(data stored in ACNUC8465 zone)

HOGENOMDNA: OSTLU_3.PE23

OSTLU_3.PE23         Location/Qualifiers
FT   CDS_pept        41687..43063
FT                   /codon_start=1
FT                   /gene_family="HOG000264639" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007989"
FT                   /orf_name="OSTLU_30347"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ABO94827.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG560083"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI00014FF51E"
FT                   /db_xref="UniProtKB/TrEMBL:A4RTQ6"
FT                   /transl_table=1
FT                   /translation="MMSEENDAGAEDAPPPAYESIHFAEDADALPEVPRDGYVKTKTIE
FT                   VSVTNPTKVGDGLTAYAVYTVSTKNKDPAYKKDESIVVRRYSDFQWLRGRLSTLYPGIV
FT                   LFPLPEKTVTTNPFQSDFLEHRRSGLEAFMKKVVEHPGLGTCEDVVMFLEEQGGSSWDQ
FT                   RAPWYSRGAVGTALGAVDSWFQSIGTATETWSTGAGMESVMMEEDPKYLEATEYLLLLE
FT                   ERLKRALKSGGEIVNAVQNLGILTGTFGENAHHLGDCEEKGAKMLLGDEAGGLGQAFRQ
FT                   VGSAACTMRAPTEAQAERLAKEFRAPLKQALQYVRAAKESIDARLDALLKLQACRAKVQ
FT                   SKRAKLEHALHAPPPPPPPQPTTIFERLSAAVTSPTPVTVEELQRDVGLAESAVNDAQA
FT                   KYDDIKSRMTNELPRVHAELEQVINAAFANCAVTMKALAETHVEAWESVFPGCTADAAA
FT                   "
     atgatgtcgg aggagaacga tgcgggcgcg gaggacgcgc cgccgccggc gtacgaaagc        60
     attcacttcg ccgaggatgc cgacgcgctg ccggaggtgc cgcgggatgg atacgtgaaa       120
     acgaagacga tcgaggtgag cgtgacgaat ccgaccaaag tcggcgacgg gttgacggcg       180
     tacgcggtgt acacggtgag caccaagaat aaagatccgg cgtataaaaa ggatgaatcc       240
     atcgtggtga gaaggtattc cgactttcag tggttgcgcg gacgcttgtc gacgctgtac       300
     ccaggcatcg tgttgtttcc gctgccggag aagacggtga cgacgaatcc gtttcagagc       360
     gatttcttgg agcatcgtcg aagcggtttg gaggcgttca tgaagaaagt ggtggaacat       420
     ccgggactcg gaacgtgcga agacgtggtg atgttcttag aggaacaggg ggggagttcg       480
     tgggaccagc gcgccccgtg gtattcgcgc ggcgcggttg gcaccgcgct cggagccgtg       540
     gattcttggt ttcagtccat cggtacggcg acggagacgt ggagcacggg cgcggggatg       600
     gaaagtgtca tgatggagga agatcccaaa tatctcgaag ctacggaata tttgttgctc       660
     ctcgaagagc gcctgaagcg agcgctgaag agcgggggtg aaatcgtcaa cgcggtgcag       720
     aatctcggca ttttaaccgg tacgtttgga gaaaacgcgc atcacttagg cgactgcgag       780
     gaaaaagggg cgaagatgtt gctcggcgat gaggccgggg gattagggca agcgttcaga       840
     caggttggtt ccgccgcgtg cacgatgcgg gcgccgacgg aggcgcaagc ggagcgcttg       900
     gcgaaagagt tccgcgcgcc gttgaaacaa gcgctgcaat acgtgcgcgc ggcgaaagaa       960
     tcaatagacg cgcgcctcga cgcgttgttg aagctgcaag cgtgccgcgc caaggtgcag      1020
     tccaagcgcg ccaagcttga acacgcgttg cacgcgccgc cgccgccgcc gccgccgcaa      1080
     ccgacgacaa tttttgagcg cctctccgct gccgtcacat ccccgacgcc cgtcaccgtg      1140
     gaagaattac agcgcgatgt cggcctcgct gaatccgcgg tgaacgacgc gcaagcaaag      1200
     tacgacgaca tcaaatctcg catgaccaac gagctcccgc gcgtgcacgc cgaattagaa      1260
     caagtcatca acgccgcctt cgcgaactgc gccgtcacca tgaaggcgct cgccgagacg      1320
     cacgtcgagg cttgggaatc cgtcttcccc gggtgcaccg ccgacgccgc ggcgtga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page