG CGGGGCGGCG ATGGCGGTCC    160440
     AGGGCAGCGG GTCGGGGAGT TGGTAAGCGG ATGGCAAGAC TTTGATAACC TTAACGTGAA    160500
     TCCGTGAAAC GGAAGCTAAC ACCACTTTGT ATTCCGTTAT AGCGATGCGT GTTTTCGCAT    160560
     CCGTATCACT ATCGATAATT ACCCCTTATC GATAGGGTGG GACGTCACAA CGCAAATCAG    160620
     CGAGTCTGAC GGCCCGCAAG CCCGGCAAAT CGCACCGCCA GCGCTTCGCT TGACGAGAGG    160680
     ACCGCCGCTG CCAGTCCCCT GCCCTCTTCC GGACGCTTTT CGCCGCCGGC GGCGGCCGTC    160740
     ACTCGCTGCG CGGCACGCTC CGGTGCGGCG CGCTGATCGC AACCTCACCG CGGGCGATCG    160800
     CCACGAACCG CCGCTTCACC TCGCCGAACA GACCCGGTGT CAGCGCGCCG TAGTAGCCGC    160860
     TGTCGGTCTC GATGTTGCGC AGATCAGGGC CCGGCCAGAC AAAGCGATTG CTTTCCGTCA    160920
     GCACGATCCA GGAGCGCTCA TGGTCGAGCC GCAGGCGGTT CTTGACCGCG GCCGGAATTT    160980
     CGATCGCGTC GGCCGGATTG GCCGGCGGCG TATGGGTGAT CGGCAGCACG CGCACCACCG    161040
     GCGCGCCGTC TTCCGTTGTC ATGACAATCG CCAGCACCAG GCACGGGCGG TCCTTGTCGC    161100
     CCTCCTCGCG GCCTTCGCGG TGCTGCCAAT CCCACAGATA GGAATAGCGA AAGATCCAGC    161160
     CGAGCTTGAT CTCAGTCGGC AGCATGTTTG GCGTCGGGTG CGCTGCTGAG ATGGCCGGGA    161220
     TCAGGCGTCA TCTCGGCAGC CTCGACCGCG GCGATCTCCG CCTCGCTCAG ATCAATCGTG    161280
     CGCTGGACGC GTCGGTCCCG CTTCGACAGC CGAACGAAAT CCTCGTAGGC CATCAGCACC    161340
     GTGCGGGGCC GGCCGTTCTT GGTGATGACC ACCGGCTCGC GCACGGCGGC ATCCTGGTAG    161400
     GCGCCGAAGT TCTTCGAGAC CTCGGCGGCG GTGACGGTCG AACTCATGGT TCAAATCTCC    161460
     TTCGTTCCGT AATATATGGA AATCCCGGTA ATCCCGCAAG TGGTCCTCGG CGCTTGGAGA    161520
     ATGGGCCAGG AGGCAGTCGG TATTCATAGG AAGATGCCCC CATGACGGAC AATGGACGCT    161580
     CAGAGCCCTC TTCGAACATC TGGACCTTGG CAGATGCGGA GGTGCGGTTT TCAGAGATCA    161640
     TCGACCGGGC GCAGACCCGC CCGCAGGTCA TTACCCGACG CGGCCACCCG TGCGCGGTGC    161700
     TCGTCTCAGC CGAGGAATGG GCGCGCAGAA CAGCCCGCAA AGGCACGCTG GCAGATTTCC    161760
     TGCTGGCTTC GCCTTTGCGG CAGGACCCGA TGGATATCGA ACGAGTCCGT GATCGACCGC    161820
     GTGACATCGA ACTGTGAACG GCCTGCTCAC AACTGAAAGC ACACTCCGAT GACCGCCGCT    161880
     GCCCGCCTCC CCGATGCCGC CTCCTTCGAA ACAGTCCTCG CTGCGCTCGA TCCAGCCTCG    161940
     GCAGATAGCG ACCTGGTCCC GGCCCTCACC GCGGCGTTTC CGGCCGTTGC AGCCGCCGAC    162000
     GGAGCGGCTG CTCATGACGC CGGATGCTCC GGTCCATCTG CTGATCGACC GGATCGAGGC    162060
     GGTGGATCGC GAGGTCGGCC TGCCCTTCGG CTGGTTCTTC CATGATGACC CGCGGTCACT    162120
     GGGTCGACCC TGATGTTGGC CTGTCGATCG CGCAAGGCCT GAAGGCGCGG CGCGTCGTAC    162180
     TGCTGCGCTG GGCAGATCGA AGCTACGGCT TCTGACGGAG TGCCACCCAT GGACGACATC    162240
     ACCTCCCGCG CGCTGGTTTC CGATCCCGAA ACCCGGCGGG CATTGCAGCT CGACGCGCTG    162300
     TCCGCGATCC TGCCGATGGA GCGGCGCGAC CGGCTCGCCG AACTCCTGAC CGACGATGAC    162360
     GTCGCAACGC TGAAGCATCT TGCCCGGGAG GGCATGGGCG AAAACACCCT GCGGGCGCTG    162420
     GCCTCCGATC TGGCCTACCT TGAGGGTTGG GCGAAAGCCG CGACCGGCGC GCCGCTGCCG    162480
     TGGCCGGCGC CGGAAAGCCT GGCGCTGAAA TACGTGGCGC ATCACCTCTG GGATCCGGCC    162540
     GAGCGCGAAA CCGACCCGCA ACACGGGATG CCAGCCGAGG TCGCAGCGGA CATGCGGTCG    162600
     GCCTTGCTGC TCCGGACCGA TGGTCCGCAT GCGCCATCGA CTGTGAAGCG CCGGCTCGCG    162660
     AACTGGGGCA CACTGCATCG CTGGAAGGGG CAGGAGGGTC CGTTCCATTC GCCCAGTCTT    162720
     CGCACGGCGC TGAGGCTCGC GGTCCGCGCC AGCAGCAGGC CCCGGCAGCG CAAGAGCATG    162780
     CGGGCTGTCA CCCGCGACGT GCTCGACCGG CTGCTCGCCA CCTGCCGCTC CGATCGGCTC    162840
     GCCGACACCC GCGATCTGGC GATCCTGCTC CTGGCGTTCG CCTCCGGCGG GCGCCGGCGC    162900
     AGCGAAGTGG CGCGGCTGCG CGTCGAGCAG CTGAGCGATG AGCCGGATGT GGCGCTCAAT    162960
     CCCATGGATC CGAAATCGCC CAGAGTGCCG TGCGTGACGA TCCAGCTCGG CCGGACAAAA    163020
     ACCGCCGTCG CGGACGAGGC GGGCAGGGTG CTTCTGGTCG GGCCGCCGGT CGAAGCGCTG    163080
     CGCGAATGGC TTGAGCGCGC CGACATCGGC AAGGGTCCGA TCTTCCGCGC CATCGATCGC    163140
     TGGGAGGCGA TCGAGGAGCG GGCGCTGACG CCGCAGTCGA TCAATCTCAT CGTTAAGCGG    163200
     CGCTGCGTGA TGGCGGGTCT TGAGCCGCGG GAGTTTTCGG CGCACGGGCT GAGGTCGGGA    163260
     TATTTGACTG AGGCTGCTCG TCAGGGCGTG GCGCTGCCGG AGGCGATGCA GCAATCGCAG    163320
     CACCGGTCGG TCCAACAGGC GGCTACTACA ATGACGCCGA GCGTGTTCGT GGGCGCGCCG    163380
     TCCGCCTGGG GGTCTAGCCT GGGGCTCCTC GTTAAGTTGT CCATGTACAA CTCCGGCGAG    163440
     GACTGTTCAG TGGGCCGCGG GCCGCGGGGG AGGGGCGAAT CACTTAGTCG GTGCTAAGTT    163500
     GTCAGCGTAC AACTACGCCA CATCGGGGCT GATTCGGGCG TGCAGTACCG AAATATACCA    163560
     CATGCGAGCG CGGCACCGTT AACCTCTCGT TAACTCAATA ATCCTTGCGG CATCGAGAGA    163620
     ATCGGGCATT ACTCTCCATC AGCGCATTTT GAGGCAAACT GCTCAAAATT CCGCAGATGC    163680
     AGAGATTAGG ATGCCAACGT CAGCGAAGCC ACTCGACGAG AACGTGCGTG ACCTCCGCTC    163740
     CCTGATCAAT GCGGACGCAG CGGAGCTTTC GGCGCGACTC CGCGCCCAGC AGCTTCGCGA    163800
     TTTCCCGCCG GCGGCTGAGA AGACGATTCG TCGGTTTTCG TCGGCGGAAG CAGCGCGCTT    163860
     CATCGGCATA GCTGAAGGCT ATCTTCGGCA ATTGGTGTCC GAAGGAAAGG GCCCTTCAGC    163920
     ACCAGCGAAC AGCCGTCGGA GTTATTCGAT CGAAGACATC GATGCGTTAC GCCGCGACCT    163980
     CGACAGCGCT GGCAAAGGTG CTCGTCGCTA CGTTCCGCAC CGGCGCGACA CCGAGGCGCT    164040
     CCAGGTCATT TCGGTCATGA ATTTCAAGGG CGGCAGCGGC AAGACCACGA CCGCCGCCCA    164100
     CCTCGCGCAG TATCTCGCGT TTCGAGGCTA CCGCGTCCTG GCCATTGACC TCGATCCGCA    164160
     AGCAAGTCTG TCAACACTGT TCGGGCACCA GCCCGAACTC GATGTCGGCG ACAACGAGAC    164220
     AATCTTCGGT GCCATCCGCT ACGACAGCGA GCGCCGTCCA ATGCCGGAGA TCGTGCGCGC    164280
     CACCTACATT CCGAATCTCC ACATCGTTCC GGGTCAGCTC GAACTCATGG AATTCGAGCA    164340
     CGAGACACCC AAAGCTTTGA TGACGCGACA GAGCAACGAC TCGATGTTCT TCGCCAGAAT    164400
     CGGCGAAGCG CTGGCGCAGG TCAGCGACGT CTACGATGTC GTGGTGATCG ATTGCCCTCC    164460
     ACAACTAGGC TTCCTCACCC TGTCTGCACT CTGCGCCGCG ACAGCAGTTT TGATTACCGT    164520
     CCATCCTCAG ATGCTCGACG TGATGTCGAT GTCGCAATTC CTGAACATGA CCGGAAGTCT    164580
     GCTTGATGTC GTCGCCGAGG CCGGAGGCGC GACCCAATAC GATTGGATGC GCTATCTCGT    164640
     CACCCGTTAT GAGCCTAGTG ACGGCCCACA AACGACCATG GTTGGTCTCA TGCGTTCCAT    164700
     CTTCGGCTCA CGCGTGCTGA CCCACCCGAT GGTAAAGAGC ACCGCCATCG CAGATGCCGG    164760
     GCTCACAAAG CAGACCCTGT ACGAGGTCGA ACGACAGCAG TTTACGCGCG GCACGTACGA    164820
     CCGCGCCATC GAAGCCTTGG ATCTCGTGAA CGGAGAAATC GAAAGCCTCA TCAAGCAGGT    164880
     CTGGAAGAGG AATTAGCCAT GGCACGCAAG ATCAACTTCG ATCTTCCAAC GACGGCGGAG    164940
     CAGACACCGC ACGAAGCGCC GCCCGTTTCG CCTGCCAATC GCGTTCGGCC GTTGTTGGGA    165000
     CTTGATCGCC CGATCAAGCA ATCGAGCGCG CTTGGCGCAA TATCGCAATC GCTTGGTGGC    165060
     ATCTCGGAGA AAGTCAAACG GGCGGAAGAG ATCGAACAAA AGCTCATCGA AGGCCAGGTG    165120
     ATTGTTGAAC TCGACCCGGC GCTCATTGAC AATTCTTTCA TCCCTGACCG CATGGAAGCC    165180
     CCTGAGGAGC AGAACGCGGC CTTCCGCGAG CTAATTCGAG AGCACGGACA AAACGTCCCG    165240
     ATTCTCGTTC GGCCAAAGCC GAGCGATACA GAGCGCTACG AGGTGGCCTT CGGTCACCGC    165300
     CGCCTGCGGG CCGCCCGAGA TCTCGGCATC AAAGTGCGCG CGGTGGTGCG CACGCTCACT    165360
     GATGAGCAAT TGGTCGTCGC GCAGGGCCAG GAGAACAGCG GGCGCACCGA CCTGACTTTC    165420
     ATTGAGCGTG CGCGCTTCGC TGCGAAACTC GAAGATCGGA AGTTTTCGCG CGAGATCATT    165480
     ATGGCATCGC TTAACGTCGA CAAAGCCGCT CTCTCGCGGC TCATCTCGAT CGCGACCCGA    165540
     GTGCCAGCTG CCGTTATCGA AGCGATTGGA CCGGCACCGG CCTTCGGCCG GGTGCGCTGG    165600
     CAGGACCTAA CGGATCTGCT GGAGCACGAA GACAATCGCA CTCGTGCGAT CGACATGGTC    165660
     AAGGCCCCAA GCTTTTGCGC CCTGGAAACG GATAAACGCT TTGAGACACT GGCGGCCGGG    165720
     CTGCGCGAGA AGACGTCGCG CGCTCGCGCT GAAACGTGGG CGGCCAAGGA TGGAACGCCT    165780
     GCTGCCAAGG TCTCGCGTGC CGGCAAGAAG CTTACGCTGA TATTTGACGA TCGCGTCGCT    165840
     CCTAAGTTCG GCGACTTTGT CAGAAAGCGG CTTCAGACGC TCTACGACGA ATTCAAAGCG    165900
     GGCGATCCGC CAGCATAACC CAGCTTGCCT GGTCGGAATG AGCCGACCGG ATCAAGACAC    165960
     CGCAACCAAG TCGGAGAACT ATAGGCAAAA GAAAAGGCCC CCGAAACGTC ACCGTCCCGG    166020
     AAGCCCCTCT GTTGTGTTTG GCGACTGACA GAGAATCACT TTCGCAAATC GCAGTCAAGT    166080
     GTCTCGTGAG AGACGGCGTC GTTTTGACGA GCAGATTTTC TTTGCCCTAA CTGAGGCAAA    166140
     GACATGCAGT CACACTCTCC AACGACGCCC TTTGGGCGGC GATCGCTGAC GCTTGCCCAT    166200
     GTGGCAAGCC AGATGGTGGC AACGACGCGA CCTCCTGAGA AGGTCGTGCA CAAATGGAAG    166260
     ATCTTCCACG CCATCTGCAC GGCGCGGCCG CGTCTTGGCG TCTCCGAGCG TTCGCTTTCA    166320
     GTCCTGAACG CGCTCCTGAC GTTTCACCCG GAGACCGCGC TCACTGGTGA AGACGATCTG    166380
     ATCGTCTTTC CGTCGAACCA CCAGTTATCG CTGCGGGCGC ATGGGATGCC GGCTTCGACG    166440
     CTGCGGCGTC ACCTTGCGGT TCTCGTCGAT GCCGGGCTTG TCGTCCGGCG CGATAGTCCG    166500
     AACGGCAAGC GCTATGCTCG TAAGGGTACC GCCGGCGAGA TCGAGCTCGC CTTCGGCTTC    166560
     GACATATCGC CACTGGTTGT GCGATCCGAA GAGTTCGAGA GCCTGGCGGC CGACATCGAG    166620
     GCGGAAGCGC GGACGCTCAA ACTTGTCCGC GAGCGGATCA CCCTTTGCCG GCGTGACATT    166680
     GCCAAGATGA TCGCCACCGG CATCGAGGAA GGTGTCCCGA CGCGCAGGGG AGGGCAGGGG    166740
     CCGGCCGACT GGCAGGAAGT TCACGTCGCT TTCCGCTCGA TCGTCGACCA GATTCCACGC    166800
     ACAGCGACCA GGCAAGAACT TGAGCCGGTC GCTGACGAGC TGTCACAGCT TGCGGATGAC    166860
     GTGCTCAATC TTCTGGAAAC ACATATCAAA TCTACGAATC CAAGCGCCAA TGAGTCCCAT    166920
     ACTGAGCGCC ACATACAGAA TTCAAATACA GACTCCCTTA TTGATTTTGA ACCTAGCCTT    166980
     CACGAAGGCA GGGCGGCGAG GACTGAGCCA AAACCTCAAG CTCCGAGAGT GGCGGAAGGG    167040
     AGCTATCCGT TGGGAATGGT GCTGAACGCT TGCCCCGACA TCATCGACTA CGCCAAGGGC    167100
     GGGATTTCGA GCTTGCGGGA TTTGCTCGCC ACCGCCGCGG TGGTTCGATC GATGCTGGGG    167160
     ATCAGTCCGA GCGCCTGGGA GGACGCGCAA ACGATCTTAG GCGAAACGCC GGCCGCGATT    167220
     GTCGTCGCGT GCATCCTGCA GCGCGGCGCC GCGATCAGAT CCGCCGGCGG CTACCTGCGC    167280
     GGGTTGACGC GGAAAGCGGA GGCCGGAGAA TTCTCGCTCG GCCCGATTTT GATGTCGCAG    167340
     ATCAATTCGC GTCTCAACGA AAAGCGCCGG GCGTGACGCG ATGACGGCCT CACCTCCAGA    167400
     TCCTCGCTTT GCCCTGCGTT CTCGAGCTTG GACTATGGGC GCACCTGACT GCGAACGGGT    167460
     GATCGAGCGA CCCGAGGGCC GCGGAAAACT GAAACTGCGC GGCCGTTCCA CACTGCGTGG    167520
     TCTCGCCGCC TACGAAAAAA CGCTGACTGG GAATCGCCAA GCCAATCGTA CCCGTCAGTG    167580
     CACGTCCGAG CTTCCGAAAT GTCCGCCTGC GGGAGGTGCG CAAAAACCCG CGATAACAGG    167640
     GCATTGCCGT GCTTGTTTCT CGCGTCGACC AAAGAGCTGG GTCGGGCAGC GATCGCAGGT    167700
     CTTTCCGTCT GGGCTGTCGC TTCCGGTTGC ATGGCTGGAT ACCTATGGCC GTCGACGGCA    167760
     CGTCGGCCCC TGGATGCCAA GAATTTTCCC CTGCCGGACA CCCCGCAAGC GGGGACCCCG    167820
     ACCGGCATTC CTCGCGCATG CGCCTCCGGC GCCAAAATTC GTGGCTCCGG CCGGGGCGCA    167880
     GCGCTGCGCT TGCCCTCTGC CCGCCTCTGG CGGGCTCCGG CTCTGTTTCG TCTTCCCGGC    167940
     CATTACGGAA AAGCCATCGC AACGGGGCAC AGCCCCACAA GATGGAGAAA GACAATGCGC    168000
     AATATCGCCG AATTCACCCT CATCGGTCGG GTCGGAACCA TCAAGCAGGT AGGCAAGACC    168060
     GTTCGCGTCA GCATCTGCGC CAACTACCCC TTCAAGGACG ACAAAGGTCA GTGGAAGGAC    168120
     GACGCGCACT GGAACGAGGT CACGATCTTC ACGAAGGCGA TCCAGTCCTA CGTCAACGAG    168180
     CATCTCAGCA AGGGCGACCT GGTCCATGTG CGCGGACGGC TTCGGCAGAA CAGCTTCGAA    168240
     CGCGATGGCC AGCGGGTCTA CACCGTCGAT CTTATCGCTC TGGAGCTCGG CCGGTTGGCG    168300
     CAGGCCAGCC AACGCGCCGC GGCATAGCGA ACAGCGGGGA GGCTTCGGCC TCCCCACCTT    168360
     GCTCCTCGTC GAACGGCTGA CGAGGTAGTT CCGCCGCGAG CGAGTCTTCG GACCGCTACG    168420
     AAGGAAGTTT TCGCGATCGG GTCTGCCGCG CGAGCCCGCG GTCGGCCCGA TTTTTCTTGC    168480
     CGATCGCCGA GACCAGCTCG TCGTAGTTGA CGCCGCTTTT CTTGAGCGCG CGGCGGGCAT    168540
     CTCCAACCTC AAAGCCGAGA AGCTCGAGTA CGCTCATATT CAGGCTCGAA GCGATCCGCT    168600
     CCATCGTCCT CAGCGTCGGA TTCCCGATGC CGCGCAGGAT CGTGTAGTAG GTGCCGCGCG    168660
     CCAGCCCCGT CTTCGGCAGG AAGGCTTCCA TGCCGCCGTT CTCGATCTCG AGCTGTTGCA    168720
     GCCGGATCGC CAACATCTCG TTCAGGATCG AATGATCGAC GGGCAGCGGT TTACGAACAG    168780
     GCGGCATCGT TGACTAGCTT TCGGATCCAT AGCGAGAACT ATGGGGACCC TACAGCAAGC    168840
     CCGAGGTCCA GTATATTGGA CGTTAGAAAC TTTAGCAGGC AAGTGCTTGA AACGACTCAC    168900
     CTTGCCGGTC GGTCTTCCCT GACCTCCGGG CGACGGTCGC CCGCCGTGTT TGCCGATCGA    168960
     CGAAGCAATC TCAGCGGGTC GATGCCGGCA CGCTCAGCAA TGAGTTCGAT GTAGTCCAGG    169020
     CTGGGATTGG CGGCCGTCGT CATCAGGTGG AAATAACTCG ATCGCGGTAT GCCCAAGTGT    169080
     TCGGCAAACT TCCGTCGGCT CAAACCTGAT TCCAACCGAA GGCCTTCCAA CCCGGCCTGG    169140
     AACGCCTGTC GCAGCGTGCT GCCTTGCGCT GTGTGAGCTG CCTTTCGGCG GCATTTCTTT    169200
     TCGCCCATCG CTCATTCCTC GCACTTCCCG ACGTTGATCG ATGCGTCCGC CCGACGGACG    169260
     AGCCTACACG TTGGACTGCT GGTTAACATT CAATATAATA GACGGATTCC AGGCAACCCT    169320
     GAGAGGTGTG TTCGGACAAA GAAAAACCCG GCAGAGCCGG GTCTCTCGAG AGGATGAACG    169380
     AGCTGGCGAC GCCAATAATG CCCCAATCGT ATGAACGCAT TTTAGCCCGC ACCATCCGAC    169440
     TTCAAGGAGA TCCGCGTTTT CACGCCACGG TCTTTGTTTG CCCGCGCGCG GACCGTCCCG    169500
     GCGCGCCCGA TCTGCCGCGT ATCACCCACG ACATCACCTT CGATCGCGTG ACGTTTCAAT    169560
     ATGAGGGCGG TGAGACACCT GTCCTCAACA ACCTCAGTCT GAAGTTCGAT GTCGGAAAGC    169620
     GCATCGCGAT CGTCGGACCT AGCGGCTCCG GCAAGAGCAC GCTGCTCAAT CTTATCCTGC    169680
     GCCTCCGCTT CCGTGGCGGT GGCCACAAGA AGTCGTATCG TATTGTCGAC TTCAAAGCAC    169740
     CAACGAGAGG ACGCGAATGG AGATGCTTGG TCAAATCCCG TAACGCCGTT TGGACGACGA    169800
     CCGCTATCGC TCAGCACCGT AAAGGTGCAG CGCGACGTCA GGGAATGTCC CCAGGGCAAG    169860
     CCGGTCACAA ATGGCACGTA TTCCGAAACA TATGCGAGGC GCGGACATCG CTGCCGGTTT    169920
     CTGACCGCGC GCTCGCGGTC CTCAATGCGC TGCTCTCATT TCATCCTGAC ACGGTGTTGA    169980
     CTGCCGGCGC CGCCGATCTC GTCGTATTCC CGTCAAATCG GCTTCTCAGC CTGCGCGCCC    170040
     ACGGAATGGC CGCTTCGACC TTGCGCCGCC ACCTTGCTGG GCTGGTCGAT AGCGGGCTCG    170100
     TTCTTAGGCG CGATAGCCCG AACGGCAAGC GCTATGCGCG CAAGGCGACT TCGGGCGATA    170160
     TTGAACAGGC CTTTGGCTTC GATCTCGGAC CGATCGTAGC CCGCGCCGAC GAATTCGCCG    170220
     CTCTGGCCGA GGCCGCGATC GCCAGACGCC AAGCCCTTAC CGTTCTTCGC GAGCGGATCA    170280
     CCTTGGCGCG GCGTGACATC GCCAAGATGA TTGCAACTGG CGTGGAGCAA CGCGGCGCCG    170340
     CCGATTGGGG ATCCCTTCAT CGAACCTTCC GCGACATCAT GGCCCGGCTT CCTCGCGCCC    170400
     CGACGTGCGA AGTCCTTGAA CCCATCGTCG TCGAACTGGC GATCCTGGCG GAAACGATCG    170460
     TCGGCGTCCT CGAGCGACAC CTTGATCCGA TCGAGTCCGG CCCTCCAAAC TTGCCCGCCG    170520
     ATCAGATTCC GAATTCAGCC CCTCAGAGGC CGAACTCATC CGAACCGGAC CCAAGACCAG    170580
     GCGCCCCGGA GACGGCCGAT GCCGACCGGC CCCAATCCGC CGGTGCAATC CCTATTCGCA    170640
     TGGTGGTCGA ACTCTGTCCC GATATCATCG ACTACGCGCG CGACGGAATT CGTACCTCTC    170700
     AGGACCTTAT TACGACGGCA TCAGCCGTGC GCCCCATGCT CGGCATCAGT CCCAGCGCCT    170760
     GGGAAGAGGC CTGCACGGCA ATGGGCGACG GACAAGCCAG CGTGGTGCTC GCCGCCATCC    170820
     TGCAACGCGG CGCAGCCATC AAGAGTCCAG GAGGCTATCT CAGAGTCCTG GCCCGTCGCG    170880
     CCGCAGCTGG GGAATTCTCG GTGTGGCCGA TGCTGATGGC ACTACGCCGG CAAGGGCGCG    170940
     CGGCCCGTGA CCGAGACTGC CTCCCGTCTT CCTTCCCGGA CGATTTTTCG CAAGGGTGAT    171000
     CCTGTTTGTC TCGCTGCCAT GATTTCGGCC CGCCGGGAGA CGTTGCTGTC AAGTTTCGCG    171060
     CGGAGGCGGC AGGCGGCCGA TTCGTTTCAG GTGGTCGTAG ACAATGCGGT CGATGATGCG    171120
     AAGCGGCTGT GTTCGCTCCT CGGCGGCCAT CTGACGCACC ACAAGGTCGA TCGCATCGGG    171180
     GAAGCGCAAC GCATAAGGCC GAGACGATGA TCGCTCGCCG TAGGCATCGA ATGGATTTCG    171240
     ACTGCGAGTG TTCTGAGGGC GCGGCTGCTT GCGCGCAGAC GCGCTATCGG CGTGGGCGGA    171300
     GTGTGCCGCT GGCGTGGTGA CCTGATCTTC ATACGCCGGC GTCACGACCA CCGGCTTGGC    171360
     CGCGAGAGCA TCGGGCGCCG CGGCGCTGAC CCTATGGGCG CGAAACGCGT CGCGGGGCAG    171420
     GGGAGGGCGA TCCGGCTTTT GTGCGGAGGC GGGATCTGTC ATGCGGCGCT ACCGCCCTGG    171480
     CCGGCGCCCT GGCTTGCCGC GAGCAATTCG CGCACGACCT GGTCGGCGTT GTAGCGCGCC    171540
     TTCCTGATCG ATTCGTCCTT GTCGCTCATC TGGTACAAGG TGCCATGTCC GCTTGTCATG    171600
     GTTCGATACG TGATGCGCCG GTACAACGCC TTGGCGCAGA CGGGAACCTT TTCCGCATCG    171660
     AGATAGGCGA CAACCTCCTT GAGGGGCCGC GTGTTGCGGT CGAGGCTGTC GTATTCGTTG    171720
     AACAGAACGC GATGCTGGCT CATCGGCAGC TTTGAAGTCG CCGCATGCTG TTCGAGATTG    171780
     CGGATCGTGC GCACGACCTG CGAAGCATCG AAGGTGTGCA CCTTGCAGGG CAAGACGACG    171840
     AGGTCGGCGC GGAGTGCCGA CTGAATCAAG ACGTCGCCAT AGTAGCCGGG TGTGTCGACA    171900
     ACGACGACAT CGTAGCCATC GAGCCGATCG ATCGTCTGGG CGAGGGCAGT TTCATCAGGT    171960
     GCGCGCACCA GGTCCACGCC CTGCGGGCTC AGGCCACGCG CGACCGACGA CGCATGCCAT    172020
     TGGTAGGAAG ACCCCTGCGG ATCGGCATCC ACGATGGCGG CGGAGTAACC GTGTTTGGCG    172080
     AACTCGCCCG CGAGAATGAT CGCGACGGTG GTCTTGCCGC TTCCGCCTTT CGGATTCGCT    172140
     ATGGCAAAGA TGCTCGGCAA CTGGGTTCCT CCAACGGGCA TGGGCGGAAT GACAACATAC    172200
     AACATAATGA ACATGCGGCA ATCCCGGATT GTGCCATTCC GGTAGTCCGC GCTTGCGTTC    172260
     TGGACGCGGT ACGTTGTTGC GGAGATGCGC GAATGCGCGT GTACGGCATG ACCGTGGTCT    172320
     TGGAATGCGA TGTTGCGAGG TTGCGGCATT CTGATTTTGC GGTGTTGCGG TTTTACCTGC    172380
     TTGCGGCATT CCGTTGGTGC GGCAATCGCG ACATGACGCA ACGCGGGATT GCCAAGTTGC    172440
     GGTATTGCCG CAATCAAGCG GAGCCTTGGA GGCGCGCTCC CGCGCCATAG GGTTTGAGAC    172500
     TCCATCGTGC TGAGCTTCTA ACATTCAATG TATTAGATAT TGGTTGACAA GATACCGGTT    172560
     TGTGGGCCAA ACCGGAAAAC GGCTGCTGGG CGCAGCCGGG AGGCGCTGAC GCGCGACGCC    172620
     GGCGTCCTGA GGGGACGCCC GGCGTATTCG GCTCCGGTCC GACGACCGGC GACCGTGCCA    172680
     ACGGGAGGGG GAGCCTCGAT GGTCCGCACT GTCAGAGCCC TGCGACGCAA GCCGAGGCTT    172740
     CGGACCGAGC TGTCCGACGC GGATGAGCAG CGTTTGCAGG AGGCCGTCGC ATTGTTCGGT    172800
     TTGCCGAAAG CCGAGGTGGT GCGGCGATTG ATCCGAGCGT CCGTTCAGGC GGGACCGGCC    172860
     TTGTCGGCCG ACAACACGCG CGCTGTGGTG GAGCTAGCGA GCCAAGTCCG GATGGTCGGC    172920
     CGCAATCTGG CGCAGGTGCT CAGAGCCATC CATCGCGGCC AGGCCGTGCG GATCGAGGAC    172980
     ACGGAACCGG TTTGGCGAGG TCTTCATGAA GTCGTCGCTG CGATCAATGA CGAGCTGACC    173040
     GAAATGACCG TGGCCTATGG CTCGAAGCTG CGTCGCGAGG CCAAGCTCGC GCTGCCGGCG    173100
     GAGATCTCGG GCGAGGAACT GACCTGAGCC GCGCAGCACA GATCGTCTGG TGGCTTGAGC    173160
     AGGTCGAGGC CGCGCGGCGG GCGGTCGCGG AGGCGCGGGC GGAACGTCGG CAGCCGCGTC    173220
     GGCCCGGCGT GCTGGACGAG GACGTCCGCG CGAGGCGAGC ACGGGTCGCG CCGCTTCCCA    173280
     ATACGCCGCC GGCACAAGAC ATCATTCGCG GCGCGACAAT CACGGGTGAG CGGGACGAGG    173340
     AACGGGCGCG CTCGATCGCG GCCGTGGGCG GGGGTGGCGG CGCGGGACCT GGGGCCGCGC    173400
     CACTGCGTGG CGCGCCGAGC CCGATCTCCG GAGGATTCGG TGCTAGCGGG GCCGCAACGA    173460
     GCTCGGCCGG GGCAGGGCAG GGCGGCCCCG TTGGCCGAGC TCGGCAACTC GCTGCCGGCT    173520
     ACCAGCCCGC TGTCATCAAG GTGGTGTCCT ATGCGCGCGG CGTCGCGCGC GCCACGGCGA    173580
     CCGGCCAATA TGTCCAGCGC GAAGATGTTC CGCTCGAGAC CCATGACGGG CGATTGTTGA    173640
     CGGACCGGGA AGCTGTGGCC GACGAGATCA AGGCCTGGTC TGCGGACTTT TCGAAGCGTG    173700
     CGGAGAGCCA AGACGTTGGC GCATTCCGTC TGAAGCTTGA AGGTGTGCCG GATACCGCCG    173760
     AAGGCCGAGC GACCTACGAG AAGGCGATCG CGGCTGCCTT CTCCGGACAT CGCTACGCTG    173820
     CTCGCGTCGA CGTCGACGAA AAGGGCGCGC TCGAGGCGCA CGTCGTCGCC GCGATGGCCG    173880
     GGAGCGGCAA GGAACGGTTT CGCATTCGAG AGGCCCAGGC CGCCGATCGG AATCATGACG    173940
     CCAGACCACG CCGTCTCGAT TCCGTTTCCG ATGCCGCTGT TCGCGCCAGG ATCGAAGCAG    174000
     CTTCGGGCAT TGACGGGAAA GCTGTGGTAA TCCGACCCGG GGCGACCAGC CATGGTCGAG    174060
     ACGGCGTCAG CTATAGGCTC AATAAGCTGA TCGAGAAGAG CGCAGCACTC GACGACCGCG    174120
     GCAAGAGCTT GTGCAACGTG GCAGATGCGC GGGTCACCGC CCGCGAATGG GGTCCGTCGC    174180
     TTCGGTCACA ATCCGCGCGC GATACGATGC ACTTGATCAT TTCGGCAAAG GCCGGAACGG    174240
     ATGTGGCCGC CTTGACCAAC GCGGCGCGTG CGTTCCTGCA CGACCGTTTT GCCGACCATA    174300
     AGTTCATGTT CGGCGTTCAC ACGGACAAGG AATCGGCCGG GCATATCCAC GCTCACGCCG    174360
     TCATTACCGT GAAGAACGAA TCCGGCCAGA AGATCCATCC CAATCGGGAT ACGTTCGCGG    174420
     AATGGCGCGA GGTGTATGCG CAACACGCTC AGGCACAAGG CTTGAAGATC GTCGCGACCT    174480
     CGGCGAAGGA GCGGGCTTCC TCGCAAAGCT ATGGTCCCAA GGACAAGGCG ATCGTCGAAG    174540
     CGGCGGATCG GCCGCGTGCC GCGCGCGAAG CCCGCGATCG CGCCTACGCC GCCGATCCCT    174600
     TCAATCAACG TCTCATCGAC AATGCGCGGC AGCGGATCCG GGTAGCGAGG ACCAATCCCA    174660
     TCCGCCTTCC CATGTCGGCG CCCGATCGCA AAGTCGTGAA CGAGAGCCTC CTCGCCTGGA    174720
     AGACTGTAGC TGCCGAGCAG CCTTCTAACG GCGCCGCAAA GGATATGCTC GAGCGCCTGT    174780
     TGATGGCGCA GACCGTTGGG GCCATCTTGC ATACGATCGG CAAGCGCGTG GAGTTTTTGA    174840
     CCAGGGAGAG CGAAATGCCA ATTACATCGG AGCAAATGCT CCAAGATCAG CGGCTCATGA    174900
     ACGATGCGGT TTCCCGGACC AGCGATCGCT TGGATGGAGA GACGAAGCAA CAATTTCGCC    174960
     AGACGTCGGC GCGCTACCTG GAAACGCTCG CCAATCGCAT TGATCTGCAG CGCATGCAGG    175020
     AACGTGGCGT ACAGCAGCTC AGCCGGGCGG ACGTCGAAGC CGTTGTTGGC GTGAACGCCG    175080
     ATCGGCTCAT CGAGCGCGCC CAAGAGATTC GGATCAAGGA AGAGCGCGAG GCGACGTCCG    175140
     CGGAACACCT CGCAACCAGT GCAATCGATG CCGAGCGGCG GCAGGAGGCG CGAGGGGGCA    175200
     TTGATCCTGC TTCACAGAAG GAGTTGAGGG CGGAAAGGGC CATTGTTGCC GGTTCGCAAC    175260
     AATCTGCGGC GCGAGAAGCG CGGGAGGCGG CCGCGGCCGT TGAAGCGGCG CGGGCTATCG    175320
     CTGAACATCC GGCGCAGCCA TTGCCAACAA GTCTGGTCCA GACGGATGCC CTGACGAAGC    175380
     TCCGTCTAGA GCAGGAAAAG ATCGTTAGCG AGCTCGAGGC TCAAAGGTCC GAGGCCCAAT    175440
     CGTCAAAGGG CCAGCGCTAC AGGTGACTAC CAAACCCGAC GCAGCCGTGA TCTTTGACGC    175500
     ACCTTGAGAG ATCATTGAGC ACCGCGTCGA CTTAATGCGA TGTCGGACCA GAGCTCTTTC    175560
     ATCGCAGGAT ATGAATGCAT TCATGACAAA CATGTCGATG ATACGTTAGC TCCTAAGTTT    175620
     CGGAGACTGA ATTTGGAGGT TAACCCAGGA TCTTTAAACG TAGGGCCATG GCGACAGCGT    175680
     GTGCCTTGTT CCCGCGTTGA GTTTGTCACG CGCCGATGCG ATGTGCTTCG TCACAGTAGA    175740
     CGGAGAAATT CCGAGAATGA CAGATATCTC CCAATCGGTC TTACCTTCCC CCGCCCAAAG    175800
     CAGACAATCC AGCTCGCGGG GTGTGACCAA CTTGTTGCCC CTCGATCTTG GGCGGCGCAG    175860
     CCTAACCAAC GTCCGATAAC AAAGTTCGCG ATACAGTCGG ATGCGCAACA ATTTGTTTTT    175920
     CCGCCCGTCT AAAATGATGA GTTTCGAGTA TAGTCTGGCT GCTCGTGGAG CAAGAGAAGG    175980
     GCGTTGCACG TGGTTGGTTC CGCATAGAAG TTCTTTCTCG CTCCAACCGG GACGCTTGCA    176040
     ATCCAAGTCC GTCAGCCAAA TGACGCCGGC GTTTGCCGGG ACAAAGGGGA CTAGGCTGCT    176100
     GACTAGCGAT CGCGCAAACT GGTCGTGAGG CAAGAAATCG CTTGGGAGAA TCTAAATCCC    176160
     GCCGACAACA TTGTAATAGC GCTCGGAAAT CAACTTTGCT AATGCCAGCC TATGGAGCGC    176220
     CAGATCGGCC AAAAAGAATT GCCTAGACCA CGAGCGCCGC GTCTCCGTCG GATGCTGCTG    176280
     CTGTTTGTCG CCTTTGCATA TCTTTTCGTC GGTCTGGCTC ACACCGTTTC CTGCACCGAT    176340
     GAGACGGTCA CCTCTTTGAT CTCCATGGGA GGTGCCTTTG GAAATGTTTC GGACGAGGGT    176400
     AGTTCGAAGA AATCGCCATT AGTCGCTCAG CATTGCTATG TTTGCGCGCC AGTTTTGATG    176460
     CCTGCGCTCA TCCCGATGGC GGTGCCGTCT GCCCGGAGTG TTAAGGTTGC TTTGATTGTG    176520
     CCGAAGGTTT TGCGCGCGAC TCAGCCTTGG GCCGATACCC CACCTCCCAA ATACCTGACC    176580
     TGAAAATCGT CGCCGGGGCG CTCTGCGCCT TGAATTGTCG TTTTCAAGGT TATTGTCATG    176640
     TTCTCCAAAC GTGCTGCGGC GCGCCTTATG TGCGTGTCGC TGATCCTAAT CGGTCCGCCG    176700
     TCGGCCGTTG CTTGGGCGGC ATCGCGACCC ATGACGCTCC AGCATGCGTT ACAGCAAGCG    176760
     CTCGCGGCCA ATCCGCGTCT CACCGCGTCC GAACGAGACG TCGGCATCGC GACCGGGCAG    176820
     CGGATCCAGG CCGGCGCGCT GATCAACCCC GACCTGTCTT ACGAACAGGA CAATTCGCTC    176880
     GGCTCGGGAT CCTACCGCGG CACGCGGTCG GCCGAGATGA CCCTGCAGAT CAGCCAGTTG    176940
     TTCGAGCTGT TCGGCAAACG CGATGCGCGC ATTGCGGCGG GGGCGGCCGG AGTCAACGTC    177000
     GCCGTCATCC AGCGCAAGGC CGTTCGACTG GAGGTCCTGT CGGAAACGGC GGTGGCCTTC    177060
     CTGACGGTGC TCGGCGCGCA ACGGCGTGTC CAGATTTTGG ACGATCAGGT TGCCGCCATC    177120
     GACCGTCTGA CGCCCTTGCT GCAACGGCGC GTCGAGGCCG GCGCGTCGTC GCCGGCTGAA    177180
     ACAGGGCGGG CTCAGGTCGC CTCCGATCTC GTCAAGGCCG ACCGTGAACG CGTCAAAGCT    177240
     TCGCTGTCGA GTGCGCGGCG CGACCTTGCG GTGCTCATGG GCGATACCTC TCCGCGATTT    177300
     TCGACCGTGA CGGGGCGTCT CGAAACGGTC GGGCGTCCGC CAACGTTTAA AGCCGTCATT    177360
     GCCGCCATCG ATGCAAATCC CCAATTGGTA CGGTGGACGG CGGTCTATGC GCAGCGGAAT    177420
     GCCGAATTGC TGCTGGCTCG GCTCAAGCCC TATCCCGACG TGCGGGTGAG CGCGGGCTGG    177480
     CGGCACTTCA ATGAAACCGG CGACGATGCT GTGCGGCTGG GAATCTCCAT TCCGATCCCG    177540
     GTATTCGACC AGAACCAGGG CAACATCCTC TCCGCACAGG AAAGCTTGGC AAAAGCCGCC    177600
     GCCGAAAGAG CGGCGAACAA GGCCACGCTC GTTGTGCTGG CGGGGCGGGC CTATGACTCT    177660
     CTGGAAGGAT CGCTGCGCGA GCTTGCGATT CTCAGGGAGT CTGCGATCCC GAAGGCACAA    177720
     GCGGCGGCGC AGGCGATCTT CGACGGCTAC GGCCAGGGAC GGTTCACGCT GCTTGAAGTC    177780
     CTCGATGCGC AAGCCACGCT CGCCCAGGCT CGGCTGCGCG AACAGGAAGC GTTGCAGAAT    177840
     TTCCATATCG CCGTGGCGAC GATCGAAGGT CTCGTCGGCA ACCCGTTTTC GCTTACCCAT    177900
     CAGAGTTCAA GATGATCAAG GCAACTCTCC GCTACTCCAT ATTCATACTG GTTGCCGTCG    177960
     CGCTGGCCTA CGGCGGCTAT CGCATGCTGA TGCCGGCAAG CTCAAAAGTC ACACCCACCG    178020
     AGAAATCGGA CAAGGACGAG CATTCAGACA GCGTCATCCT GAGCGATGCC AAAGTGGAGG    178080
     CTTCAAGGAT CGAGCTTGCG ACAGCCTCAT CCGGCGTGCT GCGCGAAAGC CTTTTCCTCA    178140
     ACGGCATCGT CCAACCGAAT CAGGAATCGC TGGTCCAGGT TACGCCGCGG TTCCCGGGGA    178200
     TCGTCCGCGA CGTTCGCAAG CGGATCGGCA ATGCCGTCCA GAAGGGTGAT GTCCTTGCAG    178260
     TCATCGAAAG CAACCAGAGC CTGACCCAGT ACGAATTAAA GGCCTCGCTG GCCGGAACGG    178320
     TGATCGACCG CCAGATCACG TTGGGCGAGT ACGCCTCCGA ACAGAAGCCC GCTTTCTTGG    178380
     TCGCGGATCT GTCGACGGTG TGGGTCGATT TTTCGGTCTA TCGGCGCGAT CTCAAGCGGG    178440
     TCAGCGTCGG TGACCAAGTG TTTATCGACC CAGCGGACGG CGGCGCGCCA ATCGATGCGA    178500
     AAATTTCCTA TCTCTCCCCG GTTGGCAGCA GTGACACCCA GAGCGCGATC GCCAGGGCAG    178560
     TGGTTCCGAA TACCGGACAA CGGCTTCGCC CGGGCCTGTT CGTCACCGGT CGTTTGATGC    178620
     TCACCGCGAA AAAGGTCGGC GTCGCGGTGA AATCGTCGGC GTTGCAGACC GTGGAAAACC    178680
     GCACGGTCGT CTTCGTTCGC AACGGCGAAA AGTTCGAGGC ACGAAACGTT GAGATCGGTG    178740
     AACGCGATCC GCAGCTCGTC GAGATCACCG TCGGCATCCT GGAAGGCGAC GTCTATGCGG    178800
     CCAAAAACAG CTTCATCGTG AAGGCTGAGA TGACGAAAGG AGCGGGCGGC GATGAACACT    178860
     GAGAACGGCA TGATTTTGAT CACCGCGTTA ATCAGACCTC ACATGGAGGG CCACATGGTC    178920
     CGCGCCCTTC ATGATCTCAC GGATTTTCCG GGTTTTACCT TCGACGAGGT GCGCGGCCAG    178980
     GGCCGCGGCC GGGGACAGGG TGGGTCATAT GTCGCGAGCG ATGAGGATAT CACCTACCAC    179040
     CAGTTTCTGG AACTGAGGCT TGTCTGCCAG TCGGATCAGG CGGTGTCGAT CTGCGAACGC    179100
     ATTGCAGCGG CCGCCTGGAC CGGTCGGAAA GGCGATGGCG TAATCTACAC AACGCCCGTG    179160
     CATTCGTTCG GACGCATCCG GGAGATCGGC GGGCATCAGG AGCGGCCTCA TGATTGATGG    179220
     AATTTTGTCA TTCGCCATCC GGCAGCGTTG GCTGGTCATG ATAGGCGTGC TGGCGATGGC    179280
     GGCCTTCGGC GCCTGGAATT TCACCCGGCT GCCGATCGAC GCGGTGCCGG ACATCACCAA    179340
     CGTCCAGGTC CAGATCAACA GCAGCGCGCC TGGTTATTCG CCGCTGGAGG TCGAGCAGCG    179400
     GATCACGTTT CCGATCGAGA CCGCAATGGG TGGGCTGCCG CATCTCGACA GCACGCGCTC    179460
     ACAGTCACGT TACGGCTTGA GCCAGGTCAC GATCATCTTC AAGGATGGGA CCGACATCTA    179520
     TTTCGCCAGG CAATTGGTCA ACGAGCGCAT CCAGCAGGTC AAGGATCAAC TGCCCGCCGG    179580
     CGTCGAGACC GCGATGGGGC CGATCTCGAC GGGACTCGGC GAGATCTATT TATTCACGGT    179640
     CGAAGCGAAG CCCGGCGCCC GCAAGGAGGG CGGCGGCGAT TATACGCCGA GCGACCTGCG    179700
     AACGATCCAG GACTGGATCA TCAAGCCGCA GTTGCGCAAC GTCCCGGGGG TCATCGAGGT    179760
     CAACACGATC GGGGGCTTCG AGAAGCAATT CCATGTGCTG CCGGACCCGG CGCAACTGAT    179820
     GGCCTACAAG CTCAGCTTCC GCGACGTGAT GACGGCGCTG GCGTCGAACA ACGCCAATGT    179880
     GGGTGCAGGC TATATCGAGC GAAATGGCGA GCAATATCTT GTTCGGACAC CGGGCCAGGT    179940
     GGCGAACGTC GAGGACATCA AGGAAATTGT CATCGGCTCT CACAATGGCG TTCCGGTTCG    180000
     GATCGGAGAC GTTGCCGAGG TGAGGGAGGG CAAGGATTTG CGAACCGGCG CGGCCACGGT    180060
     CAATGGCAAG GAAACCGTTC TCGGAACCGT CATGCTGCTG ATCGGCGAGA ACAGTCGCGC    180120
     CGTTGCGCAG CGGGTTGCTG CCAAACTCAA GGAGATCGGC CGATCGCTGC CGGATGGCGT    180180
     GATCGCACGC GCGGTATATG ACCGGACGCA CCTCGTCGAG GCGACAGTTG CGACCGTGGA    180240
     GAAAAACCTG GTCGAAGGTG CGCTGCTCGT CATCGTGATC CTCTTCATGA TCCTGGGAAA    180300
     TTTCAAAGCG GCGATCGCGA CCGCATGCGT GATTCCTCTC GCCATGCTGT TCACGATCAC    180360
     AGGCATGGTG GAGAACAAGG TCAGCGCCAA CCTGATGAGC CTCGGCGCCA TTGACTTCGG    180420
     CATCATCATC GACGGTGCAG TCATCATCGT CGAGAACTGC CTGCGGCTGC TGGCGGAAGA    180480
     ACAGCATCGG CAGGGCCGAT TGCTCAATCG TCAGGAACGG TTCGAGACCA TTCTTGCCGG    180540
     GTCTAGGGAG GTGATCGGTC CCAGTTTGTT TGGAACCTTG ATCATCGGCG TGGTCTACCT    180600
     GCCCATCCTC ACGCTGACTG GCGTCGAAGG CAAGATGTTC ACGCCGATGG CCTTGACGGT    180660
     CCTGATGGCG CTCACCGGCG CCAGCATCCT GTCGCTCACC TTCGTGCCGG CTGCGGTCGC    180720
     CCTCTTGGTG ACCGGAAAGG TCTCCGAACA CGAAAACGTT TTCATGCGCG GCGCGCGAAA    180780
     GCTCTACACG CCGTTGCTGG CCGCCTCAAT CCGTAACCGT TTCGGTGTCG CCGCCATCGC    180840
     CGCGTTGCTG GTCGTCGTCT GCGGCATTGC CGCGACGCGC ATGGGCGGTG AATTCATTCC    180900
     CAGCCTCGAC GAGGGGGATG TCGCGCTGCA GGCAATCCGG ATACCGGGAA CGAGCCTGAC    180960
     CCAGTCGCTG GAAATGCAGG CGATGCTCGA AAAGCGGCTG CTGAAGATCC CGGAGGTCAA    181020
     GGAGGCCTTC GCACGAACCG GCACCGCAGA AGTCGCGACC GATTTGATGC CACCGTCGAC    181080
     TTCGGATGGT TACGTAATGT TGAAGCCGCG CAAGGAATGG CCTGATCCGG AGAAGAGCAA    181140
     GGCCGCGGTG GTTCGCGAAA TCCAGGAAGC CGCCGAAGAA ATTCCGGGCA ACGTTTATGA    181200
     GATATCGCAG CCCATCGAGC AGCGTTTCAA CGAGCTGATC TCCGGTGTCC GCAGCGACGT    181260
     CGGAATCAAG ATTTTTGGCG ATGACCTCGA CACACTGGTC CAGTCGGCGG CGAAGGTGCA    181320
     AGCCGTGTTG CAGAACGTTG AAGGCGCAGC CGACGTCAAG ACCGAACAAG CCTCGGGCTT    181380
     GCCGGTATTG ACCGTGAAGC TCAATCGACA GGCCTTGTCG CGATACGGAA TCAATGTGTC    181440
     GGATGTCCAG AATTTGATCG AAATCGCTGT CGGGGGAAAA CCCTCCGGCC TTGTCTTTGA    181500
     GGGGGATCGG CGCTTCGACA TCGTGGTTAG GCTTCCGGAG CATTTGCGCT CTGACATGGA    181560
     AGCGATCCGA GCGCTGCCGG TGCCGTTGCC TCCGCTGGAG AACAACGCCA AGGCAACACC    181620
     AGCGGTCTGG AACAACTCGC CGCTTGCTCA GATCCGGTAT GTGCCACTTT CCGAACTTGC    181680
     CGAAATCGAC GTTGCGCTGG GTCCCAATCA GATCAGCCGC GAAAACGGCA AGCGGCGCAT    181740
     CGTGGTTACC GCCAACGTGC GCGGCCGTGA TCTCGGGTCA TTCGTTGCCG ACGCACAGAA    181800
     ACAGGTCGAG GAGAAAGTGA AACTGCCGGC CGGCTACTGG ATCGGGTGGG GCGGCCAATT    181860
     CGAACAGCTT GTTTCCGCCA CGCAACGATT GACGATCGTC GTGCCGATCG CGCTTTTGCT    181920
     GATCCTTTTG CTCCTGTTTA TGAGCCTGGG ATCAATGGCC GATGCGTTGC TGGTGTTCAG    181980
     TGGTGTGCCG CTCGCACTGA CGGGCGGCAT CGTGGCACTC CTGCTGCGCG GCATCCCATT    182040
     GTCGATCAGC GCTGGGATCG GCTTCATCGC GTTGTCCGGC GTAGCGGTGC TCAATGGTCT    182100
     GGTCATCATT ACCTTCATCG AGGGTCTGAG GCGAGAAGGA CATGCCCTTG TCGACGCGGT    182160
     CCGCGAAGGG GCGCTGACTC GGTTGCGGCC CGTGCTGATG ACGGCGCTGG TCGCCTCGCT    182220
     CGGCTTTGTG CCGATGGCGA TTGCTACCGG TGCGGGCGCC GAGGTGCAGC GGCCGCTGGC    182280
     GACCGTGGTG ATCGGCGGAA TCATCTCCTC AACGATCCTG ACATTGCTGG TGTTGCCCGC    182340
     CCTCTACGTC TTGTTCAGGC GGGAAGAGCC GGAAAATGGC GGCTCGAACT TGCCCACGGT    182400
     GGGAGGCGTA AACCCATGAG GTGTTTCACC GCGGGTGATC ATCGTCCCTG TTCTGAACGG    182460
     GGCTTAACGA TGACCAACAA CAAAGCTCCA GGCAGAAACG ACAGCCAGGA CGATGCGAAC    182520
     GCTCGTGCGA GTCCTGCGGG CGGTTCGTGG AGGCGAAGGC TTTTGGCCCT AGCGCTATCG    182580
     TCCGGTGCAT TGCTTGCGAT GGGTGGATGG CAGGTGCTGG AGGCGGAATC GCAGAAGGCC    182640
     AAGATCGTAG GTCTGGGCGC CGCGACGTGC CAACGCTTTA GCGATGACGT CAAAGCGAAT    182700
     CCGGTGCTCC GGAGAGATTA CCTCGCCTGG GCACAAGGCT TCCTGAGCGG AATCATACTC    182760
     AGCAGGCCGC CAGGTATGGA CGAGGGGCTC GAACCTCGCC CCGGCAACGT TCGATCTTGT    182820
     CGGCCAATTG CATTTCCTTG AGGACCATTG CGCCCGGAAT GCGGCGCTGG ATTTTTCCGA    182880
     TGCTGTCGAG GCGCTCTACC AGCGCCTGCG CAAGGAGGGT AGGACATGAG TTCGAACGAG    182940
     GGCGTTCGCA GCAATATCCT TGGGTGACGA TCATGAGCGA CTTTGCACAG CCCACGAAAA    183000
     TCCGGCTCCG TGTCGAGGGC ATGGACTGCG CCTCCTGCGC CACGAAGATC GAGAACGCCC    183060
     TGCAACGACT GCCCGGCGTC CAGGAAGTGT TCGTCTCCAT CCCCGCAGGC ACGGTGATCG    183120
     TCAGCCATGA CGGCAGCGAA GCCGACGACG GCATACGTCA GCGCGTTTCG GATCTGGGTT    183180
     ATCGCGTCGC GCAGGTCGAC GCGGCGGGAA GCAGCAATCA TCGACAGCAG CAAGCCGATG    183240
     ACGAAGCGTC CCACGCCGAG GATGGTCCCT CCCACCTTCA TGAACACACC TCCGGTGGGG    183300
     GACCGTGGTG GCGGACCCGC AAGGGCATCC TGACGATCGC TTCCGGGCTG GCATTGGCAG    183360
     TGGCCTACGT GCTTGGCAAG GCCGTGCCGA CGGAGCATTG GGCATTCCTG CTCGCGATGT    183420
     TGGTTGGTCT GGTTCCAATT GCGCGTCGCG CAGTCTCCGC CGCGCGTGTC GGCACGCCGT    183480
     TCTCGATCGA GATGCTGATG TCGGTTGCCG CGATCGGTGC GGTCGTTATC GGTGCAACCG    183540
     AAGAGGCCGC CACGGTGATC TTCTTGTTCC TGATCGGAGA ACTGCTCGAA GGCGTCGCCA    183600
     CCAGCCGTGC GCGCGCCAGC ATTCAGGACC TTACCAGACT TGTTCCGAAG ACCGCCCGGG    183660
     TCGAGGAGGA TGGGCAGGTA CGCGAAGTAC AGGCGGAAAC TCTTGCCGTC GGGGCGCTGA    183720
     TTCAAATCCG GCCCGGCGAT CGAATCCCCG CCGATGGCAT GATCGTTTCC GGACAAAGCG    183780
     CGATCGACGA AGCGCCCGTG ACGGGCGAGA GCACGCCGGT CCGGAAGAGG CCCGACGACA    183840
     CTCTGTTCGC CGGTACCGTC AACGGCGATG GGCTGCTGCG GGTGCGGGTG ACCGCCGCTG    183900
     CCGCGGACAA TACCATCGCG CGGGTCGTGC GCCTTGTCGA GGAAGCCCAA GAATCTAAGG    183960
     CGCCCACCGA ACGGTTCATC GACCGATTCT CGCGGATCTA CACGCCGGGT GTGGTCGCAG    184020
     TGGCAATACT GGTGGCTGTC GTGCCGCCGC TGCTGTTCGG TGGCGTTTGG AGCAACTGGA    184080
     TCTACAAGGG TCTGGCGATC TTGCTGATCG GCTGTCCCTG CGCCCTGGTC ATCTCGACGC    184140
     CCGCGGCGAT CGCCGCCAGC CTATCCGCAG GCGCGCGCCG GGGCCTGCTA CTGAAGGGTG    184200
     GTGCCGTTCT CGAACAAGTC GGCAAGGTGA CGATGGCTTG TTTCGACAAG ACCGGAACGT    184260
     TGACGGCTGG CAAGCCCCAG GTCACGGACG TCATCGGGCT CGCGCGCAGC GAGAACGACG    184320
     TACTGCGTTT TGCCGCCGCG CTCGAGGCCG GATCGAGCCA CCCATTGGCT ACCGCAATTC    184380
     TTGCTGAGGC GCACAAGCGC GACATTCCAA TTCCGGCGAC TTCGGAATCC GAGGCGGTCG    184440
     GCGGAAAGGG GATTCGCGCA AGGGTCGACG GACTCCACGT CTTTCTCGGA TCGCCGTCGG    184500
     CCGCAGCCGA AATCGTTTCC CTGAAACCCG ACGATGAGCT TCGCTTCGCG GGACTCAACG    184560
     ACGAAGGCAA AACGGTTTCG GTTCTGCTGA TCGGTCAGCT TTTGGCCGGG GCTATAGCGA    184620
     TGCGCGATGA ACCGCGTCCG GATGCCGAGA AAGGGCTGAG ACTGCTCAGC AAGGCGGGCA    184680
     TCAAAGCGGT CATGCTGACG GGCGACAATC TGCGGACAGC GACGGCGGTC GGCAAGCAAC    184740
     TCGGGATCGA TGTTCAGGCC GGGCTTTTGC CGCAGGACAA GCAGCGCATC GTCGCCCAAT    184800
     TCAGGAATAA GGGATGGACG GTCGCCAAGA TCGGCGACGG CATCAACGAC GCTCCTGCGC    184860
     TGGCGGCCGC GGACGTCGGC ATCGCCATGG GAGGCGGGAC CGACGTCGCG CTGGAGACCG    184920
     CCGACGCGGC GGTGCTTCAC GGTCGGGTCT CCGATATCGC GGCGATGGTC GATCTGTCCA    184980
     AACGAACCAT GGTCAACATC CGGCAGAATA TCGCAGTCGC GCTCGGCCTG AAGGCAGTCT    185040
     TCCTGGTTAC CACCATAGTC GGCCTGACAG GGTTGTGGCC GGCCATTCTT GCCGACACTG    185100
     GCGCGACGGT GCTGGTCACG CTCAACGCGC TGCGGCTGTT GGCGCCGTCC GGCGCCAACG    185160
     AGGCAGATGA AAAGTAACCC ACCAAAACAT TGGACAGTCT TCAAACCAAG GAGAACTCCA    185220
     TGGGCTTCGA CCAGTATCAC GAACCGCCGG GCGAGCTGTC GCGAGCTTGA GGGGATCCTC    185280
     TTCAGGGACG GCGACATCGT CGCGCTTGCG GAGAAAGCGG AGAAGAAGGC CGATTGAAGG    185340
     GAGGGAGGGC GTCGTGGAGG AGCTCCGACG GAAGAGGCGG AGCAGAGTGC TCAAGGCGGG    185400
     CACGATCTCG TTCGGCGGGG CCACGATATC CTGCGTCGTG CGCAATCTCA GCACGGTTGG    185460
     CGCGCTGCTC GATGTCGAAA GTCCGCTCGG CATTCCGAGA TGCTTCACGC TACTGGTCGC    185520
     CTCGGACTCG TTTGCGAAGG AGTGTCGCGT GATCTGGATC AAAGAAAAGC GAGTCGGTAT    185580
     CTCTTTTGAG CAGCCGAACG ACGGCGGTGT GCAGCATCGC GCGTCGGAAC CTGAATGACG    185640
     GCGACCGAGA CCGACCGCTC TCGGCGCGGC CGCGCGCAAG GAGGACACAG ATGTACGGGA    185700
     TCTGTAAGAA ATGGCTGCGA TCGATGACAG CAGGTGCGAT TTGCTTGCTT GCCGCATTGA    185760
     TCGACATGCA CGCCGTGGCT GCTGCGCGCG GTGGCTTGGC ATCGGAAAAT CCCCTGGCTG    185820
     CCGAACACGT CGATGCTTTG CCCACGGACA TCAGGCGCGC CGTCGCAATC CGGAAGCGCG    185880
     CTTGCGGCAA CAAAGCGGCC GCCGCGCATT ACTTTTCCGT TTCGATCGAA GCCGGAGGCC    185940
     GACGCTTCGT CTCGCTGCAT TTCGAGGATT TCGTCTGCGC GAATCGCGCC GCCGTCTGCG    186000
     TCGCCGATCG CTGCCTCCAC GAGGTGTACC TGGAATCGCA CGGTCGGTAC CGGATCGTCT    186060
     TCAGGACGCA CGCCAGCGAT TTGAAACTCA TCAACGCCGG CGCTGCCGGC ATCGAGGTGA    186120
     CTGACGGCAC CTCGCGACAA TTTTTCCGCT GGAACGGACG GCGGTTTGTG TCCGTCCGCA    186180
     CGATCAAGAA TGGCTGGTAA CGCGTGGTAT CATCGATCAT TGGACATCTC CATTTTGGAG    186240
     GCGCGGACCT CAGCTTCCGC AAGAAGTTCC GGCTGTTCTT CACCGTCGCA GCGGTCGTAT    186300
     TACTGCTCGG AGGCATCAAG GCCGCTGTGC ACTTTTTCGG GTTTGAGTTT CTCGAACTCA    186360
     ACAGGTTGCT GACGAGCGGC ATCGGCGGCG CCATCTTCAT CATCGGATTT CTGTTGTCGA    186420
     GTATCCTTGC CGACTACAAG GAGGCGGAAC GCATCCCGGC GGACATCCGC ACGTCCATTG    186480
     AAGCCATCGA CGGCGATCTG GAATCGTTTG CCGTTATCAA CAACGACTTC GATTTGATTG    186540
     CGAGCCGCCG CATCCTGATC GCCACGATCG ATAAACTGCG GACCGGTCGT GGCCACGCCA    186600
     GCGATCATAA GAATATTCCA CCGGTTCTCG ATGAGATCGG CAAGTTGACG CCGATTTTCG    186660
     GGCGCCTGGA GGGACTGGGG ATGTCGTACC CTCAGACGCT GCAAGTGAAG CAACTGTGAG    186720
     CTTCAGTATC GGGAATGCGG GCGATGGCGT TCGCGATGCG CCGGGATCAG CGGTTTGATG    186780
     GAAGAGTTCG ACCCCGAGTT GTAGCTTGGG CAAGACCTGG CGCCTGGCAG TACCATAGTT    186840
     GAAGTCGATG CCGCTTGCGC CGGAGACGTC GCCCTTCGAG CGGATACCTT TGTTGAACGT    186900
     ATAGATATGG TAATGACCAT ATTCGGTCGG CTCTGGGTCG TCCGACTGGT AGGGTGGGCC    186960
     AGCGATCGCC GGGAGCACGT GCAGGACGGT GAGACCGGTA GCTAAGGCGG CGAGCCCGAT    187020
     CCGTCGCCGG ATGTTTCTTT CCGGAACTTC GGTCATTACG CTCTCGCAGG CTCGAGCCGT    187080
     TGGTCTATCT GCGGAACATA GCATCTCACC CGCGACCATC CTGCTGGACC GCAATCCGGA    187140
     CCCGCGGATG GCGGAAAAGG TCAGACAGAC GATCGAGAGC GACGGAGATC GGTGACCGAC    187200
     CTGCATCTCT GGCGGCTGGG ACCTGGACAT CTGGGAGCAA TCTTCTTGCC GCTTTACGTG    187260
     CATACAATTG TAAAAGGAAA ATGGCCGGTG AAACGAGATC CTCCGCTTGC GAAGAACATA    187320
     GGATCCGTCA GGTGGCAATG ATCTGTCGCA GGTGATCCTC GAGGCTCAGC CGCGTGGATC    187380
     ATCGCGCTCC TCTCGAAGGG GCAGAAAACG GAAACGGTCA TTCAGTTGAC AGTGTCGGGG    187440
     ACAGCGTTGC GATAGAATGC ACAGCGGCAG CCACCCGCAC GTTACGCCGC AGGTGTATCG    187500
     ATTGTATGCG AAAGAGCCTC GACCACGCGG TCCAGCATCT CGAGGGCGTC CGTCGTGCCA    187560
     TCGGCCTCGC CTTTGTCGAA ATCGGCTCCG CCTTGTCCCA TTGTATTTGT GACATGGGCG    187620
     AGGCAGAGAA GCTTTGCGCC CGCCGCCTGG GCGAAAGCGT AGAGTGCGGC TGCCTCCATT    187680
     TCGACGGCCA ATATTCCTTT CAGCTTTGCC GCTCTGATCG CTTCGGCCGT CTCGCGAAAC    187740
     GGTGCATCGG TTGTCCAAGT CGATCCGACC ACGACCCGAG GCTCGATTCG CGACGTGGCA    187800
     TCGAATGCCT TCGATACCAG CAGAGGGCAG GCTTCGGAAA ATTCGGAAGG CGGAGCATAG    187860
     TGGTAGCTCG TCCCTTCATC GCGCAGCGCG CGATCGATGA TGATGAAATA GGGCGTCGGC    187920
     CCGCAGGGGA CGATCTGTCC CGCCGAAGTC AGACTGATCA GCAGGCGACA ACCGCTCGCG    187980
     AACAATTCTT CCGCCACCAG AACGGCAGAC GGTGCGCCGA CCACACGTCC AACGATCCCG    188040
     ATTTCACGGC CGGCGAGCAT GAACGTATCC AGCTCGGTGT GATAACATGG CCAAGAGGCG    188100
     AAGCGCTTGG CCTGACCCGT CTGCCGAAGT TTGCCGACGA GGTCTCCGTC GGGATCCAGC    188160
     AGGCAGACGG GCGGGACCTG AGAAACGGGA AGATTCTTTT GTCGCCGCGA TTCGCGTAGC    188220
     AAAGCCGATG GCAGGAAAAC GGAAGGTGAG GAGGTATTCT TATTGTCAAG GATCGGGGGC    188280
     GTCGCCATCG GTCGCACCTT GGTCGATTGA GAAGGAAC                            188318
//

If you have problems or comments...

PBIL Back to PBIL home page