(data stored in ACNUC8465 zone)

HOGENOMDNA: OSTLU_5

ID   OSTLU_5; SV 1; linear; genomic DNA; GRV; PLN; 783246 BP.
XX
AC   CP000587_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Ostreococcus lucimarinus (strain CCE9901) chromosome 7, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ostreococcus lucimarinus (strain CCE9901)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Ostreococcus.
XX
RN   [1]
RX   PUBMED; 17460045.
RA   Palenik B., Grimwood J., Aerts A., Rouze P., Salamov A., Putnam N.,
RA   Dupont C., Jorgensen R., Derelle E., Rombauts S., Zhou K., Otillar R.,
RA   Merchant S.S., Podell S., Gaasterland T., Napoli C., Gendler K., Manuell
RA   A., Tai V., Vallon O., Piganeau G., Jancek S., Heijde M., Jabbari K.,
RA   Bowler C., Lohr M., Robbens S., Werner G., Dubchak I., Pazour G.J., Ren
RA   Q., Paulsen I., Delwiche C., Schmutz J., Rokhsar D., Van de Peer Y.,
RA   Moreau H., Grigoriev I.V.
RT   "The tiny eukaryote Ostreococcus provides genomic insights into the
RT   paradox of plankton speciation.";
RL   Proc. Natl. Acad. Sci. U.S.A. 104:7705-7710(2007).
XX
CC   This Genome Reviews entry was created from entry CP000587.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..783246
FT                   /organism="Ostreococcus lucimarinus"
FT                   /strain="CCE9901"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 7"
FT                   /db_xref="taxon:436017"
FT   CDS_pept        complement(487..1971)
FT                   /codon_start=1
FT                   /gene_family="HOG000264995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682888"
FT                   /orf_name="OSTLU_32404"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA binding"
FT                   /protein_id="ABO97098.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG609864"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001500405"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZI9"
FT                   /transl_table=1
FT                   /translation="MSRAHDADGVEDAVLFDEDKTLLLDALERQASRGPCQGTRPWDLW
FT                   DPAGALAYDAWSMLGNISPERAMELYCEVISSRYADWFDMLVRGMSEKQKRAMIATAKE
FT                   CALEYYRALASGALGESARLAQTKDARRALAFNSSTGPTAFLDEMFASAADDEFVRLPI
FT                   LSKVSPRARSGHMSAVVDGDTIFFSHGRGSRSRLLGDLWAFDLATGAWAERKLQWPGST
FT                   CAGAASATIGSKLYAFRGKSADDCDVDGVYSLTVSAIDLTADYASKDFKWTHVRCETSD
FT                   EVSTPPRARSGHTSTAIGDRIFIFGGVDAKTGDDLDELWEFTPTTTVWKKLANGTRPRS
FT                   SHAATSVDERYLLVCGGSTGNELCDCGAVDVYDVVKGEWGTVDGDNEDGDRPSPRAAHA
FT                   SVAIGNQWFVIGGGDNENATQDAYTFDLRACVDERKCRWTLFAESCALIGKEGMSASAV
FT                   VSPSSKRVFLLLHGGLNEKGAVCDTIACRLAPLASH"
FT   CDS_pept        2565..3278
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007454"
FT                   /orf_name="OSTLU_32405"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96872.1"
FT                   /db_xref="UniParc:UPI0001500406"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ0"
FT                   /transl_table=1
FT                   /translation="MGAENMGPLLYAIARFCKPAHVLEVGAGYTSIFLLQAMRDNADEI
FT                   ATYRAMIQRQEARIGDVPWTAPDYDYEKLDASTLHIVDNCAHEHTTAHRVKEVAQALGC
FT                   ESFLRVHVCDAFDSELPSTLAVPDVKYFDLLWIDLGAANRIEGFFDAWWSRVNPCGGFV
FT                   VVHSTLTNTLSRKWLEKMRKLARDGGRDAETGASPYGEFVTVSFLEPHKMFQNSCSFFQ
FT                   RRQSSWTERTLTKYP"
FT   CDS_pept        complement(3352..6351)
FT                   /codon_start=1
FT                   /gene_family="HOG000264996" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682889"
FT                   /gene_name="AOX3"
FT                   /orf_name="OSTLU_15959"
FT                   /product="Amine oxidase"
FT                   /function="zinc ion binding"
FT                   /protein_id="ABO97099.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG609947"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR011124"
FT                   /db_xref="UniParc:UPI0001500407"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ1"
FT                   /transl_table=1
FT                   /translation="MPAVDDDDDNEEDVIAPLPPARKRHDVKFSDCEMRPSQANAAKTK
FT                   TANAAKTKTANAAKTKTAKVAKTKTAKVASAKWCAVSIADEFDGELIPGVLLDAKEYVK
FT                   KVSDAKLRAVRLLNSNRVLLLPPSNCARYAIHTDAKTLRETCDRMVLVKNAGKTSTELM
FT                   KKRQYFRVLAPALPPKPLHDVLETNEEFDAPLNRITWWDGDVYVFAQARKDNPQNIDKA
FT                   FIRIDRTTGEKLKFTNCSATGEVEIGTHMNRLRSNESIRRYLDRARVYAKDLRKRWKRV
FT                   YDEGGQRLDVPSTLPELTTTVSAVVVENGVPKDALASTTMKVIKSKPVTPKRKLSADDL
FT                   ETKATKKKCDVNDAVKKPVPKKRIEEKPAKPVNVPWGGNPSPVIVVVGAGPAGLAAARS
FT                   LKNHGASVVVLESRSRPGGRCNTVEMREMASAGLPSVQVDLGASFIHGCHDYNPVYAIA
FT                   KKHKVALNTAGGGYSAGWGEKSSWYNAEGGRVKEQDVAQAFQISRKATEIMFIKNAEDI
FT                   ERSLCVPIKSTQNEQLQAQHFIASPSARGYDEIEENSDCSLEDAFNYATNQIVNSLLNG
FT                   KKRFEKVKPVYDSIPVITWAFVAPMRELSFVFERNVQDEIRDILAPDGPVNANETSYVE
FT                   SESDASTVDSAVKRPPGKVENKQLDFSDGMVVNGYKDLLIDRLIGEKDGALDIKYEHVV
FT                   NRVKVDETSFMNEFGQQIKAKQKSYCVTCTNGTQHPCDYVVVTVPLGVLKKNRIEFTPP
FT                   LSDQKLRAIQRIGMGTENKVYMRFKEMFWPKSKFFQVTDPRYRFLNLDAYGKKHTLLAH
FT                   VAPPYAHDFDGKDELEIVRGVCRVLQKMFRLKSLPVPDDYIVTNWGNDEHSFGAYSYAR
FT                   TGTTVLDVEALAAPEHDGRLYFAGEACSITGPQCVHGAVVTGNAAAVNILSLGNVDIDV
FT                   SKIVGGDAGMQEDEEVNWKQCHKCSVWRKVPSVSMPIVEDNSLWECADGGVWNTYLAKE
FT                   GCKYSDESKM"
FT   CDS_pept        6968..7945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682890"
FT                   /orf_name="OSTLU_15960"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring acyl groups "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO96873.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016746"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniParc:UPI00015004EB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ2"
FT                   /transl_table=1
FT                   /translation="MTVVAILAVDFTLFPRRLGKTETYGVSLMDVGAGSFVFSSSVVSR
FT                   FARGKEKRNLRASRRKVMQVMLLGLARLAITTMIGYHSVETEYGRHWNFFFTLAVIQVC
FT                   ADTLPIAAHRALPFGLLISFAYQYVLSCHGLSAWILQAPDVRSHESETNVLTRFVSMNR
FT                   EGVSSACGGYFAIHLIAAHLGNALSKPVLNFSRWLQTMAIVTCAFWFAAIASHAYVEPT
FT                   SRRAGNAAYVLWIVAFNLQVIIVYVCMTWFARSANGRGKCDIPVLASAINRRQLFVFVV
FT                   GNALTGLTNLAVDTINADANTAWGVMSLYLSAISIVALAMDRRK"
FT   CDS_pept        8458..11700
FT                   /codon_start=1
FT                   /gene_family="HOG000264997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682891"
FT                   /orf_name="OSTLU_15961"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO96874.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG559509"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00015004EC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ3"
FT                   /transl_table=1
FT                   /translation="MGVDRARARRLTESENDDDDDRSLDAREEVGDGDDESDEEDVDGD
FT                   SVVRASLERASERDAEIADERDTRVRILLIRERDAEFARDPKFKSRSIAELNNEAVRYL
FT                   KAGDDVKCVVAYAKVFRKVSENNVTHPTLYVCHSNRAFAYLNLGLFQEALWDGHRAQTL
FT                   ANERFTQLQDDDGSVKVFVKGYARKGFALMGLREPKLAKLEFERGLTMSPTDEELKRGL
FT                   EEATQAVIRDLYIGRGKEKQYALPSSGKTSERISSLPYSAPLHRVHPRDMLPNTLLTPF
FT                   QAENDYHLKDTYNYMTIQADIRVPKRHFKVLQDDVRRAKFSTAIKCAIDKMHDDAKDAR
FT                   VLNIGCGAGLNTMLALKHGAHHVTATERWLYLAMATKENLLNNGYSDDQVKVVYKRPTD
FT                   LALLRDVPISCNVCVCDVFDDGLLSSGIIPAVRHALDKLLLPDAVVIPSSATLYAQAVD
FT                   MRTPAFDGINLSAIDGYRWHPTYIAGIDLFENAYITLSDPVQVFQFDFLMPPDCSEKKT
FT                   IDLTFTKRGKFNAVVFWYEMTLIDDVKISTKPGGEDCPSSMRAAVQFMPGKISIEEGSV
FT                   LPLTCAHNTVGIQFSVEDAEYDQVTKKDASFPKYHFHMLRDEGRLHAYSDALGRQVARI
FT                   KARGDTCRALDIGTGSGILAMLAARAGADSVVACDTHPSLVSVARRNVAANGYGSQVSV
FT                   LKRDATQLERGKHAPYDGVNLIVLDVFDAGLTGDDVLDMIEAARKQLSASTCAVVPAAA
FT                   TIYCAGIEAYTSEVDGFNMSAFNKYRWDSTYEATYMRDQPYRVLTKPKKVFEFFFDDSQ
FT                   KSKGRETVLKMETIAHGYMNAVCFWFDLHMDEEETITTAPLGIGKGGTIENQRILGDFD
FT                   GAHAKKVMCESLRRVRANMASNPRSEDFESDSAREGSSDRTVFVSDATSLGDDEFDDDD
FT                   REEHYWGQALQYLERGVQVRAGKKIALLAKRQNGGVHFSLKEGVGNWVGKPPWKIEWGG
FT                   GASVESPHFQRVHYCQLLVNDFLMRLRCKRFAPIEKDMKMILAHCGALFLEPHSLTDIY
FT                   HHLVMLEVYFDWEDFSPGTKVESMTKPCLRLC"
FT   CDS_pept        join(complement(12344..12370),complement(11815..12186))
FT                   /codon_start=1
FT                   /gene_family="HOG000242063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682892"
FT                   /orf_name="OSTLU_35567"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97100.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG523634"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00015004ED"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ4"
FT                   /transl_table=1
FT                   /translation="MAGKAKPKKHTAKELASKAAAALTNKGGGKSGKADRLGGAAGHAK
FT                   FKCPVCAQGAPSEKTAVAHWDSKHAKLPFVFADWTDAHAASGGVTTQGAAVKGGKEKTV
FT                   HELQKTAAGRAELARRQAEKERIANLQF"
FT   CDS_pept        join(12553..12609,12797..12817,13184..13690)
FT                   /codon_start=1
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682893"
FT                   /gene_name="RPS5"
FT                   /orf_name="OSTLU_12674"
FT                   /product="Ribosomal protein S5, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="ABO96875.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG297325"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="UniParc:UPI00015004EE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ5"
FT                   /transl_table=1
FT                   /translation="MATTQEVKLFGKWTFDDVEINDISLEDYIAVKPKYAVYVPHTAGR
FT                   FAAKRFRKAQCPIVERLVNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDQNPVQVIVD
FT                   AIIYAGPREDATRIGSAGVVRRQAVDLSPLRRVNQAIYLLTTGARESAFRNVKTIAECL
FT                   ADELINAAKQSSNSYAIKKKDELERVAKANR"
FT   CDS_pept        complement(13813..14670)
FT                   /codon_start=1
FT                   /gene_family="HOG000172261" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682894"
FT                   /orf_name="OSTLU_35464"
FT                   /product="Predicted protein"
FT                   /function="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]imidazole-4-
FT                   carboxamide isomerase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="ABO97101.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0003949"
FT                   /db_xref="HOGENOM:HBG302148"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00015004EF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ6"
FT                   /transl_table=1
FT                   /translation="MRAATVVAVNALAPHARAVRFRPCIDIHDGKVKQIVGSTLKDARP
FT                   GDAGSETPATNFETETPSSAFAEMYKRDGIYGGHAILLSKDEATLRAAKEAVRAFPGGL
FT                   QVGGGVNPTNASELLDAGASHVIVTSYVFRDGALNEDALSEMIRAVGADKLVLDLSCRL
FT                   DDADGRYKVVTDRWQKWTDLAVDGSTMERLAKCCDEFLVHGVDVEGMKLGIDLKLVELL
FT                   GEFCPIPVTYAGGARSLDDLELVKAAGRGMVDITVGSALDCFGGALKYDDVVAWHNQQK
FT                   LEVK"
FT   CDS_pept        15017..16708
FT                   /codon_start=1
FT                   /gene_family="HOG000193775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007455"
FT                   /orf_name="OSTLU_35270"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96876.1"
FT                   /db_xref="HOGENOM:HBG409391"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00015004F0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ7"
FT                   /transl_table=1
FT                   /translation="MKHWKFHDCPSTIGASSDAEAVAAYDAHDFRADVVGGGDDVEAQC
FT                   GDTATYSRDGTLFACANGDTVEVYDASVEPFALAATLDGLPGASALNFSPSKTYLAIYQ
FT                   KQTSTGASKDTKNMTIWNITGLTTNRAPPRKVYEVFQRQFLKAEWPYFQFSDDDSTAVR
FT                   CVSNEIQIIRPAEGFDRHARLRVPSVAVAKISHGSTPRVACFVPEVKGAPGSVRIYELA
FT                   QHTEEGVVENPTPVARKSFFRVTEVDLMWAPDGSAVLILGSSEVDATNKSYYGESCLHY
FT                   LKADGSFEGAVPLNKEGPVHDAQWSPCSDEFGVVYGYMPAKATIYKAAQCEPKYELGAG
FT                   PHNTLRWNPFGRFVALAGFGNLPGDVKFFQKMKDGKYKPIGSTRASCSVTLEWSPDGRR
FT                   LLTSTIAPRLNVDNGWKIWRYNGDLLLHEERAKIYEATWRPVPDGTYEDRPISPASKRV
FT                   ESQGGAVLTNASEATKGAYRPPHAAKTAYRPPHATSGSGNFSLAKASEEDMKAGKFKAA
FT                   GAKEPAKADAGVPGAGAQLSAAAAKNAKKRAAKKRAASAAAALEKL"
FT   CDS_pept        17561..19732
FT                   /codon_start=1
FT                   /gene_family="HOG000264998" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160723"
FT                   /orf_name="OSTLU_24740"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96877.1"
FT                   /db_xref="HOGENOM:HBG609865"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR003035"
FT                   /db_xref="UniParc:UPI00015004F1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ8"
FT                   /transl_table=1
FT                   /translation="MLNVAIAGSDGFTPGSGAPGRVFATNRPEWTPSVQCYHPSEFPRN
FT                   SLAIECGCYSQLIVPVNAKPQSTTPFALLEITFLHVLDNMGSVYSHVVREMTNAGLHTP
FT                   ISETLAPPPVLMDKIAGEVARLKVAETQKGLQMICSRLEIPFAQIWIPHDVDGTLICVG
FT                   TPYYQKSNHFLHYRNASMNLAISQHTGSLSKVWKNGSMVWMHDLSTLSHRDFLLKHSCD
FT                   LLKLQAMCISKIALKGVTSGQPLQVLVEIFLDPSLKSPRDQAKTVQSFWSSVEADLNAS
FT                   VVTDTDKTWLEEMKKNQTASSSGANPDAAGTALWGITLEVLQQNFHKHLKQAASDLGVG
FT                   STTLKRICRQYGIRRWPRRSLNSKNGHMSDILAKSIATGATMSDDGAGESVHGGASCVS
FT                   HTSEIGASGTLPSQSIKSHSLRDIATFSPTTSEKNKRALEQRVHRGGNLGAFWQGEGVS
FT                   KMQRGMSWHGNNQARDALDFDFPNRYEQSVHGVYNFNMPPPPMDQSVRGASTYNALSLD
FT                   ASEEMASFIDKLVKEPEKEPVVVKVQVRDVLIRVRLVTNERYVELVDALTDLLDLQMSS
FT                   CKLKYQDDEQDWCLLRNQEDFDECWAFCTRRGSSCTMRVKLTIEEGVETKSLFKPQRAR
FT                   AEVPDAQAKPISVKASVGEDVLRFKLTTEMSCDDIVAKLNLAENSSQSVTLCYQDEDED
FT                   WIRLGGDYDLAELRHVGSATGALKLQANY"
FT   CDS_pept        complement(19841..20566)
FT                   /codon_start=1
FT                   /gene_family="HOG000264999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007456"
FT                   /orf_name="OSTLU_92960"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97102.1"
FT                   /db_xref="HOGENOM:HBG562641"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00015004F2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZJ9"
FT                   /transl_table=1
FT                   /translation="MARATTTRASTSTSASSVIPGKGPGSPKYGEIYETLVKSKKVRAA
FT                   TANEVAEMLSGKRRGVVVDVRQPLEHAEWRLVGTKSAPYLVPMENVLRRASGYFLAIKG
FT                   GLKERNVAFVDVVAEVTKNRRDAVVLVDLRGGDLDIAPLNGSTAVSDRGDSLSLRAAYE
FT                   LVQAGYTDVRYVPGGFPALIDEGGLEYESEKYAGLLDAVGEGARKTLMYSNLLPDPSLA
FT                   PGFVVQIVLLAALAFLQQP"
FT   CDS_pept        join(21013..22662,22741..23061,23122..24957)
FT                   /codon_start=1
FT                   /gene_family="HOG000265000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855961"
FT                   /orf_name="OSTLU_35308"
FT                   /product="ABC(ABCG) family transporter: pleiotropic drug "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO96878.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG558246"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00015004F3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK0"
FT                   /transl_table=1
FT                   /translation="MKSLVARAENAGDKKTTLEVLRDARGCFRPGTLTLVLAPPGHGKS
FT                   TLLKSIAGVNPLPIEGEITYSGLTKNELEAKGVSLHRLCEYVTQLDEHLPYLTVKETVQ
FT                   FSHENACHVPSDAEGKAAYDDKVDKVINLLNLDGCKDTIIGNDLIRGVSGGEKKRVTIA
FT                   EAMVKNAQVLCMDEISTGLDAAVTYNIVAGLKEWASRTQGTGIIALLQPTPEVVSLFDD
FT                   VLLLKEGATVYHGPVDNVATYFKGLGFAPPAVNSGADLADWLISLLVSPTETLLRAGTQ
FT                   PSDAIPTNVDAMVKSWQSTQAYESSIKSKCTPADIELNTPFAKNQYSLSYPRSFADHFK
FT                   SVFKRQAQVTLRNKLFLQARIFGACVTSLILGSVWFDLPLERGFEKLGMLLFCILHISF
FT                   SNFSELTFSVEQKYVAFKHLDAKLFPELSYLASWALVHLPIAIVETLIFSCVLYPMVGL
FT                   NLAFKQWGFFYLQLVLANVAMASFFRVIALVSPTMEVAQIYPGPFIAVMILFAGFLISP
FT                   ELMGGLEFMYWVSIFAYCLRSLCQNEFLSGHYNSLCRQNLITPCSNMGEIILDTIGITK
FT                   DTSYKWAGPAFCLGFFALTFAVGLRTLHTTRIQRNIGSSRAEDKAQNDEEVIQMIDVAA
FT                   AQKAMDFTAMAISWKDLCYTVEKTVSKQLLHNISSAAQPGRMLALMGSSGAGKTTLLDV
FT                   IAGRKNTGLISGDIKLNGHNVKKETFARLTAYCEQMDLHNEFTTVREALEFSAKLRLHP
FT                   SISDETRVAFVDEALEILELNSIAHRMIGTSGSDTGLAPGQRKVLTVAVELVSNAPVFF
FT                   LDEPTSGLDARSALIVMKEVKKVAALGRTVISTIHQPSMEIFLMFDDMLLLQRGGYQVY
FT                   FGELGKGGSTMVNYLQSLKMALPLPSGMNPASWMLDVLGGSDSSGGASRKKGSMKRSAS
FT                   GIALDGLLLDQKFMSSAEGQAAMKLVNAISEQGADEKMFSFDSPYARTFKTQLLAILSR
FT                   ANKSQLRDVGYNCGRISILTILYILFGVIYLDLKITDEAGVQSMVACVFMTTIFTGIIC
FT                   MNSVMPVRVRERAVAFRERSSYMYDAIPFSLATAIIEVPWIAIISLVTVIPMYFLVGMI
FT                   PTAQRLFFHILVNFLVSFTFLSFGQAIACMCSTIETAQAGTSAFIPIAFLFGGLYLPLP
FT                   QIPVYWQWAYYINPVAYAIQSVVAPQFERRGCSGPYPSGNCPTIQAFRGSYFETIDTLT
FT                   YVEQKYEIKFSERWISCGYLSIFAFGMQFVHSLFFKTSNVVKR"
FT   CDS_pept        <25576..>25986
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682895"
FT                   /orf_name="OSTLU_7340"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ABO96879.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015582"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00015004F4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK1"
FT                   /transl_table=1
FT                   /translation="RLQSELMSLMTSADSGISAFPDGDNIFSWVGTIEGALGTCYENLK
FT                   YKLSLTFANDYPFKAPTVKFETPCFHPNVDQYGNICLDILKEKWSPVYNVRTILLSIQS
FT                   LLGEPNNDSPLNVAAAQLWAQPEEYKKVLLKKY"
FT   CDS_pept        join(26257..26349,26447..26884)
FT                   /codon_start=1
FT                   /gene_family="HOG000265001" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160724"
FT                   /orf_name="OSTLU_35457"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96880.1"
FT                   /db_xref="HOGENOM:HBG593555"
FT                   /db_xref="UniParc:UPI00015004F5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK2"
FT                   /transl_table=1
FT                   /translation="METSLRYDTTSRSLSLFAKERFTNSEDVVLTVSGSLDTRDGRMDG
FT                   KAHVRKRLFSPAKSSPLVPDRADIGLTYETKLDDVRYGARARKTVDVSPSKDGMSTVTL
FT                   RGGVSYGVKRSKPLIEGTIELTHKVFNFQEDQDLRLRVGYDLVKREPYAHIRENNWSFK
FT                   TDFQKSWSVYYDL"
FT   CDS_pept        complement(<27673..28071)
FT                   /codon_start=1
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682896"
FT                   /orf_name="OSTLU_35591"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ABO97103.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI00015004F6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK3"
FT                   /transl_table=1
FT                   /translation="MANRLREGLGGDADYLLVDAESLELKALRGFPGPYVKPMIDALGP
FT                   DGLWDLMSRHCDRRAELKCALGVKCLRTGEQKIFISSRSGVLVVPRGEMEASDEDGLQS
FT                   IFKPEDCHKTLAELEYSERMKISHRQDAL"
FT   CDS_pept        join(29065..29115,29224..29306,29448..31551)
FT                   /codon_start=1
FT                   /gene_family="HOG000176712" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312376"
FT                   /orf_name="OSTLU_50090"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="ABO96881.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG622322"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniParc:UPI00015004F7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK4"
FT                   /transl_table=1
FT                   /translation="MSDRRVIALEDGWGNMEDGIMKLRRILDQEDAESFTSEEYMNLYT
FT                   TIYNMCTQKAPYDFSEELYKRYEAAFNQYINSKVLPALVEKKGEYMLRSLMSRWENHKI
FT                   MVRWLSRFFNYLDRYYVQRHHYATLNQVGVGCFRRLVYEEIKPSMKTAVLALIDKEREG
FT                   EKSDRGLIKSITSIFVEMGLGTMDAYQNDFENDLLTHTSSFYTRKATQWIAEDSCPAYL
FT                   IKAEECLHSERERVQQYLHQSTESKLISKVEQQLLEQYETELLEKENSGCAALLVDDKK
FT                   EDLARMFRLFSSVPKGLAPIAQIFKTHVQKEGMSLVNSAEQAAAAMKGNKEKPTTSTSI
FT                   EQVFTRSAIDLYDKYSGYVNDCFGSNALFNRALKEAFEYFCNKGIGEISTAQLLADFAD
FT                   KLLRKGGSEKLSDEKMEETLDKVVKLLAYISDKDMFGEFASKRLSRRLLQDTSASQDYE
FT                   RSILSKLKTSCGAQFTSKMEGMVNDVQSARDTQDVFERWVDEDAANRKTCIDFNVTILT
FT                   HGFWPSWKPIQVELCDEFAQCVETFQTFYDAKMSQRKLTWVHQLGAVVLNVKYEAKTIE
FT                   MHMQTPQCSVLLLFRNEKELSMQKVIEKTKMPADAVKRALYSLSCAKYKILNKSPEGKT
FT                   VNPEDVFSFNEKFTDRSRRIKIALPPPDERKATIENVVQDRRHAIDAAIVRVMKTRKAL
FT                   AYNELVVEVVNQLQQSFLPEAKMIKMRVDDLINKEYIMRDEENSQVFKYIA"
FT   CDS_pept        join(complement(32668..32682),complement(32181..32360),
FT                   complement(31684..32028))
FT                   /codon_start=1
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312377"
FT                   /gene_name="RPL18a"
FT                   /orf_name="OSTLU_32420"
FT                   /product="Ribosomal protein L18a, component of cytosolic
FT                   80S ribosome and 60S large subunit "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO97104.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI00015004F8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK5"
FT                   /transl_table=1
FT                   /translation="MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWY
FT                   FMSRLKKVKKANGQIIACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAA
FT                   VDALYEEMASRHRVRASCLQIIKIAEVADKDVRRENTRQFIQDDLSFPVVTKVTRHPSK
FT                   ASKTIIKYKRPNHVTL"
FT   CDS_pept        33365..33805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855962"
FT                   /orf_name="OSTLU_32421"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96882.1"
FT                   /db_xref="UniParc:UPI00015004F9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK6"
FT                   /transl_table=1
FT                   /translation="MVPSDNFVHEACVASSVSDRLRSLLLGENDDAGALVAGDVPVEFR
FT                   VYPVGGSMDWHKDVALYTKPQYEIVFTVTNTSDSTTEWEDERTGMRYGGWTEPNSVIIV
FT                   RADGAPHRVTGVTRGERSIIKFVLTQTLEKTDDFFDNLLIYT"
FT   CDS_pept        complement(33843..35408)
FT                   /codon_start=1
FT                   /gene_family="HOG000265002" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160725"
FT                   /orf_name="OSTLU_32422"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97105.1"
FT                   /db_xref="HOGENOM:HBG609899"
FT                   /db_xref="UniParc:UPI00015005D6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK7"
FT                   /transl_table=1
FT                   /translation="MTHKRGSIAAYFAPAVKTPSAADGAKKARTSTDSSSRFERCPLCA
FT                   KNVAKMLLESHVGTCIIRERREDGDSDAEVAEKQPATKPKPATNAFASMMAAQRERERE
FT                   RIFLLTYDAARSRWDVSLSLGKSIKAESSAKWASQVVVKEKLASGTTCSTTLKLMTDVA
FT                   SDDGPDQENALREALRDAKEYAEVRASRASADGEQLKLSVIKSALQKNIRRGRAAAASR
FT                   VAMHMCLDPQALIECVRRLVIISLEDAILHPDVVLLTWLMCATSKGFEPTDALRAAVAR
FT                   IAGEMAAIRIKDSVSYGVAGDSASGMLALNDVEAALPAAEATVVQALMIRAHFGGMPGD
FT                   VAMLHGFSHVWFNRFKQTAKSNDVPLEYDELRNPEIIDDKSPWLSYLELAFDAAREATD
FT                   AAKTWGGFMRRDDIPIAAVDFHVSSCVEHVLQAPAVRLRIVEAGERFGFGDSIDVADRT
FT                   KSAIWRHSAGVNKKSNIALRNTVVKTMIHPPTKKEQLSLAIWEIIREDYERWVRRYLAF
FT                   RMPR"
FT   CDS_pept        complement(35716..36951)
FT                   /codon_start=1
FT                   /gene_family="HOG000265003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855963"
FT                   /orf_name="OSTLU_92965"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97106.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG559545"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI00015005D7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK8"
FT                   /transl_table=1
FT                   /translation="MKVPTHDAAPGAKSYGGMGERVLRAMGWSKCARPTTEATDATDDR
FT                   RRDARPRREERRLTARERPRARDRGDGLGKRRHGRAEAIEVVKREDNAGVGKRKTRYAW
FT                   DEKWWEGTYANAASKIARVVGGEEDGKTTSSTSTSGRDGDSSESEDSSEDEVAARLGTA
FT                   TGRDGVAFSGSKSDLQLMRELAEDNHRGSTFGGRVGKLERIAKFEAEQLAKYGIQRGSA
FT                   SAPAAAETKKKPKEKSKKDKKKRKSDGEGAVETTVRPSGVSYEGEKSLSTKLSDWWTRA
FT                   GFAWGGLVGSKRERDLNDDGAADDEDGADRAKRGKGFTENDQEALFKSAHETNVAKGTK
FT                   RGLGGRGVLKSEWTGVRRTDFGDDDDDDVAKNDARRKNEKAKKEKKEKKDKKEKKQKKE
FT                   KKEKSRTVEVAR"
FT   CDS_pept        37287..37739
FT                   /codon_start=1
FT                   /gene_family="HOG000265004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855964"
FT                   /orf_name="OSTLU_15975"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96883.1"
FT                   /db_xref="HOGENOM:HBG609909"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00015005D8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZK9"
FT                   /transl_table=1
FT                   /translation="MLEREDYLFVDCRSWKEYDRSHITKPPAKTINVPLAQDASVEDWV
FT                   KAAREKTRPGMKLLIVDADGARVAELVSGLEAAGYTNAVPVAGGYAAWTAKYTTFGRKV
FT                   PPKGKFVSTGKEALKSGLDLDPNVASAYEENWGRAPPKYGEEAKSD"
FT   CDS_pept        37934..38785
FT                   /codon_start=1
FT                   /gene_family="HOG000265005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682897"
FT                   /orf_name="OSTLU_92966"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96884.1"
FT                   /db_xref="HOGENOM:HBG609914"
FT                   /db_xref="UniParc:UPI00015005D9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL0"
FT                   /transl_table=1
FT                   /translation="MRPIPGPANAFASRENIAHARANGEGDEGAREATPNDATSSNPAA
FT                   TAEDVLDAALFASAPWRRALDAIDVENFDPNRAECKYNVAWLRRGGWRSGRAPRVAGAL
FT                   RELGATSNGDGAGTLCDPTGEIRVIVHRELMMSERALASGCAVVLRDVPVLSVDATAHA
FT                   LAVTSENLVAVFEADVDAYAASAAKRTRIEREALRERLRESAVIEAVSGVDWEDFEDVA
FT                   GDFSGYGGDAPPSAEIDHNARDEETVHTDEMMNDVTTAPTPDGPSDFALQLAALYADDG
FT                   DA"
FT   CDS_pept        38902..39549
FT                   /codon_start=1
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682898"
FT                   /orf_name="OSTLU_35233"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ABO96885.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI00015005DA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL1"
FT                   /transl_table=1
FT                   /translation="MASIPTLRIAYATGNHGKFAEAKHVFNRPENLARANVILQQFDVD
FT                   TVEIQGSKVDISKHKLKEAATILFQEADAGDFDYLLVEDVSLDLDALNGFPGPYCKPML
FT                   EAIGPDGLWDVMSRYEDRNATVTCTVGAMAVRAGGSRETNVFIGSIRGTMVPPRGEVKH
FT                   GKASWNSVFQPAGFAKTFGELQFVEQAEISHRRIALEKFLGNAIEAATEVNC"
FT   CDS_pept        complement(39600..41174)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682899"
FT                   /orf_name="OSTLU_24745"
FT                   /product="Predicted protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="ABO97107.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI00015005DB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL2"
FT                   /transl_table=1
FT                   /translation="MSTRATRGAASTRAIERGATRDGRRLRRNRRQRSRGTTTTTTTAR
FT                   ASRTNDARARDRDRDDYDVHTVMYGDTLNEIARAHGTSAEAVCEANGIRFDDEGNDEDA
FT                   PALYVGQRLLIPTTNDDGRWRRGEVGEYGSRRTTAMSERERDAEFARARRSRSEQRRMS
FT                   APTTRTHAVVSASAVEELTRDDVVGMLTHRDETVMLLVETENCRWCDDVQPAWTAVAVC
FT                   YANDPTVRVCRLRCDSAEMKQFAAKYFRAKTFPTIVALPAGKGPVYRHASADRSVGALL
FT                   EFAEEATGRTAPTLAIDLRKSPQSASSAMTTRRGVSAASDASSFSRQTAQNPFNALTGA
FT                   LGSTLGFDGNSGRSSVGVSATPSSQVLPLAAGITTLAIFAAVANVAVAARNAGAKRQPR
FT                   RLGRHFHEEEFADDHEPLDDYDEAVMEVSSQNDARQLAEWRDIVVEELFSLPSRALLLI
FT                   RIWFLIGRRSVELGKSRSKNERRGGRSRDEYEVDEYYEDERRPFRDDGDARRARPSRNS
FT                   RDDPTYY"
FT   CDS_pept        complement(41400..46199)
FT                   /codon_start=1
FT                   /gene_family="HOG000265006" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855965"
FT                   /orf_name="OSTLU_32428"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97108.1"
FT                   /db_xref="HOGENOM:HBG609930"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00015005DC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL3"
FT                   /transl_table=1
FT                   /translation="MEEAWKSVVAARTRGAIDDATRSYHALARAIEREERGFEDFSGSC
FT                   SSALRREYAGLKAIDDMPFKPEWRRSIVDIAVGEQMYVSALCEQAGAMRVMRACGLGCR
FT                   MRNAQKCSILPFDDATKDLYCNVLSEIAFEGRSYVQAMEARRDNEHLLGPTAELDMRRL
FT                   KTYAMGALCSLLVTDTAASDNIRNGVMESLLIPLVRLICRGGEDMPAWEISCEDTLRLA
FT                   EDAGEGCSSGLDAGDHDDLHRSLMQARLTCVGAIGDYVECFAEALKHGVLELSLRLVAG
FT                   PRENGWLEKYGFKRHHGETSAWPGDPQLSEALSIVSAFLAHRKFAISFIDAGGAKLLLN
FT                   IPRGPMTYYNLTRCLFGIASITTALERLVSPQVDLARRYVKVSLELLDCSNEYARRQAA
FT                   LFLTFAMQIPVVVVAFDAEAGLKLVLDVLRTLAVMVVDVDKVRPSMSPNEISQAKETGD
FT                   HVSLLLRQYMRAHFAQHVKAIEEKVMGKSKKSTSTNNRAMLQAMDIGYDATERLFSLVS
FT                   RQKRIAAVMQTKSWLVIEAFVAQKGPKVMLDLLTLAPGEKTLRECVLGSLSVLKIVTSH
FT                   PTGRVHTAKAQFDEYYSSGYVLIDVVENAAEAVDTEAVVEALKVVCNLVSPPYALHSTD
FT                   AKSQSGKLQRSHSIDGKSFSVFDYARMEETFEAGRKHIREAFGVKSLLNLLFKTSKTLP
FT                   QPSMNISRALCCRALLGLSRDASIANTLQTLQIARHLSELLRETGTTQHSAFDELAIVD
FT                   SKRENGTAATVQAAATEFHRCAVELIAATAGFANVKATTPAVASDAAAPPLAKLERHLI
FT                   AAATKVRYPHNELLQIMHEHLVAAGLTSTAASLVDEAGMERPGRSASVGRLCPSPAPRL
FT                   KLNFKSKTARTKMYRRAPRSRMTGAARGMLGIAGEPFTLGLEQGSTQAPPRKGPRRGES
FT                   SRASKLSPAVVTTSVNSVKTSKPGANGIVVTPCSTRRGKKRKTNGEEIRKSLITPPIAV
FT                   GATERACCANEHQTPSPSVKERVHKEFPTPGVLVSDAPRGETGCGVRSRLDSILTQYLR
FT                   AQHRQCAAPITACAPFSLLAPHQCPQPKRILEAPRNLTARLRQREWANVTGWDAGMRRA
FT                   DRHFVYSRFRPLRAIRGNDCLFTAASFLYGVPEQIIIGDNDGELHLYDHISGELLEIAA
FT                   TPGRVSGAIRKIAAAGPLCPTPLFAVTSVESCSIWSLPNPDDAPYMLWCSGHSGCAINS
FT                   TGSQFVSGSLESVVELADMETHRVTRRLTSNTGGPPLLTKNNDEVSFSPSDDLILWDEV
FT                   LWDVRLANDKPIRRFDRYSEAAGACFHPGGNEIIIGREVWDIRSSRLLRVVPSLDRAAL
FT                   KFNLTGTVGMAHILHPRNEPPLSSLRKCHHPYKHSFCTIDMLDYSDICTVDVPSGMIDA
FT                   AWDVNSDTLCATVEYDILNTHESTVRLHEVGRLRPADDESDVEDEHEEIEPMVLNMDHD
FT                   GWEEDYSDEDSEERIEDADGRVNINEARIRHQINSLREMVREAEVDWVRYDDDGEGVHS
FT                   GDDDSSEYDSDFIDSDSDDAEDDLHFGRALLRRALHGRRPAVTRYDDDDDEDEYETDDD
FT                   DEYETDDGDDEESEYETDDG"
FT   CDS_pept        47011..48705
FT                   /codon_start=1
FT                   /gene_family="HOG000003880" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682900"
FT                   /orf_name="OSTLU_46103"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="threonine-tRNA ligase activity"
FT                   /biological_process="threonyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO96886.1"
FT                   /db_xref="GO:0004829"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006435"
FT                   /db_xref="HOGENOM:HBG352811"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniParc:UPI00015005DD"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL4"
FT                   /transl_table=1
FT                   /translation="MAMAVQKVFPSAQCTIGPWIDRGFYYDFYYPEGFTDQDMKKIQKE
FT                   MYKIIRKDYPLRREEVSREEAERRIREINEPYKLEILEAIKTEPITIYHIGDEWWDLCA
FT                   GPHVESTGKLDQKAFALESLAGAYWRGDETKPMLQRIYGTAWENEAQLQAYNDFKAEAK
FT                   RRDHRTIGKDLGLFSLQQDNAGGGLVFWHPKGAHMRHMIETYWKDLHLARGYELLYSPH
FT                   VARQELWKTSGHSDFYSENMYQPIKVEDEMYQLKPMNCPFHIVVYQDGYYSYKDLPIRW
FT                   AELGTVYRYERSGTMHGLFRVRGFTQDDAHIFCLPDQITDEIKSVLDLTEEILSTFGFK
FT                   EFEVNLSTRPEKSVGDDKIWDTAEGALKDALQMKGWDYIVDDGGGAFYGPKIDIKILDA
FT                   IGRKWQCSTVQLDFNLPERFDLSYVDRENAKQRPIMIHRAIFGSLERFFGILTENYAGE
FT                   FPLWLAPIQVRLLPVTDEVSDYTEGVAKKLRDAGVRVEICTGQRLAKLVRTAEKAKIPV
FT                   MAVVGREEAENNTLAVRTFKDGDVGTLSVDEVLSRVTTANATKGQSF"
FT   CDS_pept        complement(48794..49456)
FT                   /codon_start=1
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682901"
FT                   /orf_name="OSTLU_35416"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ABO97109.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI00015005DE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL5"
FT                   /transl_table=1
FT                   /translation="MVEQKVYDMARAVEDSVDDELHRLEKMDGDALEDIRRKRLEAMKS
FT                   THEARKSALERGHGVVNDLDDEKAFFEKMKGEDKMIVHFYRTSSWPCEVMDKHVAAVAR
FT                   KHTETLVCRINAEKSPFLTEKLKIWMLPTLCLIRNTKVVDYIVGFDDVGGTDDFPTEHL
FT                   RLVLASKGVINYEGGDNDCDANPRAAKKAMNVIDKATNIRRGAKMALNSDDEDSDFD"
FT   CDS_pept        join(complement(50188..50532),complement(49876..50082))
FT                   /pseudo
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT   CDS_pept        50787..51785
FT                   /codon_start=1
FT                   /gene_family="HOG000201094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312378"
FT                   /orf_name="OSTLU_15982"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96887.1"
FT                   /db_xref="HOGENOM:HBG609944"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI00015005DF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL6"
FT                   /transl_table=1
FT                   /translation="MSARAFAFASASRAQPTRALARRRDARRRASNADGASSWTVVVDR
FT                   ASSRFGSDLLVERVSSDCPNAAFAGALVLTRADAPDAVLSERRDDGRESRSGRAVGRGG
FT                   VFDAFATLPATLEGEARRGKKTIGILGLGAGTCAEIMAGHHDDVDMIGWELDPAIVELA
FT                   RRHFAVGDLEREGRLRVVTGDAFEGCARSEIEFDGLIVDCFDENSVVVACLKDKATWEA
FT                   LAARLKPGGRVVANVSTGRGKGAKLDDAIACAQALADATSDEVTIWRAGACSIWNELIL
FT                   SGPEVNWRRVADEYGDFASLTKDWFYFKKPADAASGAPWLAKTLGVDNDSA"
FT   CDS_pept        join(complement(52316..52499),complement(51827..52191))
FT                   /codon_start=1
FT                   /gene_family="HOG000265007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682902"
FT                   /orf_name="OSTLU_32433"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97110.1"
FT                   /db_xref="HOGENOM:HBG609948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00015005E0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL7"
FT                   /transl_table=1
FT                   /translation="MARDDAAPASGDARLACVDFDLTVLARHSFAERVTVERVEALELR
FT                   DVEREFVDVECFRAFLEYANRRGMDVKITSFGKYAVIQAYVDRVLGEGAMTRADISTPS
FT                   RVGVKDGCAVEGGKNRQIEELLREKYGEDAWEKFRGTVVLFDDDERNVEAAIRAGFRAT
FT                   HTPDGLTKAAIQSVFGDFD"
FT   CDS_pept        join(52648..53553,53614..55242)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682903"
FT                   /orf_name="OSTLU_15983"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96888.1"
FT                   /db_xref="HOGENOM:HBG609954"
FT                   /db_xref="UniParc:UPI00015005E1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL8"
FT                   /transl_table=1
FT                   /translation="MRGALAALVGALAASRIARASSQGVETPPLNAHVSARARVASAGM
FT                   DPNIEATAAAWFANLGFRVLEGATATTRGAWGGTARESDARFATSYCLDASTNTSALED
FT                   YDFVGWLPVSNAIEDVMSDRVDFKVVLFETMATEWWEHARTRAESAKALGDACGCGAGA
FT                   TRSTASTCGNEDYHYCDIYPCVWERAFGSATPDEETWKTKYIERVREIKSAAPPGRLLT
FT                   IPMTAAPVGHATAVKISKLIAQFLEITDDLDAFGEAYPFLRRDLNGVALSNVSIAWVAF
FT                   VVVASAYIGFFANKSDPARRFHARASTRATKPNSTSEAPHTSTMPDDGARAADHARGQR
FT                   KLDEFRRHKAEAKARSSEDARATRDDEKAAPSEAAEKKHDDVAVVKQKLVKAVKKGKAI
FT                   EAERDAARARAEAAEEARDALMKELEVVKAETGERAAAREEAEVMREQLKRNAEALAYA
FT                   NDESREAADAARAVAKKMEEELETLRAALREATAGAEKASRGEEEISKLREALREASEG
FT                   KASAEKQAESFKRAAEQTTSGAESRVLELNAELDAKSTKLSSLEAELLALSSAAEDEKS
FT                   ALAAENIRLASKLDEGRLALEEVEKEKEMYLAECERVLQQNEQHERMAEELKQRLRESE
FT                   MKAEAHADEMSSLKTSQDANKAVAEAEKRIAEAQSQLAMVQDDASHMQAAAESQAKELR
FT                   TKIQSLEAQIQSLEVALQAQRATPTPPSATDESIGLRQELDSANQQIKQLQSLLSDARA
FT                   SQAASSSFTNKKNEDFADTDIEGAVLTGGSYAFVPLQNQMKSLTNAPMLHHPIALEVAS
FT                   NFDRASVYLQRRPFVRLALSVYVFILHLIILF"
FT   CDS_pept        join(complement(55604..56869),complement(55477..55500))
FT                   /codon_start=1
FT                   /gene_family="HOG000265008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312379"
FT                   /orf_name="OSTLU_15984"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ABO97111.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG609961"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI00015005E2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZL9"
FT                   /transl_table=1
FT                   /translation="MRTRGSQEKGATDDGFGGERPTSKRRGRCVAHVDADAFFAAVEKQ
FT                   RNPRLRDVPVAVRQHGDIICVDHRARELGATKHMNPDKCRALLTPHGGEVVHVHSTDDH
FT                   MLSYEPYTRASYELHAKLYAACERLRVDGGTLIYQRASVDEAYVQLENGAKPSQRGKAF
FT                   AESIRRAIAEECGYSVSVGVARNKMLAKIASKLAKPNGVVVIEDEADLERCFRQLPSSH
FT                   LPKCNEPLIRRNLALHNLRTAWDVRELNAKRLEALVGLTRERALALCKAAHGVDDSEVV
FT                   HKVHEKNTLSSSMTLTMVPKPLPKNVGSDVGVTGGPAGWYNPLTCGERERIGLTLGARA
FT                   RDLYSTIKVHQAYTERWPSTLTVKMAIEGTSVQYSKSAAFPVKFEDATSETAEDVLTKK
FT                   ATELALLTVGKRTTDKIREVAVVNSNSKET"
FT   CDS_pept        complement(56877..57269)
FT                   /codon_start=1
FT                   /gene_family="HOG000232015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682904"
FT                   /orf_name="OSTLU_35741"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97112.1"
FT                   /db_xref="HOGENOM:HBG584735"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI00015005E3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM0"
FT                   /transl_table=1
FT                   /translation="MTRAFPSLRQILLLQRDVPRAAAFYERALGLRIAVCTETFAELAL
FT                   DSRGADSTTGNAPTLALQRAEHESQLQTGYTPILHFEVDDVQTRVNAALTLGGRLDGKI
FT                   QYETHGAVACVRTPDGHMIGMYQSTP"
FT   CDS_pept        join(complement(60319..60393),complement(60061..60225),
FT                   complement(57349..60033))
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007457"
FT                   /orf_name="OSTLU_35547"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="ABO97113.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00015006B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM1"
FT                   /transl_table=1
FT                   /translation="MDANLYDEFGNYVGPEIGSSDDDDDDDAMDDDDLNASAITLAEDK
FT                   KYYPTAEEVYGEGTETLVENEDAQALETPIVAPVKRYVGGSVGAQVQSQDAEVAMKVSE
FT                   EFLVGLHGESRRMGRNVCVAGHLHHGKTTLFDMLLECSHDVNYDWLANDKQLRYTDTRM
FT                   DEQARGISLKSTPMTLPLQTSRGKTMVFNVMDTPGHVNFSDEVTASMRLADGVLLVVDA
FT                   CEGVMTSTTRQIKHAARDGLPVCVFISKIDRLIVELKLPPADAYHKLRHTIEEINGLIE
FT                   TFYTPDADGALPTVSPENGKVCFGSALYGFSFTLESFAKLYVDVNGVLVDHKEFAKRMW
FT                   GDVYYHGDTRMFKKKPPPGGGERTFVQFILEPLYKVFSQVVGETIDSVSDKLKEFGIKL
FT                   KPKETKANTKPLLKMTCQKIFGAASGLADMLAAHIPTAEEGAAMKIERAYSGPVKNGGK
FT                   LVDAMRACDPDAPAVVMVSKLIPKSDCSAFDALGRVMCGTLRKNDRVRVLGENFSPDDE
FT                   EDSVVKNVTNMWIYEARYRIPIKEARAGAWVLIEGIDQSITTTATLVPEKMPKGYDDDL
FT                   YAFKPLEFDNKSVMKIAAEPLNPSDLPKMVEGLRKITKSYPACVTKVEESGEHTIMGTG
FT                   ELFLDSVMKDLREMYSEIEVKVSDPVVCFNETVVETSSLKCYAETPNKKNKLTMIAEPL
FT                   DKGLARDIETGKVNLSAPKKQVSDFFKSEYEWDALAAKSVWAFGPDAAGPNALLDDTLP
FT                   SEVDKGLLAAIRDSVVQGFQWGTREGPLCDEPIREVKFKILDAVVADAPLQRGGGQIIP
FT                   TARRCAYSAFLMATPRLMEPIYEVEIQSPADCMSAIYTVLSKRRGHVVSDAPKPGTPVY
FT                   TVKALIPAIETFGFETDLRYHTQGQAFGQSYFDHWAVVPGDPLDKTVVLRPLEPAPVPH
FT                   LAREFMVKTRRRKGMSEDVTVSKFFDDDLLIELAQADTELAGLF"
FT   CDS_pept        complement(<61023..>61379)
FT                   /codon_start=1
FT                   /gene_family="HOG000036993" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682905"
FT                   /orf_name="OSTLU_8826"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ABO97114.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG715383"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI00015006B5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM2"
FT                   /transl_table=1
FT                   /translation="IMAAGHRTTASNFTVNLWHVARYEHIQRGIEEELEALGGRPPTFK
FT                   DVQDGRLPYTQRVVKESLRKYAPINLFPRLAEGADTLPSGHKVEAGDFILLSTYAMGRN
FT                   PRVWENPEKFDPDRF"
FT   CDS_pept        complement(62883..>64085)
FT                   /codon_start=1
FT                   /gene_family="HOG000198064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312380"
FT                   /orf_name="OSTLU_87673"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97115.1"
FT                   /db_xref="HOGENOM:HBG560668"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI00015006B6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM3"
FT                   /transl_table=1
FT                   /translation="VRVDAAVGSWSRARATYFDAPDAWKKTFAKQIFGDLYGNACGFVN
FT                   KGEGLESNENLPYARDAVAAVADYDLKLHEGACGSCFEVRCVSGFVLKDFSGGRIEYSR
FT                   ERGFWEVDPDALDSYGRKVPARPAKRDDATSTEYEFVRCWDESLVIKVKIIDTCPCDYE
FT                   YGTQEICCGPVPHFDLSFYAFEKLAHPIQGKMNIEFRPVSCGEDSRRLDVDLGARARVE
FT                   AKIYDGGLGAGWALLPYRDRWLVINREGYGRMESSSALCGEFSPRGRVAFHCWLCEISA
FT                   KPFANVSSVSVWIRISCTDNFDVSLIIGLSHRTRKQWRNGTVLTPAVETQVGRKFRLDP
FT                   GSSSSDYEIDAQCGRSFVVPIDAFRASSSDLARVNTLAIEVPSDVSDPVSFCVDALRAR
FT                   S"
FT   CDS_pept        complement(<64204..>66030)
FT                   /codon_start=1
FT                   /gene_family="HOG000185831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682906"
FT                   /orf_name="OSTLU_1178"
FT                   /product="Predicted protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="ABO97116.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG713547"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI00015006B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM4"
FT                   /transl_table=1
FT                   /translation="RRGRALLGLTATDLRGGLLGQTIVTLELASRPNGSDALPLPPHKL
FT                   SPHDVVCLRPNKSSAEGEPLASGVVYRIRDTQIELACDDMPDELSGTLRLERLSNEATH
FT                   KRLVSAVERVGKYGGSSDAKQPGAHLVGVAFGDSKPRVSKTGKEVEWINTALDASQRGA
FT                   IEHALRCVDFALIHGPPGTGKTTAVVEYVAQEVARGSRVLACTASNIAIDNLVERLMKI
FT                   KLPEGGEMRLVRVGHPARLLPSVLAASLEAQLLASDNSKLAKDCAKESKILRRKLLKLN
FT                   DRKDRVERNEVRKELRVLAKEERNRQKAAMRDVVDGARVVCSTLSGALSGTLKFQDFDV
FT                   VVIDEAAQALEAACWGAVLKGKKTVLAGDHLQLPPTVISDEAQAKGLSDTLFQRLHDMY
FT                   GDLVARMLTVQYRMHADIMTWSSEAMYQGKLTAAESVATHRLRGDGEDDPPVLLLIDTA
FT                   GCDMDERVEEDGESKENPDEAAVVMEVVRRLVARHDVAVDDIGVITPYNGQVTVLRELR
FT                   ARDDALKNLEVSTVDGFQGREKEAIIISAVRSNASGEVGFLSDSRRMNVAVTRARKHCC
FT                   LIIDSDTVSSDRFLATLVEYFETHGDVASAAAY"
FT   CDS_pept        complement(66660..67931)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682907"
FT                   /orf_name="OSTLU_32441"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97117.1"
FT                   /db_xref="UniParc:UPI00015006B8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM5"
FT                   /transl_table=1
FT                   /translation="MNLGGWASASLAKAKAVVKEAAASDAARALRRDLKTFSSHVVGDD
FT                   GARTRVVREDDDDAEDGNEDARDDAPKTADAVRLAETFASGAWAAFGGAANKAKRALEN
FT                   AEGVIENAASDPKTFATNVTKKTQSVGMGAFSALTSVVKATADVLAGDEDDDERAAAIL
FT                   VERLADFGAATAQAHVEVACERAMDALLNGASEDAQRRVRELVRELDATLTAEQSTANA
FT                   APPASPGDPATLVAVPLGDDAARAHDVESSVLVALIAAVDARAEEIGETLASTSGSSRD
FT                   NFADTVAAFEEALDELRDECVCDGLAKLSTTTLEKIVRVVDSIRGGDWLDVDPVPAAVL
FT                   ARERVAGYDDDVKIFIEATKEATTALARRAHDALRDVWPRDAPTLLDVADASFEQLARD
FT                   ERACVDVTRRTLRQLAWVIAASSK"
FT   CDS_pept        68421..69341
FT                   /codon_start=1
FT                   /gene_family="HOG000265009" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682908"
FT                   /orf_name="OSTLU_92973"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96889.1"
FT                   /db_xref="HOGENOM:HBG609990"
FT                   /db_xref="UniParc:UPI00015006B9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM6"
FT                   /transl_table=1
FT                   /translation="MFYYLAWRSLEAIARCWRATRDAFGFEPVGAAATLGVVFVERVAR
FT                   RAPGAIGDAARVVSSAAMCARGRGRGGAAERLRDAALATCSHESDFAVACFAGSMFAKM
FT                   AETERRVREAVGTRASAPATVAFALALGMATNAAAAASARALGYGDACWRGAGGLVFAL
FT                   KTYRARVDYARGYRGRVSFFGFIDVPAETASVAEIVILALMDSSPTALNLYGAGAAVGF
FT                   MVASFERETMRGLACATRGVKKLLGVALGPSVRVGSRVVLARMRNASLNGNWGIVVETR
FT                   GDQVTVSLDVDGRNITALRDNLIVV"
FT   CDS_pept        join(complement(69614..>70111),complement(<69416..69511))
FT                   /codon_start=1
FT                   /gene_family="HOG000237936" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682909"
FT                   /orf_name="OSTLU_8154"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ABO97118.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG284653"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI00015006BA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM7"
FT                   /transl_table=1
FT                   /translation="WSSAFGDARGRPLLVDVGTAKGGFIKALSTERAEAFTRAKQGVEF
FT                   NLLGVEIYPPLVRQANAWVRANEARLRLPVHFVSANVNVSLESMNLPNVRAVCVQFPDP
FT                   WSRGRHFERRVMTPEFARALANVLPSGGELFCCSDVKALASEMYDVVAANDDFIIDEAT
FT                   YARPVRNRRWLRANPYEAFTERDIVCEGKWRPVYR"
FT   CDS_pept        complement(70803..71468)
FT                   /codon_start=1
FT                   /gene_family="HOG000115733" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682910"
FT                   /orf_name="OSTLU_35431"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97119.1"
FT                   /db_xref="HOGENOM:HBG609998"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI00015006BB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM8"
FT                   /transl_table=1
FT                   /translation="MSAAAAAPALRLQYFNIEGPAEKIRLTLSIAKIPFRDDRVAFEDW
FT                   PSVKPTTPYGQLPVMYVDDEAMAQSDAILRYCGRLAGLYDEQRASEIDEAVSLVEDMRE
FT                   SWYPNLAVGMAPEKYNLEKGSDAHAATTKAMRERWIREELPRYCGFISKRVAGGKFLCG
FT                   DRVTIADCALVPLLRRFRSGGIDHVPKECLDAFADVVAYYEKFHAIPEVAAWYAAKSA"
FT   CDS_pept        join(complement(75091..76035),complement(74688..75000),
FT                   complement(71692..74594))
FT                   /codon_start=1
FT                   /gene_family="HOG000265012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312381"
FT                   /orf_name="OSTLU_50104"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO97120.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG596716"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI00015006BC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZM9"
FT                   /transl_table=1
FT                   /translation="MSHAVHREVHPPTGVDHAVTAYFTRPVGDGGDPNLIVASANRITV
FT                   YAVNRRGDEESLDVCAEFDAQGAIGSMSVLRRRFGAPRNQRDALLIAIRERKLSVVEYD
FT                   AATGDVCCSSMHSFESALGCNPLGTTLRMSREAPLVVSDPEGRCAAVVLREDGVAGKVR
FT                   VLPSVDGGLGLVANDDEGRVRGPAASVRESFPLHLPGVRLIRDACFLHGYGEPALAVLY
FT                   EKTPTWAGRYNLSKDTCEIVALSVDVDKQKGTVIWRRQNLPSSSYKLTALLPPLGGALV
FT                   FSQDFLLHESQESSSVLGLNTFGHGGPQEGNDAEITLDGAQASVVSEDRVLVTTKTGAL
FT                   LLLALHTDGRSLRRMMLQRAGGAVLSSGMCLLSRDLLFLGSRIGDSLLVKFTPKEEPTA
FT                   PLMLPDAEDESEDEATEKSKDDDDELEALLYGTTKTETVQTDAVQTEKKREGLAGIIPG
FT                   LKVAGYDLKVKDSLLGVAPVVDIAVGASAPMGSNKNERTELITACGQGKNGALAILTRG
FT                   VQPELVTEVESGTLPNLQGLWTLHYRKEGSKEEREPFHHHLLLSMKSSTMIMETGEELQ
FT                   EVSASLEFITNQATLAASNIFGHYCSVQVTGTGIRVLKGGVKVQDVGLQDMDAPKGAAI
FT                   ASAQILDPYIIVRLSDGSIRLLSGDEKQMSVSLMETGAIPTSSVTAFALVDDSVEAADA
FT                   AGGGERKSGWIHRAATNGTITGLEGNKKSGACNNSEAIVALTREGGSLELFSLPSCTRI
FT                   WCADGLSEGMRVLSPQTPVNAESSVPEIVDIRIDSFQDAHERPLLTAVRGDGTLLLYKG
FT                   FIVPAGTTYEGQDEPLEKNELRFSRVNVDVEGSGLNVAGIGAAGQLRDSLAGARLTRIG
FT                   NVGEGQGVQGIFVAGPNPLWLIVRRSRVLALPTRGEGEVVAFTVFHNVNCPHGFILGTA
FT                   LGGVRICQMPSKMHYEAAWPVRKVALKCTPHTITYLPDFKLYALVTSAPVPWVEREIEQ
FT                   DNVHGIALAKVRRERAKANDDMELQYSVRLLVPGSLDSAWQHALEPGEHVQCVRNVQLR
FT                   DINTGALLSLLAVGTAMPGGEDTPCRGRVILFQMVWERDAESMDGYRWKGQVCCVREAK
FT                   MACTALSALDGHLIVAVGTKLTVHTWDGVELNSVAFFDTPIHTVSINVVKNFILVGDLE
FT                   KGLHFFRWKANGFEKSIIQLSKDFDRMDVVSTEFLIDGATLSLLGSDMSGNARIFGYDP
FT                   KSLESWKGQKLLVRSAYHVGSPISRMVRFNVEGTTAKAAPGERPKGTNRHAVFFGTLDG
FT                   ALGIFMPTDEPTYAKLHALQRELNTTVRSPIGCNPRTFRTPKVFEGKHVQLLAPLDVLD
FT                   GGLLSKFETLTFTEQRAVAERSGVDRDLALGLIQHLSASNAFV"
FT   CDS_pept        76480..77769
FT                   /codon_start=1
FT                   /gene_family="HOG000265013" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160726"
FT                   /orf_name="OSTLU_12682"
FT                   /product="FBT family transporter: folate/pteridine "
FT                   /protein_id="ABO96890.1"
FT                   /db_xref="HOGENOM:HBG411578"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00015006BD"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN0"
FT                   /transl_table=1
FT                   /translation="MSPEVYAIALVYFVQGVIGLSRLAKDFYLKDELRLGPSETAMILS
FT                   ISQAPWLIKPLWGFLSDSVPLFGYRRKSYLMACGAVGCLGWASMATWVDAPETALVAFT
FT                   LGSLSIAFSDVLIDSIVVAKARGEEQGVSGSLQSLCWGFVAIGSIVSSYFSGSLIESYG
FT                   TRFVFGATAVFPLMIAGASTLVQEKPIVETAQVSSEGVLSDFKAMSGKLFQVAKRRDIW
FT                   APAFFVFLWQATPSAGTAMFYFNTNELGFSPEFLGRVALVRAFCALGGVALYNGYLKRV
FT                   PLKKMFLWTSILGTALGSTQLLLVSRMNLELGISDKVFALTDTAVLTVLGEVSFLPVLV
FT                   LAAKICPEGVEATFFAALMSLFNAGGVTSEFLGAGLTKSLGVTADNFDNLFLLLSICLV
FT                   TGLLPLAAINLIDEVKDDDADDVESAQKNA"
FT   CDS_pept        79002..79763
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20855966"
FT                   /orf_name="OSTLU_35363"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO96891.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00015006BE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN1"
FT                   /transl_table=1
FT                   /translation="MSSSTSYVPRGPIERARVAVTGANRGIGLELCKALLARENVVEAG
FT                   CRRASDALRALERSSDGRLIVSEGVDVGDDAAIDAWARAMTTRGRRLDVVVNNAGVVGT
FT                   NGYDAWDLETTTAEEMMYVFKINCVGPTLVVRALLRHGLIGADANAPSLVGNVTSKVGS
FT                   VEDNGSGRGYSYRASKSALNIVTKSMSIDLASRGVHFALLHPGWVKTDMTESRGLIDAE
FT                   ESARGLIRVLQGEFGDCERFWFDYKGDKIPW"
FT   CDS_pept        79999..81252
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20007458"
FT                   /orf_name="OSTLU_32448"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ABO96892.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00015006BF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN2"
FT                   /transl_table=1
FT                   /translation="MDRVPSADDLMATFLWNAQRASAGTPSNGTSGAAAHGARGVNRTP
FT                   SQHEMESYYNAMMASAAHGAHAGFGAYGALDGSIAHARDAAGGAGSAPGSREGTPGIPR
FT                   VASIDVLRKMIMSGGLGGGGGPGGASPGSATPTTAAAFSAFASGANLDALGAAVAMEQS
FT                   KADDEGKKTTTTRSGAKRSGRKPAAKAPAAKKAKAPPAKKAAAATTTRGGKAAKDAVAS
FT                   PAKAAAKAPAAKAPAAKAKAVAAKSEPLSSDLDHDSDGDSRDGDGNGDMRRRRRMLSNR
FT                   ESARRSRRRKIEHVATLEGQIAQLTAELTAALQHTQGVEQRYQALVRENHTIRAEKDRL
FT                   LQLLREAGPPGGGVTTPKTGSAMERKSSLQRISSNGDIKGELGKGSPTIGLGTGFVPFR
FT                   SLQSYENLLLLQQKSEKQ"
FT   CDS_pept        81676..82017
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682911"
FT                   /orf_name="OSTLU_32449"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96893.1"
FT                   /db_xref="UniParc:UPI00015006C0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN3"
FT                   /transl_table=1
FT                   /translation="MKSPLGIVFEDVDGDIAVVEFYDESDLGPRGRGIREGDVLRATSA
FT                   MIPEMRYPKLNVIGGGVGRPGWRRVMYTCASSQDGNLDDVTFDQAMKAIGSNAKAGNYD
FT                   VELVFERRA"
FT   CDS_pept        82531..85395
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682912"
FT                   /orf_name="OSTLU_32450"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96894.1"
FT                   /db_xref="UniParc:UPI00015007A1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN4"
FT                   /transl_table=1
FT                   /translation="MERELEQIVDEERRSGFESDDDDDGGFDDDLIDYDDEDEDEDDDD
FT                   DFDDAFVTDEYSFSSDSHSSIDETQEGEVQQTQEAFETVVPETQVLISQQANDDVVIIP
FT                   DEDADEIPPGVNDAIEVRDANALPTEDLIRLLKERMRSGEAREIEARLESEGFVRADRD
FT                   VPRATPAQTEPIRRRGRGPDRRPRKRRRRVVEPGQRTLHDVGFGTGAENGAERAVDDDD
FT                   GDIVVEGVSRHIPRLDRPPVPSTVDELYDVWERTAKDLVPRDASIYSNFRYAFGDESER
FT                   GERYREKEMKDIGNLLFKYKADKKPGQHAMLKGREREGKTGALFSITLAALLLNIRVVI
FT                   LCAPLKVAPICDMVRKLRRAGFGRMYDTQHTLGPVQAKRNKIPSAQMGQIYVASLCTLG
FT                   DLKKVKNWINCQKRDGQLTLTLMDECDELTQGKGHSTIEIEHRVDPDTFAQYIRQERRG
FT                   EDYEDVLDVPSDRKARGKNFKAQIAKASQYFRQHVHPETQVIACSATLSGYVLNPIGVF
FT                   RNDLPTSIFKVFPKDGYCGIERFKIPEGCELEHDGNLSLEAFSESNAVGKLLQRFYTRR
FT                   NECDGQRLQPLPGSSATEIALRGMLFLSCTPKVNVHGGVHDLAKTVTQMVDSWGTGISS
FT                   QKTLFICYVGSPRVLFAGSWQSMPSGYSFEAIYNETASRVKKEKFANVSLRKDEPFSKV
FT                   CTHVVLIGYNLTRRAMTAAFTPKDEPGVLCKIQYGIITAPKTTAVDTTSQRVNRPSHEF
FT                   AQHVVPENYSVDVAMWPQTLEVCQRYREMEDKMVEEQRGSPKIHAEFRQAIDVYQQGLD
FT                   SHIVSKRRIPLDCMSNTGRKERYRQQSAVDPDEIEHLKAFKVWLENHEYQPGKKLHQES
FT                   VRVYYAIIRRYFVSNADIGDIIKEVKDWVERHPEASDSEENECNPRSAASERTSERTSE
FT                   RTSERFLALARKHFLSFWEDRSRG"
FT   CDS_pept        complement(85472..86782)
FT                   /codon_start=1
FT                   /gene_family="HOG000265014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855967"
FT                   /orf_name="OSTLU_87679"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97121.1"
FT                   /db_xref="HOGENOM:HBG559552"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniParc:UPI00015007A2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN5"
FT                   /transl_table=1
FT                   /translation="MRASIARASTMRANASSNARRPTRARIARSTASRARPARVARAPR
FT                   AFFEDQEDDFDLSPSTTATATPDAWTTGTFTPLDERCVAFGVSHLVEGAHDAAEYILRR
FT                   GPKVVVVETAVTSEHGDATGNAVNYEQGVTAMMVDAATAPEALVFVTRLAGALKGELGP
FT                   IADSPQWENMKAQLPPEVLVYAAAFAVGATVIYGDRPKAVTYKRLMATPTLEELDGTFA
FT                   AQSERNYRLLLPEDHPLAAKANERVDDCFERIIIDERDRVMASTIKECAEKTDDGTVVA
FT                   VIGVDHIAGVSRIYRDNFAAAENDAKIAELNAAPEGAPDSMGVRVALAQRLMGLRCPPA
FT                   LVDDVMRTLSWDVQNLSAADANEFELVSEVYGSPRMLMACVEDKELLDAVIGGFKCDYS
FT                   EEVLAPVRAVRPINGGKGYSDEIVNALRTSSYVNFKS"
FT   CDS_pept        join(complement(87097..87480),complement(86849..86959))
FT                   /codon_start=1
FT                   /gene_family="HOG000265015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682913"
FT                   /orf_name="OSTLU_32452"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97122.1"
FT                   /db_xref="UniParc:UPI00015007A3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN6"
FT                   /transl_table=1
FT                   /translation="MARASTRRDARGARSDASRRRATTRDDAASTNLFVPLAVVGAVAF
FT                   ALLRRALGRGGAPATTRKTPTKAPSSASRAATAALPRHARSNNKKNRARRAGKRELAEA
FT                   RRREEDVARAKSEAKARKGNDVPKDKDVVGGEAGKTFTTTSHVKTSAWAHDIDARRASG
FT                   A"
FT   CDS_pept        <87741..>87986
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682914"
FT                   /orf_name="OSTLU_9462"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96895.1"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00015007A4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN7"
FT                   /transl_table=1
FT                   /translation="LLAELRAHEDAEPFAVPVDARYAPDYYAVIERPIDVATMRARAGA
FT                   SAYASKDAFAEDLALMEANAVAYNGAGSTVAKMARAV"
FT   CDS_pept        88005..88817
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007459"
FT                   /orf_name="OSTLU_15997"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96896.1"
FT                   /db_xref="UniParc:UPI00015007A5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN8"
FT                   /transl_table=1
FT                   /translation="MLRHVPRVDFETCERVAAYAARVERGETLEGEGESESESESEETR
FT                   ENDADEPGTKSWRKRTLETRVRRVLRAKALADAPVGMRRACRPRSARGMLEFMRASEDH
FT                   VDACVGARAFDDDDDDDDDALPEDEGFVANAVPTLPKYSATAECVSAEALDDMMMRSIA
FT                   VIIDARSRVGKASIEYSMTSAAAKLLLSVADDFTARISVDVAKALAARELERKRERARA
FT                   TVNASGINVPEIAHRIGLRADVARVAARAIKKFLERPLGPHPRSRSKT"
FT   CDS_pept        89002..89421
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682915"
FT                   /orf_name="OSTLU_92976"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96897.1"
FT                   /db_xref="UniParc:UPI00015007A6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZN9"
FT                   /transl_table=1
FT                   /translation="MSPSGSLARADSASSSPLASERADSVGDLPRIPLGFGAPTRNHAR
FT                   TDSSCSTDGLISRDVDVERALGDFAETSDGGVARASTSPLAPRVSRGKVSRALASVGDY
FT                   FTERANRRLKFAVAIALVLALVVLIGMPLRAWTKG"
FT   CDS_pept        <90622..>91497
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20855968"
FT                   /orf_name="OSTLU_5951"
FT                   /product="MC family transporter: aspartate/glutamate "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ABO96898.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00015007A7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP0"
FT                   /transl_table=1
FT                   /translation="LVCGGIAGAFSKSCTAPLARLTILNQLQGTNAVPGWEAAAGRASI
FT                   VSSLRRIVATEGVTALWKGNGVTIIHRLPYSAVNFYAYEQIMNVLDKVMTTLHFDENGD
FT                   PAVGAFKWGFAQRLLAGGSAGCIACTLTYPLDLIRTRLAAQTTVKHYNGIADAFMKILR
FT                   DEGTKGLYRGLKPTLIGVGPNLALNFAAYETLRNHLQSLDHGMYPMAVDLASGSAAAVV
FT                   SATATFPIDLVRRRMQMRDAVRGDSFVGVFKRVLAKEGVTGLYRGILPEFAKVAPGVAI
FT                   TYTSYAFLKRL"
FT   CDS_pept        93180..94241
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007460"
FT                   /orf_name="OSTLU_32455"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ABO96899.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00015007A8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP1"
FT                   /transl_table=1
FT                   /translation="MYRLFQSEARMKERLFELMKRGRAAKKKHQQQRCSEHTSVYMPKT
FT                   VTQYHETTTPGRQPSHVQRVQQQWILREKPSRPLETVVLPPGARERLVADVDDFLSSER
FT                   WYVNRGLPWHRGYLLHGLPGTGKTSLVFALAGHFKLPLYTIRLSDERLDDEGLHWLFSN
FT                   TQRRSIILLDDVDAPGANAVFREPAPESTGNLSVSSTLSLLDGVTAVDGRLIFLTCRDK
FT                   LSLNPTLIRPGRFDVLMRFDAPSKEQIAAYYKHFYAECDVADDELWKMANSFAAIAVDV
FT                   DKMPKSMAALQALFIANKDDPAAALEAMQSRVTQQKSKRVSALGGALTRSRSGGETEQR
FT                   DAVTKLETIEANE"
FT   CDS_pept        94632..95468
FT                   /codon_start=1
FT                   /gene_family="HOG000265016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312382"
FT                   /orf_name="OSTLU_16000"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO96900.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG559564"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniParc:UPI00015007A9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP2"
FT                   /transl_table=1
FT                   /translation="MTVLWGTTSTQAEKKELMSAFIGSAAVETMLSLDNLVVFHQIFGT
FT                   FKVPPSRRPGILVAGLPIMLVVRVTLFLSFHGVYTYVRVLFVLIGVFIIYQGVCVAYFS
FT                   EDDDDNDDLSSNWIVKGVRGCFGNRMSTKYEGSAFYVRTPDGALQFTPLILVMVFIEAS
FT                   DLMFCIDGVSTIYVVGHTDLLAVVCGDCCAVLLVRALYPQLQGTVEIFPDLNYAVAATL
FT                   VAVGVDMILTASKRELPVFVLVCFMVAVFIAGVVSSLVRGLISKTCADRKPATHDV"
FT   CDS_pept        complement(96945..97946)
FT                   /codon_start=1
FT                   /gene_family="HOG000265017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682916"
FT                   /orf_name="OSTLU_32457"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97123.1"
FT                   /db_xref="HOGENOM:HBG610026"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00015007AA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP3"
FT                   /transl_table=1
FT                   /translation="MNSLLKVCTWNAQMLPGVFAGQGGTRTDIAKRAHAMANNILCCSR
FT                   ADAIDVVCLQEMWEVEAAKALKVALREEFPFVYAPSARCGLMIASKFSMVCNHFTALPA
FT                   KGVERLSFTKGVSTSFLRLTAAEDPTTRVAIVLNTHLQSDYWSSGRDTRAKQISCIKDV
FT                   VHRAEMECAGNGYEVDRIMLVGDLNIVAGSGEYEDLMNKFPGSVDLMAPLTDIDGSIAG
FT                   REGSTRGVDRSFRLTFPVARWRHVVLPCLGESRYIDLVPKVVLDYVIDLSSMVTRGVPL
FT                   HHRHADSGYVHHAMCRDARGLALSDHYPIVAVSRKFPDCKATRPQRPTALAA"
FT   CDS_pept        join(complement(99232..99353),complement(98334..98853))
FT                   /codon_start=1
FT                   /gene_family="HOG000246912" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682917"
FT                   /orf_name="OSTLU_32458"
FT                   /product="Predicted protein"
FT                   /function="electron transporter, transferring electrons
FT                   within cytochrome b6/f complex of photosystem II activity "
FT                   /function="electron transporter, transferring electrons
FT                   within the cyclic electron transport pathway of
FT                   photosynthesis activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="photosynthesis"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="thylakoid membrane"
FT                   /protein_id="ABO97124.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0042651"
FT                   /db_xref="GO:0045156"
FT                   /db_xref="GO:0045158"
FT                   /db_xref="HOGENOM:HBG286085"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR016175"
FT                   /db_xref="UniParc:UPI00015007AB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP4"
FT                   /transl_table=1
FT                   /translation="MIAQTLSNVARPRVVARARATQKSTAARAQFGAVRGFDPLRVSPK
FT                   ARGNFQVVASVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIALC
FT                   IGLAVMEPTQLGEPADPFATPLEILPEWYFFPTFNALRVIPNKLLGVLSMAAVPVGLIT
FT                   VPFLESINKFQNPFRRPLAMTVFLVGTFYAIWMGIGACLPIDKAITLGVF"
FT   CDS_pept        99907..100749
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312383"
FT                   /orf_name="OSTLU_32459"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO96901.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00015007AC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP5"
FT                   /transl_table=1
FT                   /translation="MARGRRAEAKAALDGAAVGRDDDDDDDATFALAALRAELPYHLND
FT                   ARGSLDAMCAVHAMCAREAREARGAEAREAWRRRRDAAARGVARRHMLGDDPRAALVWL
FT                   DALARSEPDEPAHFSAAGRAHLMMGDLEGARLCFEAAEKKTAALGEAATEAQRGRVLRD
FT                   RGDYFLTGLRFPEARTAFAAAMAKGETDVAAKVNSAVAAVYDGDLNSSRALLESGLANV
FT                   VNADVNSKARAFISPSVVKNLNSIYELTARSPAEAKRAMNDFIKLVAPEDFDVTCMAT"
FT   CDS_pept        complement(<100920..>101564)
FT                   /codon_start=1
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682918"
FT                   /orf_name="OSTLU_7084"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97125.1"
FT                   /db_xref="HOGENOM:HBG748253"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniParc:UPI00015007AD"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP6"
FT                   /transl_table=1
FT                   /translation="YVKSLVFGGLDGTITTFAVVAASKGGGLSTEVVLLMGFANLVADG
FT                   ISMGFGDYLSSKAELDYAKTEKKREKWELENYPEGEKREMIELFMARGVSEEDATMVIE
FT                   RLAKYKNFFLDLMMVEELGLMPPDETDSPAKNGLVTFCAFALFGFVPLVPYVFGRAIGG
FT                   ANGDALFGLACGLTAMTMAALGAAKAKFTNQNVTSSALYMLLNGTLAAASAY"
FT   CDS_pept        102712..103548
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682919"
FT                   /orf_name="OSTLU_16004"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96902.1"
FT                   /db_xref="UniParc:UPI00015007AE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP7"
FT                   /transl_table=1
FT                   /translation="MMKARDAEKTKENDERSPSEARTLFYSPYYDVPSDLGFPPAPRST
FT                   AGTGHSAAPSSTRGFSLKKMYHSAISAFKPFKRSRSPERAGKGTETGKTLRRPKARRAV
FT                   NANAKNATSSWFWVFDSPKSDPPANDENESGAVVNDMSIEEGANVLGEINRDFSANARE
FT                   TTTRLTTQPKNALHVRKTIRKKPPVAPAASKYHRRRTETLKNGQVRKCSRCAIEGDNSI
FT                   HWRRSYDSKSPFFGSDLCDRCGKAESRALAKLNSSTAKVVVANRRRTDTRAMPRRR"
FT   CDS_pept        complement(103656..104414)
FT                   /codon_start=1
FT                   /gene_family="HOG000265018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855969"
FT                   /orf_name="OSTLU_19583"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97126.1"
FT                   /db_xref="HOGENOM:HBG559568"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00015007AF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP8"
FT                   /transl_table=1
FT                   /translation="MSLDLKPGTNTISFAFNSRVWGLQEVSAFVYLWDWNIKLVISDVD
FT                   GTITKSDVLGHLAPMVGKDWSHDGVASLYSNITDNGYKMMFLTSRAISHASGTRKYLSS
FT                   LRQGDKTLAQGPVMCAPDPLSKALFREVVTRNPQRFKIRCLQDIRNLFPPGWNPFHAGF
FT                   GNRDTDVESYLAVGVPQHRVFTINPKGEVVCETTKRVKQYTLSEVNELAHEMFPPIEDT
FT                   CPVTGSVAEEQFNDFNHWKNPVDADFGTPI"
FT   CDS_pept        complement(<104814..105071)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855970"
FT                   /orf_name="OSTLU_46163"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97127.1"
FT                   /db_xref="UniParc:UPI00015007B0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZP9"
FT                   /transl_table=1
FT                   /translation="MRLGSNGEAYFADGVDDFDDDEDEDEESDIELGTGDEDEVGAVEA
FT                   LSALRLETPPKTTRPSTSGSSGDVEDGKRTMSEEEVATAVD"
FT   CDS_pept        complement(105539..106747)
FT                   /codon_start=1
FT                   /gene_family="HOG000213047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682920"
FT                   /orf_name="OSTLU_87686"
FT                   /product="Predicted protein"
FT                   /function="nuclease activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ABO97128.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI00015007B1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ0"
FT                   /transl_table=1
FT                   /translation="MHSFHGTFIRNCIVTHVIDGKTIRVLLNPDGGQQRSSTGDGWEDS
FT                   LVVGSEPTSRIPSDELDASSVDPTTWEKVDVRLIYVDTEESLDVKKEEQAYKPITPAGV
FT                   EAFDWLKKRLGSAADGRCGDVEVDIEFDTCEFMTSVSRAREYSLDKYGRVLAYVYHNGN
FT                   SVNVETVLAGQSPYFTKHGRSRLYHGEFALAEKLAIENIRGIWDPAGASLASFGMLEYS
FT                   RDYRRLLPWWRERELFIEDWRHWGHLGLTKDILNPRDARDYQKLLVAAAAREKATILVD
FT                   LQPTQSNLYDGVMQLIRYEGGKQGLCIFAGTRRYPFNLWMDDANSMESGRLQALLHARY
FT                   CQNARNFCFITGSLFIFHAKNRPQMLLESCEQVSDFPLRPDDMSQKLRGHHRAGAAKSS
FT                   PAA"
FT   CDS_pept        join(complement(107142..107719),complement(106804..106981))
FT                   /codon_start=1
FT                   /gene_family="HOG000265019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682921"
FT                   /orf_name="OSTLU_35668"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97129.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG589595"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI00015007B2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ1"
FT                   /transl_table=1
FT                   /translation="MVFDAVAQFVASVDETPRDVAASALTTIGAFVWVKAFDALADRGA
FT                   FASTTSRKLVHVTSGTFFACTWPLFSASGAARFFAAAIPLAQGVRLFGIGSGMIKNASA
FT                   VRAVSREGGKEELLKGPLYYTAVLAACTSAYWRTNPIGIVAMAMMCGGDGFADLVGRKF
FT                   GKGNALPWNEEKSFAGSAGFVAGGFGVASGLLAYFDAFGFIEATPTTYFVTLIIAFACA
FT                   LVESLPITSIVDDNFSVAITAIACGSLLY"
FT   CDS_pept        108292..108840
FT                   /codon_start=1
FT                   /gene_family="HOG000265020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682922"
FT                   /orf_name="OSTLU_32465"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96903.1"
FT                   /db_xref="HOGENOM:HBG610030"
FT                   /db_xref="UniParc:UPI00015007B3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ2"
FT                   /transl_table=1
FT                   /translation="MIEDALKGDSDAKSIAAKCRACPGTLLLSAANMRAHAASKRHRKN
FT                   LEKLGRANDETFVCFYPAVREDDGIVSDGEAETHAERLARLRAQKILRSAEGERAKGGK
FT                   FSLDQFDSSGDEASDDESDGDDDAKMTKRLAKKEFARKVSDSAPKEKEKRSRRHAQSKR
FT                   KSGKSKPGKRQRMAMKSAT"
FT   CDS_pept        complement(108990..109802)
FT                   /codon_start=1
FT                   /gene_family="HOG000265021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682923"
FT                   /orf_name="OSTLU_32466"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ABO97130.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00015007B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ3"
FT                   /transl_table=1
FT                   /translation="MATQAMYAQQMMTTMTPEAMGAAYYERQNAALAAMGPHMMASYAA
FT                   YVAYVQSQTYNVQAYAGMMGASPPFSGAYGTPAMGAAAYGGEATSARTGRGGGGAKKGG
FT                   KGGRAGRKGGVTQSIRACKATVKASTNVKAQKQKICVNCKSTETPFWRKDKDGIGSLCN
FT                   ACGLYAAKNHAPRPALLWRRSGATGSENGGSDKTGSDKTTEAVPSSSGDAAENKSKQDG
FT                   HTSLLKTSGSGDLTATTTTTTTTTTTDSDDARIAKQEAKLDGVGRGAE"
FT   CDS_pept        complement(110346..112175)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20855971"
FT                   /orf_name="OSTLU_32467"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97131.1"
FT                   /db_xref="UniParc:UPI00015008AA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ4"
FT                   /transl_table=1
FT                   /translation="MRGYGLRFTRDAARGETVLELRGPRQLITAQSCARTPALAELARY
FT                   WLLVQSSAAVRTLVSRQELRQWRRTRRARALAPWAKKEDFEGDGYVIDPTSEQLHLTLD
FT                   ETLLCCFLALEKKKGKSSSHYEYLSKLPTLEEYQAFIPAYLPMPYFVNLFGYGESKAAY
FT                   GYEPRCNADLRWLILERHRIERAVELTYSQIVSQVTYGNSSSRGPTGSRGNEITAGEFR
FT                   WAYAVVMSRSFQSPNPVSNDPWRDMFRRMDFCGIFMAPGMDFANHKRPREVSYVSSDGF
FT                   NGNGQVTMKALRNFKAGEFLHITYGAKGNTDLLLRYGFCFKENVEPDGSSNDRFRVDKD
FT                   DFRRFVCGADDEGAVKHQEIMLQLATTADYTYKPFVELLDVARAHFVEAEPILLADRED
FT                   AAPTRDDDVWDQEEDVFAANGTDTEDEEEYVAMYGADEESLKTDSYDGDVVSRDKHSAR
FT                   LRVETKALRALSEYLSTLQLVEPPEHADALALGKADVRELTSYSHLRELARIWRASRRR
FT                   TLDVYALAAHTRAESLLRDFDSADTRRGPSSPTARAELTPTRAQLLASRALVARLADAA
FT                   DARVAADALATARARVFRATALWDSARELHGHP"
FT   CDS_pept        <113115..>114011
FT                   /codon_start=1
FT                   /gene_family="HOG000198065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682924"
FT                   /orf_name="OSTLU_2246"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO96904.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG714950"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00015008AB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ5"
FT                   /transl_table=1
FT                   /translation="HDRNAKRLHAMCGANGGLYVKAGQFASTAGGVPEAYARRLSKLQD
FT                   EVAPSPRDAVLKVVRNEFGGRAPEALFETFEPEPMAAASLAQVHRAVLKSGRTVAVKIQ
FT                   RPGLERSIESDISTMSALVRFTRLFFPSFDFGFMVDEFKSRLEKEIDFEAEGRNCERLG
FT                   LAFADDARIDTPEVFWDLTTRRVLTMEFIDGEKLTNIEGMREKGLDPEHAALALSDCFA
FT                   RMLLVHGYIHGDPHPGNLLCRAHPDGSGRTQVVLLDHGLYSELTEESRKAMSNLWIAIA
FT                   VGDSVRAVAAAKALQVPD"
FT   CDS_pept        join(114532..114577,114681..114820,114949..115401)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682925"
FT                   /orf_name="OSTLU_12688"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ABO96905.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00015008AC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ6"
FT                   /transl_table=1
FT                   /translation="MSYAYLFKYIVIGDTGVGKSCLLLQFTDKTFQPVHDLTIGVEFGS
FT                   RMVSVASKQVKLQIWDTAGQESFRSITRSYYRGAAAALLVYDVTRRETFDNLSTWLQDC
FT                   RAHANPNMVITLVGNKADISHRRAVSTEEGEMFARENGLLFVEASAKTADHVEDAFIAT
FT                   AREVVKNIDAGLDVKDESNGVKLGYVAGGGASDTVGLNAPPRVEQSGCC"
FT   CDS_pept        join(115578..116584,116973..117579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682926"
FT                   /orf_name="OSTLU_16013"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96906.1"
FT                   /db_xref="UniParc:UPI00015008AD"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ7"
FT                   /transl_table=1
FT                   /translation="MANRYGDAGDESPITSARASDLARARVDGARGESANAFSQSGGTK
FT                   EDGPRSRKKRAVSPIDAIWQPEDLVVGRKSVVPKELSTSMRALSDIGNAGAAPAREADA
FT                   PNEIDVESYLLGQKHALESAFDKSLPQRQLLGALQLALHDVREKTSKLEASSSEIEGAV
FT                   RRSEGVQNQVTGDVRALTTSTIPAIERAIGELRSRMDAEERRKTMSLTALVKETAMRTL
FT                   FGVASLETAVGNFTRSVLFPPINEGDASAVDAVDKVDATPEYAQTLGAIFLVTALELAS
FT                   RTNEYIRSRAPPSVQRTTTTFTWGLNACRTLVWAAAAIECLQFTKVRCHALASIASSFD
FT                   AVDNAALETPSDEHSFDTDEHVNVDDGDDVDDARSTPETVEETQRSNGASLHASDATSA
FT                   TTKGDESRDEVSLEENTDPRANETNPTKKPTGETVTCGLSKNVDFLLVKTGHVKSISKR
FT                   KAKTTTVSQKKPSNEVALVEMPRASRTLTTANDKRSTAHTWKSCPFAIAQGSEPAPAGS
FT                   QQCGNCRALDLFYLDSSWNQ"
FT   CDS_pept        join(complement(118706..118741),complement(117827..118402))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16682927"
FT                   /orf_name="OSTLU_12689"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ABO97132.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0000E4B602"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ8"
FT                   /transl_table=1
FT                   /translation="MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTGTYISTIGVDF
FT                   KIRTVELEGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDMESFEAVKGWLN
FT                   EIDRYANENVNKLLVGNKSDLTSQKVVDYATAKAFADEIGIPFIETSAKNATNVEQAFM
FT                   TMANEIKNRMASQPQMNAGPRGNTVRPGEGRSVNAKSSCC"
FT   CDS_pept        119068..120252
FT                   /codon_start=1
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16682928"
FT                   /orf_name="OSTLU_35268"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO96907.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG715060"
FT                   /db_xref="InterPro:IPR007857"
FT                   /db_xref="UniParc:UPI00015008AE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZQ9"
FT                   /transl_table=1
FT                   /translation="MDADGAGARDDGDGRTANLVVTKPKDIGDADFANYFCTYGYLYHQ
FT                   KDMLEDQNRMTAYSDAVRLNPDSFRGKVVLDVGTGSGVLAMWAAQAGAKKVYAVEATHM
FT                   AVQARKIVAANGLSDVVEVIQGSMEEVELPEKVDVIISEWMGYFLLRESMFDSVLCARD
FT                   KWMKPGGAMFPSHAKMYLSAIKSNKSGQKYQELQESLNVWEDFVRNTHENYGIDLSCMN
FT                   GEYEDEQKEHYLNTAAWVDIHPSQVMAKPFTLASFDLNTCSMDDIKVLRDVDFKLRLFD
FT                   GLAGPSGETRVGAFAGWFDVTFAGSKENPCENPVELTTAPDANGATHWGQQAFYMFPEV
FT                   YASDGHFISGKFDMVRRKENQRLYSVRMNWTQSDTDAGPPNESIGTRGIVWQIE"
FT   CDS_pept        <120428..>121417
FT                   /codon_start=1
FT                   /gene_family="HOG000248210" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007705"
FT                   /orf_name="OSTLU_4906"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO96908.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG526757"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00015008AF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR0"
FT                   /transl_table=1
FT                   /translation="ARDAFDDEDYDESLQICDDALGTGDEGEKVALLCHRSKTFLAVGL
FT                   AQEAFADAVDAVALEGDNSEALLRLGIAAYEIGAYAKAREALERGVGAEPSGTSRRATT
FT                   MKWLEKAKTAEMKARDGGEDASPHANDERFKRAWYQSQTHATVEIFARGVTADALTLDF
FT                   NDACDVLRVTIDALSGGDAHAKMYDPYILELKLFGAVDRESGVVNVSPAKVEIRMKKKT
FT                   PGHWNDLERRPGGGLSTSSVNAYSEVKPQADKRTAKDWDALEAELDAELSEEKPEGEAA
FT                   LNELFQKIYMNADDDTRRAMNKSFQESAGTVLSTDWKDVGSKTVTPEAP"
FT   CDS_pept        join(complement(122457..122583),complement(121524..122320))
FT                   /codon_start=1
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683922"
FT                   /orf_name="OSTLU_35481"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97133.1"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00015008B0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR1"
FT                   /transl_table=1
FT                   /translation="MQRLMQSGGMPGAMPGAGDAAQVDTAEQVYISSLALLKMLKHGRA
FT                   GVPMEVMGLMLGQFVDEYTVTVVDVFAMPQSGTGVSVEAVDPVFQTKMLDMLKQTGREE
FT                   MVVGWYHSHPGFGCWLSGVDINTQQSFEQLNPRLVAVVIDPVQSVRGKVVIDAFRLINP
FT                   QTIMLGQEPRQTTSNLGHLNKPSISALIHGLNRHYYSIGISYAKSVLEEKMLLNLNKSK
FT                   WSAGLKVNKFDEQEKQNENVVLELKELATKYEKAVVEEDKLTAQELVVKNVGRQDPKKH
FT                   LSENVQKLMADNIVQTLGVMLDTICF"
FT   CDS_pept        complement(122627..124072)
FT                   /codon_start=1
FT                   /gene_family="HOG000265023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856218"
FT                   /orf_name="OSTLU_92980"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97134.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG610034"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00015008B1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR2"
FT                   /transl_table=1
FT                   /translation="MSIEERKQKPTKLLEDELGRPLHALQDDSLAAAEETFRRDVFASF
FT                   ESGRKLLGSHRVEDYLDEYYGESDRTPPLMLADTLSMSECIEFMRAFNVSSAPVLTGDA
FT                   KTFIGWCSVFDILRDVAAAIQRAKPPGREIVRETAALTGQPHVHSAWGVLRHAFRTVTS
FT                   AERLSGESVERREVELDNHRREWLSSISPEDVKNAIDEVLNMTLKEARRKTHSEEDGRM
FT                   VSRVAAADADLLELVRSGFLRHIVTAGDFIAPRQAHVCHRVCTYSLKPDDKDEMKEKMV
FT                   VEALVSQADIVQFLYDNSDSFDDALKRRNLTSLGLGARKSHRVFPDSDVMCVFPETRLL
FT                   DAFVMMHVTGHSCLGVVDEPRGKLIDVLSVSDIREAVFDVDALCDTVERYLKSRALTRI
FT                   PLVTLTEDADFIDVLGALAKNSIHHVFVVDLEGSPLRVVTPTDVLTRLALPSARKLGWR
FT                   FDSYEVHPDTFENNPATMIRPIA"
FT   CDS_pept        complement(124174..124527)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683923"
FT                   /orf_name="OSTLU_32476"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97135.1"
FT                   /db_xref="UniParc:UPI00015008B2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR3"
FT                   /transl_table=1
FT                   /translation="MANGETAPNAEATKSESKSATTNAETAESKPKSEKPDRRGRMKQL
FT                   ADLREELAERELELESKENELLNRDQTVQVLQQELELKTKLYELMKTERDKAIEESKLA
FT                   SGLCAQAQIGGGF"
FT   CDS_pept        125081..125797
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160994"
FT                   /orf_name="OSTLU_32477"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96909.1"
FT                   /db_xref="UniParc:UPI00015008B3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR4"
FT                   /transl_table=1
FT                   /translation="MHDTFGYGAQPGPAPGVYAPGEGANSGPGLMPFDGSSQKKRRNAA
FT                   AERIKKTFNPWHLVLVFMTLFLYLSYYSRKEVVSKRRVRKHKDGLEGDLREVRARMTTL
FT                   EHDLFVRSKEHETLTRELDSMRREHETTKHELEAKKIEVKEHVERAASKPVRAGDVSTC
FT                   QKEVKTLKTEMELMRHKCRVTELELERAKHEAEFMKEHIREEVIKEDIEQLEKQIEIDE
FT                   KAEAEAAAREEVSHFS"
FT   CDS_pept        complement(125875..126852)
FT                   /codon_start=1
FT                   /gene_family="HOG000243429" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007706"
FT                   /orf_name="OSTLU_16020"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97136.1"
FT                   /db_xref="HOGENOM:HBG610037"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00015008B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR5"
FT                   /transl_table=1
FT                   /translation="MTMVNAPSAGEKTSETLRATAAPAKPKANAEDSREGVAIEKGDLR
FT                   LLTYNVWFGDVAQAERLEALGKVIETCDAHVVCLQEVTPQALFVLRAQPWWDAYVVGPK
FT                   PPLQEYFSMMLFKRVVRSEVLKRDQYAFRNSQMGRYLDVVSHMRCPSSRATFALGTSHL
FT                   ESYISASRTSARERAVQMSECFSWLNQHENAIFMGDTNWDDKDGAVPLPDGWRDAWLEA
FT                   RPGDPGFTYDARKNAMLRGYLQKRLDRAFVKLKHFDVKRVEMVGTDPIPGVTYHKTVSN
FT                   RGKAQILELPVVPSDHFGLLLTLRGKSRKLDERGGNDIETVDLT"
FT   CDS_pept        complement(127204..128202)
FT                   /codon_start=1
FT                   /gene_family="HOG000265024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683924"
FT                   /orf_name="OSTLU_24759"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97137.1"
FT                   /db_xref="HOGENOM:HBG610038"
FT                   /db_xref="UniParc:UPI00015008B5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR6"
FT                   /transl_table=1
FT                   /translation="MPRARSTAALVAVALVARVATTAGAALASSCAPPRFSCASARATV
FT                   DDASKCHASFRCRIVCSPSASCVETFTIRAGEATLPTGETVTFNASTRERSALGPTTYG
FT                   GDAACSAVGCDAYATRLTTQNAALTERYDGKFCEVRETSERCALEGAPKDGSWTEFTVT
FT                   MKCRNKILPCGARAVAEIDFLGVVGSVAPGAPSPPTPPDAPPMPPKPPPPPPPPSTFAK
FT                   GGAGRAALRAALVVALSAVVAYAALGGAYVWALERGWVEGIAEPCWERDGAFCELLWCW
FT                   CAPAYWRASDEECLAAYEGRAAAETATREDVAQTTAPLLGNASSDDDDDDA"
FT   CDS_pept        128944..129186
FT                   /codon_start=1
FT                   /gene_family="HOG000265025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683925"
FT                   /orf_name="OSTLU_32480"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96910.1"
FT                   /db_xref="HOGENOM:HBG610039"
FT                   /db_xref="InterPro:IPR007726"
FT                   /db_xref="UniParc:UPI00015008B6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR7"
FT                   /transl_table=1
FT                   /translation="MSGEQAGPSFVTPGDAAAPSVVTTELIQKYLDENQQLILAILENQ
FT                   NVGKLAECAKYQTKLQENLMYLAAIADAKPAEPSE"
FT   CDS_pept        join(complement(130783..130851),complement(129269..130636))
FT                   /codon_start=1
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20856219"
FT                   /orf_name="OSTLU_32481"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97138.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG629124"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI00015008B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR8"
FT                   /transl_table=1
FT                   /translation="MVELRKRAKTPLATTASRSRAHEDDQPPSPSSPRAPKRRVSIDHA
FT                   KRVIEQGRARWRSLRQRTQSTLLMLAAASSIIVGGHAYAMMLCFAVQFAMAKELFAFVS
FT                   NAHAEENAPGEDTAALRRTTTTLRWYWFWTLSFAVYGRFAKYLYLGFMSAKEWNELLQN
FT                   GAEVSPGAWLAMHHTFLSYCAYLVGLVYFVLTLRKGRYAYQFAQFAWTHMIVAATTMTG
FT                   YFNVSNLLEGMIWFVFPLFLVIVNDIMAYVFGKIFGKTPLIKISPNKTWEGFLGAFVST
FT                   LVAALAMASYLQKFSYFTCPPSGDMYFRGIFSRSAKICAPNEPFIVSDKPITMFLGTVV
FT                   GPLATKLTGIATVRCSMFMVHSLALGTFASAVAPFGGFFASGFKRAFKIKDFAATIPGH
FT                   GGITDRMDCQVINSCFSSLYLSNFITHVGGSLTLGALLTKIELASDAHIVALYNALTKM
FT                   IEARGLSVGIDPSIQTIVQT"
FT   CDS_pept        join(<131517..131898,132115..>132455)
FT                   /codon_start=1
FT                   /gene_family="HOG000264749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683926"
FT                   /orf_name="OSTLU_5718"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96911.1"
FT                   /db_xref="HOGENOM:HBG609132"
FT                   /db_xref="UniParc:UPI00015008B8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZR9"
FT                   /transl_table=1
FT                   /translation="ISALTDARSLKKLDLSACGLSASAGERIAAVLDENGCPLERLDLR
FT                   GNAIGAEGTLALASALRKTKTLKSLNLAQNLIGGDGLRALASALAGETSMEELDIQHNG
FT                   CGDEGCMALATHGFGSRLETLLLDLDLSNNSVRDGAKWLAKSLKSGASNLKQLNLQANE
FT                   MTDDDAWYIADALGENKTLKTLNLGSNAFGDSAASDIASDLRENIALETLDLTRNGIGR
FT                   EGACELMDAMDENTTLRRL"
FT   CDS_pept        join(133184..133205,133505..133935)
FT                   /codon_start=1
FT                   /gene_family="HOG000233943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683927"
FT                   /gene_name="RPS27a"
FT                   /orf_name="OSTLU_32483"
FT                   /product="Ribosomal protein S27a, component of cytosolic
FT                   80S ribosome and 40S small subunit "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO96912.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI00015008B9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS0"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGGKKRKKKTYTKPKKVKHVHKKVKLATLK
FT                   LYKVDDAGKVERLRKECISPTCGAGVFVAQMFDRVYCGKCCQSWAL"
FT   CDS_pept        complement(134011..134778)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312636"
FT                   /orf_name="OSTLU_32484"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97139.1"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniParc:UPI00015008BA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS1"
FT                   /transl_table=1
FT                   /translation="MAASAPGSARRRIHELGMFAMDRIDPRERALKEMPKILSSVEIVY
FT                   PSGVDVGAVRRLVERTVVDGTKNARAATTMYALGAPLSMPMFLTPVSNFPLYYFLFRLW
FT                   SSTQATTSGKEAIRLLKTTDEAAAKAVEADVLGSTRVVECKRLRPINVLNSDTGREVST
FT                   MDEPHAMACCRLSQPGGEKFLGDEGPRVLFVPCDALAKVVREYHGVDDATATQQCASAT
FT                   VERLFGASGVVDLARSHKRYDEIYGVKDESALR"
FT   CDS_pept        complement(136915..137796)
FT                   /codon_start=1
FT                   /gene_family="HOG000265026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683928"
FT                   /orf_name="OSTLU_32486"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97140.1"
FT                   /db_xref="HOGENOM:HBG610041"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI00015008BB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS2"
FT                   /transl_table=1
FT                   /translation="MSVDEVFARVANAWNEVTSSVDAAWDAAWRSRNRANAEESRKKTA
FT                   LATGIVTERDARHARVPPYVFERDVGARVRVLDLASNAIVDVDDAIGSLRNAQKVNLSF
FT                   NAVRALPRAFSTLVNLKTLDLRGNKLTALPEDIDSLLALEDLDVRENALRALPRTLGKC
FT                   KRLRRLDASANALTTFDDAIAGLGNCADLEVIRFARNREMRGALPVAWAHAVKLKEIDV
FT                   DDTKCDGVPGEILLACDRLTTLSLRRTLVDVGTLKRTDGFESYESRRQGKHNKQLDSRV
FT                   LLDDSRLDERLR"
FT   CDS_pept        complement(137915..>138775)
FT                   /codon_start=1
FT                   /gene_family="HOG000198066" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683929"
FT                   /orf_name="OSTLU_92983"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /protein_id="ABO97141.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0033897"
FT                   /db_xref="HOGENOM:HBG559631"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI00015008BC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS3"
FT                   /transl_table=1
FT                   /translation="VIALVLARPVASSSPVESASSCPAVGTKTHFGCDDGVRATRRAFD
FT                   MWELARAWTPGFCASAPRACEKGECARSAAEPALTLHGLWPSYSTATKSDGRDGCYWPQ
FT                   NCVKPSWYPSSEKWTYAAREIPSGAAAERIAPAWTRDGLGAHEWAKHGTCASWIDVEGT
FT                   TRGMTQREFYNVTFALAEALGTPEVLLEATGSELSLADAQQAFGGASKVALGCTKSCVL
FT                   LQVVQCFKRTPDGGVGEAEDCPCVGVRDSRYDNSCAERCERVRVLSPEQTGCHADIASR
FT                   VASAR"
FT   CDS_pept        join(141139..141162,141384..142406)
FT                   /codon_start=1
FT                   /gene_family="HOG000265027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683930"
FT                   /orf_name="OSTLU_24762"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96913.1"
FT                   /db_xref="HOGENOM:HBG610042"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="UniParc:UPI000150099F"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS4"
FT                   /transl_table=1
FT                   /translation="MCAHACAEVMRENEDGVTGTTTCEACDRAHGSGRAVALRAFHECA
FT                   MSDEAYRAVGKGMKQTRRGRPSNKSKSEVQALDAEVSDETFWSLVKKSQIRPSEEPSFD
FT                   RVDLFSGDDGRGQMTSDDKDDEAFIDGLIRMPSFTMLDAEMNVRVDGSAANFGTPSPAE
FT                   SSGAPVRQAYNSIFESSQATGQMSRARATSQSDSAADGIDSMFMPGGVRSSNEHVEELL
FT                   APRVDGERNMFYDIDAAGQWRMKKPKKSGRPKKMSAARNARKPAATNSSAAYAANAPDH
FT                   SAKLPGGASRQQVLDRYHEKRKARTYGKTIHYEARKVRAETRVRVGGRFAKAEDRSCDV
FT                   SIKGAVPA"
FT   CDS_pept        complement(142728..143060)
FT                   /codon_start=1
FT                   /gene_family="HOG000171075" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683931"
FT                   /orf_name="OSTLU_32489"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97142.1"
FT                   /db_xref="HOGENOM:HBG610043"
FT                   /db_xref="UniParc:UPI00015009A0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS5"
FT                   /transl_table=1
FT                   /translation="MATPSAVGAYRALMRARAKAFAGDARALDAAHREIRTQFERARDV
FT                   DANDAKMKIAAAVEAATFVRTHVVQAVREGDEGAFRMTVDAAHRDVTISRDGEGEKGCG
FT                   GGGGVA"
FT   CDS_pept        143456..144661
FT                   /codon_start=1
FT                   /gene_family="HOG000265028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683932"
FT                   /orf_name="OSTLU_16028"
FT                   /product="Predicted protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="ABO96914.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG610044"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00015009A1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS6"
FT                   /transl_table=1
FT                   /translation="MEGMGDEAERGANAATIEPAREARAKKRILLLLSGAQMQDVKMVE
FT                   FARAFALEPNDDVWCVHYSRGATRYASAMYGPGRVAGSYKADEDSVTERLGVRVVPLRR
FT                   DDAEGAESERESSWLPEYVRAELLDRRLSGKSFVQAVEISGSSGKFSVEEAVQAIVDGE
FT                   FASAENDNWVCIPKPDLIVMGCRGHGLVRRALLGSVTQNVLNRIPVSTLFFRSSLPKIV
FT                   GASDLVKQKLGGVDQRVVCICMSGSNSSRRLCEYFVKEHIRSTDVVLLLHCLAESQRKQ
FT                   KDLSEADVEENLSRSYDLVQNFQKEHPGHGRVIRMVLQKETGSASDIRDRTIDFLNMTD
FT                   VNLAVVGRAISSGHLRSRFMSPYPQYCVTHAPCPVLVWNPPPSYIRSQSQTSAAEKSTV
FT                   AA"
FT   CDS_pept        complement(144846..145850)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160995"
FT                   /orf_name="OSTLU_32491"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97143.1"
FT                   /db_xref="UniParc:UPI00015009A2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS7"
FT                   /transl_table=1
FT                   /translation="MPRDDDDDDAFCVVLDARGRVHGAAIDGDEGAYFATRARDAFART
FT                   AAHRARLADSCRKIDALGTLWLGARDAPRCALERFVKSVYDAHARGVTRDDARSGVEFW
FT                   ARTRATAAHWDKDERAREIAGVCVTPHVSTVTYVEVEESARVAPTVVFEGLTARGRPDA
FT                   EARDEAGARCERAAVMIPKAGAHFKFDGRFLHGVFDEFASGDVDASAARVTLLANIWFD
FT                   HVPVGVERLDESLAATLGDDESCVANEAATEMTTRTIASSEFATTPMKDVAFGPSGGEY
FT                   ELVGAEFPFDELRESAKGEEGEERVHLFFITNEAGVRIKLRDDDEPASKRVKM"
FT   CDS_pept        146012..147772
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312637"
FT                   /orf_name="OSTLU_92987"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96915.1"
FT                   /db_xref="HOGENOM:HBG610046"
FT                   /db_xref="UniParc:UPI00015009A3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS8"
FT                   /transl_table=1
FT                   /translation="MAAAARAIGLASRATRCERRGDGAGATASTRTARTRARDARARAR
FT                   ATRATSGSGGGKGRGGDIQRMLANADSAEAALRVVESDLDAFDAVHAATALHRVAKFSA
FT                   PESRLERDFSRAEGLTNDGRFRALAASVATRVDEFDAFGLANVAWSFAKIGYTPSQETL
FT                   GALAARLEREVSKQGARLKPQSLSNATYAFGRMRFKPPRSTLEALCAATTREMGEFRAD
FT                   ELSGMLLGLAHLDHVPDAAFLKASTDFIAKNLRRFDDAASCNVLWAFARMDKALPRDVI
FT                   DALLIQLASQNLGGANSHVNVPMCMYACARLSHQPSPAFVKAIDAEIPRCARRMNIGSL
FT                   DSMFWALGTLGGAGEGQLELSAESYEALCAAVTVKRDIDAELVSKVFWALAKVNFRPSD
FT                   STLVALGRMAKSRGKELEDENVLLIMHAWGVLRWNPGDDVVEEYVGRFVDDETQRLNAG
FT                   QAAKLLCAYGRVRWLPPAAHADALLALLMQEAAGGNLHPATAVLGLWGASLLGLKLETS
FT                   QLDVLAQNTITQKLSPRSLAKCVWSLAALGYDPTPVDLADLKRATDEAWGKLPIKDQTA
FT                   LKQAMTRLGA"
FT   CDS_pept        complement(147794..148066)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856220"
FT                   /orf_name="OSTLU_32493"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97144.1"
FT                   /db_xref="UniParc:UPI00015009A4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZS9"
FT                   /transl_table=1
FT                   /translation="MATLEGAKRAHGTRVPTAEAYEPHLSLAYGVDDAMAREWIREEAD
FT                   AYFREEGLSRGIVVSAISLWETDVEDDSCASWRRVATRELRDAKV"
FT   CDS_pept        complement(<149627..150019)
FT                   /codon_start=1
FT                   /gene_family="HOG000198067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856221"
FT                   /orf_name="OSTLU_35352"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ABO97145.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00015009A5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT0"
FT                   /transl_table=1
FT                   /translation="MGLCSSRSLDAQRVSRMLQENLKLDPASERDLIRSYRLFKKTDSN
FT                   GDGRIQKSEFARAFKLEQDVFFDRLFSLIDTDESGYIDFREFVIVLGAFQLANATGRVR
FT                   FAFRLLDLDDSGAISKDEFKACIQASV"
FT   CDS_pept        complement(150336..151907)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312638"
FT                   /gene_name="VDR1"
FT                   /orf_name="OSTLU_46153"
FT                   /product="Violaxanthin de-epoxidase related, chloroplast "
FT                   /protein_id="ABO97146.1"
FT                   /db_xref="HOGENOM:HBG319089"
FT                   /db_xref="UniParc:UPI00015009A6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT1"
FT                   /transl_table=1
FT                   /translation="MRADAFASASRARPVAQHTASSARRRGPARAARVVATAVTSPIQP
FT                   SPDVVDASRAASSAACTVACFARKDALSFMRYPKSLAARGRFDVEGPSFGEVFEHLARR
FT                   VAWSDADEGTLRMIVVDVDASDEEMRASGASDADVFIAIDVDDEETAGRVRRATASAAT
FT                   GCALNSPALEADERICYQPTRQLRAVGAKLTPWSQAAKDVRLMDQVKELYARGNHLDTL
FT                   LSILLLVDASGARVPAVDINQDITLGNVWCIASNCNKQLLACYQNPQCKKSLDCVDACG
FT                   LNDQVCTYTCIRSYQNEQFEKLARCMLHKHNCLGNDAKRPQLPAVLPMTTWRGEMLTHA
FT                   AAERIMQGWLGEKQYSWLAVAGQNPAYDYFPNQFQIWYKDKKNKTAFWYNPVFKVNTLD
FT                   GRSVYRRSDYRCRRAETPGTFIFSFMDNGVTSEEYWRVVDAADDLSWSLYYYAGAAKSA
FT                   GQSYIGAVLATPDGLWPAEDQMDRIEDSLWRGCGVKIWEMCQVDNSTAHDGDAPLEPLH
FT                   EPSLMP"
FT   CDS_pept        complement(152093..153217)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007707"
FT                   /gene_name="CHR3516"
FT                   /orf_name="OSTLU_32497"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO97147.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="HOGENOM:HBG610048"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI00015009A7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT2"
FT                   /transl_table=1
FT                   /translation="MPPNTRLLVKWWGLPYADCTWETIDGHDDFDMLLERYTQFDHESL
FT                   KRPYSVPPSLANVDESNKPSKGVQCVARWLLATWFEKEGVCFVDNSPLCKHAEVAANFI
FT                   ADRKRQYDEHGPSLIIVAESELEHWSREFSRIAPDVNVVEYGGSATCRATVQQHEWSFV
FT                   GAFPRATNGVSTPRFNVLITTHSTVVLDIVLLRQVRWESVIMVENAQKFTAETSSLLSR
FT                   LGSLHANHRVLMFRAADFSDLHVTLNILEFLKRAPTSMRNLEARLLNLSQEEACMQTAA
FT                   LLAVLTMDYQFCEAALRNKQALAEADACMGTLHTARLLELSEIVLASKVAKESDRRSVF
FT                   PACFDYTSTQYLGLLHQLQALHDMYRPLVSAEQR"
FT   CDS_pept        complement(154266..155870)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160996"
FT                   /orf_name="OSTLU_92989"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97148.1"
FT                   /db_xref="HOGENOM:HBG610049"
FT                   /db_xref="UniParc:UPI00015009A8"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT3"
FT                   /transl_table=1
FT                   /translation="MTPDDDERAMQALRATTTAREDARYARTTLDSLPMEIVQEILARR
FT                   VRDDGARGTTTAAALRCVSRTFRDAIEREPAMFYEEFDISYGFCAATDARMRAYAKKNV
FT                   FGGVRRLNLSGCGKLTDATLRLLGESCESLESVVFSGGSFTKSAMIAFAEQRPGLAAIK
FT                   IDLSSPKMTPADVLEVFEYFIARNCDTLRSVSCGREAPYSPHERRAFSTRAVRLFETIR
FT                   RCGELRSLDLTNCGEDVRFPLFSMQRALPHLQELKLNHFGGESGWRIVGDIGEDFEHTC
FT                   WKDLRVLEIAVSMETTSVGHRYGNSNVNDETMISMLYGSIESIEILDLTGCTHIGDWRN
FT                   LVWDRLPTRLKTLRCARTPISSDDGAVAHILAHLCPALEVLELADVGANARFVTDAAFE
FT                   QLFAHEGPDFPLRVLRVPGSGVTTSTIKHLVSGRHGRFPNLRTIDLASCRSLPRELRRI
FT                   SLDTFPRDNVSALRRALAADAAADADADSDAADATTTTTDDVIFVADLRDRAASAKRPR
FT                   AARERDPPRARRPKPRA"
FT   CDS_pept        join(156412..156569,156706..159205)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312639"
FT                   /orf_name="OSTLU_24764"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96916.1"
FT                   /db_xref="HOGENOM:HBG610050"
FT                   /db_xref="UniParc:UPI00015009A9"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT4"
FT                   /transl_table=1
FT                   /translation="MPGARAPRAVHARQDAMTPFGDFICVPVRTIEDVGGEERDARARG
FT                   EALDHEVRAYKLGKKKRSYNQVELAFERQREGRASAGERAREGRGARIFEAVEAPFGDD
FT                   VPEEFRNSALEYELRMYNGETARAVVYLVYAEPTRGTSEARGAGARDGKTKGVSDGRGF
FT                   SWLPVMREKCVKGCDGPILSAIQRFGKQGRTQKSAASQKDAKPDAKPTAENEWKDSRNL
FT                   FISIDEASNHVCAYGPNQCKAFRLLFGLYAKETNEFVGSGVSGPIRVLANNDVPKGAAA
FT                   MRVKCGLSDSWNGWKETAEKSEDDLREIFRAANCPQPAGKANQNRRLDDATQQNARKPL
FT                   QTQTNNGDKVGGKRAAAKGGVAPAPSKRPKQTVSQKAQLARESKSVKRTKSARSGGYFD
FT                   FDTTVNTALQDLALGMPVLGVSAQDSQDLQFQLNAIMPSPLGTPPDEKAAGAGANPFAG
FT                   MFGTPEYLAAQEILGDALNTADLPSLCTPGDKKAETNLYDGMPPPTTGMGTFKFTPGAF
FT                   PNIASTGSMMSLSGLDSLGGLIGSAFGKTPAEFKTNKTESKIFTRSAKKVAATGEPTPV
FT                   TQFVNSLLMSRQKASAERTASMPRTSRRSTRAALKEVAPSDAAPSTTAASKLITAPKSA
FT                   TGQAETGIATGVASAPGVEAAGATFDVAPIRGARSRHASPTGVAPVRLFFASPSGRGGE
FT                   TLDGSDDEDDALGFASPNLRKDVAGANGQLFSARGRRTRNAPQIRLPRMASVPEIANEM
FT                   TAGEKASDRAATKAARLSGHFRPVKMPPPPKHVAAGPDSIKRKTRHSTVHFRNDVNFEN
FT                   EAPSTSKRNASGEENEAPSPTDVAAALLSPGWPSTKRRKALNKHADASGEIKGNSPGFI
FT                   ATIKERVTNAVGWA"
FT   CDS_pept        159880..160335
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683933"
FT                   /orf_name="OSTLU_12693"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ABO96917.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00015009AA"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT5"
FT                   /transl_table=1
FT                   /translation="MDRNTGRSRGFAFVTLASAEDMERAMAATNGVDVDGRELRVSQAQ
FT                   TAGERRDRPMRMDGERRPQRNRDADNRRVYFGNLSWGMDHLDLQDLCGEFGSVEDSRLI
FT                   TDRETGRSRGFGFVTMSSEAEADEVVAQLNGQDVDGRVLRVNIANSD"
FT   CDS_pept        complement(160512..161852)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683934"
FT                   /orf_name="OSTLU_32501"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97149.1"
FT                   /db_xref="HOGENOM:HBG610051"
FT                   /db_xref="UniParc:UPI00015009AB"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT6"
FT                   /transl_table=1
FT                   /translation="MDDISSRDGYDAEEWRRIRDAETPEDECHELPQSDYWGPQPLTQS
FT                   VEGVSITVARDCCELCKKTAKCQFWRHDPAKPNECFTGTLINDYLPPMYGEEHNRKTTS
FT                   GVLYPKKSRYDAESTELKTCVHTMITSNGSPYMNWQTRVFYQTWKKAASEKDSVLRHFT
FT                   RILHRSTDDSLMDLVPTWRADPTHVECDNSCDYAVKDRARAIAEWMKSDDSRRCSHILM
FT                   AETDYLFIRSPPPSVLLAKGISYGFLFGYIVPSYPDAKEASVLLHDVSKDGPLKDVYQT
FT                   GNAPQCIHRDDLERVAPVWADKVEFGESNEVVKRVFGWVRDMYAWSFAAAAVRPKLEFE
FT                   LPPVPFQKLMIQPPADIAIGQSSVMHYTWGAIISNKEDHEVWRFDKREYLGSWDSLKKI
FT                   EPLPPWDAEQEFKLQDKKRIQKSQYEVLDKMVEIFNEAVDAVVAGDG"
FT   CDS_pept        complement(162408..163940)
FT                   /codon_start=1
FT                   /gene_family="HOG000271512" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683935"
FT                   /orf_name="OSTLU_16034"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97150.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00015009AC"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT7"
FT                   /transl_table=1
FT                   /translation="MRAEEVRERIAKAAKAQREWAKSSFATRRKLLRVIQRFILEEQDT
FT                   ICRVSARDSGKPLVDAAFGEVLVTLEKIRWLCNEGERWLKPEKRSTGAMMFYKKARVEY
FT                   HPVGVMGAIVPWNYPFHNVFNPLVANLFAGNALVVKVSEYASWSSQYYGRVIDAALDAV
FT                   GAPRDLVQIITGYGEAGSALVTGGVQKVVFVGSTGIGRKVMEAAAKTLTPVVLELGGKD
FT                   PFIVCADADLKQCVPMALRGAFQSCGQNCAGAERFYVHEKIHDKFLAKVLESARKLRQG
FT                   WALSSSVDCGAMCMPKQAQYVQSLIDDAVARGATVHVGGKIELGAQGGQFYPPTVISGI
FT                   THDMRIAREEVFGPVLAIVKTKSDEESISLANDCDFGLGSNVFTRSTRRAEKLGSQLEA
FT                   GMTSINDFCSTYMAQSLPFGGVKESGFDRFAGIEGLRGCCVPKSVVVDRFPWLMKTNIP
FT                   PPLCYPVADNAFAFCKALSRMFFGLNVAQQFGGLLSLAKCFLMPSNSYTKYD"
FT   CDS_pept        <164587..>165339
FT                   /codon_start=1
FT                   /gene_family="HOG000198068" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683936"
FT                   /orf_name="OSTLU_6083"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96918.1"
FT                   /db_xref="HOGENOM:HBG559192"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniParc:UPI00015009AD"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT8"
FT                   /transl_table=1
FT                   /translation="FSYDVVEAHAHDANAFTQGLTTCGDGIMCESTGAVGGTPSEVRTT
FT                   TTATGARRAGADVGGAFAEGLTRVGDDVHVISWKSNRGFTYAVTAEGEVTKKWTFETPL
FT                   SDGWGLTSLDGELYVTDASDKLHVLDVPGRDGAKLKLKRSMTITDDGKAIRFANELETI
FT                   GGDVYANILERPCLARIDPANGKVTAWVNLDGLKQASPNDGRGDVLNGIAYDEKLDALY
FT                   VTGKNWPTMFRLKLREEQGASLDAVRATC"
FT   CDS_pept        join(complement(168154..168270),complement(166684..167664))
FT                   /codon_start=1
FT                   /gene_family="HOG000215910" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683937"
FT                   /orf_name="OSTLU_24766"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ABO97151.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG586593"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI00015009AE"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZT9"
FT                   /transl_table=1
FT                   /translation="MSAVAHTSLAMSKATAVRGASVKRSTAAQRATAPQRSLVIRNASP
FT                   KEMRDRIASVGNTKKITDAMKLVAAAKVRKAQDAVIGARPFSESLVKVLFAINSRLAGE
FT                   DVDVPLTKMRPVKTAMLVVCTGDRGLCGGFNNFIIRKTEQRVAELKAQGVECKLITVGK
FT                   KGGVYFNRRKEQYNLVKRFDMGQAPSTQDAQTIADEIFAEFTSEEVDKVEMIYSRFVSL
FT                   IAAEPTVQTILPLSKEGEVCNVDGVCIDAANDEIFKLTTEDGKFAVKREASDTEVSEFE
FT                   GVMQFEQDPNQILDALMPLYMNSQILRALQESLASELAARMNAMSTASDNAKELKKTLS
FT                   LVYNRARQAKITSEIIELVAGASAA"
FT   CDS_pept        join(complement(169114..169400),complement(168480..168990))
FT                   /codon_start=1
FT                   /gene_family="HOG000213547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856222"
FT                   /orf_name="OSTLU_35703"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97152.1"
FT                   /db_xref="HOGENOM:HBG397437"
FT                   /db_xref="InterPro:IPR007303"
FT                   /db_xref="UniParc:UPI00015009AF"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU0"
FT                   /transl_table=1
FT                   /translation="MTTVARVARGGWDVESASTPIAKRARIEQVETNVDAPTTPEMLFD
FT                   SALELRHESGVALRFEAEDALREWVKLGLPAIEVAAAKTWRRSHVERFGDAAEYDWTFT
FT                   TPYGGTVTTTSDSNRQPPTWELTDRRIDRAMLTERDPILMYDELTLYESELDDNGVAHL
FT                   GLKVRVMPKCWFVLLRFWLRVDGVLIRLFETRFFCDFTEVDRTGAVVVVRETQRREETW
FT                   DALHARGAPCDPTQFPDADQAASVLLAAGGPVDIVTHALTIAP"
FT   CDS_pept        169530..171149
FT                   /codon_start=1
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683938"
FT                   /orf_name="OSTLU_32508"
FT                   /product="Predicted protein"
FT                   /function="NAD or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO96919.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500A95"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU1"
FT                   /transl_table=1
FT                   /translation="MTRVRRAMEAFRAIADPLERYVYLRELQRASAETFYRALVREPLE
FT                   LMPFVYTPTVGEACEKYHRLGIETNGVYITADDAGRVGAKLRGHWDRAAAARARAREGL
FT                   DGEAAKRRGVDRRARADDGVAVAVVTDGERILGLGDLGAGGMGISEGKILLYTVCAGVR
FT                   PSACLPVCLDVGTNNQRLLDDPNYKGLRRTRLKGEAYDALVDEFMREMRAWQPRCLVQF
FT                   EDFGNANAFRILEKYRTTGPCFNDDIQGTAAITLAALLSSLRATKGKLEDQKVLFYGAG
FT                   EAGVGIGELIAMAMEKTGMSHKEAMERCYFMDSKGLVCKSRLDGLQPHKVAFAHDVEYQ
FT                   PDLLSAISAVKPTALIGVSTIGGAFTEDVVKEMCALNERPIIFPLSNPTSKSECTFEQA
FT                   MAWSDGKVVFASGSPFDPVVRPRDGVKVFPAQANNAYVFPALGFAAALTGASQITDDLF
FT                   LAAAESLASITTDAEIDAGHLFPDMNSIRQVSVTLTAEICEMIVKSGLGRAPSGVSTHA
FT                   DWLAYIESHQYDPGEEQPISKL"
FT   CDS_pept        171669..174008
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007708"
FT                   /orf_name="OSTLU_32509"
FT                   /product="Predicted protein"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="ABO96920.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR014020"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="UniParc:UPI0001500A96"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU2"
FT                   /transl_table=1
FT                   /translation="MDKSMYDDFNCVVEFCTFWGPPGVGAGGLDSILSACSSAKNWLSM
FT                   SESNVVCFHVRVERGADAARILRYVVACFETYRASSSEFDIDMAFEELPTVPPRAFSAH
FT                   RAAAPSRAQIRYGGYFGDAIRTSRESGKECIPKNRLRLKRLVIAGGLSIHNGGWRPYAK
FT                   VICQSTGVVGKSATQGLAPDWHDSKHGLSPIGMELVRTGHESNTLSVETAIGLSLDGDC
FT                   VISIFHWTGDETRDELSPVMTFAFHTGFIHLKTSMGDSKAGVMRITRDQMDCTDETLIP
FT                   DDYFFDLMFLAENAEAKPKRQADIAVQTTPALNETHAGSKIAEPPALPTSPSQAPLECA
FT                   PPPPPPPPPPPPPPPPPPPPPPPPGFKLSSASMPKVATPPAPGAPPPPPPPVVQFRSVS
FT                   LTPRAPPLAQGPNLRKVYWDKLTVTQNTWWSDINSDVGALREEEKQAIVKSFEIRVNAS
FT                   KKALTEKPKHVTGMPTLIPIPRSNNIAIMLSRFPMSAEGIVEAIATGDPEGTLTLERLA
FT                   VLLQCEPTEEELQIMQNFKGDATVLNAPERFLMDLATKVERLPDKIAALVYARQFPEMM
FT                   SEAYSGLRAIEQACSQVREAEGFRKVLAVALRVGNFMNAGGPRSSTNGITLDSLHKLSD
FT                   VRTTAPTAKGGCTLLDFVVELVDAREDGEISLTNELGACQAASRIARAELEGLIRKITS
FT                   GAQRIKREIDKSSVQSFDGLLVDLDSDVEALSKEAERVDAEFTRFAELCGETRKSPEDV
FT                   FASIWTFACACDASRAARAHRASKKK"
FT   CDS_pept        174062..174763
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856223"
FT                   /orf_name="OSTLU_92993"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96921.1"
FT                   /db_xref="UniParc:UPI0001500A97"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU3"
FT                   /transl_table=1
FT                   /translation="MHRPIARGFARAYATHWLPQSARTWLDGVEHAAFARALTDAMKKI
FT                   PQLSGREESIAQSISARASEILEAETADGSFTRDAVETTHAKTAARACAVYECTRPYLG
FT                   NDDATMDLIRTHAGAERTAQTMNGGLVRGALMLSRDPIATIASMVGNVTNDLAPGAWRR
FT                   EDGEFVTSTCTYREFFKKRDMEFLTATTCCSLDVDVWFSGLDAKSATVTLESSMARGDP
FT                   ECRISVRAGEK"
FT   CDS_pept        join(174916..175642,175716..175855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683939"
FT                   /orf_name="OSTLU_32511"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96922.1"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="UniParc:UPI0001500A98"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU4"
FT                   /transl_table=1
FT                   /translation="MRPRNPPDVDDATSSSPFDSSALHGRLVHGTCGWASKSQNLSFYA
FT                   PNELSSGERRLPSYAERFGCVEVDSTTYAIPTRDVVQRWVDATPDGFVFLVKAFGGLCA
FT                   STVDARSLPRDVREMLPPTPSGRVAYSSMPTRAKDALWARWNDAIAPIVEAGKLGCVVF
FT                   QFHLSQGVGDALRAHALECQSRLNGARTAVEFRNRDWITGDVGTQTVRWCREHDLLLVA
FT                   ADELEHETFQRDRQQTGLPVDGTGRRSACSTKKKFRFGASACARSIPNRREDLFGLLGA
FT                   PSGATLR"
FT   CDS_pept        <176280..177722
FT                   /codon_start=1
FT                   /gene_family="HOG000198069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312640"
FT                   /gene_name="HDA3505"
FT                   /orf_name="OSTLU_87707"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96923.1"
FT                   /db_xref="HOGENOM:HBG713516"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI0001500A99"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU5"
FT                   /transl_table=1
FT                   /translation="VKARAVALDHARVNVDDVDALVSGLGALGLRASEDKQHPITRVQT
FT                   PPPLRKHAHARTVSVSDVDVSAVKLERDEAPAKRKRRVGLLYDDAMEMHEKEGHFEQPA
FT                   RHRVVVNEIKAEKLDLRCERLEAREATEAELTRAHTKEHVAFVDSAFDVDGEKVQVMTG
FT                   EDVFGDDIFFTKHTAKGARMAAGTVAEACLAVGRGDVDRAFAVVRPPGHHAVCGQAMGF
FT                   CFFNNAVVGARAVIETKLCERVLIIDWDVHHGNGIQDIVYEDESVMYVSLHRYGDGFYP
FT                   GTGAVAEVGKGGTNVNVAWSEKGLGDADYLAAFDVVIEPVVKSFAPDLIIIAAGFDAAD
FT                   GDPLGGMMVSPTGYMHMTKRLIEIGTGRVVVALEGGYALRPLATCATATLRALLGDEPK
FT                   PISSRSRPRKSSIKLCRELASLLAEHWPVLESDEYKNSTALIAKRATVVGAAREYPTGR
FT                   RSKSPANSSSSASTAVGAVCTT"
FT   CDS_pept        177856..179784
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856224"
FT                   /orf_name="OSTLU_16043"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96924.1"
FT                   /db_xref="HOGENOM:HBG609869"
FT                   /db_xref="UniParc:UPI0001500A9A"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU6"
FT                   /transl_table=1
FT                   /translation="MTIRGRARSICVLLAALALTTSAYAAPTSAPRARSRATPAPATSR
FT                   PRDSPDIETSNIDMNDVEAFLTQARDEFIATRASRGSSHGRSTTTSPDEAGLDWIASFF
FT                   SPRERRRGSAGRAARNRRDSNLPPVEVDQTGVDFYLTARAYAQEHAVSDPRGGRMRIAR
FT                   AEEPNQFQWWYDFIWQTQQQIIACEGRESCEGLWHQFGAQGSICCDAGAEFYGHAHFSC
FT                   VESVEQCEALTTCASSADCGVNQVCCATKPHSDDLMCVTSFQDCAAYCHSDAQCKAEKG
FT                   EQCCYDEVLGYTICIPEGLSCPPPPPECPTTGQPTCRSDSERTCCGGVCCPPDENGVEW
FT                   LCCRICDENVCYRATPSLGDGSYECPDPFCPRPPECSSQAELSQCTDPVNPIVAAQSAR
FT                   NGDPPTGSICCGGVCCEIGDPDLVPIGTFGPNFCCYDFPDGPSGWSCQPGIPGDPLPTP
FT                   PPGCARQPPSAQCPAGSEYLDTCVADDQSIGVCCGPEVDGGGLTCCPDESVCCANVVDG
FT                   ATVGYECKAQNECQEGELCRILGDCPNSQQYSVCGSCGQGNNDCALSCQAGAGEPPNDP
FT                   SWICSTVDGCDPVADYNNGPSDATCVCNNGACGGATQCKTGGNCCACQARGPRGGVQCD
FT                   NPPTVLV"
FT   CDS_pept        complement(179908..180711)
FT                   /codon_start=1
FT                   /gene_family="HOG000249464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683940"
FT                   /orf_name="OSTLU_87708"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ABO97153.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG559580"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI0001500A9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU7"
FT                   /transl_table=1
FT                   /translation="MSTFRATSAERGTTLTGDAKLEFVSQLFDVVAHRYDAVNAVLALG
FT                   FVDRWRRKALSAGLVATFAPAFARGRRVFRRGDSVLDVGCGTGNVTRFLEYEAMNYLAL
FT                   DVVGVDCSKNMIEEARRLTPGEAKYEVGNAGKLRFADASFDCVTTCYTLRNFSDVPETL
FT                   REMFRVCKPNGTLLILDAFPPTGIFGAVLRLWLRFVLPLVGALMTGEKKAYAYLGTSIE
FT                   RARTPREVADELEALGAEAVEISALFPFGAASAIIARKPFDGSSK"
FT   CDS_pept        <181065..182645
FT                   /codon_start=1
FT                   /gene_family="HOG000025142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856225"
FT                   /orf_name="OSTLU_87709"
FT                   /product="Predicted protein"
FT                   /function="anthranilate synthase activity"
FT                   /biological_process="tryptophan biosynthetic process "
FT                   /protein_id="ABO96925.1"
FT                   /db_xref="GO:0000162"
FT                   /db_xref="GO:0004049"
FT                   /db_xref="HOGENOM:HBG507440"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniParc:UPI0001500A9C"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU8"
FT                   /transl_table=1
FT                   /translation="VARETQRAAFDRALSLGNNVVPLYRRIFDDQLTPILAYRLLVKED
FT                   EREAPSFLLESVVGGTQIGRYSFLGRRPVMEVTAKDYEVTVTRHEGGGAASETTTERDP
FT                   MEVMKRIGESWRACKTPGLPDCFAGGWVGFTGYDTVRYQYQSKLGFEGAPKDDRSLPDI
FT                   HLGLYKDVVVFDNATKQLYAVHWVMVDEYSSADEAYTTGMDALDAMIDDLQPSKSPPMK
FT                   QGYVNLELNQRPSEPKDSTMTKDEFLGAVAATKEHIKAGDIFQLVLSHRFQRKTSVDPF
FT                   EVYRALRVVNPSPYMIYYQGRDCILVASSPEILCRVDKARTVVNRPLAGTRMRGKTPEE
FT                   DEALEVDLLADEKERAEHVMLVDLGRNDVGRVSKAGTVKVEKLMEIERYSHVMHISSTV
FT                   TGNLVDDLGPWDVLRAALPAGTVSGAPKVRAMQIIDNLEVTRRGPYGGGIGYVGFTGEM
FT                   DMALALRTMVVPTRQAKETNGSREWMIHLQAGAGIVADSNPESEYQETVNKAAALGRAI
FT                   DLAESAFTD"
FT   CDS_pept        complement(<183185..>184225)
FT                   /codon_start=1
FT                   /gene_family="HOG000198070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683941"
FT                   /orf_name="OSTLU_2530"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="ABO97154.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG395964"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI0001500A9D"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZU9"
FT                   /transl_table=1
FT                   /translation="IDFSYLDAAPIRNEPGSASATAVKALAVEEEEAEEEYFDPNENPR
FT                   WCPPGTVKRLRNLQSPLIRLHTEIVDFSRYLEPTEEEATSRAAAVERVRAVVNGIWPDA
FT                   RFEVHGSFATGMYLPSSDIDAVILDSGAKNAGLCLKALAVALARRGMAIKIQLIAKARV
FT                   PIVKFEEVESGHQFDISFDVANGPASAEIVRENMRRFPALRPLTTVLKAFLHQRGLNEV
FT                   YSGGIGSYALLCMVMAHLQLHNTTCKSTWAGSHGASDASEGCLGTLLIDFFELFGRRLV
FT                   AEEVGISCGGKGPGFFKKRDKGMYEDSRPFLWAIEDPQDETNDLGRNSYACRQVKSAFE
FT                   HAFTVIT"
FT   CDS_pept        <185267..185800
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683942"
FT                   /orf_name="OSTLU_92995"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="ABO96926.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG559536"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniParc:UPI0001500A9E"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV0"
FT                   /transl_table=1
FT                   /translation="VKRAKARAKAKRDGRGWGGGGAKRAKSAPATNVSGWEKVVAGESS
FT                   FVSVPLTNDGDGEEEDARWSFPSTREERERYAVFKDLHDKSFYMTSGAKFGSDFLAYPG
FT                   DPILFHAHYTVRIVSWDAVIHPLVIAATTRMSNAARKNFVVAAVRATDANGENFEVRYF
FT                   TMEADVDLSSNRGY"
FT   CDS_pept        complement(185823..186260)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160997"
FT                   /orf_name="OSTLU_16047"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97155.1"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniParc:UPI0001500A9F"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV1"
FT                   /transl_table=1
FT                   /translation="MVADELARVASGRSMVIPDTMRYRLDPPPRSERESAEAWEKAIEN
FT                   ARAQLEHQATRRANLELALKYAPAAWRARNAWGDAAVKAYEEELARVRTEVNELNVMRK
FT                   LQQESAAKEISALEREWYATTRKCAAIEGAIADLEAELATK"
FT   CDS_pept        <187273..>188826
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160998"
FT                   /orf_name="OSTLU_1075"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ABO96927.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001500AA0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV2"
FT                   /transl_table=1
FT                   /translation="LIEDASVTLVPGRRYGLIGRNGKGKSTLLKFLAARRVEGIDESYS
FT                   VHYVTQEVELTAEEEDMLPGDVVLRADLQRWLLLEEQMKLESSEDALAVARLQEVNGML
FT                   DAIGSASAPARVSVLLKNLGFSDALIARPMKALSGGWRVRTALAAALFAQPDILFLDEP
FT                   TNHLSISAVMFLSRELSTNSVWSSRIIVTVSHDRHFLDEVTTDSMHISGAAKRLSSHRM
FT                   PYSAWAKKRREQQLALKRRVEQRQEKIDKLKEFAGHGFRYGGSSSAINMMKKKELEAKK
FT                   LELEAGDEASLMADLEEDAELALNLQAGGELRQNIVRFDGVSFAYPGGDELFADVDLSV
FT                   DSKSRVVLLGENGQGKTTMVKIITGELEPTSGLVTRDRGARVCLVNQHHAEQLAYDKTP
FT                   LAFMLDAFPGDGSYNHEQKLRSHLSGCGVLTELQNVPALALSGGQKSRVAMAAVSFQAP
FT                   HLIILDEPTNNLDLESCEALAEAIENFKGGVVLVSHDQYFVERVAKEVVVIENGAVKRL
FT                   E"
FT   CDS_pept        complement(189019..189630)
FT                   /codon_start=1
FT                   /gene_family="HOG000265029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312641"
FT                   /orf_name="OSTLU_92996"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97156.1"
FT                   /db_xref="HOGENOM:HBG559540"
FT                   /db_xref="UniParc:UPI0001500AA1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV3"
FT                   /transl_table=1
FT                   /translation="MDRSRTQEWPKCDAAKAAGIAEKKIAKCLKEGGKKGVEIEGAADM
FT                   SGLTCFCTRMTEAGDSVELLEVSMEGMNAIPDPANEEERKGCSGHISKLIIGHNDQTNK
FT                   IAMVAYVAEPLKDKLNATEWMKAVCDTDLGGGVGGAPAESSTATWATASISEDTDNGKY
FT                   YLKFKDNALTAAINYLRDKGLFLDDSDSDSGDNPAADFEW"
FT   CDS_pept        join(190008..190056,190245..190444)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683943"
FT                   /orf_name="OSTLU_32521"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96928.1"
FT                   /db_xref="UniParc:UPI0001500AA2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV4"
FT                   /transl_table=1
FT                   /translation="MGARDADAACALRDDEVSNALFELTALAGLDVRREVHDAVLELSR
FT                   ARVVPTATAQVLRSLASKAADARAAGLEDALRAPARE"
FT   CDS_pept        190516..191055
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007709"
FT                   /orf_name="OSTLU_32522"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96929.1"
FT                   /db_xref="UniParc:UPI0001500AA3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV5"
FT                   /transl_table=1
FT                   /translation="MIGLKTSPLAAPVVVRRRRARAIARAGPFDFLRNNKDVGGRDTTW
FT                   EAQQEILKKRRSGANLGKEVAARRAKVSRFVNKKLPAAEQKAIEAKNRAKANALSKEAV
FT                   TGGIPLPMISLGMPEFDGGERFDLRGKYVDEGWVDPEDAKAAAGDWLFGGAFKKKASSA
FT                   QKKPAATPKKKGWFGK"
FT   CDS_pept        complement(191133..192146)
FT                   /codon_start=1
FT                   /gene_family="HOG000176477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683944"
FT                   /orf_name="OSTLU_12699"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97157.1"
FT                   /db_xref="HOGENOM:HBG600017"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001500AA4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV6"
FT                   /transl_table=1
FT                   /translation="MAPGRFFRDHTSAVNALDFHHTEDALVTTGDDDAIHLYNTNTGAK
FT                   TRTLYSKKYGCTNVCFTHSAAAVIYGSRNKGAGGAAIDDHAVRYHSLHDNTYLRYFKGH
FT                   TDAVTSIAMNSTNDCFLTGSADLTVRMWDLRTPKCCAVIPECPAIPYVATDAQGDVFAV
FT                   TEGDGGIKLYGTNSYSQGAFAQFETYIDNAGKELFPNPDNNPQMRPPAISCLKFSPDGK
FT                   RLLAVNGSWITIFDAFNGEHTMRIRVPGSGQQQHAVTPMEASFSPCGEYVVSGGADSRV
FT                   HVWSCSTGYQTGHWRSRHAGLPTCVKWAPSMMLVASGCSEGGTALWVPDPNVDERR"
FT   CDS_pept        complement(192496..193227)
FT                   /codon_start=1
FT                   /gene_family="HOG000106741" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312642"
FT                   /orf_name="OSTLU_32524"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ABO97158.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG297404"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="UniParc:UPI0001500AA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV7"
FT                   /transl_table=1
FT                   /translation="MKGGSKVVVEKHRHEGVFVARGKEDALVTRNMVVGESVYGEKRIS
FT                   VDEADGTKTEYRVWNPFRSKIAAGILGGLDAIHIKPGSKLLYLGGASGTTVSHCSDLVG
FT                   PEGTVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPQKYRMLIGMVDTIFADVAQPD
FT                   QARIVGLNAQYFLKQGGNFMISIKASCIDSTAAPEAVFAREVKKLQTEGFKPAEQLTLE
FT                   PYERDHAMVVGAYRVSKKKSS"
FT   CDS_pept        complement(<193942..>194334)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683945"
FT                   /orf_name="OSTLU_8140"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97159.1"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="UniParc:UPI0001500AA6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV8"
FT                   /transl_table=1
FT                   /translation="AVSVRATAKEIIATDKSPAALGPYNQAVKVGNTVYVSGQIGLTPA
FT                   MEFAGETIEEQTEQVMKNLGEVLAAAGATYADVVKTTIMIADMDDFKTVNGIYGSRFPE
FT                   NAPARATLAAKTLPLGALVEIDAVAII"
FT   CDS_pept        complement(194604..195935)
FT                   /codon_start=1
FT                   /gene_family="HOG000265030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19160999"
FT                   /orf_name="OSTLU_16054"
FT                   /product="MOP(MATE) family transporter: multidrug efflux "
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97160.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609873"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI0001500B95"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZV9"
FT                   /transl_table=1
FT                   /translation="MSTPAAVWYVGWPTTVIGLMRSFFPLTDTFWVGKLGIVELNALCS
FT                   NAFAGWMLYLLCSVVACGVQNRVSMKVGAEKYDDVGPVLRDGLYGAVLTYAFLACLLPF
FT                   TAVYTSTLGIQSGGTFAIGQSHLRASLIGSVGLCFSNILEATLRGFGSMKPALWVTAFM
FT                   VLCNMVLDPLLIYGMGPFPQLGVAGAAVGTSLSNCIGAVMFYRMLIKDFKVKIPITRPD
FT                   VKMLKDIVAIGAPIAVAGIVFALVYVGLGRILTSLDPMSLTAMGLGQQFENIPYTVTEA
FT                   FRIGTSTIVGQWVGARNATRARDAGWSAIRIASAALIPFGVVFIAFAPQFVGLLTQNPA
FT                   VAAHAVQYMYWNFPIVSFMALECAAEGAFTGTGVTYPVLVIAILLNFSRLPIAAALAPI
FT                   YGVSGVWFTIVFTQVIKSCLKTIWLRKVFNDLIKEERGAGAATA"
FT   CDS_pept        <196697..>197386
FT                   /codon_start=1
FT                   /gene_family="HOG000198071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683946"
FT                   /orf_name="OSTLU_5426"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO96930.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG318280"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0001500B96"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW0"
FT                   /transl_table=1
FT                   /translation="DSALKRAVRKGVPSDLRCEAWFACSGARELKKMGPMDSYYEKLLV
FT                   MKVDQKVVDQIELDLARTFPANEKYERGEGGQRGNDVLRRMLYAYARHNRKTGYCQGMN
FT                   YIAAFLWLVMGDEEKAFWTFTALLDVVLPSDVHARDIKGTISQYKILHKLLQSNVPKVA
FT                   RHLKELDVDLVMIASKWLLCLFVESFPATTAARVLDCLTYEGEKVWFRVAIAMMKMYER
FT                   DILECDSL"
FT   CDS_pept        join(complement(202508..204485),complement(200646..200692))
FT                   /codon_start=1
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20007710"
FT                   /orf_name="OSTLU_24771"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="threonine-tRNA ligase activity"
FT                   /biological_process="threonyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97161.1"
FT                   /db_xref="GO:0004829"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006435"
FT                   /db_xref="HOGENOM:HBG352811"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniParc:UPI0001500B97"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW1"
FT                   /transl_table=1
FT                   /translation="MADAPTPTNADHAREKSPYYAHRIDLFDKYRARELTRIEEAKARG
FT                   EGIKVTLPDGAQKDGTRFATTPFDIALGIHKKLAQSALVAKVDGEFWDMRRPLEGDCAL
FT                   ALFTFDDEEGKECYWHSSAHVLGEALELEYGADLTIGPAIEEGFYYDCYLGERTLTPED
FT                   TEIIKGRMEKIIKEKQEFQRIVVSRAEALEMFEENKFKIELISNLPEDATISCYRCGPM
FT                   VDLCRGPHLPDTAWLKSVSVNQCSRAHWRADVTKDPLVRVYAVTFPSDKLMKEYTTRIE
FT                   EAKKRDHRTIGLNQELFFFHHLSPGSCFFQKHGARIYNNLVQFIREKYWEYEYDEVITP
FT                   NIYNFDLWKTSGHAAHYKENMFSFNVEKEEFGLKPMNCPGHCVMFAHRHRTYRELPMRV
FT                   ADFGVLHRNEFSGALHGLTRVRRFQQDDAHIFCREDQMEQELSGFLQFLDDVYEVFGLT
FT                   YEMKLSTRPEGYLGELEVWDKAEAALKSALDRSGREWKLNEGDGAFYGPKIDITVFDAL
FT                   KRRFQCATVQLDFQLPIRFDLSYVDENNSSVRPIIIHRAILGSVERMFAILTEHFAGKW
FT                   PYWLSPKQVMIVPISEASRDYCYEVKRQLRKAGHFAEVDVTDRKMQKKVREAQLDQFNY
FT                   ILVCGESEKANETVNVRTRDNKVHVIIRGETAITRFRKT"
FT   CDS_pept        <205261..>205941
FT                   /codon_start=1
FT                   /gene_family="HOG000006413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683947"
FT                   /orf_name="OSTLU_4907"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ABO96931.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG320571"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001500B98"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW2"
FT                   /transl_table=1
FT                   /translation="TATFETPQVAFAYERGWRDSFKRAGFPGPDEEARLAVDALGEFAK
FT                   GGIVVDASCGSGLFTRRFLKTYKGRSKAYKGVVALDYSDAMLRQAKQYMEDENLLGDAD
FT                   VCFVRADIARLPFPEGSLDGVHAGAAIHCWPDAKTGVAEIARVLKPGATFCGTTFMNPQ
FT                   VPFFDEDQQAIFDNAVREFSGTVNAERGFRWWSKKELRDLCTECGLVDFKCEIRNQFIF
FT                   YSAKK"
FT   CDS_pept        complement(206049..206927)
FT                   /codon_start=1
FT                   /gene_family="HOG000265031" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683948"
FT                   /orf_name="OSTLU_35719"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97162.1"
FT                   /db_xref="HOGENOM:HBG316666"
FT                   /db_xref="UniParc:UPI0001500B99"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW3"
FT                   /transl_table=1
FT                   /translation="MKTASDRAEREAVELVMCLRQRGVVKAFGAAHNVPKRDYALAELR
FT                   LNNIEAEKLLAPTESTIKGIRDNFTRLLGVAYVAGLYFLHPTFAQGAGVAAFAAFCATY
FT                   DQIAFGGGVSALALDTVAQSTSKEYVTRLRRHEAAHFLTAYLIGILPKGYTLSSMDAFK
FT                   TYGAFNIQAGCAFCDGEFQREVQKGKITSTSLGRFACVAMAGICMEYILFGFAEGGLSD
FT                   VQQLDGLLRALAFTQKKSDSEVRWAVLNTTSLLRRHLGLTEKLADYMARGASVGECVAL
FT                   IEKEVETAEFV"
FT   CDS_pept        207423..208316
FT                   /codon_start=1
FT                   /gene_family="HOG000265032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683949"
FT                   /orf_name="OSTLU_32534"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96932.1"
FT                   /db_xref="HOGENOM:HBG559587"
FT                   /db_xref="UniParc:UPI0001500B9A"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW4"
FT                   /transl_table=1
FT                   /translation="MAQQGVAMTQKSHFARSTRASMRSGARATRGARAVAPRAAGADDF
FT                   TPEKFMAKYDEISYKIPPLLTAAAVPVVGLSLLCKTLTGHGLPGTALGSIEGISWLVLP
FT                   LGAKSFWPKAQDIARLKDKTPENVLKILQTEGRAYGGFGEDSRGKNATERLNSIASEVD
FT                   PNSPLGQQMADIARQKAEREKETPEQQAERERLRAELAASALGMANAKTAEFEAEADTK
FT                   GKDGLLAKPVTETLKDSMTVENYDVDVTKYDDKALGSKLNLSSTDIEKGVPKNNKGDAW
FT                   REQYRTEENAEGAKED"
FT   CDS_pept        complement(208389..>208940)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683950"
FT                   /orf_name="OSTLU_92998"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97163.1"
FT                   /db_xref="UniParc:UPI0001500B9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW5"
FT                   /transl_table=1
FT                   /translation="LRPFIIGVTSCLESLRSSISKAALSLIKTLAVHLKGKINGELGCV
FT                   FPSVLKRASESSFLSAEADEVLHVLIEAAAPHAVIRTLSQHVSARRLQAKIAFALTYCV
FT                   ERNAECASVFRGRAGRTALDLTLATLDVCIRGGHPDARLYAKRCLSCLIDVLGSDGLEK
FT                   PMRAYPDLFAFEESGNASVY"
FT   CDS_pept        211249..212733
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683951"
FT                   /orf_name="OSTLU_16060"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96933.1"
FT                   /db_xref="UniParc:UPI0001500B9C"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW6"
FT                   /transl_table=1
FT                   /translation="MLRKDDLFCRNQAGLGNVFSIAYYFDGVDYKDEYSRWVQLKLKAF
FT                   PDLLYKANALVYENDDNYLSSAQSTAVQKALMRRKIKIGAVSSFFTSESSIWGNFGEIV
FT                   LGLQRDARFEVDMVHYPRDPIKEEDINLSLRPERSIVLIKGGDLETVKANREAIEERRF
FT                   DVLIYLDLFMTGEMHDLAVAKLAPVQMVTHGHPVTSGIPAWIMDYFISWDLAELPDQKK
FT                   AQSFYTEELLLVKSKKAAWEYYKPRTEGEVSIIVGEAPFYQFTRENLDFIPAEEMEKLS
FT                   SRDGLTWYFCPQAVFKYHITFDQILGKIQREDPNAIIILMKLVDNALEALHEKVVERLI
FT                   KQGDVDLDRVVFIPRMKHYQLMAMYKLSDVVLDSVYFGGDTTTREAFEVGSPVITLPGK
FT                   TIGQRWTQAYYRVMGIKDFIARTVDEYVRIAVKAANATDKQKSNTRARIKKALHKKLFK
FT                   NADAPRLWGDAIMSALQKPKRWHWIEAEPLKQHDEL"
FT   CDS_pept        complement(212781..213512)
FT                   /codon_start=1
FT                   /gene_family="HOG000265034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683952"
FT                   /orf_name="OSTLU_50142"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97164.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG559584"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI0001500B9D"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW7"
FT                   /transl_table=1
FT                   /translation="MVSKSPSLDLEYLRVAIPSLQKVVPQSVGWTLLYVFLRFGVLRRR
FT                   TADFSNRTVSFIHAVVAIYMCARCLPTWGALLENVGGANTMAHLECMTLSLGYFVYDFF
FT                   YCLLNNEVENVVHHMFTVGGLASGVITGRSGPELVGCLFLMEVSNPSLHLRSMLRELNM
FT                   KDSLLATLNDLLFALLFLLCRLIVGPPLVWRTVVNDSNTYIVKAGALGIFVVSVMWGWR
FT                   IIMMIVRTVKKLFGGAKAKKV"
FT   CDS_pept        complement(215296..215952)
FT                   /codon_start=1
FT                   /gene_family="HOG000229079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683953"
FT                   /orf_name="OSTLU_32539"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="thymidylate kinase activity"
FT                   /biological_process="dTDP biosynthetic process "
FT                   /biological_process="dTTP biosynthetic process "
FT                   /protein_id="ABO97165.1"
FT                   /db_xref="GO:0004798"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006233"
FT                   /db_xref="GO:0006235"
FT                   /db_xref="HOGENOM:HBG626009"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="UniParc:UPI0001500B9E"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW8"
FT                   /transl_table=1
FT                   /translation="MSAAGKVAARGAFVLFEGADRCGKSTQAMRLVHTLEARGVEAELW
FT                   RYPDRATAMGKMIDQYLRSKSEMEDGAIHLLFAANRWEKKALMERKLASGVTLVCDRYS
FT                   YSGCAFTAAKGVDGLDLEWCRAPEVGLPRPDALMYLELSLEDAAKRGGFGEERYETTEM
FT                   QRAVKASFEAMREDWWDVIDANREPDVIQDEVLRIALSAVEKCRAGRELKRLWQS"
FT   CDS_pept        join(216227..216334,216708..217253)
FT                   /codon_start=1
FT                   /gene_family="HOG000265035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683954"
FT                   /orf_name="OSTLU_32540"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="ABO96934.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG668108"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniParc:UPI0001500B9F"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZW9"
FT                   /transl_table=1
FT                   /translation="MFTISASSTAARPTVVAHRRANKTRAKRSVVVHGAKSNPVSSGYA
FT                   AALVDACKSSGALEQVHADMETLDAYVKANASVAGFLANPTIVAEKKKDVLAKLGKEAG
FT                   FHAFTGNFLNLLVDKRRENQIEAIIAEFETLFCEATDTQVATVTSAVKLENEQQFMIAK
FT                   KLQEMTGAKNIKLKPEVDESLLGGFVVQYGKDGSGFIDMSVRGQVDKLASVFVN"
FT   CDS_pept        complement(217383..218348)
FT                   /codon_start=1
FT                   /gene_family="HOG000205225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683955"
FT                   /orf_name="OSTLU_32541"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97166.1"
FT                   /db_xref="HOGENOM:HBG559591"
FT                   /db_xref="InterPro:IPR015222"
FT                   /db_xref="UniParc:UPI0001500BA0"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX0"
FT                   /transl_table=1
FT                   /translation="MRANARARERIAGVLAALPPVEHALAYGSAVLADASVAGPERALD
FT                   VLVAVRDPAAWHDANATRNPSHYAWHARLGGGRAIHGAATTLGADAHYNARLRDERGRA
FT                   YKYGVVDVRDVVDDLERWKHLFVAGRMHKPHETARACDAIVNAQARNARSAANAALLTL
FT                   PETFSELDFHRAIVRLSYDGDVRFAFAAEDGLKIERIARSNGEAMREMYEDVVRELKGV
FT                   ETSASTWRQDKSPEATRERIDALPATVTTMLNRVEVGDDAERVGDAVRACLRRIVRAST
FT                   LRQAVAGLLTTSPTKTLAYVGAKFFKAASSRATNSSNDAR"
FT   CDS_pept        complement(218451..218816)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683956"
FT                   /orf_name="OSTLU_32542"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97167.1"
FT                   /db_xref="UniParc:UPI0001500BA1"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX1"
FT                   /transl_table=1
FT                   /translation="MRRARRARGREDAEEGEAPRASDDGASEDVGIDCALVFDEASGTF
FT                   TLEAVDGEIGNLRIAREDAEDVGAGELTTKTEERRAAAAAAAASAAARDAREGADANGE
FT                   RDVVDALPSSKKKPRKT"
FT   CDS_pept        <219342..>220622
FT                   /codon_start=1
FT                   /gene_family="HOG000198073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007711"
FT                   /orf_name="OSTLU_3450"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ABO96935.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG748042"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017962"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI0001500BA2"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX2"
FT                   /transl_table=1
FT                   /translation="SYGSVFTHAKAGMENVDRERVARVVYDATVGTPHHENETRKERAT
FT                   SKRIAAMKAKGQGMTKTEWETFGRRADERARAMERTRSGARKWLVVDMDGFYAACEELY
FT                   DPALKSVPVGVAAGPSSVLTTANYVARKYGVRAAMPGFIAKKLCPDLVFVKPDFKKYVK
FT                   ASNESRGVFAQYNPDYIAGSLDEAYIEVTEYCEKHDTTMEAIAEEIRSKVKEATGGLTC
FT                   SVGGGCSRRLAKVCSDFNKPNGQYILGTTRDDILKFLRDLPVRKMYGIGKTLERILNEF
FT                   DIKTCGDLLAKRATMLALFTPKAFDFLLGIALGIGTECHPRETPEGSGGRKGVSKSETF
FT                   KATADKAYLDAKMTELATEVALECQRLNLKGRMVAVKLKRSTFDVIQRQTTLAGPTNDV
FT                   KTIVNSALRLMRNENSIGANMTLRLVGA"
FT   CDS_pept        complement(220997..222895)
FT                   /codon_start=1
FT                   /gene_family="HOG000265036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161000"
FT                   /orf_name="OSTLU_93000"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97168.1"
FT                   /db_xref="HOGENOM:HBG609876"
FT                   /db_xref="UniParc:UPI0001500BA3"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX3"
FT                   /transl_table=1
FT                   /translation="MTTSALNARAKLFVPGVGIVTPERGGARAREGAARNPFEDDDRLA
FT                   TTARARDDAGSISALSSEDDDAREAAVELDASTLSMDGREGAATMEWVRFDDDDDDDDD
FT                   DGEGEDATTANDADDAVRDAPAASVSLLKHASSFHSDAYGASAESPRVEDNATLREPLL
FT                   RRGDSYGAVEDALENSPQIVLELDAVDDAVPGESMSAAARESGAAEPLLATNASLAEYG
FT                   AKDDGDSPREWRDVRVPLLPVVKESTYGAASPIRPVQSSRGTNVRKVKELEVPPPIQIG
FT                   EETNASTKRELNDSAAQTPLLGKSSSGPNLMSYGAVEKQVHGGAVAEGEDEIDLRHFLQ
FT                   SNTAPYERLDEYEEEDYEYDAPARDIQMDDTNDVDVESPLPSAPPLIESIEFTHARPLV
FT                   DDLCCIVWTVARERLDLLQPLFRLQGSSIGRITLAHLRNVMEKLEPQRASPRALDRLEA
FT                   MLCACGYVEDVTLSEFVHATHAGTLAATRLSTGSGANEAAVLCGYLSELMSRTPASAQT
FT                   ALMLGGRRHKAWLDLPRLLAKNLEPNQLCLLVATLDLADDLTAHERFVDMTVYQSWLRR
FT                   MQTMLRSTPMPRKPLETVAQNAPAPPTPKELMMRRAKRDRLVALWEEREARRRGNN"
FT   CDS_pept        223001..224149
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683957"
FT                   /orf_name="OSTLU_35576"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO96936.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001500BA4"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX4"
FT                   /transl_table=1
FT                   /translation="MDRYVKGRTLGEGTFGVVHEARVEATGERVAIKKIRLGKLKEGVN
FT                   FTAIREIKLLQEIEHEHVIALVDVFAHKKNLNLVFEFCGGDLEMVIRDKTAPLERGEVK
FT                   SYAMMTLRAVAHCHERWVLHRDLKPNNLLIAPNGCLKLADFGLARIFGSPDRRFTHQVF
FT                   ARWYRAPELLLGSKTYGPGVDIWAVGCIIAELMLRRPFFAGSSDIDQLGKVYAALGTPT
FT                   ETNWPGVSALPDFIEFVYVPPPNLRDTFPNETDEALDLLRKMLEYDPNKRITAAQALEH
FT                   PYFHTKPAPIPYEQLPKRFVAKEAEANAAAAAAAAAAAGDEEPASPASARQPKTGEKRR
FT                   LEDTTDSTDPNFRPKLDEEDRESLRKRKGALDAAFADVDGDD"
FT   CDS_pept        complement(224216..224800)
FT                   /codon_start=1
FT                   /gene_family="HOG000265037" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683958"
FT                   /orf_name="OSTLU_32546"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97169.1"
FT                   /db_xref="HOGENOM:HBG609877"
FT                   /db_xref="InterPro:IPR019008"
FT                   /db_xref="UniParc:UPI0001500BA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX5"
FT                   /transl_table=1
FT                   /translation="MKTRDGANTAVVTRERYVLDGALDEGALRAHGVDTRTIRVTLNTE
FT                   AHGKIGAKVRGDGTFAVRDAPAGRHVLDVHAVGLNFPPVAVRIVGADDGDGGKVGDVEA
FT                   YLAEDRTVTVPTKPLRLTPASTLEYYEPASSVSLGSLLRNPMALMVIMSVFLAVVAPKI
FT                   LEGIDPEELKRMQAELAGAARGEAPRVDAAD"
FT   CDS_pept        224999..226459
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007712"
FT                   /orf_name="OSTLU_35336"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96937.1"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI0001500BA6"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX6"
FT                   /transl_table=1
FT                   /translation="MITDDAYGRWKSLVPFVYDWFAHTRTSWPSLCARWGEVLDANDHR
FT                   SRQRVYLTEQTEGTTASGKPTPNTILVCQAEVVRPRVAAAEHMIFDEHAKSPILKKEKA
FT                   LWHPGEVNRMRCVPGKENVLLTHTDAPEVFVFDANGPGGKQSACKRADGTQYTPPTACL
FT                   RGHTENAEYALAVSTVGEVVASGGKDEKVMIWELGDASTGGGARGKEEKEGSGAPVVGG
FT                   GLSSTELARHTSIWARVEFSGHTDTIEDVCFNPRNERELCSVGDDRNMFFWDTRTKKAA
FT                   GFAKGAHADDVHCVAWSAFEEHVIVTGGKDTTVKVWDRRTLSDSSNEAMHTFDDHTDSV
FT                   LCVDMHPQAKGVFMTADEVGRVNVFDYSKVGAEQSAEQAKAGPAHLVFQHSGHRGTVWD
FT                   IQWNPYDSWTACSTSVGDFQNTLQLWRVNDLIYRDEEECIRELEQHRDIICGRAALKQS
FT                   EPSVKEEKTDADTDGGSIIIEDDRVDED"
FT   CDS_pept        complement(226542..226859)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683959"
FT                   /orf_name="OSTLU_32548"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97170.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI0001500BA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX7"
FT                   /transl_table=1
FT                   /translation="MEPNANGEPVVYPNRGARRAAEAQARDREFIEKARAKKRGTVVGA
FT                   GHEYGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGAFGAE
FT                   R"
FT   CDS_pept        229088..230284
FT                   /codon_start=1
FT                   /gene_family="HOG000265038" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683960"
FT                   /gene_name="DMT3502"
FT                   /orf_name="OSTLU_16070"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA methylation"
FT                   /protein_id="ABO96938.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006306"
FT                   /db_xref="HOGENOM:HBG490141"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="UniParc:UPI0001500C89"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX8"
FT                   /transl_table=1
FT                   /translation="MAVATGGRFAERSASVKPIGRERPERRARRRVVRVASTRDARLVE
FT                   LYSGIGATRLALEPLVTLKSAIAVDNSDAANAVYEANFADAPRRVNVEHLDLNALFASG
FT                   NGDEGRQGRRNDYVLTVSPPCQPYTRRGKGLASEDPRARSFHAVIDQLRAIEHVPRRIF
FT                   VENVVGFESSDTRRALLNALGSRRYDVREFIVSPMALGIPYSRSRYYLIATLREGGFRA
FT                   PTPAWLAGRELNDDGSVVTSDAQSSPSSSATLSEYIVADADGRVDLLLSPDTIKKYRRM
FT                   LDVVHAKSRRCSTFTSGYGSTVFGGSVVLRGGNDELVSMLEVDVNETSGVARISERDIE
FT                   RFVGELRWFAVEEIKRLHGVRRDFTFDACSTKKAIFLLGNSISVDVVREVLRHLIQDG"
FT   CDS_pept        complement(230376..230945)
FT                   /codon_start=1
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683961"
FT                   /gene_name="CSD2"
FT                   /orf_name="OSTLU_32550"
FT                   /product="Copper/zinc superoxide dismutase-like protein "
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ABO97171.1"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG609879"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI0001500C8A"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZX9"
FT                   /transl_table=1
FT                   /translation="MVALHASASVAWAGEATYAARLTPTRAGAGASGEVEFSLETNRAN
FT                   QEVVVVRANVRGLTPGKHGINVHENGDVSGCDDAGACTGKSYNPDKRPHHGPTALKKFG
FT                   ASACHFVGDGCVLNRHIGDLGNIVADENGDSTTSFKDLYTTLKAGTSNSIAGRSVVIRA
FT                   TADDFETEEDDGGAGPIVLYGSIVRK"
FT   CDS_pept        231214..232128
FT                   /codon_start=1
FT                   /gene_family="HOG000265039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312643"
FT                   /orf_name="OSTLU_32551"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /protein_id="ABO96939.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="HOGENOM:HBG558636"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="UniParc:UPI0001500C8B"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY0"
FT                   /transl_table=1
FT                   /translation="MRERNARMHSAASVARGTTGFAPRASDVFIATYPKTGTTWMMQIC
FT                   HQVRCEAARARGEDANGEAFDEITEVVPWDVVALDCGQDLDAAQTTTPRLFKSHERATT
FT                   MARGARSVVVTREPADVFHSFYEFLPAYMGIERGAITREEFAEAIFAGASHSGGFAEHY
FT                   LSWYDAATASRDDVLMVAFEDMKEDLGAVVDDVAAFLRCELDERGRDVVLERASFAYMR
FT                   KNHTKFDDHFVRARLAEQIGLPKASTFSVGKVREGGGAVGAGARELPQTVRDAIQAHWD
FT                   ARMAPRGFKTYDAFRAALRDLRR"
FT   CDS_pept        232381..233475
FT                   /codon_start=1
FT                   /gene_family="HOG000294680" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683962"
FT                   /orf_name="OSTLU_35640"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO96940.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500C8C"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY1"
FT                   /transl_table=1
FT                   /translation="MRASSAARASASDASGATRRAWEISKKGNLQNLKLNERAAREALG
FT                   PNECRIAVRAIGLNFADVFTVLGLYSAAPEGTFVPGLECCGEVVETASGSNYVVGDRVM
FT                   CVVRFGAFADEINCPVTQMRKLPNGWSFEEGSAFLVQGLTSYYGLKALGDVRKNASVLV
FT                   HSAAGGCGLQSLGICERVGAKAIAVIGNPSKVDTLKERFPSLKAIIVRDRKRFAKQVRD
FT                   ACEAIGASEGVDIVFDATLGDFFQGGWENLARGGRYVVYGAADLTPRGDSIGLLGWIKL
FT                   AWKFVRRQKVDPLMLPGENKGILGFNLIWQFDRQEELARLLAELLALDLPAPKVGATFE
FT                   FSQLPEALRLFQTGQTTGKVVVKI"
FT   CDS_pept        233612..233779
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856226"
FT                   /orf_name="OSTLU_32553"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96941.1"
FT                   /db_xref="UniParc:UPI0001500C8D"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY2"
FT                   /transl_table=1
FT                   /translation="MLAFFLVLFVSARFRPCAATRVSTRVYEKDDGATIDVTREHRLNG
FT                   YFVSAVYTKP"
FT   CDS_pept        join(complement(235846..235900),complement(233809..235688))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683963"
FT                   /orf_name="OSTLU_32554"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97172.1"
FT                   /db_xref="UniParc:UPI0001500C8E"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY3"
FT                   /transl_table=1
FT                   /translation="MDVDRAARTRGRGAGGDFDAVVDDGEGALPSFAARRGAGGRREVG
FT                   GAKRAFALTVRLESFERAARGEAFDFDAAVAASACADDALADALGIDRARSECLVRTAP
FT                   SARPASRPGDVVVFPSGKDSVDFACAPATLAETLARKPLLLVDVWSVAATSRVASAEIA
FT                   IDELLRRPEVRYRAEVTDEDGVVVGRVRLYVRLEDRGALDGVVSEPSALKTPPPKPKEP
FT                   STAMLMSPPPVPSAQKPPPPAPKAQTRHAAPPTNAPADPRAGAEYKVAYDLEVWKQHQM
FT                   TKFYEDLRMKESVRMKILEDEWRRHETQRAREAEEGANRLRIMEKKLQEAAVALESRER
FT                   KLVELEENFDHRKHKLERETSRAREEAKDSIRRNQETSEHRVEMEKQKAREAIRERDSL
FT                   HRRLEHADAQLIELESSFAAHKKAQLETNEAALQAEISRLVPRCEAAEAQAAEESESKE
FT                   RYKNQLTKMARQVVALERERAHLRRAIERAGLNVSSRSHVAPSANEFMNEMLAGENADA
FT                   DAFMNTFRADVAAVSDVPFTSAKANFARTAPQARQVIRPPLSPKLDREVRDFEHEFSES
FT                   ENKAPFVPKYATSDATLNEKRAAEKEVRRLVSERGDLMRTGMYGSGDKIIALIDERIEE
FT                   LTDRIASSV"
FT   CDS_pept        236684..237622
FT                   /codon_start=1
FT                   /gene_family="HOG000265040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312644"
FT                   /orf_name="OSTLU_32555"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96942.1"
FT                   /db_xref="HOGENOM:HBG609882"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniParc:UPI0001500C8F"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY4"
FT                   /transl_table=1
FT                   /translation="MRARSCRATTSRTRGRTARARAATTNGDAQNVAFDAAAIGRWAAR
FT                   AREAPWDARGAGWREFFAAKPIGAVVEVDNARETISAKEVESHGLNWPTCRAEAVERAR
FT                   VNTVRFRQNYAQIACAATLLGSECAAFAMALVSFYAYLALRSDRILGELSLATKDALKW
FT                   NDAVVAGVSRSKLKSTTLGVAVVLFLLSDATANTYAIMRSVAWTAAIALLHAILRPIDL
FT                   KGTLADIVKDFRAAKSKEDLRGAARSGLKSMKAWISEKAKPVEATPIFVVEKGEKKRSD
FT                   GADATPARRSEDANGAIDVDAREAEDTKYLP"
FT   CDS_pept        complement(237684..238331)
FT                   /codon_start=1
FT                   /gene_family="HOG000236354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161001"
FT                   /orf_name="OSTLU_35662"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97173.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG314222"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI0001500C90"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY5"
FT                   /transl_table=1
FT                   /translation="MPSKLALAFTAALAFTAPSSARADVDGAVTCGSALKIKHANTKHI
FT                   LASQPVAYASGSGQQSVTAIKNAGEEAYWLIHGAVGEDCARGAPVTHGMTVRFRHAGTR
FT                   AWLHSHEHRSPLSGNNEVSCFGGDESSDTGDNWIVEVPSGSGTWEMGKKVRFKHVDTGA
FT                   YLQSHGLKYGRPIAGHQEVMAQKSAGPNALWTTEGTGVFFPTAQEIAAKDEL"
FT   CDS_pept        complement(238523..239086)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161002"
FT                   /orf_name="OSTLU_32557"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97174.1"
FT                   /db_xref="HOGENOM:HBG609883"
FT                   /db_xref="UniParc:UPI0001500C91"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY6"
FT                   /transl_table=1
FT                   /translation="MFRGRARALTARVERAIAAIATPATTSRSGGAREATRRLASTTAR
FT                   EDDGGRDDDWLAARKRWKAEVNEMRKAWRREFDEKSAEKAKAEEVARAEVAEAKAERLA
FT                   EKARARAARAGASARTLEELKREKDRKMRVIAGRRYQRAHAMSLRRQAREVDLLKQSRD
FT                   WIDTPEALEASIERAMAHPERLFK"
FT   CDS_pept        239508..240455
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312645"
FT                   /orf_name="OSTLU_93003"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ABO96943.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001500C92"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY7"
FT                   /transl_table=1
FT                   /translation="MRRLTTRANAGRAQDGTHGGDGPTAEDLDELRDVIIHCDGSMDVL
FT                   GGLSSDIARDVPVLGDRATAFVMECVTELPVKTPVYAALAGLINAEAREFGAQVVEATR
FT                   EALMECLNGDDLTQRVRARVLTRFLVMLSTVGVVQRREVMEYLASLLSSAQASAKKGAA
FT                   GWQPRADWLAYVALSALPWGGEFFSKSESSNDFEALLDMAEAYCKIRTPNSDAASIIIK
FT                   SADGIEVDWFVDMCNRLSAARTDGRWHIASIPAIAEPFVEKLASTANAHSLNGIEIPEK
FT                   TFTNHAEAAAKYPGRSMLRYVHSHARRASLVRWR"
FT   CDS_pept        <240615..242096
FT                   /codon_start=1
FT                   /gene_family="HOG000198074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683964"
FT                   /orf_name="OSTLU_87731"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ABO96944.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG559642"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001500C93"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY8"
FT                   /transl_table=1
FT                   /translation="LEPSFTEGTGNADAWGPLERFVAEEYIIDTIWAFEPGYRRSATIP
FT                   VTEQLASLPLPADQPEQCQFMVAETLFAELLSLPKPSFTPVLYHIIIQDLCKIIPTFPP
FT                   KMAKTVGAMFRAIDRMDVGARDRLASWLAHQISCFDLVWPWSSWKHVMEQPDDAPQRTF
FT                   CKEVLRKLCQLSFFERVQKSLIEELHPLLPGQAGINAEYVDAVAQEPVFGALKEMLASK
FT                   KEGHEVLGWIQSQAASASPDVLLRALAVATLERGQKCITHHDVLLKRYALPIRDLVEKA
FT                   GGEVLVDAAAGVWRGHPQMGPIAIERLLALDLVTPAAVVNWLLQRAAAFGEDDTYEIAN
FT                   VVCEFVCASKEQAIGKREALLRKLREAEAEAAAAGQAATELTEQGRVFEAQQAQAAEAS
FT                   AVEEISIHEAALASADAPVDRCAAITREICLNLCGGLVKAASGGASAAVADRILAFVRK
FT                   YRAELALDADAVIKAAGTKKTAKSAVAAALGVHLK"
FT   CDS_pept        join(242237..242464,242689..242946)
FT                   /codon_start=1
FT                   /gene_family="HOG000111610" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312646"
FT                   /gene_name="PRPL27"
FT                   /orf_name="OSTLU_32559"
FT                   /product="Plastid ribosomal protein L27 large ribosomal
FT                   subunit"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO96945.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG609885"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI0001500C94"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZY9"
FT                   /transl_table=1
FT                   /translation="MHAALSSKLSTVALRIAPARVDARAPRRAVIECAHKKGTGSTKNG
FT                   RDSNPQYLGVKKYGEEKVQVGSIIVRQRGNKFHAGAGVGTGKDFTLFALRDGEVMFKVG
FT                   ANKKKFVTVVDTVDRSGRADGQPTRKDKRKAMYSPRAVVRAALEEGISAPGVERVAR"
FT   CDS_pept        243159..>243521
FT                   /codon_start=1
FT                   /gene_family="HOG000111610" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19161003"
FT                   /orf_name="OSTLU_35728"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO96946.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG285569"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI0001500C95"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ0"
FT                   /transl_table=1
FT                   /translation="MIAAASALASRFAVATALDRIAPARVDARAPRRAVIECAHKKGTG
FT                   STKNGRDSNPQYLGVKKYGEEKVQVGSIIVRQRGNKFHAGDGVGTGKDFTLYALRDGEV
FT                   KFKVGANKKKFVTIVDA"
FT   CDS_pept        244456..245337
FT                   /codon_start=1
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683965"
FT                   /orf_name="OSTLU_16077"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ABO96947.1"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG328751"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI0001500C96"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ1"
FT                   /transl_table=1
FT                   /translation="MAAEIIDGKAIAQAVRDEVRDKVTAMRAKTGKAPGLAVVLVGERK
FT                   DSQTYVRSKKKACEEAGIESFGTDLPEDATEEEVLAVVAAYNADPNVHGILVQLPMPKH
FT                   INEERVLGAIDYEKDVDGFHPLNIGRLSQRGREPLFVPCTPRGCIELLERTGIPIAGKE
FT                   AVVVGRSNVVGTPAALLLQRRDATVTIVHSRTPNPEEICRRADIVIAACGQMEMVKGSW
FT                   LKPGCAVIDVGINAKDDPSKKRGYRLVGDVEYDSAAEVAGHITPVPGGVGPMTIAILLQ
FT                   NTLEGAERAFGP"
FT   tRNA            complement(245439..245602)
FT                   /gene_name="tRNA:Met (CAU)"
FT                   /anticodon=(pos:245566..245568,aa:Met)
FT   CDS_pept        245761..247113
FT                   /codon_start=1
FT                   /gene_family="HOG000265041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161004"
FT                   /orf_name="OSTLU_32562"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ABO96948.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG609886"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI0001500C97"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ2"
FT                   /transl_table=1
FT                   /translation="MLASSLSASRAVAPRASRAFRDARSSARRTARRARAPARVAAKLE
FT                   DTPKFVRDSRDDAKAAQPPDAGRTAADVEAFIADLSGDARGDSPVTQTLNKEFGLSDGA
FT                   TPFVRVRDGRGSLTKVTLTHPNGSYVDVYLKGGNVASWVLASGGEVLYVPDDASFKKHA
FT                   PTDGGNPVCFPQFGAGGERPGSVGAAKMPEDGFANRMEWRIGETGTYASSDGTSCPFVT
FT                   LELTDDDSSRAAFNHNFKLTQEISLEHNALKVKMTCANTGSTAFEYAIGRKAHIAVSDV
FT                   REGDVYYVGFEDCVVLDNCLHPTKPRVRFTKDLDAMSERCFKLDGPTDKVYLATEDLAT
FT                   GVEVGTGCTVFAQNLSGERGCVDRAVFNPWEASPKTYRWYAGLGIGNFGKLRVAEPDTK
FT                   SSTEIQYKVVDSTPSIGIREDFELFEKVNARNMFARPKIDLSNAELPDDMQ"
FT   CDS_pept        complement(247271..>247786)
FT                   /codon_start=1
FT                   /gene_family="HOG000198075" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683966"
FT                   /orf_name="OSTLU_93004"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97175.1"
FT                   /db_xref="HOGENOM:HBG559593"
FT                   /db_xref="UniParc:UPI0001500C98"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ3"
FT                   /transl_table=1
FT                   /translation="LAYSPVSVPALLESTMARGAEEGMTMDDDDDMSEDAKALVLENSA
FT                   HEQLATFLRLCVATCGGGRGATARGDCWTWLFGAITVWVDAEGADESAPQRQAYELSEV
FT                   RVVVKKGVAVDGEAAADQVLAGIDALVDADDQLCGKKNLYVRFGCRGDWPDLKPPGEYA
FT                   GDAAAAPT"
FT   CDS_pept        join(complement(248898..249793),complement(248685..248751))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312647"
FT                   /orf_name="OSTLU_32564"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97176.1"
FT                   /db_xref="UniParc:UPI0001500C99"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ4"
FT                   /transl_table=1
FT                   /translation="MRAIVADGDDASEWRIQSLAGSGKAEDGGPSEGAGTDQTSIMHSD
FT                   EGVANVLKTMMGDDIIVDETGRIDAEACDKRQDFESTAAATARIERPEFLAPSDDDRDP
FT                   EELRKLRSLTGDQMGTLATYQQMLQNKRRARDEWRVATRLALRKLFQEASEITGAYNQR
FT                   IRDLAIERENTEFAIVMFDLRRARIARRLHERHLAGDFDGKSDEEAARVREALSDVHRA
FT                   TEIVREYAANVEETQRLLDSATFALKAAQRAFRREVQDHPASSVHLDALQALYQRQDAI
FT                   ARTVEEAASKKIPVFPQRHRQSARTRSKDGAIGTMDSSV"
FT   CDS_pept        complement(250802..250969)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856227"
FT                   /orf_name="OSTLU_32565"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97177.1"
FT                   /db_xref="UniParc:UPI0001500C9A"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ5"
FT                   /transl_table=1
FT                   /translation="MVNRLLLTGRDAVDQAVSKFLERREAIQREEDGGDGKGSVGGSFG
FT                   GSLGGSVYGK"
FT   CDS_pept        join(complement(254257..255380),complement(251463..254109))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312648"
FT                   /orf_name="OSTLU_35503"
FT                   /product="ABC(ABCC) family transporter: multispecific
FT                   organic anion/multidrug"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97178.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001500C9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ6"
FT                   /transl_table=1
FT                   /translation="MLETLGRVERERAAAAADADAAADADATTRKEAKAKAKEGFLPAL
FT                   ASPLWRTFGGVILQGTFFKLCNDVVQFLPPVVLSGFLRYVGNKPNFMSDAFGASVTGNG
FT                   IGWLYCALMFSLAVLRTLCEQTYFYYAQASGICIKGALSTAVYRKTMRLSSAGRSGSTT
FT                   GEVLNYMQLDAQRVGDLMLFLNVLWSGLLQTMGYMALLYSYIGWSVFGGLFIMLGLIPA
FT                   QKFFYGMMYRYRKKQNVETDRRVKLENEGLSGIKILKLNAWEESLREEVAEVRKREMIQ
FT                   ATKVANVAAINTSIMSAGPVIVSVVVFSLYAGVMERPMDADIVFPALTLFNLLRFPILF
FT                   YPRCLAQCADAVSSLQRLQKYFMLPEASATTKTVDDAKKDEIVDKVNPTVPFLRDINFE
FT                   LKRGELTIVVGAVGAGKTALISALLGEMSARDGASVTIDATVSYVAQTAWVQSMSLRDN
FT                   VLFGKRYDEEKYHQALEAACMEADINLLPNGDDTEIGEKGITLSGGQKQRTAIARAVYA
FT                   DAEIAILDDPLSALDAHVAKDVFKRCIRGVLRSSAVLLVTHQLQFTEFADNILVMKDGE
FT                   VVESGKYSELMDKGPVFQQMMRSYRGTQKAETTKEEVVDTSVSKDMKQTMSLQKDKAKQ
FT                   NIEKREEGSVKMNVYKAYINAMGGRFWTFSFLMFITIAERALSVFTNVWLAYWSQQKWN
FT                   LGQTVYLGGYSAIGIVSAFIAWIRTFAWVVAALTAATGLHLKLLQSVMDTRMSFFDTTP
FT                   LGRVIQRFSKDTNALDNIIGQSVSSVMSFGLLLFGTIVVMGWIMPILLPFMVPIFAVYF
FT                   YIQMYYRPGYREAKRLDAISGSPVFAHFGETLGGLSTIRAFGHQRRFITENEQRIGANQ
FT                   IADYTQKCCCERWLPVRLETIGNSLTLVVACVAVYSRDSLDAALIGLAVTYAIDITGVL
FT                   SWVIRIVSELESQMVSVERIDEYTRLPSEEETGAMAAHGVVEEPPPEWPSQGGLRFEKL
FT                   QMRYRSELPLVLNGISFEVQPGHKVGICGRTGSGKSSLLVALWRLCEPTAGSIWLDGID
FT                   ISTISLKRLRSSITCIPQDPVLFSGTIRYNLDPFNEYTDEKLWYVLEHVKCKDFIGKQG
FT                   LGLDAPVEEFGGNYSAGQRQMLCLARAMLRDTKVVCLDEATASVDTETDDNMQKVIATE
FT                   FVNCTILTIAHRINTIIENHQVVCLQAGNLVAMDSPSAMLADPNSIFSQLVAETGEASA
FT                   KNLKQRADAAEAARARNTRDIERTHLDSHIC"
FT   CDS_pept        255665..256813
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683967"
FT                   /orf_name="OSTLU_93006"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96949.1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI0001500D82"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ7"
FT                   /transl_table=1
FT                   /translation="MTSAREVARARLARLARVVRAPARDVVVFGGVVVDVHARARGATA
FT                   RGTSARGRVDRGVGGVGLNVACACAATSAARVRLVSACGDDADGASVREAWRARARGRD
FT                   DGAGVRARAGARTGRVVAVTDESGEIVASVADVDVVERDVDEEWCEKYASDARGARVVV
FT                   IDGNLSARGIRAARRAAATTATWFEPVSVAKAVRIVESGDAGRPMVGVRWCSPNAAELR
FT                   ELANAVRRSWAKGSPMSPCPFNPELEFDAANDALDALASDIATVLAAGCERVVLTLGSL
FT                   GVIVSSAPDGDASNAEHAHVPAFAVKSAASLIGAGDALVGGAVGALARGVDEMRAIAIG
FT                   VACASMACERREAALFDVDAREIDRRAAIVFDGITPIKAAVQ"
FT   CDS_pept        complement(256834..258477)
FT                   /codon_start=1
FT                   /gene_family="HOG000201093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161005"
FT                   /orf_name="OSTLU_16081"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97179.1"
FT                   /db_xref="HOGENOM:HBG609890"
FT                   /db_xref="UniParc:UPI0001500D83"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ8"
FT                   /transl_table=1
FT                   /translation="MARRAEEETFRPRTHGEGRRDAGKRASLEKLAAPRTALWERSASV
FT                   KKEKDEAVFAENCTFAPKVGRGPKTPSTKPAAERLYEYAEKRLETRERVQARVVEEEME
FT                   LLTFKPTVNVRTSAGIRDKVAKTPPLHRRVADVLRAKENVRTEARLKVEDELAKAHTFK
FT                   PTINPTSVILAMQRAEIQKAMEDDDDAGDEAPTIHRRRSSALDGEDENLTFAPKITRES
FT                   ERVVDELERQGKLGAGFLERQRDFSEKVARRAQEKRAMVDDECTFMPDIGNAASVLRRG
FT                   RHVYKLLETPEERSDRLAVKDAERKRAAQRVREREHYAQFTYQPELNEKSYELAPHGST
FT                   IDDLARDERRDLARRRAQAELEREFREQHTFEPNLDRSNEARKARDTSQFAMDYGVGGD
FT                   AVSARIEAYRHEKETALENLRRRAEYRELEQCTFRPESIAREPRAMGSPSASKVKGMDS
FT                   FLRKQAKARELEEEKRERYAKAFLENLDDFDRWGRRTIPEPFTGAFAENVVEKAEARRK
FT                   ALAEEHLRRELEECTWEPATNHSRKSTSIK"
FT   CDS_pept        259328..260509
FT                   /codon_start=1
FT                   /gene_family="HOG000049094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683968"
FT                   /orf_name="OSTLU_32569"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="microtubule-based process "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="ABO96950.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG478075"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="UniParc:UPI0001500D84"
FT                   /db_xref="UniProtKB/TrEMBL:A4RZZ9"
FT                   /transl_table=1
FT                   /translation="MTRRSGTTTRAATNAATIKVVGVGGGGSNAVNRMVDADINGVEFW
FT                   IVNTDAQALETAVADPRNHLQIGAELTRGLGAGGNPEIGQKAAEESRAAIEQALSGSDM
FT                   VFVTAGMGGGTGSGAAPVVAQVAKSAGILTVGIVTMPFKFEGRQRYNQAMEAVERLRQN
FT                   VDTLIVIPNDRLLAAVDASLPVQDAFLLADDILRQGVRGITDIITLPGLINVDFADVRA
FT                   VMADAGSSLMGIGRASGKNRAREAAEAAISSPLLDLGIDRATGIVWNITGGSDLTLHEV
FT                   NEAAEVIYDLVDPSALIIFGAVVKDGNRATDGEVSITLIATGFSPSAGISQTAAPASRS
FT                   NGKKAPAAIDGRTPIMGWNTKTEIPSNGKSERDEEQPASRGGIPSFLRRRMGR"
FT   CDS_pept        complement(260615..262594)
FT                   /codon_start=1
FT                   /gene_family="HOG000265042" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683969"
FT                   /orf_name="OSTLU_93007"
FT                   /product="Predicted protein"
FT                   /biological_process="negative regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO97180.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016481"
FT                   /db_xref="HOGENOM:HBG609891"
FT                   /db_xref="InterPro:IPR006942"
FT                   /db_xref="UniParc:UPI0001500D85"
FT                   /db_xref="UniProtKB/TrEMBL:A4S000"
FT                   /transl_table=1
FT                   /translation="MSDDDEVCTRTATASDGEGTRAGESGAIAALGETKTSRLMELEAR
FT                   LAEKDFIMEPSAIDDVRAYVSAGGAPSTAIELLSENYRGYAAMTTLAVHWLKVTAPPRR
FT                   GANTSPIKVSAAVETRGIDNGDGDATRTPTGGILTSGAGKGTPRERAATMETEARFDEM
FT                   YFLEALVREKFDANKADAVFQGRPPAWLDGLFKSERGRAVLFSLAERNPNCLLISCAIQ
FT                   HAWQRGMRHEVRALGPAAAAYFSIFHELLADHVKGIIEAGDDDERRMDFEERLKSMCCQ
FT                   SIGTYVFGQLMLATLGRDTDKATTKSSQAIAARLSEEIEEAAASLHGAATVRRLAPWLA
FT                   ASAADATAKYATADLLSSRPVGTNTSSVGQIRDSGALAAGDLKKLLDLYVSSDVKKKPS
FT                   VAPLRHPDVLYNLISEAFKWTVDSGANRLRSECFELIALAASDDETSVDEVKAALTEAV
FT                   AIVENAKRGEMPEQTSVDKVFAIPCATAGIIAAARSALTNEMYHRVVQVGNANSVFVHV
FT                   LGEVAKKHIGLQGVVLEALNAIIQSCGSSHGAELAISLLDLGCELVAAGHVMPTITAAA
FT                   NSWRRTLDPSQIRYFANEVLEIAGPPYSRDFAVVMIRLLDSANSRKRMSKTVDDFVEDV
FT                   RVNRRSFHPPLSLAEVGVLDSLSR"
FT   CDS_pept        262907..263212
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683970"
FT                   /orf_name="OSTLU_93008"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96951.1"
FT                   /db_xref="InterPro:IPR019013"
FT                   /db_xref="UniParc:UPI0001500D86"
FT                   /db_xref="UniProtKB/TrEMBL:A4S001"
FT                   /transl_table=1
FT                   /translation="MPDGEGERRASANERAALRRLGWFTAALAAVPYATYKTTLRTTCP
FT                   AAYERYGATFLATESGRATCAGMFAIVAVNVVLLLYVASALRGGDERLPVPAKKAD"
FT   CDS_pept        complement(<264104..266086)
FT                   /codon_start=1
FT                   /gene_family="HOG000029513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856228"
FT                   /orf_name="OSTLU_35458"
FT                   /product="Predicted protein"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="ABO97181.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI0001500D87"
FT                   /db_xref="UniProtKB/TrEMBL:A4S002"
FT                   /transl_table=1
FT                   /translation="MNNINPGGEPRNLEARRQLMFFANSLSFATLKMPTKLRNMRAWTA
FT                   FTPYYAEEVSYVKDELIKPLEDQKTLLSIIQATYPDEYENFKERVGALACDDATVTEKY
FT                   WEELRIWTSDHTQSLSRCVRGVCSYGAALRFLARAEGYDEDEIETLVCDKFEYLVSCQV
FT                   YGNMLNAPQGSADRQKAEDINELILNHPELRVCFVQTKSDTNDTFASCLVGCDRENRTL
FT                   SLACKVELPGNPIIGEGKPENQNHAVIFSRGAYLQTLDMNQDGYFPEALKMRNLLDVFS
FT                   EDVVLVGFPEVIFSETTGAVAQFAAISEFIFQTFQRFMTWPLMVRFHYGHPDVWDKAFT
FT                   MTNGGVSKASKMIHVAEDFFGGVNAIVRGGRVLFEEFIEVGKGRDMGFTSVNGFEQKIS
FT                   GSAGTISMSRDVYRLHRSMDFFRMMSMYFSGPGFFISVMQTAWCVYLYILVHAGLAIAD
FT                   LEIYRVYRYFKMTETQTTLSLSKEEGGYYNSIYAIQLGLLTVLPLFLKMVMDRGLRDGI
FT                   EYTASSLVRGSWAFNIFAMTTKGYNYMVGLLFGKAQYIATERGFVLQNANMVVLYGLYA
FT                   KSHLYFGMEVLLLLLLFHANTVLPKSLLYSWSVWSFGICIIITPWWFSPQSTNTYWMRN
FT                   SWNDWRDWLDGTFDKPKIANGSWKEW"
FT   CDS_pept        complement(<271538..272095)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683971"
FT                   /orf_name="OSTLU_35532"
FT                   /product="Predicted protein"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="ABO97182.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI0001500D88"
FT                   /db_xref="UniProtKB/TrEMBL:A4S003"
FT                   /transl_table=1
FT                   /translation="MNGEVEALVEQFPHVTVNYVEQPSGDNDNFAIAKLSRGADGKFKR
FT                   THRVQLPGHPIVGEGKPENQNMGLVWSRGMYVQTIDMNQDAHLAEGLKLRNVLRLYGSD
FT                   EDIVLIGFTEQLISGRQGSVSSFAATSEAVFGTLLQRFMTNPLRVRMHYGHPDIWDGAF
FT                   IRSSGGVSKASRRLHLSEDVYGG"
FT   CDS_pept        278278..279930
FT                   /codon_start=1
FT                   /gene_family="HOG000265043" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312649"
FT                   /orf_name="OSTLU_16085"
FT                   /product="Predicted protein"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ABO96952.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG559623"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="UniParc:UPI0001500D89"
FT                   /db_xref="UniProtKB/TrEMBL:A4S004"
FT                   /transl_table=1
FT                   /translation="MASLNAKRVHFRSEGERAALGAAPDGAKDASDGFEMTMTEFEHYM
FT                   RLHGKSKQTYCSRREGGAAQDVRACEATLSRAEASFRRNQRIVAQHNADPSNTFKLRLN
FT                   KFADVDSEDFQASQLRYSARPMSKLRSHHQNAKRFARHFASGMLGQSDVDRTEFPKRFN
FT                   WKDVPNVMGRVHNQKQDCASCWAYVTTDILESLMVIRKVTPVHEELAVDELINCDTYDS
FT                   GCATGNMFTAFEWIETKGGIATNKNFNGLLDGISKKPESWFSKVQAHAGPIGYANDDLA
FT                   PEFSTRPEPHFESALKVEPGVTLEKVQEQMCMASEKPDWPRVAQVHGYCELSLSGGEKE
FT                   LMHALSKSPVAIGVNANKKFQLYDRGILRLKDCPPAPHTSETMYTAINHAALLTGWGEE
FT                   KMPNGEVVKYWEVKNSFGSDWGEGGYFRVERGPVTAEGLGTCGMYFESVYPIVDEKEAR
FT                   AQECVPGATFRRDYYRALMGGAAQQGRSFMQFFDSNDDAMAVRLALLVAAGFVMTVTLV
FT                   TRVTRMVKRTCAPQEGRAPLLDSNGARRGSDLV"
FT   CDS_pept        complement(<280247..>280693)
FT                   /codon_start=1
FT                   /gene_family="HOG000198076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683972"
FT                   /orf_name="OSTLU_10356"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97183.1"
FT                   /db_xref="HOGENOM:HBG635442"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI0001500D8A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S005"
FT                   /transl_table=1
FT                   /translation="YIESLGPTGYALFLMGYVALEVLAVPAFPLTMSAGALFGTYSGTL
FT                   LVTTAATIAAAIAFLISRYVARDKVMSLAEKYPKFKAIDKAIGEDSLRVVAIMRLSPLM
FT                   PFALSNYLYGLTSVKFRSYVVGSFFGMMPGTFAYVSAGTATRQVA"
FT   CDS_pept        <281616..282692
FT                   /codon_start=1
FT                   /gene_family="HOG000198077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683973"
FT                   /orf_name="OSTLU_87739"
FT                   /product="DMT family transporter: UDP-galactose/UDP-glucose"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO96953.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG559740"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0001500D8B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S006"
FT                   /transl_table=1
FT                   /translation="VGIFVAFSYFALAQEDVYKKRYGGARFAATFFVLACERLVNVMVA
FT                   AIGLGACGGSGARLARGEIFQSGASQTLAMAASNEALRYVSYPTQVLGKSCKMVPVMVG
FT                   GMVLGGRTFTASQYAQVVFVTLGVAIFNFGADTKKTSGNDSAYGLSLIAISLVMDAVTG
FT                   GLQDRVKRTTKALNPRAGASAKPSVYESMLYTNLSGFVVALGFAFATGQLTSGVRSCVA
FT                   HVALARAVLVYSLASAVGQVFIYYTITHFDVLVLTTVTTTRKIFSTVISVFRDPSNALN
FT                   RIQWFGCSLVFTFLALDVVAAAFRPRHSAPAAATAARRAPSSRRAERDTDTDRAAAAIG
FT                   SARSTSSRRRHSSRRSSS"
FT   CDS_pept        283074..284510
FT                   /codon_start=1
FT                   /gene_family="HOG000265047" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683974"
FT                   /orf_name="OSTLU_16088"
FT                   /product="Predicted protein"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ABO96954.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG559623"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="UniParc:UPI0001500D8C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S007"
FT                   /transl_table=1
FT                   /translation="MVRYEAHNADSAHKFQLKETKFSDLTEEEFAARVLTYKPRRQFGE
FT                   TMLGNSEDEVSSTSARVGYEAAALKSPAEIAVARKHSQRARDRTQRRERNRLRGHVEDH
FT                   GEVDDSGPLGDADPSIPAAFSWRTPPDGYGNVVGVVHDQEDLCASCWAFVTADSIASRI
FT                   AIINKGDDAPALSVKQLMACDAVDHGCSTGNMYTAYEWIGQYGGISSKADYNAKVPGDR
FT                   DDAPDAKCDASVKKVYDTPAMCDLAQVAGEEPLYRAIFERGPVAVGINANKLQAYGSGV
FT                   IMLDDCKPLGRGIESINHAALVVGWGTTDDGVKYWEIKNSYGPEWGDEGFFRLERGRIG
FT                   EHKFGTCGLLFESVYPVVTKAGDATSTDAPCVKGSVQKQTYYRNETLNPGLGDDDVEDE
FT                   ARIGVAQRRAHRAHGHAHRARKARLGDAASSHLTTHTENVVAAAAALASIAVLVAAVAH
FT                   RRRARRDAVPESAALLAAEP"
FT   CDS_pept        284690..285295
FT                   /codon_start=1
FT                   /gene_family="HOG000265048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683975"
FT                   /orf_name="OSTLU_32576"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO96955.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG609893"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001500D8D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S008"
FT                   /transl_table=1
FT                   /translation="MDFLRDVANTVERAVTGASPRALDLPQCDVAFVSETIAEYGRILA
FT                   RSKDVVVRDADRATDAEVRRARFNMVWALCHSGVEDQLRRGTQMLERGASNGANAETTL
FT                   EARWRVEFGDAMEVRDGHYLRSVAYYGMRDYERAREAAFAALKCDPECRQAAALREASE
FT                   EALARDGLVGAGAIAAAGLAILGATAAIAANSAGGSRR"
FT   CDS_pept        complement(285360..286934)
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312650"
FT                   /orf_name="OSTLU_16090"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ABO97184.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001500D8E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S009"
FT                   /transl_table=1
FT                   /translation="MSVNGNELIKDCVMELNVGRRYGLLGPNGCGKSMLLEAIAKRELE
FT                   VPAHVDIYHLREEAEPSERSALEAVVDHIREEVSRLQAIESEILTTNGPGDERLQGIYE
FT                   RLEELDPVKFETTAAELLHNLGFDKVMMNRETKALSGGWRMRVSLARALLASPALLLLD
FT                   EPTNHLDLSACVWLEDHLSKYKKCLVVISHSQDFLNGVCSHVIRVTNKTLKYYTGDFDT
FT                   FRATLAAEEVIQQKQYEKEQADIKHLKEFIASCGTYADKMKQANSKQKILDKMEAAGLT
FT                   PSPTAERTFEFTFPDCAKLAPPVLPFKNVSFRYHTADPSLGMLLENLEFGVDCDSRIAL
FT                   VGPNGAGKSTILKLMTGDIEASEGEVARHHHLSIGRYHQHSVDVLDPRASPLDFFSGTY
FT                   YDMRKPTDEWRSYLGKFGISGRLQTNPIAALSDGQKSRLVFAMICLGNPNMLLLDEPTN
FT                   HLDHDCIDSLADAINKYKGGLVLVSHDFRLIDKVAKEIWVCENKKVSVWKDSIRSYKKT
FT                   LEKASIK"
FT   CDS_pept        join(complement(288285..288986),c
FT                   omplement(<287196..288077))
FT                   /codon_start=1
FT                   /gene_family="HOG000264523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856229"
FT                   /orf_name="OSTLU_35279"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ABO97185.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001500D8F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S010"
FT                   /transl_table=1
FT                   /translation="MANATSTREDVGTSEGLILDLRGIILAYAAKVLLRPTNLSLTRGA
FT                   RYGVVGHNGAGKTTLLTRIAAGDIAGFPTGIKCVFVRHEVLVTLSASVVKFMADEANEF
FT                   GGADASAIDSSLRSVGFDDDMMKKSVAELSGGWRMRLSIARAMLQRADLLLLDEPTNHL
FT                   DVSAVEWLANYLVALEGTTVMCVSHDYEFLRKISTHIIQFDKQQLSTFDGGFDGFRAQR
FT                   PNLVLPRMKKDMQPSSAAIVFPDPGPLDGIKSKTQVVARLEDLSFAYPNNQVLSGVYTR
FT                   MYLSSRVAVVGANGAGKTTLMKNIVGELEPTGGSIWKHHNLRIAYIAQHSMHHLQAHLD
FT                   MSPKEYIQTRFYQGRDKELAKMSTMSLTDDEKVEQQSRGSVCEILGRAVKGGELCYEVK
FT                   KVGDRVGVTHWEPKRFLKVSYVVKMCKNYDEMMKAIQSGMDIRPLTSGEVYSHLRDFGI
FT                   SQELADGKIKRMSGGQKSRLVLAAAMWTKPHIIALDEPTNYLDNETLAALTAALRRFKG
FT                   GVLTISHNASF"
FT   CDS_pept        289289..290884
FT                   /codon_start=1
FT                   /gene_family="HOG000265049" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683976"
FT                   /orf_name="OSTLU_87742"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ABO96956.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG562401"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0001500D90"
FT                   /db_xref="UniProtKB/TrEMBL:A4S011"
FT                   /transl_table=1
FT                   /translation="MASRATARAAASHDARAATRRARVGGAARESAARRRASGRATSDV
FT                   DGASGRATSDVDGASGRATSADAFDLGQAIGTLARGERGATLPPGRVGALGVRETLEYL
FT                   ADSNGFVRRRVERYGPIFKTALFFKPAIVFGSREAVREFLKFEGELPADEALPETFREL
FT                   HTEYGALRMTGSRHAATRANFGKVLGRAALESYAPAIGERTREFVEDVARRSGKETSSF
FT                   RPGAECVDFALDLLFELFLGHVPEAKYKDAMKAYNGGLLSLGKWSSEFKAGKLALEDLT
FT                   SYVEAHYRGVKARGELDRPEYFFYKQYSQAVDEFDEVFSDDRIATTCVLMVWGSYIEAA
FT                   ALMGHACVLLGEHDDARRAVLREFERVCCDDENGCRRIGTLADIMSMQYTSAVAKESLR
FT                   VMPQTAGGLRVNPSPRKFASFDVPAGYVLTADPRIPFRDEANFPDPDAFKPERFVPGTH
FT                   EAKQNDVSSETYYPGGMGQHQCPGISLATVMTQIFLAELVSAFPNGWRGKTAPKYVQVP
FT                   IVILDREYEIEFLR"
FT   CDS_pept        complement(290940..291593)
FT                   /codon_start=1
FT                   /gene_family="HOG000265050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683977"
FT                   /orf_name="OSTLU_32579"
FT                   /product="Predicted protein"
FT                   /function="cysteamine dioxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97186.1"
FT                   /db_xref="GO:0047800"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG717459"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001500D91"
FT                   /db_xref="UniProtKB/TrEMBL:A4S012"
FT                   /transl_table=1
FT                   /translation="MDDVGLRALRAFSRRAEARDARDARERDGEASTTSTPRATSTPQA
FT                   TVTYLRLHAEEDFTVGAFVFERGQTIPLHNHPGMTVLMRCLFGETRVKAYDLIDDAPRL
FT                   STRDAHAARGGEHEARDCVDEVMSAANGARGATRILYPRRANVHTLSALSACAVLEVQT
FT                   PPYRVGQGRDCHYFELVRDGAKTGQNSILRETAPPPDFVCGTFRDDEDDDVELE"
FT   CDS_pept        <291800..>292258
FT                   /codon_start=1
FT                   /gene_family="HOG000198078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856230"
FT                   /orf_name="OSTLU_8500"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ABO96957.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG717773"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI0001500E77"
FT                   /db_xref="UniProtKB/TrEMBL:A4S013"
FT                   /transl_table=1
FT                   /translation="GGRGARGARGGRGGRGRGDARAPSSNGGIWRSKVTCFGCRGVGHT
FT                   LRDCRVAKGGSATMRRGEKSCYNCGASDHAARDCAAAWTNYAHAKCFVCGETGHLSKSC
FT                   PRNERGVYVNGGECKICKAKDHLVKDCPHKGDTCIRCGERGHFAAGCSK"
FT   CDS_pept        complement(<293807..>294790)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312651"
FT                   /orf_name="OSTLU_4180"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protochlorophyllide reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97187.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016630"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500E78"
FT                   /db_xref="UniProtKB/TrEMBL:A4S014"
FT                   /transl_table=1
FT                   /translation="IVTGSSSGLGLYTAKALIKNGYFVVNAVRSPEKMQVKANELGLDE
FT                   SSYAIMYLELGDLQSVRDFATEFRRSKYVKNFQALVCNAALYLPNATVPSYTKDGFEEC
FT                   VGVNHLGHHLLSLLLLDDLAEAPDANMKRLIIVGSVTGNTNTLAGQVPPRAGLGDMSGL
FT                   RNGFKNSDRNQGALIDGTRFIGAKAYKDSKLCNMLDIKAFAERFGESTGIKFSTMYPGC
FT                   IADSNLFRNHTAFFRWFFPILQKNVTKGYVSEEEAGERLASIVYDPRYSEQGAYWAWKG
FT                   GGDQLWDNYNNNNDDTRTIAFNNKPSKEGRDMAKANEVFDISTELVG"
FT   tRNA            295382..295511
FT                   /gene_name="tRNA:Asp (GUC)"
FT                   /anticodon=(pos:295416..295418,aa:Asp)
FT   CDS_pept        complement(295843..296886)
FT                   /codon_start=1
FT                   /gene_family="HOG000265051" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856231"
FT                   /orf_name="OSTLU_24784"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97188.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559761"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI0001500E79"
FT                   /db_xref="UniProtKB/TrEMBL:A4S015"
FT                   /transl_table=1
FT                   /translation="MTTSAPRLAASLCERRASTPASTSSRVPARTRRGAPPRAGFGAAV
FT                   PTARSAAVLDKHVPIDRYADGLRQLHASPDVFVVDDFLSADACADIIARAKAKGDMTQS
FT                   PVVYAGWTNDVEAWTSTVSSGPAVWIGALAMLIGSAAFGQSGLGLLGEGVVGYLGAVGA
FT                   AYAASLAYVKDKERELGDLRTSTSTALDGSGVGERELIRATERLLPGTSWTTYEAPTVI
FT                   RYERGQKLAPHFDANRGAAVEDANRGGQTLVTLLVYLNDVDEVRGGGQTVFGRLGDLAV
FT                   RPAKGRALVFFPANADGEFDDRVEHEGTEANEEKWIVRIWVHQNEVGGPPSGLPDDWND
FT                   ERGVVAP"
FT   CDS_pept        complement(297126..>297437)
FT                   /codon_start=1
FT                   /gene_family="HOG000198079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683978"
FT                   /orf_name="OSTLU_35695"
FT                   /product="Predicted protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO97189.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG706775"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="UniParc:UPI0001500E7A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S016"
FT                   /transl_table=1
FT                   /translation="AIIEVGGSQQFVSEGRFYECHSLKGVEPGSKIAFERVLGTHDGNA
FT                   PNWGHPYVKGARVEATVLENFDAKKVIVFKYRPKKHYRKKNGHRQSMTRFLVTKVVKA"
FT   CDS_pept        298188..298757
FT                   /codon_start=1
FT                   /gene_family="HOG000265052" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683979"
FT                   /orf_name="OSTLU_32585"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96958.1"
FT                   /db_xref="HOGENOM:HBG587361"
FT                   /db_xref="UniParc:UPI0001500E7B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S017"
FT                   /transl_table=1
FT                   /translation="MRATAIARARATATARATATRARRARRTTTRAGVEEETNFAPIDA
FT                   TASDAPGGVADGRFGPEAALLVGFTESEVARWRETLDEIGADFVRATACEEATLDAPLG
FT                   RALERLPREDASAAKLALGVPRMMFLSGMSSAEVMEIVDVYDELEWEPCVFACAVPKNY
FT                   ETNVRALLAEIMDDHERLTGEARCNL"
FT   CDS_pept        <299098..>300339
FT                   /codon_start=1
FT                   /gene_family="HOG000030512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161006"
FT                   /orf_name="OSTLU_10137"
FT                   /product="HAAAP family transporter: tyrosine/tryptophan "
FT                   /protein_id="ABO96959.1"
FT                   /db_xref="HOGENOM:HBG617818"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniParc:UPI0001500E7C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S018"
FT                   /transl_table=1
FT                   /translation="RLWSNVERGDDGLRRRAGSLGASVALVAGTTLGAGMLALPLVLRD
FT                   AGFVPSTVVIVACWVFFAATGLCVLEVNLGTMCELGRGGGVSVNAMCRRTLGDAGVNAA
FT                   TASFAFIHYALLVAYVQKVGELAVEIWPQVPGGANAASVAYATAMSTFLYLASPAKIER
FT                   FNSALFAGVVGTFVPLLLLAARSETTSVDNLLAVSDWSAAPATIPIVAVAFVYHQVVPV
FT                   VATSLEGDRKRATTAVLAGTAIPALMFILWDAAVLGSVDAGAIDVDPIGALQASSPLTA
FT                   ALVRGFEFFAVSTSFLGFGWGLADFLADGMKTTDIHDPRPWALALVPPVIFALACPGVF
FT                   LAALDSAGAFGVLVVFGMIPPAMVYRHRQMRDECALENDPVGCLPVLDPVLPGGALTLA
FT                   LMFAFAASEVGSETI"
FT   CDS_pept        complement(<300796..>301983)
FT                   /codon_start=1
FT                   /gene_family="HOG000198080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683980"
FT                   /orf_name="OSTLU_2814"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ABO97190.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001500E7D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S019"
FT                   /transl_table=1
FT                   /translation="PDYFMDAMKSIGHRRTTPVQRQCWPPACAGSDVLAIAPPGSGKTL
FT                   GFLLPAIEAALKDHRENPNVGKKRPGAPAVLVVAPTRELTLQISGVCNKLKKAVPVRAV
FT                   AVYGGASQEEQEEALAQHTSQALLVIGTPGRLLAVLESGALQLDRCAMLVLDEADRMLA
FT                   LGFEEQLSTIREALPDKDSGRQTLLFSATFPKAVRAIGKTWLRKGFETVKIDSEKATVP
FT                   KDDDDVNVHMAIVEQTVHVCAEHKKSRKLMKYITKLRAEDGRARSRVLVFANRIKTVQF
FT                   IADLCKRHNEKVSTLHGTMKQNRRDQALKDFKAGKTPVLIATDVAGRGLDIAGLEYVVN
FT                   WDFPGSIEQYRHRVGRAGRQGKKGAALSFFTRKFTPLASDLVKLLEKDGHFVDPNL"
FT   CDS_pept        complement(302738..303676)
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312652"
FT                   /orf_name="OSTLU_32588"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ABO97191.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI0001500E7E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S020"
FT                   /transl_table=1
FT                   /translation="MTRLRASEYGDYDAMVSALLKHEFLPEEEVMTLCDRARGLLAEES
FT                   NVQLVRAPVTVVGDIHGQFHDMMEMFKMGGLAPDTNYLFLGDYVDRGYYSVETVTLVVA
FT                   LKVRYPDRVTIIRGNHESRQITQVYGFYDECMRKYGHAGIWKAFTDLFDFMPLSAVIEN
FT                   KIFCPHGGLSPSIDTLDDVRKIDRFAEVPHEGPVCDLVWSDPDDRAGWGMSPRGAGYTF
FT                   GQDITEQFNHNNGLKLIARAHQLVMEGYLWHHDQSLVTIFSAPNYCYRCGNQASIMEVD
FT                   DNLGTSFLQFDPAPRRGEEQQAAKRCPDYFL"
FT   CDS_pept        join(<304317..305277,305365..>305630)
FT                   /codon_start=1
FT                   /gene_family="HOG000188732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312653"
FT                   /orf_name="OSTLU_3069"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96960.1"
FT                   /db_xref="HOGENOM:HBG713247"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001500E7F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S021"
FT                   /transl_table=1
FT                   /translation="ETAQEKRVRLAKAYLERLREEQAAEDTDEDDGEEEGKNLDSHTRL
FT                   AARLMEDAQRKSGHQRASIADRTTATRAPARLWRGHKRAVTGVALAEDDRTAYSVSKDG
FT                   SIFGWDIETEKRTKFPRTPEAVVDPTQGGGGPQAPPKCGAHVVSCCAVSGERNLLVTGG
FT                   ADKRVHVWDTRSMTHITAFAGHRGAITGLGFRHGTGQLFSCAEDRTVKVWSLDDMAYVD
FT                   TLFGHQDRCIGLDTQRRERLVTVGADRSTRFWKVPEDSQLVLRPPEGGGPAESCAFTAH
FT                   DHWITGSQDGTVAIWNTQRKRAAQTWENVHGFREIVAPKGVGEMASWVSAVHVAKGTDL
FT                   AASGAGDGAMRLWKTSHEGEPLVPLDCVPARGFVNSIQVASSGRFILAGMGQEPRLGRW
FT                   GRDAGARNGV"
FT   CDS_pept        join(complement(306792..307905),c
FT                   omplement(<306337..306647))
FT                   /codon_start=1
FT                   /gene_family="HOG000232962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161007"
FT                   /orf_name="OSTLU_35349"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO97192.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001500E80"
FT                   /db_xref="UniProtKB/TrEMBL:A4S022"
FT                   /transl_table=1
FT                   /translation="MDEWAALASQEGDVEPAELRRYDPAATRKYFSTRPITLLKRGIRS
FT                   FILLGGFSAKLWLDRKTRGENTSDAKRKEINTKRATQLRNLLVSLGPTYVKLGQVLSSR
FT                   ADLLPAEYIEELRVLQDRVPPFDDDLARRILDRELGPTADRLSLGSTPIASASLGQVYR
FT                   GTWRNDEGQLEEVAVKVQRPGALVAISLDVGIIRSFAEPWRKWNNLNSDLEGLVDEWGR
FT                   RFIAELDYEAEATNGENFAKAMASRSDLGGVVTAAPVFRQASTRRVLTTGWIEGVRLQD
FT                   SKADDTAQLCAVALTSYLAMLLDLGYLHADPHPGNLLRTNDGKLCILDWGLVTPVSKDL
FT                   SAAILRFIAHLVSKDFEAVPGDLDAMGFIPSELKGVKDPKARRDAFLEAAGTDSKVAQL
FT                   TKDLEGVQEKYGNIFQIPAYFGYILRAFSVLEGIGLSSDKNYSIANECYPYVARRLLTD
FT                   KSPETRRALEQLLYGKE"
FT   CDS_pept        308630..309934
FT                   /codon_start=1
FT                   /gene_family="HOG000201092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161008"
FT                   /orf_name="OSTLU_32591"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96961.1"
FT                   /db_xref="HOGENOM:HBG609895"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="UniParc:UPI0001500E81"
FT                   /db_xref="UniProtKB/TrEMBL:A4S023"
FT                   /transl_table=1
FT                   /translation="MSSDARVAELDRRGYYVAVDVPRGATFALDTAEWTCDERFAGVKA
FT                   LTRGLHFVAVRDANERGAGERVGEFIDAAPGSVEIRRWDAAVETLGEGEGMSAEDAERA
FT                   RAATREGRAFDGGLAWYPTEVETRWMGLSGWITRDSLRRCGVDCGTRVVAGDPEAETRG
FT                   DERGGVVPYFDNIQRAPTFTVNAVRKRPSGMTPAEVSAINIDANARLAHAVACFGDDGW
FT                   RGLLGEFQLAFVLLMGLSSMAALEQWKHLAHVVCSCAETAVFDYPELYLGFVDALDAQL
FT                   ARAGEDFFVDDYTEDNFLRPCMVALMRIDVDDTPKREVTDMDVESTLDAISSKLAALAR
FT                   GVREKFDVDLIEEAREAKLADSSVVDAEEDAPVVVELSEGHYMAMNATDVDVESDAFKT
FT                   DAESGAERMGWMRAYAPTSADHTPRNGSKFVNQRA"
FT   CDS_pept        310837..312609
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683981"
FT                   /orf_name="OSTLU_32592"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96962.1"
FT                   /db_xref="UniParc:UPI0001500E82"
FT                   /db_xref="UniProtKB/TrEMBL:A4S024"
FT                   /transl_table=1
FT                   /translation="MANALIAFTLANAACELVTPIRYARTMTLWSRGRGDCGETAKIGA
FT                   VCGYLIQIAATFTWYELAVLGIIPGGASDGTVDFELRLIHQMFTYVTFGAVFAIWLDDL
FT                   AVVGAPVSWCSSLARLYQFFSTRMIACMMIMASRKTPTAWHPFWTAAGYTASAVKGAGT
FT                   DVILKYAYYFCRAGFSVVSMAIALTGVFYWNPVRAWFIRVEDSQSRASRTSNRKEMMRT
FT                   IFWHCAFGLIFSAIWITASNSGIPRIDAIKGASRSTMSTHYFEPWIPGHQIIHAKNHGQ
FT                   TMIAVAYATFIAYSLNYMDDGGLWISKVLSIQLPAQIYNFFVVIYIIVALGGGTIFHPT
FT                   WYTNGWAPSWATHRMLDWLFFVGTGHLTIFGVPLITYALLKHLSIPEFKPYATASMGFF
FT                   TKCMRHGMVSILFSGLWMMAVSTGVPMPDAKLTAMFGLPPLHKLDVRETIKMHHVDIIV
FT                   SIIIMANGYAVLALDRVVQLDYKLHQFITVVWKHSMTSRWVYFWCAKILLHSGERFTTP
FT                   NVIASLLRFRSQVKSTSSDNWFFVLIAVMELYSFTAMMLLFLFTLTRMARASVAYLRNN
FT                   GQGQVNWTTGLKQE"
FT   CDS_pept        complement(312807..313859)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007713"
FT                   /orf_name="OSTLU_32593"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ABO97193.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001500E83"
FT                   /db_xref="UniProtKB/TrEMBL:A4S025"
FT                   /transl_table=1
FT                   /translation="MFAWTYDLPLGAYAFGGTVREASEQRTQKIAVIVIGYVLEIFLVL
FT                   GYARAGKKRMHPKFRLNRRRARRLLVHVAFGTMELTLGARALLVGGGARGTMRASAACV
FT                   LVIALTAMLQIDASFGTPSIITPALHIINTAHIEKAFRVLIGAGALSSDSSGAVLENFI
FT                   DQLVLAQGFVYSRMFIFAFTNVPGIKEHRYTTGATLALFLVIPAVYGPVGALIAIVIIA
FT                   AYSNACGSEESGKERNFAAICGRVNSLVRLRIGKTPLRTAFDVLDKDGNGTLDGSELRE
FT                   QLFTWGVDARDIKELFERIDISNRGSLSFEEILNDTAGQAMLEYISVLLHDNESLDGAP
FT                   HSSSRASKLA"
FT   CDS_pept        complement(314138..317233)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161009"
FT                   /orf_name="OSTLU_46073"
FT                   /product="Predicted protein"
FT                   /function="catalase activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ABO97194.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000907"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR008976"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR013819"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0001500E84"
FT                   /db_xref="UniProtKB/TrEMBL:A4S026"
FT                   /transl_table=1
FT                   /translation="MFDAASNSEFPIPMPPPNAFGLLVMQLKIAFMFVFGTLMQKRRPT
FT                   HPVGVGAIGQFTVIENSKVPKNAFFTKGKTMPIILRHSNAVGVKLADSEMYDDASLEIR
FT                   GCALKFSNAVDESPFDLHLNTGEFAGFFNLDSFLPFVFQMATFNDSAYKAWGMKYPTGI
FT                   KAGIGGVRRAPDSYCDLHYYSQTCREFHALDGKKRYCKFRLVPYGAGPGTDVGQEPFLP
FT                   DEADQNLIATTHMMKYRRLPNEKRLPDYLRNEFCTKVAGEAVRYRLQIQLYEATSSDTA
FT                   EIFNPNKAWGTEFLDVGVVRLHAALPQHSVENLSFGMNRTPACMPLTRPINSQDYNSLN
FT                   WTRAVVYETSYKIRRVFTRGRKDVYAPEASKKYTIKVTTHSIAGSGIDGDVVLQFVGTR
FT                   GATPKIVLHDLGDSFATGAISTHFVHADDIGEPAYAIISQTSKSSWNCGRIDVTFTSQI
FT                   PTSFTLNVWRYIGQGVRFVLPCSITPTTSLACRQLIADATEQYLSFMKKEFDWSNGSYL
FT                   PNHSTYDDHSKLPITEQFSSTKYKDFFVDTFVGFENKGVAEMIKDEEIKSLDDYYRLYA
FT                   SLPPVAIIRDWRSDEEFGRQFMNGTHPNQVRKVSQIPAKFRVTEEHVRGVLPPGKTLES
FT                   ELAAGHIFMVDYEILEDIKRGQGYCVENSMALFFADKSTALRPICIQHFQSGASAPVWT
FT                   PKDGEYEWLLAKAHLMCSDGNVHQMISHLLGTHLLMEPWSVCVERTLPRNHPVYRVLRP
FT                   HLIYVIAINTLGRSLLISPGGVTDRVVAVGQGGHMDLMSKAYQRFKLDDLHVPTSFKKR
FT                   GVLSEGDLRGYHHRDDSLRAWACLRRFAKSIFKLHYTSDAEVAADPYIQSMILEMQGYG
FT                   YQGTDRSQHGVPGSIDSIDQLVDICTSVMYTCSFTHAAVNFSQWDYYSYCPNRPLIMRK
FT                   PAPTKKVPVTEKDVIDALPSVGQAAQTMATGWTLSQFSKEEVFVGHYITDMMITPAEIA
FT                   ALQDLRSELRAMGRQIENRNAKLGVKAYPYMHPERVPSNIGV"
FT   CDS_pept        <324061..>328050
FT                   /codon_start=1
FT                   /gene_family="HOG000213714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683982"
FT                   /orf_name="OSTLU_81"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO96963.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG320390"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001500024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S027"
FT                   /transl_table=1
FT                   /translation="PLVSTFLTKVLSDVDAGVRSATVETGRLMIDAHGAEHTQQLLAVY
FT                   EAYFDRGGSRGNLSEEAEDHVRQGVIVFLGALAVHLDKEDEKVRAILTRLLEVLSTPSE
FT                   AVQRSVADCLPPLMKKLSAEEQQALVDALLQQLTTSHAYADRRGAAFGLAGAVKGIGMS
FT                   SLKGMNIMDTLKVAIEDKKNPESREGAVMAFELFCTRLGRLFEPYVVNILPMLLVCFGD
FT                   VTAPVREATQAAARVIMANLSAQGVKLVLPALLCGVDDDKWRTKQGSVQLLGAMSNCAP
FT                   KQLGACLPQIVPRLSETLIDTHPKVVEAATQALKAVGDVIRNPEIIALSSYLLGAIQDP
FT                   TRRTKACLDVLLETTFVNVVDAPSLALIVPVLVRGLREQKADMKKKAAKIAGNMSALVA
FT                   DPKDMAPYIPMLVPELKKALMDPIPEVRGVAAQALAGLINGLGEEYFEDLLPWMMRAMQ
FT                   SDGTSVERSGAAQGLSECLAVLSTDHFDALFPEILSGCANASSAVREGHLTLLRFLPIS
FT                   LGDVFEAHLVDALACVLQGLADEDEPVREAALNAGRVFVEEFSHSGSSLDLILPAIEDG
FT                   IVSDNWRIRQSSVELLGSMLFRIIGSSGKVRVEGGDDAEGISTEAQGQMLSNTLGEIRH
FT                   HNLLAAVYILRSDGTLSVRNAAVHIWKTVVANTPKTLRVILPLLMQRVISTMSGGSDDR
FT                   QQTASRCLGDVVRKLGERVLVSVLPIMREGLKSELAEHREGVALGLAEILFAATDSQLE
FT                   NHYDVVIPTVQDALCDEDERVRSAAGAAFDKLFQHGGGHAAGEIVPALLEQLESSPTVL
FT                   EGLKQVLKAQPKILATVLPNLAQPPLSISGARTLGALAEVAGTALPPHLPLLIPPLLEA
FT                   MADDDEESRSAASSAALAVIKAVPENSSHLLLTEIKRGMTDEYPGCRAAAAKLAGEYAK
FT                   NAPGYDGDSETEVLIKRLFELFTDTDEAVLLAAWSAMGDVTATISRQELPEYVECVSKA
FT                   LTLARDKVRRANKASHEYLIPALCLPKGLAPIVQIFLQGVLSAESADAREDATKGLTLA
FT                   VSSTTSAALKAHIIAITGPLIRVVGDKHPSAVKSAILESLGVLINKGGIALKPFVPQLQ
FT                   TTFVKCLSDVQISVRMKAATAIGLLMALQTRVDALVNDLISTVESDETEAGIRESTYKA
FT                   IAGVFAYGGKNIAAPNVTRAVDAAYAALASSSSGERACASLALSRAFVWCPTEERTAVL
FT                   ERLNAGDGRAAEHREGVADALCQISRANGQVIMNDHASITLNALVRAASDERPPSRAAA
FT                   ARGLGALAAISATTSGGASPYLSKLMPVLSKLLRDAVIEVRYAATR"
FT   CDS_pept        complement(328410..329507)
FT                   /codon_start=1
FT                   /gene_family="HOG000265053" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312654"
FT                   /orf_name="OSTLU_32596"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ABO97195.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG562357"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001500025"
FT                   /db_xref="UniProtKB/TrEMBL:A4S028"
FT                   /transl_table=1
FT                   /translation="MTREKALEVLELGSSIADARARRGDGSTEEDGDAAKVIRAKYRAL
FT                   CLRWHPDKNPDDVEKAKMMFTEITCAYHTLTTANFDHERWARTYEIPPLQRLEDVLALA
FT                   LSGMDPFEIEAMLRARGEYRPHVNFGVDVRVPWEAGERPEADFNCGASAYSKTRALGDG
FT                   SGANETRQMELAWAAKAVAGASDERPWERVGGVGFDASVVAPKKSLSWKASDAVASLST
FT                   AEELNDQGMALYAKKKYADALALYVEAARMEPGKIAYQGNTAAAALLYANELRDASPQK
FT                   AEVLEIAISACESAIAIDESYVRGYVRGGKALLALGDATQNVGKLKRAREMLHKALELD
FT                   AANSSAKAALKDVEISLQLFDSDSD"
FT   CDS_pept        329923..330189
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312655"
FT                   /orf_name="OSTLU_32597"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ABO96964.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI0001500026"
FT                   /db_xref="UniProtKB/TrEMBL:A4S029"
FT                   /transl_table=1
FT                   /translation="MALWCRKCVFLKGKLEKKASFFGDDVRFAFVDVNKVSQELVRGCG
FT                   VESMPTLQVYRNGEKLWELVAGEDGEAVVKKLHYAIEDAQKEK"
FT   CDS_pept        join(complement(331706..331897),complement(331190..331666),
FT                   complement(<330839..331093))
FT                   /codon_start=1
FT                   /gene_family="HOG000198081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683983"
FT                   /orf_name="OSTLU_35690"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97196.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="UniParc:UPI0001500027"
FT                   /db_xref="UniProtKB/TrEMBL:A4S030"
FT                   /transl_table=1
FT                   /translation="MFRNYELRTAYAATASRTLPITLVVGFLGAGKTTLARRALENRQT
FT                   LRVAAAVNDFAALNVDARLDGRAAARVTELTNGCVCCSLRDDLERGVIELLNADENGGE
FT                   LGVFDYLLIETSGLVDPGEVVSRLDRNFGALTRARLDGVVCVVDAEIASEGGPEVEREA
FT                   WDAQLACADVVLLNKIDLLEGDEERLARARAVVEDKARGARVLECVDANVPLTSILDVD
FT                   MTEEQKIVVRGPLSLDPSRKTTHFAGGSQSSCNSLAHETTSPLVFARFQHWATKMMPAA
FT                   TIRAKGVLTLAEDENRESYDFHFSGKR"
FT   CDS_pept        join(<332248..332801,332868..>333537)
FT                   /codon_start=1
FT                   /gene_family="HOG000239815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683984"
FT                   /orf_name="OSTLU_2867"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96965.1"
FT                   /db_xref="HOGENOM:HBG595519"
FT                   /db_xref="UniParc:UPI0001500028"
FT                   /db_xref="UniProtKB/TrEMBL:A4S031"
FT                   /transl_table=1
FT                   /translation="RRARTAIARAAAFGAVLRGGLSVGKIALAATRRGRRGTTAGRARK
FT                   AVRDVASYAAFLATFAGTYVSADEGLRRRYGGEESKAWRCALAGACAGPSLMLAGSGAT
FT                   HYGLAGYIWVRSIVLLTRVAQKSEDETMKRLTAATRMEHGDCALMVGSAAVILSCFILR
FT                   PETVEPAYKHFLDVHGGKTREELAISNTWSAGKTAREMANKTAVGAIGAGTGAIDRAEL
FT                   YRMIFFRGASNAEHFLSHVVKSFAATLSVYAPVYLVPAALIHREKLLSREKGPDLLSRI
FT                   AVGSARSALFLSSYVGAAWSGVDLANRAFGGSCDGRSLTLGVSMAGLATFIEKKSRRME
FT                   LAMYCTSRAIETAALMAVYRGFVPNWIQRRRGDIFLFSIASATIMHCYNTERDVFRSKY
FT                   LSVLDFIFG"
FT   CDS_pept        334069..334494
FT                   /codon_start=1
FT                   /gene_family="HOG000265054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683985"
FT                   /orf_name="OSTLU_32600"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96966.1"
FT                   /db_xref="HOGENOM:HBG609901"
FT                   /db_xref="UniParc:UPI0001500029"
FT                   /db_xref="UniProtKB/TrEMBL:A4S032"
FT                   /transl_table=1
FT                   /translation="MLAARATTTTRATVQTPRAPSAGASRARVVARASLKQSASSLVAH
FT                   AAVALTVANPALADALAAVDDVPLTKSPAFLGFACVAVCWGIPQTLGTAILSQKEAKGR
FT                   ALLQKRGIDTSDIGQGNWGKVQRRLQENDIDWKNEEA"
FT   CDS_pept        complement(334653..336245)
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683986"
FT                   /orf_name="OSTLU_32601"
FT                   /product="Amt family transporter: ammonium "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97197.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000150002A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S033"
FT                   /transl_table=1
FT                   /translation="MTTTTTTTTRGARLSTDARARASAARASGCARAARANGAEKNSRV
FT                   LGRAIGATAGRRARVAGAVSVDAARATLAEAESNAARSVFARAKTPVAAAAVAVAGLTL
FT                   AGPAAAAAAAVPAVVGADTCWILISSALVLFMTIPGLAAFYAGLVRRTNTLSVLIQCFA
FT                   LTAHMSVLWFLCGYSLSFSDVGMKEGVTTLASFIGGWDKVGLAGVTAASVAGTIPEALW
FT                   VLYQMTFAIITPALMIGALVERMKFNAVMWFSTLWMFAVYFPACHMVWGGPGAFFADMG
FT                   VLDFAGGIVVHITAGIGALVAAMYLGERKENKMHQGNLVLTFLGTAMLWVGWFGFNGGS
FT                   AGAASAGAAFACLATQLSASVAAIVWTALDVIENGKVSVLGTCTASIAGLAAITPAAGF
FT                   VGPVGACLMGLASAIVCRFFSTTVKEKFGYDDALDVFGVHGVGGFLGTILLGVLAHPAL
FT                   GGFNDVPMMKQTIVQVIAAVSTAVYTAGASWACLKLTDKITGGIRVPAEAEELGLDVYS
FT                   HGETAYTPMPPVR"
FT   CDS_pept        <336827..>337207
FT                   /codon_start=1
FT                   /gene_family="HOG000177330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683987"
FT                   /orf_name="OSTLU_8172"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ABO96967.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG629943"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000150002B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S034"
FT                   /transl_table=1
FT                   /translation="VVPRGGDVVFGRVTRVLEKAAHVEIAAVNGRAPRGGDFAGVVRRQ
FT                   DARAHAVDSVELERCFRAGDVVRAKVLSLGDARSFYLTTAGDDLGVVRATHGTSRATML
FT                   PIGWTEVQCPVTGEVEDRKVARV"
FT   CDS_pept        complement(337329..338219)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683988"
FT                   /orf_name="OSTLU_16112"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97198.1"
FT                   /db_xref="UniParc:UPI000150002C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S035"
FT                   /transl_table=1
FT                   /translation="MRARARRVGARRVALARAAIAMTMMASAAAVDAPPYPPYPEYPEA
FT                   PPAPAPPRPPRPPPAPRAPHPPRSPPSPTPRSPPSPPPPPSPPPPTIARTADGAALVIF
FT                   TALTLIVVSGLVYVGIGLGGARALGERRRGASGRNARGARQLDDSDSEEEMTLRDELRE
FT                   FAKQAKVIVAEGARAAIVRVQRLTHGESGERDEDWRRLSDTNPFVRWVKRQLADDDNVD
FT                   DGVGEPLIDERDDDYEDLMAEPYRFSEFADYVDAVDASSLDAVEDAAFVRLPRAQPEPS
FT                   WFARSPTTNTTDGTP"
FT   CDS_pept        join(338332..338388,338485..338691)
FT                   /codon_start=1
FT                   /gene_family="HOG000261845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683989"
FT                   /orf_name="OSTLU_32604"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA binding"
FT                   /protein_id="ABO96968.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG715417"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniParc:UPI000150002D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S036"
FT                   /transl_table=1
FT                   /translation="MATLEEFNAAAEAIKAVKETTNEEMLELYALFKQANVGDVNTARP
FT                   GMMDFKGKAKWDAWKKREGTSKEDAMTAYVALVAELKSKYGK"
FT   CDS_pept        join(339207..340154,340195..340281)
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312656"
FT                   /orf_name="OSTLU_16113"
FT                   /product="Predicted protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="ABO96969.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000150002E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S037"
FT                   /transl_table=1
FT                   /translation="MDDGRLTTRVGAQDANGEEKLERAYSPSLRSGEHGEVGCREAMED
FT                   ATVLDDNVPVEGARDVVAFYGVFDGHGGRAAAEFLRDNLMKNVVENENFMRDPELALKE
FT                   AFLRTDEDFYDKSGPGETSGSTGLAACVIGGKLYIANAGDCRAVLSRKGKAIDLSIDQK
FT                   PSSVGEMERIKNAGGFVEDGYVNGLLGVSRAFGDWHIEGLKGRGGKAGPVTVDPEIEKT
FT                   RLTEDDEFLILACDGLWDVFSSQNAVDVARASLRQHNDPTITAKELAAEALRRDSSDNI
FT                   SVVCVCLTPEAPKKETFIRTSPSLLRSLSVEAMSIFPKRSRQNACKAFGTLQVTDELDP
FT                   IPIP"
FT   CDS_pept        complement(340532..341560)
FT                   /codon_start=1
FT                   /gene_family="HOG000265055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683990"
FT                   /orf_name="OSTLU_87757"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97199.1"
FT                   /db_xref="HOGENOM:HBG559628"
FT                   /db_xref="UniParc:UPI000150002F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S038"
FT                   /transl_table=1
FT                   /translation="MEDDDTAKRVDAASEVLDKIIRETVEGIFLEEAATEVLNEASAAN
FT                   EREAVESAVDKRAVLRAVVRSHFEELDGSFLAALGAYVRASEASGDLQLVSLLNAIKEE
FT                   TLATVTDSLTDEMQVVQLVARLKSNEERFEVIRVAHAGGGRALGDVDVPGVSVEKIERA
FT                   AAQLIDELELQEQIPNWDLLYQVIVVRETARQLSKAADASGVYSDVVVSGSFAPSELPK
FT                   AESALIKELVVVNTVAQRRALLAQMFDETRDKLDQDFDRSSGKVKLKKTTRGFQPRIER
FT                   AAATAAGLDSRDLRPGRFIDSVINLRVSLLREGEESTPVVTRLGEIYYEMCDVVMENAN
FT                   VG"
FT   CDS_pept        <343745..>344479
FT                   /codon_start=1
FT                   /gene_family="HOG000198082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007714"
FT                   /orf_name="OSTLU_6116"
FT                   /product="Predicted protein"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="ABO96970.1"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG316610"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="UniParc:UPI0001500030"
FT                   /db_xref="UniProtKB/TrEMBL:A4S039"
FT                   /transl_table=1
FT                   /translation="AVFKPADEEPFAPNNPRGHRSSHNGEGMRKGTKAGEGATREVAAY
FT                   LLDHGGFAGVPATSLVNLTDGTEEDDGKLGSLQEYVENTAEAEEYGPSMFPTEEVHKIT
FT                   VLDIRLANTDRNAGNILCRSDENGNIVALIPIDHGYALPHTLEDVCFEWEFWPQASIPY
FT                   SDDVKEYVAMLDADADVEYLRENDIELQASSERVLRVCTLVLKEAVRRNFTAANIASML
FT                   SRKMSNRKSDIEKIAAQAASTAI"
FT   CDS_pept        344911..346950
FT                   /codon_start=1
FT                   /gene_family="HOG000265056" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20856232"
FT                   /gene_name="rbcL"
FT                   /orf_name="OSTLU_32608"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="ribulose-bisphosphate carboxylase activity "
FT                   /biological_process="carbon fixation"
FT                   /cellular_component="plastid"
FT                   /protein_id="ABO96971.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009536"
FT                   /db_xref="GO:0015977"
FT                   /db_xref="GO:0016984"
FT                   /db_xref="HOGENOM:HBG609904"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="UniParc:UPI0001500031"
FT                   /db_xref="UniProtKB/TrEMBL:A4S040"
FT                   /transl_table=1
FT                   /translation="MAPKSFEDMFACSPASLTKLRASHAPHASPAASHARDYSPIAFPS
FT                   MRRDDEDERARAVAGAFDDMFACSPASLKKMRGSAVERASGGVGTPTGTPTRPTASRED
FT                   LASAFGDMFLASPASLKKMRATNTAVTGTKARERGDGFGSPLRYDGDANAAEPKKEAVS
FT                   FSEMFASSPSDLAKMRRSDVGGAARGSNVEVAKVAVDARERTNAFAGMFASSPADLAKM
FT                   RGRSQSSISYAEGRHGASDRFQVIAPDFQAMFSSSPSDLKNLRSASSSSRKRLGDEADR
FT                   FEVTYLLLAPCEAAAREKVLEICLEQTVELPASLVPEGTWIREHVVGRLESLTKPKTGP
FT                   HARRPDAWNAIVSYHADTAGGELTQLVNVIFGNTSMKENVMVVDIELPRTMLREYPGPR
FT                   FGVHGLRRLLRVPEGPLVMTALKPMGLSSQELAEIAYGFAKGGIDIIKDDHGLADQPYS
FT                   PYDERVRMCAAAVARANAETGRNVLYAPCINAPAHLIISRAHAARQAGAGAVLMIPGIT
FT                   GLDAMRELAADPSFNLPIIAHPALLGCMLGGGSTNRIAGFSHEVLLGLLPRLAGADATV
FT                   FPSFGGRFGFSVDECKAINVGCTRVMGDLPAILPSPGGGMTLERIAQMREVYGPDLLLL
FT                   IGGSLYSHSENLVDGARHFMKLAGRKELYGPLECPHDGYRGHTM"
FT   CDS_pept        complement(346985..347257)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312657"
FT                   /orf_name="OSTLU_32609"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97200.1"
FT                   /db_xref="UniParc:UPI0001500032"
FT                   /db_xref="UniProtKB/TrEMBL:A4S041"
FT                   /transl_table=1
FT                   /translation="MDGVKEAIDTFLLYDFFVILFILAWLVVGVGVRLSKGNGLSYDEP
FT                   FLGTWLFLWPFLFQPLLGVHMLATLVSPAVGWAAKRGIVSEDAWR"
FT   CDS_pept        <347943..>348200
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007715"
FT                   /orf_name="OSTLU_10662"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96972.1"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniParc:UPI0001500033"
FT                   /db_xref="UniProtKB/TrEMBL:A4S042"
FT                   /transl_table=1
FT                   /translation="LFGASLFPYLGFLYFLAKPEARCPRGTLFGFKFLLAFVFGTIPFA
FT                   IYAKVEYDEILANVDVLHGVAESLLTMTNVFIVLGFRQGLR"
FT   CDS_pept        <348393..>348665
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683991"
FT                   /orf_name="OSTLU_9615"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96973.1"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="UniParc:UPI0001500034"
FT                   /db_xref="UniProtKB/TrEMBL:A4S043"
FT                   /transl_table=1
FT                   /translation="NALSLPTWVIHVSSLVEWLIAMGLAWEYAEVTKRPAWKGLTLGMI
FT                   PCHASGIAACTFHLFYNAPALNSVVAMQALLTVVGNTTCALASYRI"
FT   CDS_pept        complement(349652..350542)
FT                   /codon_start=1
FT                   /gene_family="HOG000265059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683992"
FT                   /orf_name="OSTLU_32611"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97201.1"
FT                   /db_xref="HOGENOM:HBG609906"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI0001500035"
FT                   /db_xref="UniProtKB/TrEMBL:A4S044"
FT                   /transl_table=1
FT                   /translation="MRPQNERAPEGGVKRKWVKRTGGKHAAAKRPSVKNQIRSIERLLK
FT                   REGIPPKLREEKARELEKLRDAGKENARIEREKKLSTKYHKVKFFERVKLTRRKEQLEK
FT                   KRDDDGALGADELDELAQVKEDLEYVMNFPRGEKYVSVLVKEGDTEHATKERARLRKLV
FT                   KANLAASAALGDENEGGADMAAQGDAAIDAEQDDFFLNESDDGNDSDSSSSSSSSSSSS
FT                   SSSSSSSSSSSSKKARTPVHIPKKELPVTKDPIYIKNHAQKLVERSERAKAEASKDGNK
FT                   PQRTRAEGGRKRRKK"
FT   CDS_pept        complement(350753..351295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007716"
FT                   /orf_name="OSTLU_32612"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97202.1"
FT                   /db_xref="UniParc:UPI0001500036"
FT                   /db_xref="UniProtKB/TrEMBL:A4S045"
FT                   /transl_table=1
FT                   /translation="MDFLYASAEVHTLPPRKRLACVLRDVAHSPTDLGSKKARLAGEAY
FT                   VRTALRDPRLLGKALEIVSEERYDVDGGSSDRENGGASASTKSKKGPRNMSSSSLNTAT
FT                   ATTEKKKKKLSTKRDRSTTQALKSDEDDDDDSNAEPKELTDEQMAMKLHLEMNASPRMS
FT                   RGSSRSTQMLTGRALFG"
FT   tRNA            351670..351740
FT                   /gene_name="tRNA:Gly (CCC)"
FT                   /anticodon=(pos:351702..351704,aa:Gly)
FT   CDS_pept        complement(351862..353262)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161010"
FT                   /orf_name="OSTLU_16119"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97203.1"
FT                   /db_xref="HOGENOM:HBG609908"
FT                   /db_xref="InterPro:IPR022035"
FT                   /db_xref="UniParc:UPI000150012B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S046"
FT                   /transl_table=1
FT                   /translation="MPKRARRADRAPTDAVKRRIWDPRVRALDVDDRRSSDTPTGVRVR
FT                   GVRERADVGDARRAAARELALFRGVKRARSALQRIARARTGRTDEGGTPLLLFERWLAR
FT                   CAVSGALAAPVLPAQGLGLAKDLIRHGASERDGAEGAAEALAVAKESAARWAEARDDGG
FT                   EARDAVVVRDKGAFLTMQLGTEKPYVKCAKAHLGKLRALYCRTVRGCEPLTEDVDSDEY
FT                   QKFACAVFALLMRYESLGGAGYQSALAEDAFDVLNEKLGVSCECFASPLNARYGQFCSQ
FT                   FGFDEDRAPDVDAFFGSLGSFFSDDFAPKRGSFEMNPPFVPETMSRAVEKANDLLDRAA
FT                   NANEALSFVVIVPLWKECHYWSALLESRHLQHGPDIIDAQSHGFCDGAQHARPSHERHR
FT                   VSSFDTGVFYLRTSRAERERPVDEEIRKRVLRGMKTALGSCKDVQELEVRYRGERARGG
FT                   PAKIEDRK"
FT   CDS_pept        complement(353424..358895)
FT                   /codon_start=1
FT                   /gene_family="HOG000201091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683993"
FT                   /orf_name="OSTLU_87761"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97204.1"
FT                   /db_xref="HOGENOM:HBG609910"
FT                   /db_xref="UniParc:UPI000150012C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S047"
FT                   /transl_table=1
FT                   /translation="MGFGSDARAGAARARPGEGGWARGGATRGRRAETRASSDGSLRMT
FT                   YEANETTTTTTTTTMGVPSGSSNDGPNSTPPAMRALLTAGAVVGAVCAADYAFVTAGGL
FT                   TWAATPGASAIRASAATLATLVSAYVWSKFGGMASAPGALAMCVTYAFGSLLSIVVVQA
FT                   YKVSATCVLSAGAACAATCAAAWLVRTLADSSMFEGSYDAQVHAQAMARGAKSFERLEA
FT                   LREVMMREFEAEMAELEQKQSQFAMEMSRVEERHKREIARLQMDITKLRDQNNSHAADK
FT                   AKALEQAKAQFEAEKRRMREAHERDTALLKETISKLETEVAGMEGKFADERKDLLSKVR
FT                   AAKALYQAQRAMMYSEVSKLQKAISVKEAQAADWHAKVTAIEAEKLSLISKLEEAAANA
FT                   ETSAAELVAAVAEVQFEAERELQRAIAEALAERQALELLMNDKEAAWKVEMRAAITEAE
FT                   MKINEDAKKKLADLDARHTEAIAQLMREHQAKMQQVESEAEKRGASAFAAEKATLEATY
FT                   RSAADAAQKAHADSLEQTKAASAKDVEAIRAEMAVLKATYESAAAAAQTAHARSLELVK
FT                   EGAAQDLVAAKQEIIDAVAEQIHLNEIEKMQLVAEMKEEELEMTAELLAEKDAAIAELQ
FT                   KQLKMSKNERRAVFDLLKSESEKMKMFTGDNLKKEIESAEERLNLFWSGKMERLGAAHA
FT                   VKVEKMEKDTKSKVRQLKEDAKQELAAQLEFTAKATRVAAEAELEKQLANATRSMAAER
FT                   RALKALFDSETSKTQKLVSSYESRINALEIAEKAAKEKAQAYDAEIDALKKQSQISLES
FT                   ALASREAEVEKTWLTKMDELERAHKVQIERINADHAKAIAESQSKLKSAEAAQAEAIKA
FT                   KMAQLETDLAKTTKSLEDQLAAAREDAARQLAAEKSRTAEAIQAAAIQAEDGSAAKKEL
FT                   DALTAKFSSTESEYKSTVQKLEAEIKALELKAAAAGTDAKAQFEAEIATLNAKLKEAEE
FT                   EIKELESQLSEAKSAAANKVAELEKHFADEMHELRSAFDAQAKEGVAAVSSERDALSAR
FT                   IAALEAEHDQNLSLAKADAEKAKASAVQSLADVDAQISARLAEQKAELDAKLAAQIEEL
FT                   RKRTDADVAAASKALADAKAQYEADVAALKAQNARDLTAAKEAAESADAVLLSKISKLE
FT                   TEQKSALQKAKEQVEAEYGAKLTKAQAEIDALKAKLADAEKQNAAQAEKELADALTKAA
FT                   LIPGLQQQVDELTNSLTSSKASYESTLNKLQQDHAAEIDKLNKDHVAALKDASDASDLK
FT                   AQISALEAQLQSEKDKLAKSLTDAEAQRAELEASSKTALERARSQVIAQAEDQRKKLEQ
FT                   MFLDESAKARAAFEAEVAEYEKLVKQATADLKKAHADELSSIVAQHKSELSQALAKVDT
FT                   TSAGKVTALEAEKAKLEKAIADTNAALTKASADAKSASNDAASAKAALEKLEQEVASLT
FT                   NARDAALARASELEKEVATLTKNAVDPKELAALASARDAALARASELEKEVATLTKNAV
FT                   DPKELATLASARDAALARASELEKEVATLTKNAVDPKELATLATARDAAQARVAELEKS
FT                   LAAIAEEKSVLANKLSSVDASKAAEMQKLKDELAQLQADLTKALANAQNQRASEIARLT
FT                   ADFESKYASMQQKHESEIDELSRQALVDVSSAEKRADVAEAEIQRLRSETKDVATYKSQ
FT                   IETNEKQLIIVREKLGATEKKLADFLALYGEERKVLEESRKIADDLDRIKRRYATSMEI
FT                   DESTIDEISSKVEKQLAAADDGEKMQAMMDGRAKGDTVVDVRDIPVWAYYALGVATAIL
FT                   PRIIAGGL"
FT   CDS_pept        join(359612..359743,359862..360347)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683994"
FT                   /orf_name="OSTLU_32615"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96974.1"
FT                   /db_xref="UniParc:UPI000150012D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S048"
FT                   /transl_table=1
FT                   /translation="MHAQLACALLGTCGWQGTGYLAGVAAMSCFGLVAIETGKSGLLKY
FT                   TAASCWYTLWLDIIWMASYATDNINKNNNWNSGHRRGNELCVGMVVLIFMLRFPQFFVW
FT                   QKLWHLGFKASGGAGAQPSRYVDFATNPVARGQEMGSPRPQGDAFAQPPRATTATPSSA
FT                   LATAPVSPSPAPPAPVVSAPSPPAPISAPAVVSFTPSGPGNV"
FT   CDS_pept        join(complement(361134..361186),complement(360952..361012),
FT                   complement(360783..360838),complement(360588..360645))
FT                   /codon_start=1
FT                   /gene_family="HOG000157009" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683995"
FT                   /orf_name="OSTLU_35755"
FT                   /product="Predicted protein"
FT                   /function="cyclin-dependent protein kinase regulator
FT                   activity"
FT                   /biological_process="cell cycle"
FT                   /protein_id="ABO97205.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0016538"
FT                   /db_xref="HOGENOM:HBG611605"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="UniParc:UPI000150012E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S049"
FT                   /transl_table=1
FT                   /translation="MPQIQYSEKYYDDVYEYRHVVLPPDIAKLLPKNRLLTETEWRGLG
FT                   VQQSRGWVHYAIHRPEPHIMLYRRPKETTA"
FT   CDS_pept        361513..362907
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16683996"
FT                   /orf_name="OSTLU_16121"
FT                   /product="Predicted protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="ABO96975.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG607382"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000150012F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S050"
FT                   /transl_table=1
FT                   /translation="MRRRTTTATAGRRLSRADAIEIRSYGARLGNGYGSGHEFSLTVTL
FT                   PGAQSFDLIVDTGSPLTYFPCVGCDAELCGYHEHQYYDWRLSNDFRLLNASMNAADAAF
FT                   CDAMPVAHNVSADGECLFGLGYLDGARGGGSMIEDVVSVGDELSPAKMIFGCGGVVEAD
FT                   GGFDRQDGMAGFSRGNTAFHTQLAKAGVINAHVFGFCSEGSGTDTAMLSLGRYDFGRDL
FT                   APLSYTRILGADDLAVRTMSWKLGEAIIASSSNVYTVLDSGTTLVLLPPAMRDDFITKL
FT                   VAQMAATHPELELFDDEDLGQMCFSSATPVLTAKLRDEWFPKLAITYDPDITLILPSEN
FT                   YLNSHLYIPHTYCLGIDESDDGTILLGQQALRNTFIEYDLENDRVGVVVAQCENLRKKF
FT                   APDTPHNPWRFVATIFILLFTACVVSAVSFCLYAKFGGQKPFKYRVFQVSDILDEEIEM
FT                   GNVVDT"
FT   CDS_pept        complement(363063..365783)
FT                   /codon_start=1
FT                   /gene_family="HOG000156965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161011"
FT                   /orf_name="OSTLU_32618"
FT                   /product="Probable alanyl-tRNA synthetase, chloroplastic "
FT                   /EC_number="6.1.1.7"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="metal ion binding"
FT                   /function="tRNA binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ABO97206.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG354397"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniParc:UPI0001500130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4S051"
FT                   /transl_table=1
FT                   /translation="MSAATERERLTNANPNARGKDNSGAAIRQRFLKFYETRGHAVLPS
FT                   SSLVPEDPTVLLTIAGMLQFKPVFMGQRERAHERATTTQKCVRTNDIENVGVTARHHTF
FT                   FEMLGNFSFGDYFKKDACQWAWELATGEFGLNPERVWVSVFREDDEAFAIWRDVVGVPE
FT                   SRIKRMDEKDNFWAAGPTGPCGPCSELYYDFYPERGLEGADLDDDSRFIEFYNLVFMEL
FT                   NRDADGGVTPLKNKNIDTGMGLERMAQILQGVPNNYETDLIMPIINKAASMAGIDYNAC
FT                   NDVQKQQLKVIGDHTRAVSYMISDGVFASNIGRGYIVRRLLRRVVRNGRLLGIKPEEGA
FT                   SAFTPAIAEVAISMSEGCDPQVAKNSARILAELEREELSFQKTLGRGEEMLAELIETAK
FT                   KTKTGLSGKDAFTLYDTYGFPLDITADVATEAGITVDLEGFESAMAEQRSMSQAAHQTV
FT                   DVTAGNALARVADELGAKSTFIGYESTSSDVSNVLAIVCGGESVEEAPEGAKVDIVLDV
FT                   TPFYAESGGQVGDNGVLHTADGATLEVSDVQKAGGGRIIVHTATVTKGSIKKGSQVTAN
FT                   VDENSRRRAKSNHTATHLLQSALKKVLGEDVSQAGSLCGFDRLRFDFNSPKAPTEAQLL
FT                   EVENLVNGWISQSAALTAEEMPIAAAKDKGATMMFGEKYGDVVRVVDVPGISMELCGGT
FT                   HVSNTAEIGGFKILSEAGIASGIRRIEAVAGAGVVELLQQRDAVVKQLASALRVPPEEI
FT                   TGRVSSLQEDLRATQKLAESLRGELAVAKAGALVSQAREVGEAKVLVARLDGVDPAALK
FT                   VAAENLAAQLGDGAAIVLGSANGANVGLVALFDDKVQKDGGLKAGQVLGAAAKKCGGGG
FT                   GGKPGFAQAGGRDATQLDAALDEALTTVTAALSPK"
FT   CDS_pept        complement(366137..367108)
FT                   /codon_start=1
FT                   /gene_family="HOG000265060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683997"
FT                   /orf_name="OSTLU_32619"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97207.1"
FT                   /db_xref="HOGENOM:HBG561930"
FT                   /db_xref="UniParc:UPI0001500131"
FT                   /db_xref="UniProtKB/TrEMBL:A4S052"
FT                   /transl_table=1
FT                   /translation="MYDKLTDVFDKREEKDWIGLLAFSGKWRELRDGLFERVKTRAQQC
FT                   EDPDDEMRLSKLRRKLMALDERVDGYHALLEEVRAKEVDMWEGFVATRRAEFSPEFFTY
FT                   LTFKLEAVAQGEDDNAKESMAKDAALLLSLCEAYDEASKDQAVIEEATQTLQDILQCDS
FT                   LDAMDAKIDELAMANQISPALILTASKAHMSVKESPYTSEEVKDVMAHLYFKMKDTTSR
FT                   QQPKEVRILKYILSLEDPQDQRNALEEAFTPGPELEEIGSNTDLLWCEPAALLKLIDVI
FT                   VENFHQSAGKKNLRGDAAAMMSPAIVERMKTLKQLIIAHFSD"
FT   CDS_pept        complement(367469..368164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161012"
FT                   /orf_name="OSTLU_32620"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97208.1"
FT                   /db_xref="InterPro:IPR018143"
FT                   /db_xref="UniParc:UPI0001500132"
FT                   /db_xref="UniProtKB/TrEMBL:A4S053"
FT                   /transl_table=1
FT                   /translation="MTFCDAHRGSTCCGKEQTDAARVRAVHMQLNGFGERCRDAWGALE
FT                   CSVCDARVGVSEGVPVCAAACDGVYRACADEFFAEDGSRRLVPCRPSDTICTKLSEWIG
FT                   DVRDKGKEMCEAAGWDYVAPGERWCFDGAAAKSSERAARRSGSADKAKTSKPSKKRGKK
FT                   SRKASKGSKIDAGRVAMLAGGGVGLIYVLFTRALPLALQWHHRKNSVGARYAARRAAEQ
FT                   RSGNRAHYL"
FT   CDS_pept        368878..369378
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161013"
FT                   /orf_name="OSTLU_32621"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96976.1"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI0001500133"
FT                   /db_xref="UniProtKB/TrEMBL:A4S054"
FT                   /transl_table=1
FT                   /translation="MTLRGVAASSVYNLLTDYEASPRAFRAVRSVRVIECEGDACVASN
FT                   IYIEQECEWKFFVFGGAFPCAFEVEERDEEMKMKCSLARGRRGTGFLKQFEGSWSVENT
FT                   SEGVLIEHTLMVKPKLTPPYASKIFVQQVEQILEDVVNEIETWNGVVYGKPPHRQGVDA
FT                   SII"
FT   CDS_pept        join(complement(371414..371497),complement(369521..371248))
FT                   /codon_start=1
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161014"
FT                   /orf_name="OSTLU_32622"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO97209.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG526812"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001500134"
FT                   /db_xref="UniProtKB/TrEMBL:A4S055"
FT                   /transl_table=1
FT                   /translation="MSHDAPSTTAHAEEDDAISVGALIDDLKSEDVELRLKSIAKLGTI
FT                   AKALGAERARSELVPFLAERDDEDDECLLAIAGELATLIDAVGGEEHVHVILAPLETLI
FT                   TVEETVVRAKAVETACAVGRAMTPGGIGKYFVPLIERLAQGDWFTARVSACGLFATAFE
FT                   RSEESQLELRNTLTGMFRDLCADETPMVRRAAAQNLGKIAIVSSGDFIVNELLTMFAAL
FT                   TSDDQDSVRLLVVEDCVVLGKLLSATDCANKIVPIVLKLAADKSWRVRYAVAQQIYEMC
FT                   DVVGAEVAAKGLFDAYVALLGDSEGEVRISAAGKISEFCSLAGAVYSAEKILPKVHELA
FT                   NDSSQHVRAALAEAVLGLAPTMGKDTTVEKLLPVFFILLKDEFPDVRLNIISKLEQVNT
FT                   VIGVEMLSTELLPAIKELAEDKHWRVRLAIIEYIPVLAQQIGTTFLFQKDEGSDSGDDL
FT                   LNSLCLQWLQDSVYSIREAAANNLFRLTEIFGADWALEYIFPRIKELMSSHHYLYRLTV
FT                   LRAVSLLAPAVGEEVILGEILPIIKHATTDTVPNVRFNAAKALSPLIKAIDVAKFQSEI
FT                   RPILVGLQSDPDADVRYFASEVLTSAA"
FT   CDS_pept        join(371592..371734,371866..372070)
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683998"
FT                   /orf_name="OSTLU_35735"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ABO96977.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI0001500135"
FT                   /db_xref="UniProtKB/TrEMBL:A4S056"
FT                   /transl_table=1
FT                   /translation="MNQPSRADRFVLPEGERKLSYERDTKVENAGTFVLQREDHTIGNL
FT                   LRMELHKNPDVVFAGYKNPHPTDHRIVLKVHTNANTTPVQALRDAVTNLRAEVGDLSQQ
FT                   FADEINALRRE"
FT   CDS_pept        complement(<373603..374331)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16683999"
FT                   /orf_name="OSTLU_35775"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO97210.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001500136"
FT                   /db_xref="UniProtKB/TrEMBL:A4S057"
FT                   /transl_table=1
FT                   /translation="MKETHVGAFGEDEHRIAAYAEVEALSAMSHPNVVAFVGAYQTSAE
FT                   VHLVMELVDGTSLLEYLTMLNDYEDANEDKKHEVRLDLMRQLANAVAYVHAKDYVFRDL
FT                   ALENVMVRHAPDDATANVTLKIIDFGRVRKLRPETGMRLPSASPMGAASFQAPEVEERG
FT                   EYSQASDMWSVGIFMYWLSSGKMPFQNSVEGVFQVLRAEYDSLDESISALTRDLVHSLL
FT                   RLNPVNRMNAAQAAAHPCLKQ"
FT   CDS_pept        375458..>377353
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684967"
FT                   /orf_name="OSTLU_16127"
FT                   /product="Predicted protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="ABO96978.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniParc:UPI0001500137"
FT                   /db_xref="UniProtKB/TrEMBL:A4S058"
FT                   /transl_table=1
FT                   /translation="MTDETTRRARGDRTFDEATELAVKTMQTRYGLPANGQWGALERMM
FT                   FEEVGIHTDTPRLEALAPAKMGTLAARVSASGGARETLAPTLGARDGVMSTFGSAVAGA
FT                   ALGLSAAFVIGAADNARRGGGVHDFVEDARVNLLGLAGLFKPSNFKRPTRATAAYDDDV
FT                   GGEQYEDRRDTRRNDGWADDDWRGNDPRRGPDGGMPPGASEEYYGYDAQYHTSRTRRLM
FT                   AGAVSAVVESERPKQRQGTSRRPGGGGARAQRALAGMDLQRKQQELVNSPELEVEVEVE
FT                   VGASSRPMATMMQRVRQGWDASLDAVGNVIPDAIPLIGNGSDFTARAQRERDLNARLAE
FT                   ARYYAELEQQKRLKAEKAFKQSHQKWLDAQAATREVRAQAAATAAKLGELEERLFSEDI
FT                   FDDHPVMNKVTQLENLLKQEAREDKTAEQLKSELTQLEMNTTSRVKDLEEQVAELQLEL
FT                   ETRPDLPRDISARLEALESAMTSGTSYDAESATARATGLQQSISDVGDALVELRDGMRD
FT                   EMYKVQSELNNIHPLMDHGAGRIDILFAKLTALEHSVDAISDGAASQIGRLSAQIERLE
FT                   KALAASSGVVFEPFPEIEDIAIEDPAPMVEEFVEKEDEVTTDMFAPVEEELAVEED"
FT   CDS_pept        377465..378697
FT                   /codon_start=1
FT                   /gene_family="HOG000239525" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684968"
FT                   /orf_name="OSTLU_35756"
FT                   /product="Predicted protein"
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ABO96979.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG318585"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001500213"
FT                   /db_xref="UniProtKB/TrEMBL:A4S059"
FT                   /transl_table=1
FT                   /translation="MQKEIVKESGVLPRIATGREIMIQGFHWESHNLDWYKIVQDRLGE
FT                   MNQAGFTQVWLPPPADSLAPQGYLPRNMYSLNSAYGSEQALRNLIANCKEHDVLPVLDA
FT                   VLNHRCATHQGAGGKWNRWEGTGMDWGEWAIDNRNPDFAGQGNHPTGDEFSGAPNIDHT
FT                   NERVRSDLAKWFQWLRNDIGFGGVRFDFSKGYGGQFAGEYIKAMDPEFAVGEYWDTLAY
FT                   GAGLEYNQDAHRQRIVDWIDAAGGNCTAFDFTTKGILQEACGRSEFWRLIDSEGRAPGV
FT                   IGLWPARAVTFIDNHDTGSTQGHWPFPNDKVAMGYAYILTHPGTPCVMWDHYFDWGEKL
FT                   SNNIKTLMEARQSCGIHSRSKLQIIAANDGLYAAIVDNRMAVKLGRDHWSPAGDDWTHI
FT                   CGDNDWSVWRR"
FT   CDS_pept        379365..380129
FT                   /codon_start=1
FT                   /gene_family="HOG000265061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312920"
FT                   /orf_name="OSTLU_32626"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96980.1"
FT                   /db_xref="HOGENOM:HBG609915"
FT                   /db_xref="UniParc:UPI0001500214"
FT                   /db_xref="UniProtKB/TrEMBL:A4S060"
FT                   /transl_table=1
FT                   /translation="MVKPNDDPKIFGYYDVSYVSVGEKQVGNPAGGRFRSPLGRFLFKT
FT                   IGLEQNLFAPNKIENRVAFTLFGCLPGEVTLEGTFAPAEGVDDGRTVKASFGPPGISVA
FT                   GGPKLRIGPKSSVVLSTTYLDDHVRLGKGSRGSLFVFTRKSEEKAERDHRRWGIGGLAI
FT                   AIMLLTALGLGIFGVHELRTTSHTLYSVTVVLASAISLAMAYILRDGGIVAEDADLDDD
FT                   VGELSEQQKAFLSRGRGDGENKGENVFSSQKA"
FT   CDS_pept        complement(380203..381057)
FT                   /codon_start=1
FT                   /gene_family="HOG000265062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312921"
FT                   /orf_name="OSTLU_16130"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97211.1"
FT                   /db_xref="UniParc:UPI0001500215"
FT                   /db_xref="UniProtKB/TrEMBL:A4S061"
FT                   /transl_table=1
FT                   /translation="MPESDDDSDDDGLFGRRNTTLEVSWSDDDDALAGARAPGTKKSTP
FT                   LRGALKLTSGKASSDDDDDDDARAFDAKISEMIATATDGSPRGSPSSAKKRETKRRAAD
FT                   ARFAEATASLPRSKKNKSDDGGVGSSDATLESVQALKSACDALAQRPPPAYVPRAVEAH
FT                   AVDDDEDDEDDEDVREVVNNGDKDGGVDVIEGNLNEETGNMITVSFQLPNGDKFERRVG
FT                   ETWTFAKIVGAWRECAEWCEMTCLLGSEQLTVVCDGDVVRGNETPETYGLEDGDTLDII
FT                   KPK"
FT   CDS_pept        complement(381174..381653)
FT                   /codon_start=1
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16684969"
FT                   /orf_name="OSTLU_35397"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="ABO97212.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI0001500216"
FT                   /db_xref="UniProtKB/TrEMBL:A4S062"
FT                   /transl_table=1
FT                   /translation="MSTSDEVAPFFGFMGATSALVFSCMGAAYGTAKSGVGIASMGVMR
FT                   PELVMKSIVPVVMAGVLGIYGLIIAVVISTNIDASSYTLFQGYAHLGSGLACGLSGLSA
FT                   GMCIGIVGDAGVRANAQQPKLFVGVILILIFAEALALYGMIVGIILSSAASAATS"
FT   CDS_pept        join(387127..387249,387317..387383,387567..387592)
FT                   /codon_start=1
FT                   /gene_family="HOG000214506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684970"
FT                   /orf_name="OSTLU_32630"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, catalytic core F(1)"
FT                   /protein_id="ABO96981.1"
FT                   /db_xref="GO:0000275"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG601799"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="UniParc:UPI0001500217"
FT                   /db_xref="UniProtKB/TrEMBL:A4S063"
FT                   /transl_table=1
FT                   /translation="MSAAAKNSAAYWRIAGMSYLKYANACGEVVRQSLKEPFLTQAKAR
FT                   ETVYYKMTKYAEGKAGQSVITEVLPK"
FT   CDS_pept        complement(387905..388294)
FT                   /codon_start=1
FT                   /gene_family="HOG000194088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856482"
FT                   /orf_name="OSTLU_16133"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97213.1"
FT                   /db_xref="HOGENOM:HBG622406"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI0001500218"
FT                   /db_xref="UniProtKB/TrEMBL:A4S064"
FT                   /transl_table=1
FT                   /translation="MGRRRSGGFGAPPPGNRGRFGGAPPPARQQQQSGGSLVGGLAGMI
FT                   YQGFGWGVGSSLGRAATASLLGSSGGSGYATESVPSSEAPQQPNPCAQAAKAFGECISN
FT                   SPDDLAKCQPYADLLTSCKRNELSR"
FT   CDS_pept        complement(388413..390758)
FT                   /codon_start=1
FT                   /gene_family="HOG000218210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19161259"
FT                   /gene_name="CLPC2"
FT                   /orf_name="OSTLU_46264"
FT                   /product="Chaperone, Hsp100 family, ClpC-type "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ABO97214.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI0001500219"
FT                   /db_xref="UniProtKB/TrEMBL:A4S065"
FT                   /transl_table=1
FT                   /translation="MDLAKKFRSAECGSEHVLLALTRNRDRTSKALHKHGVTEEATRRA
FT                   LGERAGVSELELMNPFNKPSAEGLLALSDELKKVFERASASGSEVGSKELALAMIDEPA
FT                   SGARATMAALEGCDLKVLRKEITGANERELVGAGKKTRNTKKQTLADCSIDLTAEAREG
FT                   KLDPVLGRDEEVTRVMRILVRRRKSNPCLVGEPGVGKTAIAEGLAMMIAKGDVPESLKE
FT                   KRVVSLQIGLLLADTKYRGEFEEKMKNVMEEVKQAGDIILFVDEIHMLVGAGGTGEDGG
FT                   MDAGNLMKPALARGELQCIGATTIDEYRKHIEKDAALERRFQPVRVIEPSPEQTLTILR
FT                   GLKDTYQEHHGVSFTDEALRAAVSLSTRYINDRFLPDKAIDVIDEAGALVQLTPGDSTL
FT                   VDESHITEVVAQWTGVPVQQLSADESLSLMNFEQELGKRVIGQVEAVRSISQAIRRARA
FT                   GLADASKPVASIIFSGPTGVGKTELAKAVAQTYFGAEKAMVRIDMSEYMESHSVSRLIG
FT                   PPPGYIGFGEGGQLTEAVRTNPHSLVLLDEIEKAHPDVFNILLQVLEDGRLTDSKGRTV
FT                   DFTNAMLVMTSNIGSREILESMSGEGEDEEKYKKLQTQVKRELGKEYRPEFLNRLDEII
FT                   IFRPLERPEVSAIADLMLASVSKRALARGITLDFTDSFKSLLYSNGFSPRFGARPMRRC
FT                   VRGLLENNLAECMLDGFASSGDTVNFDYDDDQELISVTTANETMARTFDVEFGSGIEDV
FT                   AEDTSADDFPAPFFSNEGGGETTAQAFA"
FT   CDS_pept        391033..391869
FT                   /codon_start=1
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16684971"
FT                   /orf_name="OSTLU_16135"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO96982.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniParc:UPI000150021A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S066"
FT                   /transl_table=1
FT                   /translation="MRRPTCAVDIDADGVGVLTLSRPHRANALNEEMWTDFAECVKFVG
FT                   QSNARCVVVRGDGRHFCAGIDVADEATLKSTLGDVGDVGAATCEGRRRESLLRNIKRLQ
FT                   DAFTALERDVECPTIACVRGACYGAGVDMITACDLRVCCGKSARFCVKEVDLGITADVG
FT                   TLQRLPSIIGFGRAVELAMTAREMDAKEALAIGLVSEICDDVEARAMALAKMLAKKSPL
FT                   ALRGTKRTLLRQRDDPNVARGLDYVATHNAAMLMSNDLNESLRARFEKREPIFAKL"
FT   CDS_pept        complement(391914..392537)
FT                   /codon_start=1
FT                   /gene_family="HOG000265063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007997"
FT                   /orf_name="OSTLU_32634"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97215.1"
FT                   /db_xref="HOGENOM:HBG609917"
FT                   /db_xref="InterPro:IPR005082"
FT                   /db_xref="UniParc:UPI000150021B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S067"
FT                   /transl_table=1
FT                   /translation="MGVCVSVHTVERALADEAEIERRSRVDALARSLANNKGELYLHGV
FT                   LARCDRVNRNGRVYPKPILHREVAAYVAARVRRGRAYGKLEHPAATDEAEFRDADDETR
FT                   ACCRVVDVYWCDGDRTLMGYVKILDTESGRAIREIYEGGGLVGASTRSWSSLETRADGK
FT                   CYVDDDLELLAFDLVRDPATISLSANGLLTPVRGAVEGRGERLD"
FT   CDS_pept        392715..>393809
FT                   /codon_start=1
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16684972"
FT                   /orf_name="OSTLU_35743"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO96983.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="HOGENOM:HBG682649"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI000150021C"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4S068"
FT                   /transl_table=1
FT                   /translation="MSSLEAIRYARGNLELLDQLALPLETKYIDVRDCNACWRCIKDMN
FT                   VRGAPAIAIAAALALAVELEAKRGTLTTCEAAEAFVRERFDHMYTSRPTAVNLGEAKNR
FT                   IQALAKRLSESGDVSGMIEGVIEGCEAMHAEDVASCRAIGDKGAAALLRACGAKDGENI
FT                   KVMTCCNTGSLATAGYGTALGVIRALWESGRLERAYCLETRPYNQGSRLTAYELVYEKI
FT                   PGTLICDNMAAALMARGDVDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGVPMFTAA
FT                   PVTTLDPETATGADIHIEERPGEEVTHSLGKRVAAEGIDVWNPSFDVTPAALLTGVITE
FT                   HGVIEKNASGLFPVADFVAQAKGGT"
FT   CDS_pept        <393840..>395057
FT                   /codon_start=1
FT                   /gene_family="HOG000082744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856483"
FT                   /orf_name="OSTLU_3520"
FT                   /product="Predicted protein"
FT                   /function="S-methyl-5-thioribose kinase activity "
FT                   /biological_process="methionine biosynthetic process "
FT                   /protein_id="ABO96984.1"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046522"
FT                   /db_xref="HOGENOM:HBG305135"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000150021D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S069"
FT                   /transl_table=1
FT                   /translation="GFIALNCETVLDYAASKENVAKVLGGASTRASWSAKEIGDGNINF
FT                   VYIVTGASANKSVIVKQGLPFVRCVGESWPLTQERVRYEAEALIQAHKFCPEHVPEVYV
FT                   YDATMATIVMRYLEPPHIILRGGIIEGKVYPKLAEHVGEYLATTLYKSSALAVGGAELR
FT                   RARQAFGQNEDMCELTEQVIFTEPYGKADNNHWTTPQLDDIVGEIQSDAALKRAINALK
FT                   EKFMTEAQALLHGDLHTGSLMCTETTTFAIDNEFAFYGPMGFDIGAFLANLLLAYFSQN
FT                   GWAKCNGEDRGAQRDWLLSAFASTWGIFEKRFLEQWNEQGVRDDCGGLSPAILYGKDVK
FT                   SGASALEEHQRTFMRKIWADTLGFAGAKMIRRIIGIAHVADLDKIPDANVRAQCERAAL
FT                   KCGRELM"
FT   CDS_pept        complement(395203..397257)
FT                   /codon_start=1
FT                   /gene_family="HOG000265064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684973"
FT                   /orf_name="OSTLU_93021"
FT                   /product="Predicted protein"
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ABO97216.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG609918"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniParc:UPI000150021E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S070"
FT                   /transl_table=1
FT                   /translation="MTSTSGSGPGLARGDGGAFALIGTPGRCVTTFRVRKRTRFGQRVV
FT                   LVGSTAELGTWRVLGGSIRCAPEGNDWWSATVCLEVPTSRVVGEECVVCEYNFAVIDDV
FT                   AESTGPTYVWRSGTSALMLPSYAFMVEVVDVWTEEKREFTSLTDTFRMNEPALKQVLQY
FT                   YTGGASKSLRARDDRNVKTEIWFPSDDCAVLTEDGEAVEILENVRDEEEGDQAMRVGDV
FT                   YLGTVVSKVPNMKSLLVGVATKNGKFTKTVLLRDGLSQPAAWWKGQESDKVVIEASEVS
FT                   LPDEDEDVEMKLISSMMHSDMNDQLARAGKQAFGMYNIGDAVILEIIRDSREHKGAIAT
FT                   AEPSLTGRFTVFKGTANGVSAHASKKLSVVTRDSLAQWGENTLKQTWRYGLEKIKDKNE
FT                   APLFTGFHGGGAHLIMRSASASAPPDVVTREVSELTRRWKSMCISAAKSVTKSRKRQQP
FT                   LVPRLLWRDNTNFKGMVLRELASTNIHSIVMPNDSKPEELEEITKSVSTLRADTEEMQT
FT                   VVRVGSQVKMQNLIRRARTFSERVTIPDTQSAQLVIQSTEALTAIDVNTGSSRMSVAEI
FT                   NVMAARTAAAEIRRRNISGIIVIDFVNAGNPKTRDQIYRQIEAEFADAATRDRGKISFM
FT                   PISAFGLMQITRSHIPYGPKVEAKDVRREDARSSTKSSATKWLDKRKTR"
FT   CDS_pept        398114..399454
FT                   /codon_start=1
FT                   /gene_family="HOG000265065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856484"
FT                   /orf_name="OSTLU_93022"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96985.1"
FT                   /db_xref="HOGENOM:HBG609919"
FT                   /db_xref="UniParc:UPI000150021F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S071"
FT                   /transl_table=1
FT                   /translation="MADGSSAMLARAVTTYEDATTAAMHAAAARVRERWGTTRDAGAAW
FT                   RFWLAEETTVSALTTPLGGSSIEVGARDDLSVMMCAHDALEAPVGGWEGRVACCPRAFA
FT                   VDAHLTVDGKRFEDAHACAGEPDYDRERAIEAGLDDAGLYASEAREAARRVLRRERDGG
FT                   GKPWCTVFGSRFSEGNHFVHLPLIADYLDGAILDPFSKSYAHSLMWRWAEVCEKIGPGE
FT                   HEVTLRCAPLGVFVPAAGACRLVGYDEAKHGSDKGFKAFLQSLDTEYETSASAAGMSAT
FT                   FTIKLHPNHCAGKKIERRAQEWAPDWPADEIAECYTTALQLANTGPPGAMAAQMTPGAT
FT                   CCHVVLPTTDGHSGIAEVKDRDGRTLYHEFHAWGLFRGVDGELEARTGAQIKFRCVKSC
FT                   VNGEPTGVWMAKDYDPRPCNGLLLKNKFIDQAIARDDEHIKIPSGVA"
FT   CDS_pept        complement(399510..400664)
FT                   /codon_start=1
FT                   /gene_family="HOG000265066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856485"
FT                   /orf_name="OSTLU_32638"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ion channel activity"
FT                   /function="receptor activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97217.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609920"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="UniParc:UPI0001500220"
FT                   /db_xref="UniProtKB/TrEMBL:A4S072"
FT                   /transl_table=1
FT                   /translation="MVGLSYTTQKSVVIRSWRLGALYYAIVGVVLSYVGWYLVYLKHGY
FT                   QLRSQAVGNIGLKIKGQAVLRDAATGLETVYDANDLVIYEPSGFFVATALMTTLQARGR
FT                   CPGMDDDEACTEDASICRAGAFSASGRMTGACVDAGGSSGEKRCEIEGWCPGEPEDDRV
FT                   NVLENVGNFTVFTRISVEFPGIPNKKGDGNLLWTNLNGTEPTMGWNLWTLNDLLASGGM
FT                   RVEDIAKKGWDGRLDVQFDCDLDRGIESCAPKTPYKVRQVTDSEINTLSKGYNIRWVSA
FT                   HNVGEPAPMQGVTYNQTGNSKDVRLLVKGYGPRIRFAVDGVGRKFDVLALSTTVGAGVA
FT                   FLGIASLVVNAVMMYGSGKKSKQYENWLFAEFNDDSYGATENNS"
FT   CDS_pept        400900..402699
FT                   /codon_start=1
FT                   /gene_family="HOG000265067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312922"
FT                   /orf_name="OSTLU_32639"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO96986.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609921"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniParc:UPI0001500221"
FT                   /db_xref="UniProtKB/TrEMBL:A4S073"
FT                   /transl_table=1
FT                   /translation="MAPSTPAARVPTMRRAREDEPVTNLSVAALGALFLANIALVILGL
FT                   ILIVVGRRAGGVGSVFAHGGLDDPLFENPGTSASVIGTLLCALASYGLAGLYHRNKTYL
FT                   LSYHVLSIFMLVGIIYACAVMNIYKSASADMVRNYWHTFQQNTNITGITRVGRPTRLDH
FT                   AVWIMRVEEARAEARLFLRTVASCMGASIFFILTALGCTAYIMGLKYTGVYVGITTNVA
FT                   GVAFALTLFVLCYYVAKSTYNVPDAVSMKFDVAFMHDVGVSVPPEATTLFNTLRKSPDL
FT                   IFQTADPSNGRRRLLQSGDNSTQSPPTPPSPSPPPPPSPSPPPPPDADWQAQSVWVFEE
FT                   RHVRVDNVQYNLTFKLALAGISGDDLDESFSAWAAKKIADFGEITPDKVYVSELKAGAE
FT                   HKIGGVWAPRFLAATAFIIAFFNVYGLVAIYKDDRFLMATHFCFSFTGILLMIIAAALV
FT                   SKHADATSRLISNNWHSIQNKVIGAGVEPVDAGAFARAHFKAAAALGITVIVLQVTSIV
FT                   ATLLNFFSNEPSYTLLTPGKSGSNSNGATIGRFAGVELDSFDEEYGKRGSLSQQRGHTR
FT                   RGSDGLVPLGNLATPPSKHFSID"
FT   CDS_pept        complement(402823..403686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856486"
FT                   /orf_name="OSTLU_93023"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97218.1"
FT                   /db_xref="UniParc:UPI0001500222"
FT                   /db_xref="UniProtKB/TrEMBL:A4S074"
FT                   /transl_table=1
FT                   /translation="MPTTTRAAFGDDVDACARATSDGVDVVCYRRRRSTRAPPLARVRA
FT                   RGTGAREREREAFDALRATMGTPRAWTANAEGCAMTPRAGERAEARAALETFIHERIFR
FT                   ALFGTTTAATAAGDAGVFAPHRGTNVMWHRDGYMAGAYVAHAILAAEEEEEEASGGKWF
FT                   EHALVDADEDEESTTETFEVDFENQGILSKSVRKGNFVPIDARGGVLCVFEDAAVLHRS
FT                   PKSAGKALDAMTRTIARFNFSAVDGSGRTVRIFAPDDASWTPFDDRGAVRGLTAMDGFD
FT                   AYVRDS"
FT   CDS_pept        404021..405025
FT                   /codon_start=1
FT                   /gene_family="HOG000265068" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684974"
FT                   /orf_name="OSTLU_32641"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ABO96987.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001500223"
FT                   /db_xref="UniProtKB/TrEMBL:A4S075"
FT                   /transl_table=1
FT                   /translation="MAAAKARGDAATAFNAAISAYNRMGMSESCVALMEMMRDALDVAP
FT                   DVVTYALCASALTREGRLRDAEATLERASEALRRGTRPNRKQKKRAKNDDEWSMVVLRD
FT                   SDGIAAVVKPAGVLTHPVEGGGSELTLMDAALSRFDGQLSDLNGLDKRGIVSRLDKPTS
FT                   GVVLLAKNNASHAELLTQFYQRCVVKQYCALLDGTLPASGSESTPLDGRSATSEYEVME
FT                   TFIGPSWSYSLVRVEPKSGRKHQIRRHMALLGAPLVGDPLYRTARTKQINPNPPECVLK
FT                   ALSVGKPGTIFWLHASAVEYSGMPNGERIVVSAPLPSAFETLLASLRAGARDE"
FT   CDS_pept        join(complement(407409..407431),complement(407080..407123),
FT                   complement(405123..406840))
FT                   /codon_start=1
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16684975"
FT                   /gene_name="CPN60B"
FT                   /orf_name="OSTLU_32642"
FT                   /product="Chaperonin 60 beta chain, chloroplast "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein refolding"
FT                   /protein_id="ABO97219.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042026"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG625289"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="UniParc:UPI000150030D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S076"
FT                   /transl_table=1
FT                   /translation="MFATTTMSATAATFSARTRVADGKTIAVNVRRAGGARTRAPLSVV
FT                   AAAKNLYFNKNDGSALKKMQKGVDKLASVVGVTLGPKGRNVVLESKFGSPKIVNDGVTV
FT                   AKEVDLEDPVENVGAKLVRQASQKTNDQAGDGTTTATVLSAAMIAEGMKIVMAGTNPVQ
FT                   LTRGMDKTVKALVEVLKGLSKDVADEELAKVASISAGGNMEVGEMIAAAMAKVGRKGVI
FT                   SLEEARSVDNNLIVVEGMQFDRGYISPYFVTDPERMTCVYDQCKLLLVDKKISTARDMI
FT                   GILEAAIQQGFPLMIIAEDIEQEALATLVVNKLRGSLKITAIKAPGFGERKSQYLEDIA
FT                   ILTGGTVVKEELGLSLDKCGVEVLGNAARVELGKESTTIVGAGDTAAEVAARVKQINRL
FT                   VEATEADYEKEKLNERAARLSGGVAIIQVGAQTETELKEKKLRVEDALNATKSAVEEGI
FT                   VIGGGCTFLKLAAAVDEIKATLENDEQRVGADIIKRALSYPIRLVAHNAGVNGSVACEK
FT                   VMSSKDPNFGYNAATGEYEDLMKGGVLDPTKVIRCSLENACSVAKIFLTSDVVVCEIPE
FT                   DEEPAAGGSPMDNSGYGN"
FT   CDS_pept        join(complement(408679..409763),complement(407589..408540))
FT                   /codon_start=1
FT                   /gene_family="HOG000258436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161260"
FT                   /orf_name="OSTLU_35708"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97220.1"
FT                   /db_xref="HOGENOM:HBG410428"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000150030E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S077"
FT                   /transl_table=1
FT                   /translation="MSLPELTLDAAVGFAGSVRNGFHLHPDGESRVYPLGATIAISRPR
FT                   TDSKAREGAPTREHQTSHITFLHGHAGEVTALAVSSSGRFIASGESISSGVAEIILWEA
FT                   CNEAVGTTYAVARRLSLHIGEVVALAFSTDESALASIGGDNDRRVVMWNVSNGNALCGS
FT                   PAPLDGKVRTVAFLRHSSTHFLTAGELAVSAWEYDAMTKRLQLEPIKLGILKRDILSIA
FT                   VDENDEYAYLGTASADVLCVSIPNRVIKESFTLKKYISRGVSSLTIVRNGLLAGAGDGS
FT                   LSLMRREDGSCVLQFEACRTVGDGAVTSVAVARSPQSNVKGLEYPKKCKSDYAKRKYVH
FT                   EALLSLRNGYIGAECYRDASQTVAFPRKQSQYFATGGGSEVRVWATDTAKLLLKIDVKP
FT                   CTSKCLCVSFMPDGDTLLSGWDDGKIRAHDRETGELFFVAANAHDKVTALRGMKDSSGI
FT                   ISGGSEGNVRLWNVINGSIITLEASMKEHRSSVNDIALFNDDASAVTASDDGSCVVWDI
FT                   LRRTRQVSFFGSTYFKAIGVHPDEKQIVTTGTDRKITWWDPADASTLRVVDDPADAELA
FT                   TLSIAHPHGASIAIAGTDRIVKVFDYESGDLTAITPRHCARVVAVAFAPDARALVSASA
FT                   DGAVRIWSIPDSPLAELGREKERHIHRVLTGEIDDDVLATARP"
FT   CDS_pept        complement(409840..413481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684976"
FT                   /gene_name="NFE3501"
FT                   /orf_name="OSTLU_32644"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97221.1"
FT                   /db_xref="UniParc:UPI000150030F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S078"
FT                   /transl_table=1
FT                   /translation="MTLARDARRDDDDDDARGGDAARARAGDDGAKDDDDANVEDSDEE
FT                   EEEEDGEDGDGDDDDDDDDFEVSRGRRRASRSTERGAQVGGIEGADVEGLPAVEASAFS
FT                   IDADRARFKAGTLKAEVFKMLEAAWPKLMDANELYEMGTKAGVNVGKNKTVLASGLSHD
FT                   QCFVRMPGTKNKWALRAHVGLPAGTKRKAESEKEPRERKAKAPRVRGGFSAILESMDGD
FT                   EKAMLLAWTEKLKQNAGDLKKAKQQVEKAKNALERASKALEEFEANPSTDSVVQSKSAE
FT                   DILCEPEAPSDVLDKEYRVYTGPDDRKFLIAWRKSVETERARVKRAQDVYVSQRKKEIR
FT                   EASTKLNKKREQLTSAVSKAQQQLRLAEGTVERAEIVHEITRDRIQLMKEKASVEGEDA
FT                   IKAVNEKITALDEKMTQLFGQKLAAIENQIEREKLRLMAKGERDAERARLIEEKNRLKE
FT                   EEKAERAKQRETEKAERDKAKAEEKAAKEKAARYPLDDDILAVELAEESKETGVPLETL
FT                   LKPIPAPVPLANGQVLAEEAFVAEFISVFGAGIQAPQGLTNVEGVNAMFENTPKSRSTL
FT                   AELYLSIIYEALTPAASGPGRFVARLNRIVNNLNWPEVARKLILHGGEEAHGKKAVEVA
FT                   TKLAKSTWDKLSNADHLVLLRALADLALQGDVCRDIISSRMQQADIFRSERHEARLKAV
FT                   ANRRIVEKAEKEERKRERERIAEEKRAAKAAAEAAKVGANPEGDVKIEEDAKETKDDEV
FT                   KEDVTMEDASEPMFELPERLREYKGHPDDRHTLMAWKNEVAKVQAELDREREEYESDRS
FT                   KEVRMQKATESEIKRKKEAVEEEARRKLELEEKRSRDREIKRAAEDAACQVRARPLGMD
FT                   RHLATYWWNFGGRKDAVYVQSFSGEWGVYNSQEAVDALVDALCEKGVRELGLKKQLEKR
FT                   KVTIADAFKLLAETQEERDARFAAQLEGGERRSARSRTAPSNDAYVATRPAADLACDEG
FT                   AVITAARKCMDTMCINAERIGLETDVDWRTFRNKLKNAHNSYVAESLLHLEEKYFECQI
FT                   KEFKLAAEREKIEREKQPEAPDELSKATLEALVLKHTGKDMSSWKLARRKLAALLPKEI
FT                   IAEAVEERRRQQLDSEEDDDEDEDEDEEVDDSWNNDENAPEDVGDISIWKGSLQRDQFR
FT                   EYLNPQEDFPVVRIAYAAATLLDATCAFSEEIVHRRELRGEGEEMTN"
FT   CDS_pept        413752..414435
FT                   /codon_start=1
FT                   /gene_family="HOG000232965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684977"
FT                   /gene_name="PSBP3"
FT                   /orf_name="OSTLU_118778"
FT                   /product="Lumenal PsbP-like protein "
FT                   /function="calcium ion binding"
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="extrinsic to membrane"
FT                   /cellular_component="oxygen evolving complex"
FT                   /protein_id="ABO96988.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0009654"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0019898"
FT                   /db_xref="HOGENOM:HBG286672"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI0001500310"
FT                   /db_xref="UniProtKB/TrEMBL:A4S079"
FT                   /transl_table=1
FT                   /translation="MRAATTTLAPARATTRRTRTTRTDARRAVTRAATKATTDVTTTTR
FT                   RELAAKTLAAMALTATPTIGAFAGPAHALSGMNAVKDTREGYEFLYPVGWQEIQVDGQA
FT                   AVYKDIIEPLESVALNVYPTQRESVKDIGTADEVAKTLVGKALTAPGAQAKVLATSERT
FT                   DKDGHLYYQFEFVTKTQSYERHALTVVTVTQGKFYTLTTGSSEKRWKKMKERLLATVGS
FT                   FSVYY"
FT   CDS_pept        complement(<414653..>415900)
FT                   /codon_start=1
FT                   /gene_family="HOG000239285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312923"
FT                   /orf_name="OSTLU_3227"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ABO97222.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001500311"
FT                   /db_xref="UniProtKB/TrEMBL:A4S080"
FT                   /transl_table=1
FT                   /translation="TFRDLGVGARLTRALERAGVETPSIAQRAAMPAIARGENVAMQSH
FT                   TGSGKTLAYLLPVICDIVDDETGTVRRDAGNGVRALVVAPSQELAMQIVRQVERLLGDL
FT                   GREITQQAIGGANAKRQEEAIRRKRPLIVVGTPGRLAELSRTGILQTHGVKTLVVDEAD
FT                   DLLASNFRRDMARISEHTGKAVPGGRQTVIVSATLKQETLDAYSYLAPNLTHIVATYDK
FT                   PSPTALTTPGEDEEVEEADVADARDEKSASAAARQERMQGVVSLPPHITHCSVISERRH
FT                   KVDELRRAIHATDVQRALIFCNFGRRLEEVQAKLSARRMPVGVLHGGMDKMERQKELAK
FT                   FRRGEFRALVVSDLAARGLDVDDCDAVFNLELPTDETHYVHRAGRTGRMGSPGVVVTIA
FT                   EPQEAFVLERFERNLGV"
FT   CDS_pept        416762..418024
FT                   /codon_start=1
FT                   /gene_family="HOG000265069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856487"
FT                   /orf_name="OSTLU_35343"
FT                   /product="Predicted protein"
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="ABO96989.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="HOGENOM:HBG559682"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI0001500312"
FT                   /db_xref="UniProtKB/TrEMBL:A4S081"
FT                   /transl_table=1
FT                   /translation="MPLLVFVNSKSGGQMGTYMLESLRSNLNPLQVVDLHNTGPKAALK
FT                   LFANVPNVRILVAGGDGTVAWILQTLDEIDVPKKPPVGVLPLGTGNDLARVLGWGGGYS
FT                   NELISELLVQVLEAHPALLDRWQVEITANEPPKTPSKFASAAGLPAAPPLPKKKEIVFQ
FT                   NYLGIGVDAQAALRFHRTRNLRPQLFFSAMTNKLLYGAFGAKDVLEHSCAGLHRSIRIY
FT                   ADGVRQTIPPEAEGIILLNINSFAGGVRMWERDGSYGVSSMQDGMVDIVVVHGALHLGQ
FT                   LNIGVDKPVRICQAREVRVVVDRKIPMHVDGEPWEQPACTMDIKLRNKATMLRRTADVR
FT                   GMTVIEMQNTLDWACKEDIISEPQREQIMVEAYRRADARSMENGHRRSGLHRRSGSIGN
FT                   LLNAKSSSYSQLFAGDGFGLG"
FT   CDS_pept        join(418111..418194,418273..418701)
FT                   /codon_start=1
FT                   /gene_family="HOG000265070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856488"
FT                   /orf_name="OSTLU_32648"
FT                   /product="Predicted protein"
FT                   /function="ATPase activator activity"
FT                   /function="chaperone binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO96990.1"
FT                   /db_xref="GO:0001671"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG609925"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="UniParc:UPI0001500313"
FT                   /db_xref="UniProtKB/TrEMBL:A4S082"
FT                   /transl_table=1
FT                   /translation="MAKWGEGDSRWIVDERRDGTNINGWHWEERNMMKWSRERIESLLV
FT                   GVDLDVPVSEGRATVTELSKFEGDSSVSTRKGGKKFGCFDLSFTAKWRGVVGVAADSTE
FT                   DEDEVKGEIVVKEFCSTNDEDEYDFAVSAKDGKSESKALLKSRVEKSVEAILLPKLRQF
FT                   CEELKEM"
FT   CDS_pept        complement(418835..419659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161261"
FT                   /orf_name="OSTLU_16147"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97223.1"
FT                   /db_xref="UniParc:UPI0001500314"
FT                   /db_xref="UniProtKB/TrEMBL:A4S083"
FT                   /transl_table=1
FT                   /translation="MEQALCAAPSARGITVADLEVVRECAGSPGPLKRFVPETSSPSDI
FT                   MMNTPPHLRGGEMTSGSKRSIEDSPSYTLSPQSALKPPSFGDGQLGSSYGDGRDKSVSP
FT                   RSASSPPVAVYSYATSAGSARGGNGAFAGRPPRGDRATFKPGSLPHPRSGTSFGNRADA
FT                   KQAQPAIKFTGAAFRSARDEYLDRVFGFLFKEVGDGEWMAIKSKTGVSGRCRKPVTMPE
FT                   TYLEFFDSHRDKFEINAERTKVRLRNQRTRSDSGDSDDTNVESLSDSLKATL"
FT   CDS_pept        419693..423310
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684978"
FT                   /orf_name="OSTLU_93026"
FT                   /product="Predicted protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="ABO96991.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG609927"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniParc:UPI0001500315"
FT                   /db_xref="UniProtKB/TrEMBL:A4S084"
FT                   /transl_table=1
FT                   /translation="MTHQIIIAPPRRRASTQIRHLARLASPLVLTPNAPPSRSRPLPPP
FT                   SLRRVVQSPPSARKSLPDASISPSRSLAARPRTSPYPPSSSRRPPPPPPAPRTTAPGVS
FT                   PRSPTSSARASAPPRPASPSSSSSRLRVASPSSSRPFQTARRRRRRPSRSASSSRASTG
FT                   AMPTRAVRRARRANRAARIAPRVGVARRSGVARRARCRRESVSVWCATREGFCLTRNNG
FT                   LGSPNADRRATRPRTDARGMETLPKRAPATTLADVVERVARACHVELRQLVERCAGADA
FT                   RARAAELARYAHRARQRLVRCAIVERWSRKSAKIATVATNAHLTLRAHEEAFAKLADGL
FT                   FHLHQQIEWAKAPAWDLAGALNVLCDGDYELGREISEIGVGRVAATEETEETEETRERR
FT                   LDFERRFEEEMTERLVRSKTHGCATRDDHSEWPNEKFKVFAIGGGKVEVGVEGEYRATL
FT                   SLGGPVAPNATEQPRYGGWRVETIEMLAGDEKGAKFELNKAETRKLADMACASMVGLPP
FT                   FGQKLADDAPPLEPLHLKGLHGVASDAVLLKSAAAILAQAGALKDAAERANSESRWSRN
FT                   AVKVEIVKGEAAGILKGVRVAFWRQNVASADEAGMLDVSFNPETADLRAKARAPGEAEF
FT                   FDLPVNYARVDLEAILVEAIRIASSKKLHSVSTEVSGEKSFTTVVEESMTAEECACSED
FT                   EDAWGTDARPAIRLEISKFTNIFITCRISDGTLILHGAGELVPSATEADLSKRLALEGH
FT                   DAIVSIVEEVSVAVEQQELKGLLRTSGTSVHPAPKTLGGEPWSTSDAVPSGVAPTALVP
FT                   VVPSDGGVFVATWMGATPTFALVRAHRVNPASRYIAHSVEKLNLGARKGSKADVVVKMI
FT                   GEACRDLSVDAQRSALMRALKEQRVPFVDIRPTSKGTKKAANTVSFEIVNTSRWAQSKY
FT                   KRAIKQKSPLKAHVTLRGIDGLSASIGGETRAYEHSEFMIHAFLADVRRIAAAQGFLSA
FT                   LSDNDSGVDFAKLGCKLSRQAADVVSISYKDSIECTIEWRHSGYLGPGLYADGERLSSS
FT                   AKRALSVAARDGRCEIFACALRAVEAAASHFAQLHGDFQLTFGAPSVLSIVRIIGVSAM
FT                   RVCSIGFRLDGSVSFVVGRGGDGAHDDGSTNDDEMNITDDHEALIPTRPEGLTQYIDEI
FT                   SAALEGPLGSKPKHGDAVVANASSASPALAALAKSVVAK"
FT   CDS_pept        complement(423370..423729)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856489"
FT                   /orf_name="OSTLU_16149"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97224.1"
FT                   /db_xref="UniParc:UPI0001500316"
FT                   /db_xref="UniProtKB/TrEMBL:A4S085"
FT                   /transl_table=1
FT                   /translation="MALTMTPVASAGLNKSGNNDAYAEMMRQMEEDRKRDAESAPALSA
FT                   ESLFKQGGGACGEGYELKVVKVLGASCVCASDSCAEDDSRKERSEYERSFGKDKSAEAD
FT                   APVGDSGIKFTFATD"
FT   CDS_pept        424056..425216
FT                   /codon_start=1
FT                   /gene_family="HOG000213048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161262"
FT                   /orf_name="OSTLU_35581"
FT                   /product="Predicted protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="chlorophyllide a oxygenase [overall] activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO96992.1"
FT                   /db_xref="GO:0010277"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG609929"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0001500317"
FT                   /db_xref="UniProtKB/TrEMBL:A4S086"
FT                   /transl_table=1
FT                   /translation="MARATPAPAPAPATARARAEARGDAGRRSVAARARRARARAPVGA
FT                   VVDDATTRARGARGVDGARRTRDARDYWFPVCFSGNLRDKDALVAFDLFNVPWVLFRGR
FT                   DGEVGCVKDECCHRACPLSLGKVVDGRVQCPYHGWEYETNGECAKMPSCSFLKNVFADE
FT                   LRVIERDGMIFVWAGESDPADFVGPEAACESWDEDVYEANEPGMFTTGEGFVTMAEVIA
FT                   DVKLDSDVVVERLLDITERARREPVSVKNRGRGALFPVDGTRLISKVLRIGYDAVPQSV
FT                   VFKPSCVIASTIALRPRVGGGDGTSMQVEQLHVCLPAKPGLTRVLFRMAFDFVPEGAQN
FT                   AAGDVWKNLAMQVLQEELEDVRSAGLKSETTSIAVESFRVFKRGDK"
FT   CDS_pept        join(complement(425776..425843),complement(425269..425686))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684979"
FT                   /orf_name="OSTLU_32653"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97225.1"
FT                   /db_xref="UniParc:UPI0001500318"
FT                   /db_xref="UniProtKB/TrEMBL:A4S087"
FT                   /transl_table=1
FT                   /translation="MGRAREYFVDKGLTPTDVVPAFVFHEVISVAFAASTWIAAYAIEP
FT                   SRTVLKPLAKTKVAEKAAPLFRKTLAAAAKQTAKATTRVPALRAANAERLTLSLAESLF
FT                   FRGCIKPITFGGKLWLSYQFIVWTKTVGRNAAKPLASASARMGAKRDRALGIALKTA"
FT   CDS_pept        425909..427549
FT                   /codon_start=1
FT                   /gene_family="HOG000201090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684980"
FT                   /orf_name="OSTLU_32654"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ABO96993.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG559692"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI0001500319"
FT                   /db_xref="UniProtKB/TrEMBL:A4S088"
FT                   /transl_table=1
FT                   /translation="MSTARCARAPRVAPARAPSASATTKPRARARATRARAFWDRFGVS
FT                   KTDDVPSGENVDADARATATATATTTTRAAKPTAEDSLSALSALLGEDEREAKAARELE
FT                   EADARRAEAQARERERKEAGAARRREFVKADAATTRIQRLQAVFLDVPLGMMDFSTMKD
FT                   KTPGGEALGPEPEWFKLPTEVFDKVTGERFVVEEESDSGLELKPKGSGESEGDSGEIVR
FT                   LPGEFQLPVIPYPFVATPGTYVRLNLFEPRWLTLFSKLIPGGDESATDKATESRPSSEV
FT                   KTDEDGFGASTVRRRVLRGIDGKAKIDLNALPIIEAYETGARSFDIVPGFGRLPEDEFV
FT                   DTNAFGAVFRGLDGQIASVGTTMEVQAHDVVVDGRLLSVCAKGTRRFKVLRVAQTEPYV
FT                   IVDAVPIEDDDQSSVVTPDQASAEAVNEVFDLMKVVDPYYMEAIGLEDVSKSDVKDMTE
FT                   FDLANVMYYTHPTLALKLLASKDSALRKRVVLASAKSFKRAIELGFTPRKSRLLSSFVN
FT                   LALLFGVGFTILAIKNALEGDPSGLDDFY"
FT   CDS_pept        complement(427695..427997)
FT                   /codon_start=1
FT                   /gene_family="HOG000118147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684981"
FT                   /orf_name="OSTLU_32655"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97226.1"
FT                   /db_xref="HOGENOM:HBG712516"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000150031A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S089"
FT                   /transl_table=1
FT                   /translation="MAANADGSNAYALLTLDYVDGMLEKRAPHREAHLAGARRAHEEGK
FT                   VVMAGALLDPVDQGVFVFKNCEREEIEAFVKADAYYVAGLVPRYAIRPWMVVVGN"
FT   CDS_pept        <429266..>430123
FT                   /codon_start=1
FT                   /gene_family="HOG000244054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007998"
FT                   /orf_name="OSTLU_4848"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96994.1"
FT                   /db_xref="HOGENOM:HBG316623"
FT                   /db_xref="InterPro:IPR021825"
FT                   /db_xref="UniParc:UPI0001500408"
FT                   /db_xref="UniProtKB/TrEMBL:A4S090"
FT                   /transl_table=1
FT                   /translation="IGETFDRKAIQAVLSEWFKTMESLPGGIRMAVEMGIVSSLALVRF
FT                   MSVNVRPSVVRAVSRGTPQAFSRAFVGRLMADPAFLYKLAFEQVVTIGAATMYEVAHRG
FT                   ERLKSEWDLALSNIMQLSLANALTVWCCTPVRSFGSSATNGFQKFMATMPNNAFDRAGP
FT                   LRQYTNATRGLSVVTKAAELSAVGVLTGGAFSAINTGLLALHKNKKGEQWEPAIPVPDL
FT                   KTSALGMGAFLGISCNLRYQLLGGADRWMTEHLTSLASSVSATALGRVINNQLGEPTRL
FT                   FALGL"
FT   CDS_pept        430470..>431756
FT                   /codon_start=1
FT                   /gene_family="HOG000257443" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684982"
FT                   /orf_name="OSTLU_35630"
FT                   /product="Predicted protein"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="NADP or NADPH binding"
FT                   /function="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ABO96995.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0008835"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG668075"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0001500409"
FT                   /db_xref="UniProtKB/TrEMBL:A4S091"
FT                   /transl_table=1
FT                   /translation="MSAASPSRALARARAASASSTAPSSSTESPPASRRPRARPRRARA
FT                   ATLRAVTPRDAEIMTRVCELARAREGIAAPHPLSACAVTRGDGDVVVEATHAGQGSTRA
FT                   EIACADEMRRRGATLNSSDRGTVYVNLEPAHGEVAGETRSVEALAATGATRAVVGMLHP
FT                   LPGLRGRAVRALRERGIEVCVLEGEAEGFEGEAARACRETNEALLYRVATGLPFSVYKY
FT                   AMTLDGKIATDTGHSSWVTGAEAREMVFRERKRADAVVVGGGTVRKDNPRLTCREETGF
FT                   QPARVVLTRSLDLPEDAKLWNVRGVAPTIVCTTKGVKPEFQNALRAKGVEVVEFDELTP
FT                   LAAAQYMFKRGFLRCFWECGGGLAAPAMKSGVFHEVLAFIAPKLVGGGALAPTPLGNLG
FT                   IEAMHDALPLSGVRLEIYGRDILIRGYVPN"
FT   CDS_pept        431928..432437
FT                   /codon_start=1
FT                   /gene_family="HOG000270609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312924"
FT                   /orf_name="OSTLU_35648"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO96996.1"
FT                   /db_xref="HOGENOM:HBG549787"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="UniParc:UPI000150040A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S092"
FT                   /transl_table=1
FT                   /translation="MDNLPPVKFYKAWDEYGALSNFSPFPVSVDGVEWPTVEHYYQAQK
FT                   FAGVHNDIARESFEKIKLAESPEAAAKIGRSAQAAHPESVRKDWDDVKVDVMRRALTEK
FT                   LVRYEGPRTLLMESVCTDGRVRVIEDSPVDGVWGAGRDGTGQNLLGALLVNIREDLVSG
FT                   RLDVEK"
FT   CDS_pept        complement(432472..433980)
FT                   /codon_start=1
FT                   /gene_family="HOG000115852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312925"
FT                   /orf_name="OSTLU_35663"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="regulation of mitotic
FT                   metaphase/anaphase transition"
FT                   /cellular_component="anaphase-promoting complex "
FT                   /protein_id="ABO97227.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005680"
FT                   /db_xref="GO:0030071"
FT                   /db_xref="HOGENOM:HBG323794"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000150040B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S093"
FT                   /transl_table=1
FT                   /translation="MDDAYSLAKAYFDLGEYRRCAHALREANAPLQTFLREYATFLAGE
FT                   KSKGQASAVGGGDVDGGAGAVDSSQTPSIGARKQAPEPNAGTNAELESLSEWLRAQDYS
FT                   GAKDGFLTYLHGIVCRESGQPTQAKDLLAEACRKYPLNWSAWQALIPMLTSEEEEQALD
FT                   LPREHWVYRWFIGVFQLEMQKNKESLDTFVSLGKEFPQSKLLLGHMAEAHYNLREFDEA
FT                   QEIYKDIRDLDPYRIDGMDNYSNVLYVKESFAELSHLAHHLVATDKYTPETCCVVGNYY
FT                   SLKSMHAKAVVYFKRALKLNPRYLSAWTLMGHEYVEMKNPAAAIDAYRHAVDINPRDYR
FT                   AWYGLGQTYEILQMPYYALYYYQQAVKLRPSDPRMWCAMGQCYESDQLRLFQSAIRCYQ
FT                   RAVANNEREGIALSKLATLHREKNEKAAAHYYLLNLKRLDAEVLDADSNEKIEALEFLS
FT                   QFYKKERRLEEAEAACVRLLDAPGPAKHAAKALLREIHSMLSST"
FT   CDS_pept        join(434514..434579,434955..435590)
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684983"
FT                   /gene_name="lhcp2.2"
FT                   /gene_synonym="lhcp2.1"
FT                   /gene_synonym="lhcp2.3"
FT                   /gene_synonym="lhcp2.4"
FT                   /orf_name="OSTLU_50137"
FT                   /product="Prasinophyte light harvesting complex,
FT                   chlorophyll binding"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO96997.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI00014FFC53"
FT                   /db_xref="UniProtKB/TrEMBL:A4RUX8"
FT                   /transl_table=1
FT                   /translation="MSALLASSFVGRVAAFKATKIQAKSVSTTVKADIYPEFGTYPGGG
FT                   ESPIIPFGDEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADK
FT                   FPGAVAPLAPEGSGYPSFWNVLIIEIVLVGAAEAYRTGISDSPFDDGLTVGDVNPGGRF
FT                   DPLGLAESGDLEELKIKELKHCRLSMFAWLGCIFQALATQEGPIANWQSHVADPVHSNV
FT                   LTNAAKGFGFY"
FT   CDS_pept        join(439430..440946,441035..441305)
FT                   /codon_start=1
FT                   /gene_family="HOG000265071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856490"
FT                   /orf_name="OSTLU_32661"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="ABO96998.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG559698"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI000150040C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S095"
FT                   /transl_table=1
FT                   /translation="MSENDMAVANAPVDASCAKSAIEGASGDARAAAAVPAWMADDDDD
FT                   GLTEEQRRVIAERVAALQNRFKKFEEKTTREKVEELMLGNADKGLTEREADMVLRVCNG
FT                   NEFEASDRLGEAEDGESFLMSIRFMIQEEDALKRRSQSSKAAQTANERFNKRIERLRKR
FT                   RMSFGGDEEDEEDAGEPEEFFETEYILEESLGVQFVRHTKKHVNVKRLRLDDAIARAQV
FT                   AEELAEPEVNPYEGWSEARIKAWKNREKNENQYYYRFNEPGEMQANGKWTDEEHQKFMD
FT                   IIASLPGGKANYEWGTFSKGIPGRVGYQCSNYYRTLVKNNIIQDENYMVDPVSGDLRFN
FT                   FKNKGFTRAEPVEGEPRMVMVKKVIKQKKPKAPKQPKKAKKKVKKSDDKAFHCTIRAGP
FT                   VRSSGRATKKTYTDGGDDDEDFDDEFEELPVLPGFIDPITRMAIEEPAISPYGHVAGYE
FT                   TWCKILRQPEAPDTCPFTKQPLKRRELIKLTHENIDQYRSKIVENQQTGENAQVRHLGR
FT                   GNRVRTPTHPTKGDYLSIKTEEVIFGILFAFMAWKLWQSVRGLFRYWKYVRAPNAPETE
FT                   LEAGAIAFEEDDDENEKID"
FT   CDS_pept        complement(441387..444569)
FT                   /codon_start=1
FT                   /gene_family="HOG000265072" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684984"
FT                   /orf_name="OSTLU_32662"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97228.1"
FT                   /db_xref="HOGENOM:HBG609932"
FT                   /db_xref="UniParc:UPI000150040D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S096"
FT                   /transl_table=1
FT                   /translation="MVAKTERKGAETKPPTHFPGVAGAFVRVTMHNFMCHANAKVELGP
FT                   RINYVTGENGSGKSAILTALAVALGAKMKSIGRSSTKSAKGMIKTGASFARVVVVISND
FT                   GEDAFKPDVFGRSITVEKVLNATGANSLKIKSESGETVGTRVDELNKLADHFCIDVDNP
FT                   ITVMTQDMAKKFLHTGDATKKYQFFIDATLLSDLMELQEIAKNKSNEMKDVLNEHLETI
FT                   PKLREEVAELTHELHSFERVQELRSKAIDFRNRLAWSKVVEAEKKLEEEKEAQQVYVQK
FT                   RGELQAKLGTAQATLEKAAIDNEEFGRQSEDFSRKLQELSAERRQAENERREAGRQLQK
FT                   AETDKLSEETSVRKLSKRVSDTESKIQRSLEAQRGDTTETDRRLQKLSSNLVAAKAEIE
FT                   TCSGDIEKLKAGQEDKQRAQSNFARQKKFAENEINDIRKHISTLKQTSSNRLVLFGQQM
FT                   PRLVDTVQRRLGEFSKPPIGPVGMHVTLKDQSWIVPVEEALGQSMTTFLVSSPKDMDKL
FT                   RQISKECGMNNLSIQSVDFNRGRYNIPVEKVPNQTEFTSIESVLECKHDVVFNFLVDSA
FT                   GIERAVLMKDEREARGMFYSGAAKQKQVAVAYTFHRKIFMTGQVVRDEAFKSYNQAQRL
FT                   GTDPKAQIASMENRVKEKQSEIKLLSNDEAACMRAVKDIANMIKKKEAEFSTLNKNAQK
FT                   AFSDLQQAKLDAEDSSGTGVDVSTLQEELDSLNVDLSKHQSSLKEAEFAFTQAKEAHDI
FT                   AENVINEKLSLADSYKAEVEQYAKAMQKIDSERQKAEKQVETCVERLQQADNLIEDCET
FT                   SIQAMKTECEELADKTKKEICDREVAEHAGDITLLPTQLQRLYEKTKESMKKEESRHKR
FT                   PYEEVNDELSDRKRKLIKLEHGVESSKKIFQKLRVGVRKRRETMVTQARQTAANVSHRF
FT                   NYHMQAKGQAGQIEVNYEESQLIIKLKDGTNTRAITDTRALSGGERSYSTLAFNLALGD
FT                   ESDSPFRAMDEFDVFMDAVNRRISMKTLLEFARSDNHSNKQFLFITPQDLSAINADDPD
FT                   VKVQKMIAARPS"
FT   CDS_pept        444695..445924
FT                   /codon_start=1
FT                   /gene_family="HOG000265073" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16684985"
FT                   /orf_name="OSTLU_93031"
FT                   /product="Predicted protein"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO96999.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG609933"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniParc:UPI000150040E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S097"
FT                   /transl_table=1
FT                   /translation="MLDYVRRSRLHLVTGGHDAAEETPCAHCARGRHVGANARRCAQVR
FT                   AYAYSSPNLSLCERLFLNAFWDGAVRRSCPTWIAPNLMTALGLLAIAVAYALIWTLSPN
FT                   LAFEAPRWTYAACAALAFAYQTADGMDGKQARRTKSGSPLGEVVDHACDALSMCIYPLI
FT                   VMDIFGVGHRSRDARAICTTMMMTGRAMFVVDTVSSTFTGVLPVSEFLDSQEIQLICQT
FT                   LMLCVAFSGSNAFLYAPVTVPFVGATTLGRAGAVFCITTGAISRVGTFVNTVLKANKKE
FT                   APPHWPAYRKPLSIAARCALVEAFHGLCLYKAKNFAYAHATSSILFGESEARIMSIRVS
FT                   DPDFPVTNWLALFIMALTTVVPEGDAFVSGMLMGAALFMLLHRGSCLAAQITGCLGMHP
FT                   NIFIIRPRDA"
FT   CDS_pept        complement(445973..446680)
FT                   /codon_start=1
FT                   /gene_family="HOG000154343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684986"
FT                   /orf_name="OSTLU_35500"
FT                   /product="Predicted protein"
FT                   /function="magnesium protoporphyrin IX methyltransferase
FT                   activity"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ABO97229.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0046406"
FT                   /db_xref="HOGENOM:HBG403755"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="UniParc:UPI000150040F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S098"
FT                   /transl_table=1
FT                   /translation="MAETGGDEAASVKNYFDTTGFERWNKIYGETEDVNKVQLDIREGH
FT                   QQTVDKVLAWVKNDDLEGVTVCDAGCGTGSLAIPLALQGANVSASDISSSMVGEAERRY
FT                   KELVANGAKAPATEPKFDAMGLEEATGKYDMVTCIDVMIHYPKDRVDGMINHLASLSSK
FT                   KLIISFAPKTLAYLILKRVGELFPGPSKATRAYLHDEADVEIALKAAGFKVKRREMTAT
FT                   SFYFSRLLECERV"
FT   CDS_pept        join(447167..447266,447345..447601)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312926"
FT                   /orf_name="OSTLU_32665"
FT                   /product="Predicted protein"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO97000.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG609934"
FT                   /db_xref="InterPro:IPR007218"
FT                   /db_xref="UniParc:UPI0001500410"
FT                   /db_xref="UniProtKB/TrEMBL:A4S099"
FT                   /transl_table=1
FT                   /translation="MPPRSARRPPSATTIDALFRSTKPGAARPGKTKGANVAIEDDDAE
FT                   TIDDDDAVERDARELKTFDLTSKFGPCCGLTRIERWDRARALGLDPPKRVLEILHRRGE
FT                   ASARWRECVWHGRV"
FT   CDS_pept        447836..449362
FT                   /codon_start=1
FT                   /gene_family="HOG000265074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684987"
FT                   /orf_name="OSTLU_32666"
FT                   /product="MFS family transporter"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97001.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG561385"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001500411"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A0"
FT                   /transl_table=1
FT                   /translation="MLAPLAPRDAHPPWFLALLVLLNVVDAFHLNIVWPMLPFAVRDFG
FT                   VAEIDVGFYCGVIGAAAPLGALLSAYQWGRISDRYGRRPALIAGSALSTMSVFVFGTAK
FT                   SVRAAALGRWMSGLLNGNAAIVKTYLGETSTKKAQSEAFGVLAFGYGLASTLAPAAAGF
FT                   LQRPARRWPETFAGTAFDTYPYLLPMCVAACLTGLGAVLGVLLLPETASFVRRAEAKAM
FT                   ARNGDEEKRLVKLASAGDLRAIELRDVDEWSDVAGDKGESDDVEDVAPKEVLFTPETTR
FT                   AVACYAVLAAIAIGYDEMLPVFLKTSHELGGCEFAPRDIGILLVCGGVTLLVFQLVLYP
FT                   RIADALGAVRAFRFGVALFAAVSMLAPFASVMPNEPMLWTVALVSQCTKICALGIGFVS
FT                   ITIVVNNSCEDAVKARVNGIAGTTSAFARIVAPVICGWTFAGAMRLTFPARQFLPFAFI
FT                   CAVTVALRVIAERLPTALDSPTSSVADVDTLPSDDPAPVAPVASNLDSPC"
FT   CDS_pept        449498..451051
FT                   /codon_start=1
FT                   /gene_family="HOG000182223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684988"
FT                   /orf_name="OSTLU_32667"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97002.1"
FT                   /db_xref="HOGENOM:HBG446814"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="UniParc:UPI0001500412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A1"
FT                   /transl_table=1
FT                   /translation="MRDDDATFDVAYDVARTASWIRDGAFSRVALQLPDDKLPDAARLA
FT                   RALQTALARDDDAARASREVFVLADTTFGSCCVDEVAAAHRDADAIVHFGRACCSPTSR
FT                   TPARLVFDRKEIDCARCARALEAHAAASARRGARAVVALCDQEYFWALDELKRASTSST
FT                   ANVQGAEIFIADAVEVEVDPSRDSRVRGRDEDASTTRVGASRFRPPNGTTNEDCAYVWI
FT                   GATGPAMTHAMLVLGDCAAKFGGMAQYDPSVDGDAVRVEADGAGEAARALKRRRFLIAK
FT                   AKEARVVGIIAGTLGVAGYREMIENLRKLIANSGRKSYTVVAGKPNPQKLANFPEIEVF
FT                   IMVSCELTALMDGRDYMQPIITPYEATIAFTPGKMWMGEVKLDFASVPTFEDVVANGDD
FT                   DDDVQPEFSLVSGTYISPVNASSSAHDADDIDALTGTELARRAEGALSLRASGVSDAVV
FT                   TSGAEYLISKRTYTGLEPGPKRDDETGAIADAPLEAARGLSGRAKSYADESPASAATDP
FT                   "
FT   CDS_pept        451470..452072
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684989"
FT                   /orf_name="OSTLU_32668"
FT                   /product="Predicted protein"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97003.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR021602"
FT                   /db_xref="UniParc:UPI0001500413"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A2"
FT                   /transl_table=1
FT                   /translation="MRYFGALRNELTLDQNMNEYEAATTEALLRLGHEDAAKKFGSGLR
FT                   AFQVRNHPVHNTRCFMIVRTDGTMEDFSYRKCAARLFPGYDPATFREKTGAARSGGGRG
FT                   GRGGGGRGGGRGARGGGRGGGRGGGRGGGRGGGRGGRGGRGGGRGNFGRGGGRGGGRGN
FT                   SGRGGGRGGPDRGGDRFGGGADRGGGGGDRPRFGRPY"
FT   CDS_pept        452308..453804
FT                   /codon_start=1
FT                   /gene_family="HOG000265075" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20007999"
FT                   /orf_name="OSTLU_32669"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97004.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG558323"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500414"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A3"
FT                   /transl_table=1
FT                   /translation="MVARDVVAKAARSQLVKTAGAKLLDARPKMIALSGPGGFLGARVL
FT                   DAVLDAHDYRRAHGLESGEALLLSASPGNLMSRLTKQYGAERLRGVRASRVDYYYQHDV
FT                   DSWQDQLGSLGMAGCNSVFMNLAGLAGPVSGKANAMMAVNYLAPVAAARACERLGFGHF
FT                   IQSSTQATKAERAGQVPYSRWKAMADFSLARLEKLPVTVCALGMLYDKDQGVVGQRGDL
FT                   LNMIDLTLLPLTPIMGDGSAPLQPLEVADAASRLAFLGLTEVADLPASNLPCQEEGAWN
FT                   RESWSGTDSIWSRESWARIVTQNEKRQYTLRMYDAVGPETMSMLELNKKFAQLNNRKLR
FT                   AVHVDYRNFERVLNVASLGNLNRQFVSLLRSEQDAEHPVVGNSDAFEKILGPDAKLCAL
FT                   GDLDRVTQRRRFPYSATLGWAMHNYGVIWPGILLGTEILVTYLFGQKYSTDDYWKYTRL
FT                   SFKAVFLACVVGGGTYFGGESATHLLELVRNTLPPPPPSP"
FT   CDS_pept        join(454012..454214,454315..454861)
FT                   /codon_start=1
FT                   /gene_family="HOG000265076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684990"
FT                   /orf_name="OSTLU_32670"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97005.1"
FT                   /db_xref="HOGENOM:HBG560541"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="UniParc:UPI0001500415"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A4"
FT                   /transl_table=1
FT                   /translation="MPPAAAAKRKAKPLAATSPSPVKKNAKTTAPAASNDDASALSVQQ
FT                   QCFLQALLSRGIVESEDAEALYREIVEDDAANEFTRFWGEIAVALKFLDLDIRTGKFEG
FT                   DGKTYMAVVNQGTTEVAKLATRMTPAEIALFRVAMLEILRDDSSAERGIDFMSALNSTE
FT                   LQLTQDASTQDGATQMTQLEKQTQTVQKMSKVVKDAALNDLVAERWLERVDDGRRLTLG
FT                   PRSFLELREFILAQAPERARARWDKLL"
FT   CDS_pept        454968..456125
FT                   /codon_start=1
FT                   /gene_family="HOG000173282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684991"
FT                   /orf_name="OSTLU_35232"
FT                   /product="Predicted protein"
FT                   /function="tRNA (adenine-N1-)-methyltransferase activity "
FT                   /protein_id="ABO97006.1"
FT                   /db_xref="GO:0016429"
FT                   /db_xref="HOGENOM:HBG737548"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="UniParc:UPI0001500416"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A5"
FT                   /transl_table=1
FT                   /translation="MLACADAPSTTASASLDAPPPPERVVRDGDLVVVVEGFNAAVAER
FT                   VRSGGVYASKYGTFHHDDWIGRAFGARARERDGRGFVWLCAPTPELWTKVLEHRTQILY
FT                   AADISLVCAEMELTPGSVVMESGTGSGSLTHALARCVAPTGRVWTYEFNETRVKAAKEE
FT                   FALNGISEYVTVTHRDIERDGFPKEMAGRADAVFLDLPGPHKCVGSVARSLRPDGVLCS
FT                   FSPCIEQVQKTILEMKKHGFADVKTVELLGREYDVEGKRLQRDLSAPLSKATKVGWRKD
FT                   TKRPRDAPVDDGDDNVMTQHVVTFPRQRLQSHTAYLTFARLVPEPEGWAKTLAERSKNG
FT                   VGGDLLARAAEVLQRNRRSGRDSPAPRAPKAPNKNMLSNPGEYSD"
FT   CDS_pept        complement(456199..456990)
FT                   /codon_start=1
FT                   /gene_family="HOG000265077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684992"
FT                   /orf_name="OSTLU_93033"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97230.1"
FT                   /db_xref="HOGENOM:HBG609936"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI00015004FA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A6"
FT                   /transl_table=1
FT                   /translation="MFATAAPAPRAAPAPRAARSTTPPSSARASARASSSGADVLYFCY
FT                   GSNLNPSTFDGVRGMRPTSSTPCVLRGFELAFNVPGVPYVEPAFASAVAREGAECHGVA
FT                   HGITRDEWEYLVTTEGSYDVVDVDCDAYDGRKLRCKTLTHRTLKNFGERAPSLRYATLL
FT                   REGARFHGLDEAWIARLDALETYEPVELDLGQRAALALSVGPTLLAAVPAAGAAAAKRL
FT                   STGDGRGAVIDAFVETQDVVWGVQNAFFAPWMGSSGRNAKK"
FT   CDS_pept        complement(457100..458686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684993"
FT                   /orf_name="OSTLU_93034"
FT                   /product="Predicted protein"
FT                   /biological_process="transcription"
FT                   /protein_id="ABO97231.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR012921"
FT                   /db_xref="UniParc:UPI00015004FB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A7"
FT                   /transl_table=1
FT                   /translation="MEAAKAEEEKIRSTVREFILKAMEMAAEETKASGHDEANGTPSEV
FT                   AAAVESALYKKCGSADKEYRTRARSLKSNLQDVRNPQLRARVLANDLKASQLVDMSPLQ
FT                   LANKELVEWRKARQEIAGEGAFMKGIALEDIVVKKDGKNEIHVELKPEEPAPSKPVEQT
FT                   PSVEEEPTQVTEIDVTSGNDQLSDEEHEEAAPMNVDGDDSEMLSFEKFANGGEEDKEEE
FT                   QEEEEDEEDAAPEYEPEPEYEPEDEPEYDPEATTADEVEEEEYNPADDPIDVPLPEGAW
FT                   EGTVDVPGLPTLQLRAVPIGGEGAHVGDILPESLHIKGRVDYKAMQSFVKQVHRSSTSR
FT                   AVTLVHISSAPSGGDDAEAAMAKIVKQYRERKRCGVAKTEDGIELYLAPRGQHADKVIL
FT                   TVDLIPGHVPPSTGMIGMVIHPRGIGPRKVDSKELHRSKKTRVEEHVDEDEYAPNAPPA
FT                   QFMEVPPPPPPSAQMAPLAPPQTLREVPPPPPPAAAPPAFQAQDLAGLIATLSGAQQPV
FT                   RMNVPPPPPPP"
FT   CDS_pept        join(459286..459377,459504..459621)
FT                   /codon_start=1
FT                   /gene_family="HOG000265078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856491"
FT                   /orf_name="OSTLU_32674"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP hydrolysis coupled proton
FT                   transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="ABO97007.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015991"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG523530"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="UniParc:UPI00015004FC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A8"
FT                   /transl_table=1
FT                   /translation="MGFWFTTLAFAALEGVFYAYVQGSAPAARRSFLHVMYGTSVFCCW
FT                   FMWAVIYMAQMTPLVRPVLQAKES"
FT   CDS_pept        join(complement(460572..460631),complement(459876..460433))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20008000"
FT                   /orf_name="OSTLU_32675"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="ABO97232.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015600"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00015004FD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0A9"
FT                   /transl_table=1
FT                   /translation="MSATRAGVTPLPKYKLVFLGDQSVGKTSIISRFMYDKFDNSYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSSRASFVNS
FT                   AKWISEVKAERGGDVIIALVGNKTDLDGREVSAAEGEAKAKEEGVMFIETSAKAGFNVK
FT                   VLFRKIAAALPGMETPSTKADEDLVEVKLTGQAQQSAKSSCC"
FT   CDS_pept        460966..461289
FT                   /codon_start=1
FT                   /gene_family="HOG000265081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856492"
FT                   /orf_name="OSTLU_32676"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97008.1"
FT                   /db_xref="HOGENOM:HBG716382"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013970"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00015004FE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B0"
FT                   /transl_table=1
FT                   /translation="MDDSAPRPRVNGEALVNFIGKTVLVVGEVTPRDANSATVKTADDK
FT                   MITVNLAGAGAFGSKYVEFEATVDGADCVTECSRVEFGDDFDQYSYGELCKLINGKSKE
FT                   LFY"
FT   CDS_pept        complement(<461456..>462604)
FT                   /codon_start=1
FT                   /gene_family="HOG000069115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684994"
FT                   /orf_name="OSTLU_10147"
FT                   /product="ABC(Membrane) family transporter "
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="ABO97233.1"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="HOGENOM:HBG711081"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="UniParc:UPI00015004FF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B1"
FT                   /transl_table=1
FT                   /translation="PTNRAEEYRFTDFSALTTATLVGPKEGASADASATRVEDACATVV
FT                   LVDGVLDATQSDFEGAAKAGIKISVGAADATTGKQSATRGNVFAAINSASAADVVVVRV
FT                   PKGVKCASPVHIVTMSTGGENGATRVSAPRITIVVEEEGELCVVEDFAGEGETEYWQNG
FT                   VCEIAVEKGASMKHALIQNHGRGATHTRTTLVTQAEDSKYEVNEISVGGKTARHDLNIK
FT                   QLGPRTETVLGCFNLAGSNQTLDLHSKLQLDHEEGSSNQVHKCIVSAASGKGVFDGNVQ
FT                   VNRMAQRTDAQQLSRNLLLVPKATVNVKPNLQIIADDVKCTHGCTVSDLEEEELFYIRS
FT                   RGLSAETARSLLVSGFGVDVISRLPGKDLRDRVNSIVRTSLER"
FT   CDS_pept        <463482..>464441
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312927"
FT                   /orf_name="OSTLU_3119"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO97009.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0001500500"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B2"
FT                   /transl_table=1
FT                   /translation="DDFDILKLVGQGAFGKVFQVRKKDSGAIYAMKVMKKERIVEKDQA
FT                   EYTRAERDILTAVTHPFIVSLRYSFQTTSKLYLILEFINGGHLFFQLYQQGTFGDELTK
FT                   FYISEICLAIGHLHSLSIMHRDLKPENILVDHDGHVKITDFGLAKRIVDDKRANSLAGS
FT                   IDYMAPEILNAKGHGKTADWWSVGVLMFEMLSGTLPFKGKNKQAVQKAICSEKVKVPNY
FT                   FQPEAVGLIKGLLAKDPSMRLGRGDDGTADIKSHKYFKGVDWAKIAAKANPPPFKPNVH
FT                   GEHCTANFDTRWTDVDPVDSVAATPVSGEQEKFLGFTFV"
FT   CDS_pept        465683..467725
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856493"
FT                   /orf_name="OSTLU_93035"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97010.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001500501"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B3"
FT                   /transl_table=1
FT                   /translation="MPRASRRAASSSDASSEEDVASAAAERVRDEHAPSLKYVPGSSGK
FT                   AQRARAKLLRNASRRKREQRAERRSPSASPSESSPTPRDARTATNVVELRALLERISLT
FT                   ELERETFVARRGEDGDVKVCEASAFVESVRRNEARLRDVERVEMLGNDDDDDGYVIWPR
FT                   NDGTARQMRYEDATAARCALDHAPSEVWERIFGFLNLRDAVRLAATCKSTWILSQREFM
FT                   RDKRYESMFGRARASAEEGADGDRAMVVSFLSSERWLGESHVGETKFPKPVHFGVGPSF
FT                   VRGLIADETTVTSFDREKVKIWYHGARGDDDAGGRLASLFVEKKSSATRGLTALAINQS
FT                   SIVAGDDGGRLRIWQSDTLEYVQRRAHAIANDYAVTALCGIPATSLVVCASAKSTNLEI
FT                   WDTEEVASVTSIALGDLVHDGDGGNAHHGATCMSMFGGNSYSNRSYIGGATSRLWAGTT
FT                   FQKVVGVDLNRATFVDTLNLPESYASEAEIRAIAVNGPLIAAVVADGAVMWDRRAMPHE
FT                   QVVATFASPFSHIAGASEQSSCIDLEDFALWMSNPGDPGVSMFDIRKTFGPPRKQERWV
FT                   SSLTTNAVTNILRPRARTRGFSEEVNVGCFARVAGAPGAVIVAPDSDSSEARCSIFLHK
FT                   NEMPSMVDIETMANEFDDQWRSRRARKQGKPPQPKSRGRYPKRSS"
FT   CDS_pept        complement(467763..468626)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312928"
FT                   /orf_name="OSTLU_93036"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97234.1"
FT                   /db_xref="UniParc:UPI0001500502"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B4"
FT                   /transl_table=1
FT                   /translation="MFARVSAPARPRTTPQASRRALSTRCAPRTPSAPRADLKPRPRQE
FT                   NDCFQIAATSTRALAPPAQFTPAQVFAFKCGLVLGLPLALYKIALDVRAQNIAERRRAA
FT                   ALGAKTRAASALDGRRDGMLRADAVAAKREARSEMRRRTNVMDIPVASNKKREVVMPTR
FT                   AMAKPATKPTAAVESKATARAPKAKGPPVKITLATQCALPDGVGLAVVGDDSAIERPIA
FT                   MQRVGADRYQIVLEVGSGNLTYMYVAKKGDKLIKENRVKEGKGERTRQIDLDGKPLVIE
FT                   TEAPVF"
FT   CDS_pept        join(complement(469325..469527),complement(468730..469243))
FT                   /codon_start=1
FT                   /gene_family="HOG000040143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856494"
FT                   /orf_name="OSTLU_32681"
FT                   /product="Predicted protein"
FT                   /biological_process="translation"
FT                   /protein_id="ABO97235.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG533975"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR015998"
FT                   /db_xref="UniParc:UPI0001500503"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B5"
FT                   /transl_table=1
FT                   /translation="MRWCLLSMRASTPAAARDVAARSYSKKKKQKQRAAAASDEDGDGD
FT                   EDGDGDGGEEGDVVEYDAKEWQSKFDAALHALDVDLSQLRTARASAGMIDHIIVDVYGE
FT                   PTPLSHLGTITAPNAQTLSVTLFDPSTKPSVEKAIVNSPLGFVPKESSDGLIVPIPAMT
FT                   QDTRKEVCKLASKLGETAKIAARNIRHKAQKRIKRAEMSEDDRKRAEKNLQALTDDIVG
FT                   KITQRCAAKEKEIMTL"
FT   CDS_pept        complement(<471108..>471815)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856495"
FT                   /orf_name="OSTLU_5235"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO97236.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001500504"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B6"
FT                   /transl_table=1
FT                   /translation="LKKPEEAKQTFIKALNITKSRFGDLHHGTAERLSDLASMHLELRN
FT                   FDQAKALYTKALDVDTQLFGRNHPNLAVHQIYLASVLRARGENLEALRQYKEAEAILKE
FT                   TNETVHPGLAASLNSLAEKYKSMDQAQRAEPLYSRAVEIAEHDFHASSELETYLINLGR
FT                   CYRSQGRTLKAKACFEQALKIAEGEFDAAHTNIATRCVELGELLMEMKEWGEALPCYTR
FT                   AKDIRVQKFGLDHP"
FT   CDS_pept        complement(474630..476552)
FT                   /codon_start=1
FT                   /gene_family="HOG000232962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856496"
FT                   /orf_name="OSTLU_35328"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO97237.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG593509"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001500505"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B7"
FT                   /transl_table=1
FT                   /translation="MRSQSPLRYAPEASAAKFTKDPVRVAARAADIATSLSSFAASVAL
FT                   DYQRGTVEENARKRAAELREKLTRLGPAFVKVGQALSTRPDLLPTQYLEELSTLQDALP
FT                   TFADADAFALVEKELGRPLETMFQKISPSPIAAASLGQVYKAVTMEGRDVALKVQRPSI
FT                   EGGLDLDFFLIRSGAVVIDKLVTSLNTSVVELVDEFAARVFQELDYVQEGRNAERFARL
FT                   YGDRPDIVVPGIEWETTSPRVITMEWIEGTKLSDQESLKAQGLDVLALVDSGIQCSLRQ
FT                   LLEFGYFHADPHPGNLLATPDGRLAFLDFGMMSEMPESARYAIIDHVVHLVNRDYVEMA
FT                   NDYYALEFLDESVDVTPIVPALEEFFDDVLEATVDELNFKTITDGLGAVLYKYPFNVPG
FT                   YYALILRSLTVLEGLALTTDPKFKVLAKAYPYMARRLLTDPRPQLRDSFAELLFQDGKF
FT                   RWNRLENLLREGSKSDDYDAAAVVPPLIELAIGEDKPGEAKNTLRPLIEAETVKVLEAI
FT                   LLGSAMDSAKSDALAPIVAALPAELRALPPLTFGNAKQEAKLLEKREQVLRIVEMFSSS
FT                   KGFDPQTLTPFTEALRKPSASIFVQHVATGLAERIAARVVNVFLLSQEVTPSPAKSADA
FT                   TASPR"
FT   CDS_pept        join(complement(478988..479403),complement(477131..478748))
FT                   /codon_start=1
FT                   /gene_family="HOG000242015" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20856497"
FT                   /orf_name="OSTLU_12730"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97238.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="HOGENOM:HBG319978"
FT                   /db_xref="InterPro:IPR000738"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI0001500506"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B8"
FT                   /transl_table=1
FT                   /translation="MDALEQKQEEVNAAGAQVRALKAQNADADAIAAAIAELKRLKVDL
FT                   EKDLNALKEAGNAEAKAKEEFRAKLGQLLEGRLFYIPSFKIYGGVAGLYDYGPPGCAVK
FT                   SNVQQFWRQHFVLEESMLEVECPAVTPEPVLRASGHVEKFTDLMVNDVVTKDCFRADHL
FT                   LEEVVEELLRDPMLKADRRRELEDLQACIDELNVEQMSAALKDTNTKAPVTGNDLSEPY
FT                   PFNLMFPTQIGPSGAVKGFLRPETAQGIFVNFRDLLYYNGGKLPFAAAQIGQSFRNEIA
FT                   PRAGLLRVREFTQAEIEHFVHPEHKEHPRFAEVADTVLSLFSQDAQLGEVKKPFPMTVG
FT                   EAVSKGIIANETLGYFIARCHLFLVQIGIDTNRLRFRQHLKHEMAHYAADCWDAEIQCS
FT                   YGWIECVGLADRSAFDLKAHSDKSKVDLVAYERFDKPIEETVVEITPNKKVLGKAFKKD
FT                   AKPVTDALLALSEADAFALQDACAANGSAPLQTENGEQQIAADMFTVEKVTKTVNGRNY
FT                   TPSVIEPSFGIGRIMYCMFEHAFYIRPDDEQKTVLRLTPVVAPIKTTIFPLVNDDKLNA
FT                   IAAEMNKMLTTNGISAKLDATAISVGKRYARTDELGVPFAVTVDHRSVTENTVTVRERD
FT                   SCGQVRVPIPEVPGLLGRLCKMTVDWETATAGFEKQATAADE"
FT   CDS_pept        join(480410..480460,480555..481019)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684995"
FT                   /orf_name="OSTLU_16174"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97011.1"
FT                   /db_xref="UniParc:UPI0001500507"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0B9"
FT                   /transl_table=1
FT                   /translation="MSSSRHIALTAIGGALAAAGAFYGPSALEVYTAESSLATAERKLA
FT                   AVKALARDDEQNFAKARSRWSAVTSAFKDASERYRRTKESLDTRLRALEQAKRAYEDTK
FT                   REVDEAACALAEAEKDEAEANLTLARARQKLGTHEEAIAQAKVEVQKLTTVAEAAIKKM
FT                   NALKLPTF"
FT   CDS_pept        complement(481069..482154)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684996"
FT                   /orf_name="OSTLU_32687"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97239.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI0001500508"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C0"
FT                   /transl_table=1
FT                   /translation="MFSKDEDDRELAVVLWLLFATRAGGDIWEAYAAWLPTAANGLPST
FT                   LLATDEELASTQNEALVRRAREVRSLVSLAFDRVPFGAVPGKLTPDDLRWGYALVTSRA
FT                   IAAEVGADEEGGADDTQVAVLAPCVDMANHVDIANVTALKKIGASDGGGLKGAYWRVVT
FT                   GGSVDGGGGACCLETNRPIQGADEEVTISYQPDASNDELMESYGFSLRGNRNDRLGGAN
FT                   ITLRLGAFRQAMEESGVLGGSTPEEDVRRIIAVTASACGGIPPGRELVADDDWTLEGDD
FT                   IQRELDDAVKLGEAWERELDAFATTLEEDEAELLENRKYTTAFGRAAVEYRAERKRLLG
FT                   VGLGALSAYVDWLCADDDVEG"
FT   CDS_pept        complement(482691..483944)
FT                   /codon_start=1
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684997"
FT                   /orf_name="OSTLU_32688"
FT                   /product="Predicted protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="tryptophan synthase activity"
FT                   /protein_id="ABO97240.1"
FT                   /db_xref="GO:0004834"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG303148"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniParc:UPI0001500509"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C1"
FT                   /transl_table=1
FT                   /translation="MTPPTQGKISEQSRPDANGRYGAYGGKYVPETLIPALRALEKEYE
FT                   AIKTDPAFQAELKDILKDYVGRENPLYYAERLSEHFKDANGEGPDVYLKREDLNHTGAH
FT                   KINNAVGQALLAKRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGAADMERQKLN
FT                   VFRMRLLGATVRPVRAGTATLKDATSEAIRDWVTNVEDTHYILGSVAGPHPYPMMVRDF
FT                   HAVIGQETRRQAMEKWGGLPDILVACVGGGSNAMGLFHEFIDDESVRIIGVEAGGEGIE
FT                   PGQKHAATLTLGTPGVLHGSFSYLIQDEEGQIVEPHSISAGLDYPGIGPEHAFLKDFGR
FT                   AEYHAITDKEALDAFVATSRLEGIIPALETSHALAYLWKLCPGLPNGTKVVLNCSGRGD
FT                   KDVNTAAKFLDISGEVDG"
FT   CDS_pept        484440..485909
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161263"
FT                   /orf_name="OSTLU_50012"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ABO97012.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000150050A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C2"
FT                   /transl_table=1
FT                   /translation="MSTWADDDGDLPPPPGFEDVRAGAHAAEIADIASQLGGAPAIGTR
FT                   ADAVDAPDVALKSEGLREEHAGEVVKAIVDPSTPYASAKSFEDLGLSAELLRGLYGEMK
FT                   FEKPSKIQAETLPLILMPPHRNLIAQAHNGSGKTTCFTLGMLSRIDPNLKAPQGLMICP
FT                   TRELVVQNVSVMERMGKYTGVTIASTADPKWDNTNRNKIVDQAVIGTPGKILRWMRERQ
FT                   LACNNMRILVFDEADHMMATDGHRVDSTKILKHLSMNAKAWQVLLFSATFNEAVKSFAT
FT                   KVVPNANQIFIPATELSLDVIKQHRVAVNTVEAKDVLLKEKIFPLCDKIGQTIIFVRTR
FT                   EGARRLHASMNASGYKCTVIEGQMEHADRDRVVKEFRDGLTKILIATDVLSRGLDVSTV
FT                   TLVINYDMPVEFHNPRSPNYETYLHRIGRSGRFGKKGAAFNLILGDSERAICDQIELHF
FT                   NHKIPEVAFNDDVTFEKVLEDAGLMSKEEAL"
FT   CDS_pept        complement(486014..487123)
FT                   /codon_start=1
FT                   /gene_family="HOG000265082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684998"
FT                   /orf_name="OSTLU_16178"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97241.1"
FT                   /db_xref="HOGENOM:HBG609942"
FT                   /db_xref="UniParc:UPI00015005E4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C3"
FT                   /transl_table=1
FT                   /translation="MATSRRRRARLGALVLACVAALAARARASDVDTECAEARRACARD
FT                   ARRAIDSDARLQKFLATATRDATRADGDAALGASRYGGFVADDAPRLAFAELVALGCCL
FT                   FDGECARDAATRAARRGDDEAAATRDALEIGGALLFRASEHEHWTKMPGIGTLGADART
FT                   CAEATGTTRCDDALVATYVKAGDAGDELGVLRAGDAMLRRYVAGLATRVQGEGAREECD
FT                   ATRGGDVGDAAGARALFKRLLTSNRFDKVAAERLREVTRAEELWVDPTRGGTPDKAYLM
FT                   ADALIRLASRGATAIAVCVVFYVFRNFTFIGGAWRFARSVFLAVTGISLVTRVFKRVRA
FT                   FVKWLRWKPPVVDTRQARREEARKSKKRV"
FT   CDS_pept        487301..488326
FT                   /codon_start=1
FT                   /gene_family="HOG000265083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16684999"
FT                   /orf_name="OSTLU_32691"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97013.1"
FT                   /db_xref="HOGENOM:HBG609943"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI00015005E5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C4"
FT                   /transl_table=1
FT                   /translation="MTDAPSAFTTKLASLNGSAQSIETLSHWCIFHRKNARTLAGTWDE
FT                   RLRAAASKQKLPFLYLASDIVQKSRKKGPEWADALVGYMPDACKHAVEHGDGTTTEKVK
FT                   KLLRVWGERQCFPGASTESWLDGASDGGGGSTAVAAKVAAPAATSAAPVAKKNKNDLAE
FT                   VPALSGDNAALAKLLVKMENAERDVAAASERFDADVREELLDETNVENAEDPVGMLRAV
FT                   QCCESAIVFKRNAVDTMTETLDTLEKKLRAALARVEAARESQSGVNMGELTQMMIKALK
FT                   ARKKASKRNADFIVRQIASEAGDAPLPEPVDFDADADNYDPSDAPDEYHPPDESNKRPR
FT                   R"
FT   CDS_pept        488520..488963
FT                   /codon_start=1
FT                   /gene_family="HOG000265084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161264"
FT                   /orf_name="OSTLU_32692"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97014.1"
FT                   /db_xref="HOGENOM:HBG559713"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00015005E6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C5"
FT                   /transl_table=1
FT                   /translation="MSAYPRPAHPYGASAAGLTSRPNASTSGGEFHVHVGAASAMDLDD
FT                   EVAGLRGKVKMLKQMSNQIGEEASVRGSLIDALSVDFSSSDAAMKDVRRKVEHAFKQAK
FT                   SGHLMALMFFALCAFFGMFVFVKFSKVISYLVPRGTGQSVRHH"
FT   CDS_pept        complement(489066..489557)
FT                   /codon_start=1
FT                   /gene_family="HOG000167115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008001"
FT                   /orf_name="OSTLU_35485"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97242.1"
FT                   /db_xref="HOGENOM:HBG590687"
FT                   /db_xref="InterPro:IPR008584"
FT                   /db_xref="UniParc:UPI00015005E7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C6"
FT                   /transl_table=1
FT                   /translation="MVLLVLYCKAEFENVASVEFPAGYHYCFDVKDSQSDETREGVFMS
FT                   ADDVVEMENSRGEANFVMKFPDSKKQASVSFVDVKGLTTKGVIDASGTWVPVMGFECRG
FT                   LELEKFYPTKGATVKSEGGSTWRDVDLSEDPDGWFEYCENGGDSVGITEFTCEIRKHKA
FT                   "
FT   CDS_pept        complement(489597..491231)
FT                   /codon_start=1
FT                   /gene_family="HOG000265085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685000"
FT                   /orf_name="OSTLU_32694"
FT                   /product="MFS family transporter"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97243.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG559714"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00015005E8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C7"
FT                   /transl_table=1
FT                   /translation="MRLADASRALAPRWTRRADVQLVVACALTTLLGGALQLHKLASLD
FT                   AAGREFAETSTAAKVSFLLPFALAKSCANLVVGAVADARGRRRVVVAGWSVAIAAPALG
FT                   MIAGARKSFGVVTMSAFFLGSAQGLTWTALVLASVDLCGKARRGFASGLNETIGYTAIA
FT                   IFAEFYGSMERSGVRCAWTTQTPSAACSAANAAQTCAVADDWVKACVGECACDGYMRVP
FT                   MGIELMMCLIGLLVSIFVFKETLATLAAGRRFDVAWASEIPEEDDKELRGRDCESSDGG
FT                   SLQVIPAPNESLKEAMIRTTWRNKNTAVVCYAAFCANFETAVAWGLMSVWARDQLGLTG
FT                   RERDFFTGCYSFMKGFTQIASGLMSDKIGRKLPMSFGLIGGAVALLVATFGAGFHGKFM
FT                   SGSPDATELRAMQLAYLTLSSVALGFCTGVTYPVLAAAAVDHAPDERHYASTLGVVRFW
FT                   RDLGYVMGVPIAAIADSASAELALILVSIVMATAGYGVHKTYEERLGGADPHADGYAHT
FT                   PVADADREDDFNDEPITTTAIEMSPRA"
FT   CDS_pept        491395..492246
FT                   /codon_start=1
FT                   /gene_family="HOG000161910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685001"
FT                   /orf_name="OSTLU_35539"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ABO97015.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG737783"
FT                   /db_xref="InterPro:IPR008576"
FT                   /db_xref="UniParc:UPI00015005E9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C8"
FT                   /transl_table=1
FT                   /translation="MRDDATPDAVEFRGVDDLGRDVGTHEAFWAEVAKKRSHGADGSKP
FT                   TFYAKGIEYWDGVAPDVDGVLGGFAHVSAPDARDNAKLLEDLRGRGRGGAKANGTKTTA
FT                   LDCGAGVGRVTSTFLIEKFDEVDLVEPCRHFLDAAAADALVRGDGRADGHRAKRFVAEP
FT                   LESFVPERERYDVIWIQWCIGHLTDDDFVAFLRRCKDGLRENGVIVMKENNAASGFILD
FT                   LEDSSITRSHEYLLHIINRTGMRCLEHRLQTGFPPELFAVRMYVIVPSSSFRRVGIQNS
FT                   SR"
FT   CDS_pept        complement(492283..493878)
FT                   /codon_start=1
FT                   /gene_family="HOG000265086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008002"
FT                   /orf_name="OSTLU_32696"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ABO97244.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG388407"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00015005EA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0C9"
FT                   /transl_table=1
FT                   /translation="MSKSLSIQVPARTPLGERSGNENISAASKFPSSKLKLDELFLNWL
FT                   SMAESQNLVYELLKDAKAGKPLRQPKSGAMHANVAAAIGTPPRSPQKGSRYGTSAFSPT
FT                   RRPLSRQASLFTRATNEPHSIPTFYKPGGEGLSEEVNAGKVALAERMFERHLTGMNLEA
FT                   FAGVVRDVVGLPRYFAKRVMKLVAGANADVVTREQWFSYWNSTLRRQKDVSSAMFEILR
FT                   RPNARALEHADFTEVLTEMTQTHPGLDFLKTTREFQERYVETVIYRIFYECNTTWNGRL
FT                   TLRELRKSDLLEHMLLAEEEEDINRVLKYFSYEHFYVIYCKFWELDTDHDFFINREDLL
FT                   HYGNHALTYRIVARIFDQAGRPFKSDVPGKMSYEDFVWFILSEENKNHPLALDYWFKCI
FT                   DTHHDGVITRDEIYYFYEEQIQRMECLAQEPVLFEDILCQMMDMLKPEVDARVTLNDLR
FT                   SSKMSGNFFNVLFNMNKFIAFETRDPFLMRQEREEPHLTEWDRFARGEYLRLSMEEDDE
FT                   MDHASDVVWEESPI"
FT   CDS_pept        complement(494290..496602)
FT                   /codon_start=1
FT                   /gene_family="HOG000265087" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685002"
FT                   /orf_name="OSTLU_32698"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ABO97245.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG609945"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00015005EB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D0"
FT                   /transl_table=1
FT                   /translation="MPRAAPLARARAQTCAPRSLCGAATSASTRGARAAPSSRRADVAP
FT                   VARRRRASFATRATSDDAEVADEEPANWKYAYLYDGACPVCQTLKSALEGTGRGEGKVW
FT                   YVDISDPAYDAKKHQGVTFAEAMETIHVLKRDKSEPLRGLPAIEALFAEVGMGWAVKLA
FT                   TMPAISLAASVLYKLISSNRLKIGGAMGAGVMALGRVGMEMRGEKASCAEGDECRGIAD
FT                   MEVDEDARGAEEETSFESVYAEGPRAILGAYASGGIVSAAIVNVRTGELESELITAPLD
FT                   EGALLDINAVGSALRSLTKELKWQGSVSVALPGVWHADEKLGGTSVYAAMETLNPFEGR
FT                   REREETEELLRNAVGLDVTVVTGAEAHGYGHQDLWGDAARRVKIGQTLDSDDPDNAMSG
FT                   LTGVVTAGHEAVHVALFRDGVLRTNADFREADLAISWIEPEWANAKPPADDCEDEEEWK
FT                   AWATRMAVHLAKVENCRCARGGLERWVVSGSAARNFDKWSHLVPKLSVVQAGKAAAPLI
FT                   IGGSNSLEGVRGAAAGGSFRFRYMADIRRVRSAIGKEVGRSPQLVSAIQLRELFEKFGG
FT                   DINDDAIDLDAFVRMVAAMGVRLPEDEVRELVCDIDVQCESSVTFDQFETWYKSVIGTE
FT                   VAQVLHTEAAVDQVLEEEMGTGRAVVLQVGFTSCMPCKKFLPYFEQSARDNREKCRYVR
FT                   IYGNENASTIHLARDRLAVKSTPTFFVFKDGVVTHMHSGSNTEKFDDAIAEQVGVLPIG
FT                   TYEAKWNPPVPTEATTV"
FT   CDS_pept        complement(496843..497529)
FT                   /codon_start=1
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161265"
FT                   /orf_name="OSTLU_35737"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ABO97246.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG380350"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00015005EC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D1"
FT                   /transl_table=1
FT                   /translation="MPKVTKRTERDARELVDASGAIVADDADALRPVYAPLGAPTETRK
FT                   GTKHEYRKVNVPAHRFAPLREHWMALYEPVTKQMKIDVRMNLKSKKVELKTTERTEDES
FT                   ALQKSADFVQAFLLGFDVQDAVALLRLDDLYLECFEVKDVKTLRGEHMSRGIGRLAGKN
FT                   GKTKFTIENATRTRIVIADQHIRILGSFQNIKVARDAICSLILGSPPGKVYSRLRAVTA
FT                   RLAERF"
FT   CDS_pept        497731..>499332
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685003"
FT                   /orf_name="OSTLU_16184"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97016.1"
FT                   /db_xref="UniParc:UPI00015005ED"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D2"
FT                   /transl_table=1
FT                   /translation="MARRRTRDGAARVAVACVALVVARSVRATTTASCAAMLDDDDDAP
FT                   RTTYSSARRAESREVRYGTSWNASGETRAREDGVTLRLTAPPWCGSTRALALALERELA
FT                   SEPSGGARVLWERPWRPEREATGGAIGSWSAPRAEFELADASGTRVRYGGEWSAAGLAR
FT                   AARTLNRETMGKNESVMTLWPFVRLRDKYAVADFFDNGAAELAVVVLDPCKSADGCAST
FT                   ASMRRLRAAILERIGYTPKNRLGVLMGADAWRIGTKLLDEFDPDDITAVAFVRGALHSV
FT                   WMGNRKNETSVERWIDEINNATVSTVVRRGFFSLSEFSPAVGARKLAMIFANEANEDLD
FT                   ALGVHIHHLVDSSSLNATVGVVDTSRGTWLLCQITDSCDDSGDDETSRIQVALIDVEED
FT                   SIQTVNVSPLPDGALSETRPFTRSARSVPKTPAGMTPPRVPHIARNQLDHKAAQTMALR
FT                   RQGKFSVLFSSSACAFCQRFLSLLNAALGDLDYRALVDGTQTARAFQIDCAVNDCHDSW
FT                   DAEAQSLVGRVLRYPTL"
FT   CDS_pept        499477..500346
FT                   /codon_start=1
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856498"
FT                   /orf_name="OSTLU_16185"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97017.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI00015005EE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D3"
FT                   /transl_table=1
FT                   /translation="MPARDLLPRVARRALATAAAAPRAFVPPPLPPSLASCARVFAVAS
FT                   GKGGVGKSTTCVNIAVALARLGHRVALLDADVYGPSVPTLMRLSGQPVVDADGRMLPME
FT                   NHGVRCQSMGFLMKPGAAATWRGPMVSGALTKMIQDTRWGDVDVLMVDMPPGTGDAQIS
FT                   ISQKLPLTGAVVVSTPQELALADARRGIDMYGKVNTEVVGVVENMAYYCEKDGTRSYVF
FT                   GRGGARATAAERGVEFLAEVPLDATIRESSDEGAPIVVRDPDGEVAAIYTNIARRIMEK
FT                   TRSFRDVR"
FT   CDS_pept        complement(500408..502669)
FT                   /codon_start=1
FT                   /gene_family="HOG000265088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856499"
FT                   /orf_name="OSTLU_32702"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97247.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG559723"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="UniParc:UPI00015005EF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D4"
FT                   /transl_table=1
FT                   /translation="MLKSTPELILQDAMGELYWASADLGTTWTQPCGKVSHTGEEGCFK
FT                   NPGEVVPGGRGRAMGAIRPHPKRAGWLLSFVRTCDAGPGPGGMACRVNRLLASGDLGKT
FT                   WTDMVANSKGKVASFVDFDWAPDDGAGPYPPIYATVFRDGTKFAAYRGAWDYNIDFVRS
FT                   EDLFSTHTLVEQCANAFEILNGDVYTASPPDCADYHKHGAKNHPSSEVNTNNVVLKIST
FT                   NQGKSFNTACFPMNLPANAFEIYDFHADDAGPDFIAVDHIETSAIEARAPMSQLYASDE
FT                   SMSFFSMSMRTMVKDSGGSFVQDFAKVLGLEGVFIANQISYKAFIDGAAIRNGDYSAYY
FT                   ESRISFNAGGTWHKIPAPATDAEGVKYACAEDEFDCERYGLHLHGAVDWDTSEDWNGRL
FT                   GGVYTRSSAPGVIISTGNVGDAVITDEPARVNTYISRDGGATWIESKKGAYIYEFGNRG
FT                   GLLVVAKQFMPVDVIEYSLNEGKSWSTLKLANSIFVHNIRVDPSSKGHVFIIHGMTAES
FT                   VHADPNRGSYFVVDFDEIISGGKVCGAADYEMWSPAAPGSHGCLMGQKYELKRRKLDVE
FT                   CFNDEDFDRAYTIVGTCECSRVFDTECDYGTERVYNVPNASQWPHCAPSDNVNTQCAAL
FT                   NHKPPTPSSNLRIISGDKCTSPGAALGDDGPRRRGHHRGRMFVQFIMLLAFLGVAAYGA
FT                   MYVHANYDLGTLSTTVPNAARNAINGAYEKFQDTFGKREQATPPGYFEPLGDFAAEDEI
FT                   "
FT   CDS_pept        503063..503335
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161266"
FT                   /orf_name="OSTLU_32703"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97018.1"
FT                   /db_xref="UniParc:UPI00015005F0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D5"
FT                   /transl_table=1
FT                   /translation="MRDDAPSKAPREDYVVVDLPLELTDLPGDALKFEDLDTRTPKLRT
FT                   IDGARYVGRYELTCGEQLVVGFDGDDALEARVLAKTERRLKFTPA"
FT   CDS_pept        503576..503992
FT                   /codon_start=1
FT                   /gene_family="HOG000265089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685004"
FT                   /orf_name="OSTLU_32704"
FT                   /product="Predicted protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="ABO97019.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG592480"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI00015005F1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D6"
FT                   /transl_table=1
FT                   /translation="MSAPDALDLPSDGFKQFVELQAKYAESASAMKSLRQRVQQREHDR
FT                   ARATLTTRELTALDDCEGARLFKPLGRSFVLEDKGALVEALEATSAAATEEIEKAMARR
FT                   EHLSKALSDAETNLRELMNGNEALAKELQARGVI"
FT   CDS_pept        complement(504091..505596)
FT                   /codon_start=1
FT                   /gene_family="HOG000265090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685005"
FT                   /orf_name="OSTLU_16187"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97248.1"
FT                   /db_xref="HOGENOM:HBG609949"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI00015005F2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D7"
FT                   /transl_table=1
FT                   /translation="MLAGTYAMFSFEVTCEPMDVEISFRKGADESRNDARRSDGDAAAY
FT                   VDEDDEARFILHRGALEHPEMLGVYANDSLSFGLFPHEDSLNIDVDAIDVGVWYLQIVV
FT                   ISGSLRSGFEISHRLFGSRLARFSDFNGCEFDDGTLSVTVRSENETYTRREPFVAEPDY
FT                   GACGNDTNSCYLGEQHSGDAFQGRGAERTGTGPVSGRAVVAMSTPVAFDDEYFLLAGDA
FT                   RKFLGNFSTGWFTTDGFLNATLTSEPWLLAQMVPNRTNAPFDHEACGTMLNAADLRGAV
FT                   CVTSRGGCFFSQKTLACQKAGAVAAVIIDTEFEPLAAVNWVGSHPPDSISIPTIVMNLL
FT                   DGNKLLKKMYDEPDVRVGAEVYECRPKTRCRRCAPGFASPGTNCSTRCPGLDDAFSSNC
FT                   SRAGECVYDEIAMSFSCVCEDGFSGDACDILANVVDDRGFKRADRSTIAAVLAVTFCFV
FT                   GVVVVCAVYQIRRRRRRMTGHIIWKPHEEDESGAPPTAPVAQP"
FT   CDS_pept        507825..509345
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685006"
FT                   /orf_name="OSTLU_24827"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97020.1"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="UniParc:UPI00015005F3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D8"
FT                   /transl_table=1
FT                   /translation="MADDMKFSFGEASFNAEAPCTGAIRVDIVTTETGNLLGTTELDVM
FT                   KLPRRKTDRHGNVAAAPSGRYHKLYSGDEGDDEDVGFVFLQAYVDPAVTYSQSQKPVLG
FT                   ELSIKVLKLNGLPESCAPALIANVGDAWALLPGFGGGGPSGWKRELHAAVRDAADQCTI
FT                   GIYNRNKSDEMLGKIKFSPFSLPEHGRALVCTVPLTTRDVFGSGDDNGEATVRLQFKQK
FT                   VSNTALFFHYCTPMLPMSAYRYGDMDEIMRDLDIINYEHLVTGRDALPEPLVRSILDVS
FT                   DTDPSIATTRRTKASAMRLAATLESFGDVLKPLTQAVTWEKPMYTAALHISIFMCLWLP
FT                   RLTFVGYFAFIAWYISLRNKPRVFTALGEDKSKLAGSVNVSKAPPGSTLSPLSSLVRES
FT                   YGVAARATPSNDAYDAVVQISFWCQAQVEFLRAPLEKFNAILTWEDESESAKYQTLFLG
FT                   AAVGFLFIPFRFVAAAILFVCLRHPWAAKPPLPPYKVALARRSIAPAA"
FT   CDS_pept        <511223..512110
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161267"
FT                   /orf_name="OSTLU_93044"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97021.1"
FT                   /db_xref="HOGENOM:HBG143907"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00015006C1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0D9"
FT                   /transl_table=1
FT                   /translation="LRHAKSDWSDDTLPDKRRPLAAKGRRRAMRCATRLDERAWTPDLI
FT                   LTSDATRCLETLEAMGDAVEAFRTAPVILVPDFYDKTHGDEGDVSQAKSAKVIGKRVGV
FT                   EVGLGTMQPRTVMCVGHNFGFELAARSFCGSANVELKTAHAALLTARGPARRGERAFKV
FT                   IVAPLDDTALAFEVWNRELRGSTSVMFCVCDVAVCAVIDDAPPERNHHDDAWQRAFTDH
FT                   KFRLEAVLNPEEPESASEIIKRVVERMIEELIDSDMSSEEVLERVIAQAESVEDAMSHQ
FT                   SRALGSGDFEIEEW"
FT   CDS_pept        complement(512189..513733)
FT                   /codon_start=1
FT                   /gene_family="HOG000265091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685007"
FT                   /orf_name="OSTLU_16190"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ABO97249.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG609951"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="UniParc:UPI00015006C2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E0"
FT                   /transl_table=1
FT                   /translation="MSRPCDDARYVDAAIAGIRPPAGKPRTPRASDGRELCKLFMLRDK
FT                   SCDFPNCQRAHLDVPSRPRCETFEKYGFCDRGDARDCWLRHEPCEAWEMDVCLMVDMEM
FT                   AARHVERARRILGPRAVVKAGRIKLSRHTDALICIKSDALGAAGAMRALYREEPYGMAK
FT                   TKRTFVFPREGGWSRTFEGLEWDDEAIRAMDAWLEKCIDACVEESGATREKPVYARVRA
FT                   APRWLEGRLHDAMDRIIDARGDTLACKPLGGGITTRDCTHCIDAVNLWDRAYVGVWKTS
FT                   GIYETMEVTGSAPTQVLPEIDAPQLPPAGEASMDDLAFYFPLKLQDYRVEVKPLCRAYF
FT                   KLHEALLRGRVPIEGDWNCVDIGAAPGGWTQVLSERLTTGCVWAIDPAEITLNPFPTTM
FT                   THLRVLAEDAVETVREGLQSTASGELRLVVCDANMHPEACLRIALDFSTKFSSMKESWL
FT                   VMSTKNFCKRRENWLKVIDTCIEQCRDAGYDDVFVEHLFSNCSEEKTLFARRKGKD"
FT   CDS_pept        513831..514919
FT                   /codon_start=1
FT                   /gene_family="HOG000201089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685008"
FT                   /orf_name="OSTLU_32711"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97022.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG609952"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI00015006C3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E1"
FT                   /transl_table=1
FT                   /translation="MATRVIAPGGARIYARRARIALVARGRGIARCAAVEDESALSASA
FT                   SPEACARRVRDGDATLICGEGDFSFALAFATAASANARIVATSLAAREEVVEAWRGGDN
FT                   VDALRKRPNCRVEHGVDATTLSTTFAKETFDRVLFNFPHIPGKAKMDRNRELLAAYLRE
FT                   ALRVAPNGFVECALAPGQGGTLVDGENRREYGNSWQCYTHGAENGALLVEAVRFEDAAW
FT                   RARGYESRGHWRGLRAERGFLTEGGVVHVFCAESRARELGLECDHCVPFTRDVSVWASA
FT                   ADDDSALTVRRAFERACGDFDARVSSVERIDEWRDDSGRTSETFRVEYASRTMALTRAR
FT                   VNAWNDAARNALGDRLRGVAPT"
FT   CDS_pept        515908..516189
FT                   /codon_start=1
FT                   /gene_family="HOG000223547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685009"
FT                   /orf_name="OSTLU_32713"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97023.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00015006C4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E2"
FT                   /transl_table=1
FT                   /translation="MALPAKAANANPSLVLPSELVERCVGSPLWVLMKSERELVGTLRG
FT                   FDVYVNMVLEDVTEYETTAEGRRVTGRLDQILLNGNNIAMLVPGGGPE"
FT   CDS_pept        complement(516338..518881)
FT                   /codon_start=1
FT                   /gene_family="HOG000265092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856500"
FT                   /orf_name="OSTLU_87805"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ABO97250.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG609953"
FT                   /db_xref="InterPro:IPR011124"
FT                   /db_xref="UniParc:UPI00015006C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E3"
FT                   /transl_table=1
FT                   /translation="MRARAIAVGAERSDAGSKRMEKSAPATVGETPRGGRAPAKTRTMG
FT                   LSVDVPAMDGDEATRSAPATIKDKVGARAAGSTDCVVDEPATPAPMTPIPDQSSAGSLA
FT                   PKSKYTKKVTKTPKKAATTTPSSVQSGAANTQKPRRERRPDSRFIKRRDAELTEFPPGM
FT                   IVWVRLRSTHKGQWWPGRTWKLRQCANAYDLLDIKPEGSLALVKLFGSNCFEWASKEDL
FT                   APYDAQRQSSYREGMLLWYNESASRRKSRGSALKALRCADAAEVEEWSDPWSTSDASSS
FT                   SDEESDAEATNKANVQALESMKVGLTPDWIVHGACKVFGLDLPTIEAPLIKGLLDPCTN
FT                   SHLRPNIPAEKCYDKKDDGLKMSNPWAGYHVLVNPPYEAQVQWRFINRAINEVEWEHCP
FT                   GIILVCRNSTDTSYFQRLLPFPRIHLRRKAVQFKDYSNCPIGFGICVFCIVSPTHPQQA
FT                   DIYSRFHDEFHAAGEFNIPVDGKFVKSPPFIELTTRLHRVACEDYRDSWIACDVCDRWR
FT                   EIPFDQMLKARKSKVWQCRDSFPMGCSTPLTKTEIAAFSVAKAETNTVLVASKVEGTKG
FT                   PVGVYAAETRAGSSVEAVDEQESLTPLDGALANQSTRVDEYSEIREREERTNEFLQSGG
FT                   KLHGLGCPCNWEPCRERRQKEQKILSKHFPGLRVEWEKMRDEITNVLTPFERERLEKIE
FT                   ANKNKMRSLMLSTEEQATMTSHKVVHASAAESAALRMWEIAKRKHKTKTSNAERRERKV
FT                   SSLKAQLEAAETRLSDIMGEVREANVGVDTALKVLEAIRSRATRVEREFDRNNARLKTV
FT                   KVACRKSNSAANKSADAIWSDARARVPLAADVAPP"
FT   CDS_pept        complement(<519758..>520591)
FT                   /codon_start=1
FT                   /gene_family="HOG000237419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856501"
FT                   /orf_name="OSTLU_5177"
FT                   /product="Predicted protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97251.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00015006C6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E4"
FT                   /transl_table=1
FT                   /translation="TQKKPCACCHKFFADSTALEAHWKLVQHSAHDAVCNACGRHFPSY
FT                   DTLRQHLVGNLPKASCAEAYKRAGCERCYEIFQDDEATASHACIFRETEDADDDVDDWP
FT                   CVALDCEFVGVGEAGEKHACARVCVVGSSGEILLHTWVNPGEEVTDYREELTGATPEKL
FT                   ADAPSLERVRAIVVQILLGKAVQTRREHVGVKHLLIGHSVEHDLEVLDIKWKKGMRRDT
FT                   AQFPLYLRHTHLPFKLRALAEQFLGEKIQEEGEAHDPCVDARISMRLYQAAKRRDH"
FT   CDS_pept        521112..523562
FT                   /codon_start=1
FT                   /gene_family="HOG000265093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161268"
FT                   /orf_name="OSTLU_16194"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97024.1"
FT                   /db_xref="HOGENOM:HBG561936"
FT                   /db_xref="InterPro:IPR019335"
FT                   /db_xref="UniParc:UPI00015006C7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E5"
FT                   /transl_table=1
FT                   /translation="MTSAMRDAKASLRDFSSDDFDRVRWINEQTRARIGDAGGSGRDAT
FT                   ARDGSAVVARAVGEGTRGTSASPLERFLADLELQLQLLGEDLSMSLEERSREGVARVPK
FT                   AVKEIEVVEGRVKRLHEEVRGILDRLDEVESESRASVEALRQLDAAKQRMESARETLQE
FT                   ANGLADLMASVDGIFASGNIRNMSESLARMKRGLAVVGDVPEFADGQDKVNAFEHKLEA
FT                   IVRPALITALESQNSTAAREHRDVLRTTGRGSALESIYADTRVTSRMLKQWKSRERDAT
FT                   TTDAGRLDASVHMIDEFLKYCATALKEEISWCSSTFPEDAVLLIPLSWCSLHTTLETSI
FT                   TEKLSSLTLEQLVSARNSFQTYVEDVGIAFTKLAGDAAAHANADAVKGAIGDALMAIVE
FT                   PFIAVEQRFGQLALADIRTTLDSSVNIPEAQSIATSDDLTAVIQSVLATLPKAIDVFGV
FT                   VIDRCEAITAGVETMTCIHAIESGMEHYVDLVALVLRDLRNAAGLIDSTATNMNSNTTS
FT                   AGEEFIRGSLSMLDMINAIPNALLDFESDLRAKLLKLRATLRPALDVTLELGDGPKSRT
FT                   LLGLSIAAHAARSRKLATFLDKVADAAVKHSLDGSIIPVGAEHMNALTRSLEKFVYDTL
FT                   LGRVSLELKGISTSEVWSAKPAESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDNMHDD
FT                   DLARATSLSGDSNAAQEPATSEAWIAKIAEASAELLLKEVRAIASLTDQGAAQLSADLE
FT                   YFSNIVAALSLAPPSALIAWYKCASAPRDEYEDFARAATSEGIDVRVVRAAAATRGIKL
FT                   SSSL"
FT   CDS_pept        complement(523674..524975)
FT                   /codon_start=1
FT                   /gene_family="HOG000278604" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19161269"
FT                   /orf_name="OSTLU_35780"
FT                   /product="Predicted protein"
FT                   /function="glucose-1-phosphate adenylyltransferase activity"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="ABO97252.1"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0008878"
FT                   /db_xref="HOGENOM:HBG703946"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="UniParc:UPI00015006C8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E6"
FT                   /transl_table=1
FT                   /translation="MDNVLSIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNC
FT                   INSDINKVYCLTQFNSASLNRHLSQAYNTNIGTYTRQGFVEVLAAQQSPINKAWFQGTA
FT                   DAVRQYLWLFAESGCEEYLILSGDHLYRMDYRPFIRDHRAKNADITVAALPTDEKRASS
FT                   FGLMKINEHATIIEFSEKPKGDALKAMQCDTTILGLDAERAKEMPYIASMGIYVFNAKA
FT                   MEQVLQDDFPEANDFGGEIIPMAAQKGMKVVAHLYDGYWEDIGTVDAFFHANLECNDPN
FT                   PKFSFYDRNAPIYTQSRFLPPSKVQDCEIERSTIGDGCTIKQAKLKNVMVGLRSTVNEG
FT                   CDLEDTLVMGADYYESLEECDPASLPGCTPIGIGAGTKIRKAIIDKNARIGENCQILNE
FT                   AGVMDKDCESEGYIIRDGIIVVIKDAVIKAGTVI"
FT   CDS_pept        join(525767..526906,526980..526994)
FT                   /codon_start=1
FT                   /gene_family="HOG000200797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312929"
FT                   /orf_name="OSTLU_32718"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ABO97025.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI00015006C9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E7"
FT                   /transl_table=1
FT                   /translation="MVGRVAVFARVRPRDGRGREEDDGEGAEAGGEDGDGAGRRGAWIE
FT                   DGRVVSVKSTTSVNGVTRRFAVDGAFDGRATQREVYAETCAPVLEAVRSGCRGCVLAYG
FT                   QTGSGKTYSLLNGGGDRAEREASTSEGGNGGPGLVPRIAVDCFARAASDARHAYEVSCA
FT                   MAQIYNEQVDDLVAKKSGLRVVPASDGSGWEIENLSWTPCRSAEDVLECFRRGRSRLVY
FT                   AETHMNKQSSRSHCVFQMKIERIERPIEADVDRDEDEDEDGTAQLVAVEKRLGLLTIVD
FT                   LAGSERQKKTQNVGARFKEALNINTSLLALGNVVSALAAGHRHIPYRDSTLTKILEPSL
FT                   NGKSRTVLLVCVSSEIEHANESANSLDFATRAMRIVTSPERWRV"
FT   CDS_pept        complement(527200..527610)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312930"
FT                   /orf_name="OSTLU_32719"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97253.1"
FT                   /db_xref="UniParc:UPI00015006CA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E8"
FT                   /transl_table=1
FT                   /translation="MNRDSHSHTSSARSATTRACFDSSAACLRINLALSIRCDPTVDRS
FT                   RTFSALSLAFSTILESLDTFSSLASLLRCSMRLSVCEADARSALNCASNFRASATSRAD
FT                   SSLNFALSFCSSFEDVLNFTTSVRTRESSALR"
FT   CDS_pept        528386..528802
FT                   /codon_start=1
FT                   /gene_family="HOG000265094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008003"
FT                   /orf_name="OSTLU_32720"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97026.1"
FT                   /db_xref="InterPro:IPR019351"
FT                   /db_xref="UniParc:UPI00015006CB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0E9"
FT                   /transl_table=1
FT                   /translation="MSGGRSRSQKHQNRVPFVAKRDIKRNEGDRERELGLRNLALQNVC
FT                   KRCQQKIVWRFQMGKYKAKKPGTRGRCNKCEQKSVRMAYRSLCDACGKAHDLCPGCQHP
FT                   PSEANASRDVPEACASSGSDSDAESEPASDGEES"
FT   CDS_pept        529060..530625
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856502"
FT                   /orf_name="OSTLU_49993"
FT                   /product="ABC(ABCB) family transporter: multidrug "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97027.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00015006CC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F0"
FT                   /transl_table=1
FT                   /translation="MPHFTSVAIGASIDGDEARFRANVTRFLVVGVVNGVLDFSNVFLF
FT                   ALAQSRVARRLRNRAFAATLRKNMAYFDARTSGKINSTVTNDTSAVSANLSWLLRSCVE
FT                   AVVRCVGVGAYLLFWVNFELGALALVVIPITSVVNYFYGKLLSANAESVQETLAKSNGV
FT                   AQETISNIVTVRSFANEPFERRRFGDAIDEWYEQSYRAAQLSGWYYSFMYSLVSACFVP
FT                   AAILYVGGGFVVDGSMHAEKLVATMLYSAILQEYFGNLLSSFTNLFAARGAAAELFKVL
FT                   AKNEREDDDADNGATLPIDDVKGAISFSNVSFSYPTRPDIPALSGVSFDVSPGEIIGIV
FT                   GRSGCGKSTVFALLQRFYTEFSGDITLDGARIETLSPNWLRRHCFALVGQEPVLFNGTI
FT                   LSNIAYARLGAGIDRERAIECAKTALIHDVIEDELGGYDTHVGERGCQLSGGQKQRVAI
FT                   ARALYSSPRVLLLDEPTSALDLEAESIVTAALRKAARGRTTIVISHTPVDSFVDRTLEL
FT                   SPRT"
FT   CDS_pept        complement(<530850..532130)
FT                   /codon_start=1
FT                   /gene_family="HOG000239858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685010"
FT                   /orf_name="OSTLU_46154"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97254.1"
FT                   /db_xref="HOGENOM:HBG318900"
FT                   /db_xref="UniParc:UPI00015006CD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F1"
FT                   /transl_table=1
FT                   /translation="MVLKRMFSRGSLGDLNERRAKKRSRTNPKDLRAPGRKFVIVTTAA
FT                   LPWMTGTSVNPLLRAVYLANGDTTREVTLLVPWLARKDQRIVYPKRVEFKTPSEQEAYI
FT                   MDWTKKRVGFAPKILIAWYPGRYATDKGSIVPVGDITLRVPKASRDVAILEEPEHLCWY
FT                   HPGARWTSRFKHVVGIIHTNYLEYARREEDGERKEQILRWINHLTARCHTHKVIKLSDA
FT                   VQEFARSITQNVHGVSNGFIDAGREKAKRIKKEGSGAFSRGAYFIGKCVWAKGYSELMH
FT                   VVGDFNEKYAKSAKERLEMDVYGDGDDFADVKAAVAEKALPLSLLGRLDHANEKILDYK
FT                   VFINPSLSDVVATTSAEALAMGKFVVCAEHPSNAFFATFPNCRTYSNMDEFAKCIREVT
FT                   TSTPKPMTDDEIHRLTWEAATERLLDAA"
FT   CDS_pept        complement(532352..534283)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008004"
FT                   /orf_name="OSTLU_32723"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="ABO97255.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI00015006CE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F2"
FT                   /transl_table=1
FT                   /translation="MRATSDATRASLRPVQAPRGAKRIDIDPLGTPKELLNDARALGFA
FT                   DPTLPRHIVTVALVTTPECAIELRTAASEVFVQDKFGALRMLKPRAKAFLKRGEVLFFA
FT                   WSKARGTRFGYVLDVGDGGGEDDGAKGAGGGRGAAEVIDIASEEDASGTPRRRREDGAN
FT                   ERAEEAAAAATRKTRRESSVHGKTSPSSTTTTTTSEGTRRSARNARKASAPEASAKDEN
FT                   VDDEDGDEVEDDVIEVENDDWTHAKRRREEGSPATASSSQAARQSRSNKDCPINWARAR
FT                   GYGKPNLPPREAETCPHDYAEPPRREEPSMWGGQQGREEARQQAEAARIPPCPPEGLPD
FT                   DPTELQNARTALKQAHRQLVSALNTEVAMRQTLAQCQLDFQRTMRGGADYALRQWHKDN
FT                   LQMVAGKYQQSQFAAAAARSSYQHALKLFHRTVERCEGLRTGADASASPAASPMSKQRQ
FT                   KPEEPTASAATKSRFDAECEAWDTLLSVDPTKMSIKDLRRCATDVGIDVSTLVEREDYV
FT                   NALTKKRDTGQAAFNEKKRKRDEERAAVEAKQRAKKASEEEDHAKRAAVHQVSIWAMHA
FT                   DLRLFLYRCGVSIDQHGRSTKRLLQKSYRQAMLKFHPDRARQKSIREQALANEVTKWLT
FT                   HAWQQLPP"
FT   CDS_pept        <534580..>535743
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685011"
FT                   /orf_name="OSTLU_3375"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97028.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI00015006CF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F3"
FT                   /transl_table=1
FT                   /translation="DSRVPVTILTGFLGSGKTTLLNHVLKAEHGKRIVVIENEFGEVDI
FT                   DGELVAFRESGDEDIMLLNNGCLCCTVRSDLVEMLMRLVKEKKGMFDHILIETTGLANP
FT                   APIIQTFYLEPALLDSLRLDGVVTLVDAKHAELHLDEVKPAGVVNESLEQVAFADRIVL
FT                   NKTDLVTDAQANALEYRLRTINDLAKIGRASMAKVDLDFVLGVGGFDLERVQDQVLPDE
FT                   PKKTEAHDHGHSHAAGEESCEKCDHDDGHSHSHGEEHSHSHAHSHGVEADADCEVCGEH
FT                   GHSHSHHVHDDAVGSVSLSLDGDLDLDLVNDWLGLLLNERWEDLYRMKGVLAIQGCDER
FT                   YVFQGVHALFEGMPDRAWKADETRSSKLVFIGKDLDRAELQRDFEACL"
FT   CDS_pept        535882..537048
FT                   /codon_start=1
FT                   /gene_family="HOG000265095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312931"
FT                   /orf_name="OSTLU_16199"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97029.1"
FT                   /db_xref="HOGENOM:HBG609958"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="UniParc:UPI00015007B5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F4"
FT                   /transl_table=1
FT                   /translation="MFASRARSIARAFTRARALIALACVARVALARADETAQDVDAHAT
FT                   WLRRELPRYRARAASCVACQRVLAHFDEHLVLALQDITNAERRKATSATGERRFDAARY
FT                   GAYESVIEEAVPRACATTSVALNRTLRVACERMIERSEDEVVKLYYEVGKAMERGEKEA
FT                   DLGEALCGANGAMGGACEDAETAAWTVSELEALETAAMKVSREDLNPWDTAPGHEGEFL
FT                   SEPEYAAPKKGEVARIVASDFYKRIILERDIDAVVYFSYPTKAKEFHEAYEQTHALLAE
FT                   VLEDAKDLIIAQIDVEKNDVPPPYADMATTPCVLLYRAKKKENPRWVPLRTEAGEYITG
FT                   ESAPTLADVLTMVSKNAKTKKTKREADKALVEASAEELHSNRAKDDEL"
FT   CDS_pept        complement(537058..537300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856503"
FT                   /orf_name="OSTLU_32726"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97256.1"
FT                   /db_xref="UniParc:UPI00015007B6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F5"
FT                   /transl_table=1
FT                   /translation="MSTQLQLRLAVICALCTLAHAATNEPRRALVESSITYAADTTGIS
FT                   RGQSISTSTTWNTFCEFILPFLLERGYTPPAHVCN"
FT   CDS_pept        join(complement(538574..539686),complement(537403..538497))
FT                   /codon_start=1
FT                   /gene_family="HOG000265096" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161270"
FT                   /orf_name="OSTLU_32727"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to mitochondrial inner
FT                   membrane"
FT                   /protein_id="ABO97257.1"
FT                   /db_xref="GO:0031305"
FT                   /db_xref="HOGENOM:HBG609960"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniParc:UPI00015007B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F6"
FT                   /transl_table=1
FT                   /translation="MAARGSGASASVGTTARAWIAASATRAARADALGRGYATKTTKTT
FT                   TKSTSGDGAATATARGGGKGRAKAKTGTGTARAAPAKAKTSRKKKPPIGKIRAVPHAAA
FT                   KKFPLHESVLGDPRTYKATMGDATAAARATARARATAAPPPTSGNRVMPHAKAATFPLH
FT                   ESVLAEAKSMATKGTVLREPLSKPAGAAATAPPAAANATPTEESGSNRTALLAAAGAGI
FT                   AALLAYSMSVVDEEDRPPPPRRAKPKAAAARKDVEVQIEIVKQPDAKELTNSKKATTES
FT                   KKDGKETAKDELSDAFSATADFLANVEVRNISYFCDAYSRGLILICRGFSVPRRTYQGP
FT                   TLNASLARTHANRASSAAGVLRLVALPRLVPVPQDEPDQKEPEVLAKVNVPKPPARENV
FT                   SIMNASKSLSAARLLEEAVKTLGETLSDDEKAALRDGMKVQSESDMKIFSELSSSMVQN
FT                   FETVVSAERSVTDELIAAINVLEQRAEDASRQLEREKERAVVDKERALKTQEKKLKAEH
FT                   ADFLVAERIERIKALDEERIRMGALRQVLTKRREALERAHAVQSFELAVMDFGSRVENG
FT                   EAFEDALALLNTCAKKDPFIATIIQGLDQDMAKRGVPTRLQLAEQLERVRDTARKLSLV
FT                   PQDGGGMLAHGLAYAASLLRVKDTSDEGAQGIEGAIAKAETHLANGELMHAAKSLASAA
FT                   EGTKAATSVTEWAHSVRSRAEVEQAQTALNAHAQCRASALV"
FT   CDS_pept        <539999..>540511
FT                   /codon_start=1
FT                   /gene_family="HOG000218325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16685012"
FT                   /orf_name="OSTLU_8062"
FT                   /product="Predicted protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97030.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG751055"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="UniParc:UPI00015007B8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F7"
FT                   /transl_table=1
FT                   /translation="VVAMAHPRRVQKVQQQMRREISSMMQSDKNLRAMISPEERMGVDH
FT                   MLSVMATVADVEVSNDLQVVKVYVSILGDERGKNNAIKGMKRMEQYVRRKIGRRMSLRL
FT                   TPEIRFIYDDSFERGQKVSALLDEIRLENRNKTAKKYGKDALMSVEDVIAERGEVEDED
FT                   ESEWGMDD"
FT   CDS_pept        complement(540691..541773)
FT                   /codon_start=1
FT                   /gene_family="HOG000230845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312932"
FT                   /orf_name="OSTLU_35770"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="ABO97258.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI00015007B9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F8"
FT                   /transl_table=1
FT                   /translation="MLERLEEQRHYVRAGAEHNANVNEVAYGGAYASVGKDFAFSAERF
FT                   RETFALTLTTSDEERCVFELEGCSPAFANAFRRIILSEVPTMAIEKVFVVNNTSVVADE
FT                   VFAHRLGLVPIKADPAMFEYRGEGDAANETNTIVLKMHVRCHKERNPDGTLGEVVNRSV
FT                   YSNALTWCPEGSQLPEENGAKYSDFKRSQKEVVGDQELGCVHDDILLVKLAPGQEVELE
FT                   CHCVKGIGQEHAKWSPVGTCWYKMVPEITILEPITGADADEFMKKCANFSETHKCYACE
FT                   GKGDKKTVKVVESRGCDFCVERVRELTGEPGWADKIAVRKRKDHFIFTIETIGQMAPGT
FT                   IFKEAVKILASKAQNVLSTL"
FT   CDS_pept        join(542907..543785,543822..>544595)
FT                   /codon_start=1
FT                   /gene_family="HOG000008047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685013"
FT                   /orf_name="OSTLU_35638"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ABO97031.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG756596"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00015007BA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0F9"
FT                   /transl_table=1
FT                   /translation="MDPEAIQTYVYPAQISRRDYQFDMARNALLTNSLVCLPTGLGKTL
FT                   IAAVVMYNYYRWFPTGKIIFMAPTRPLVDQQMSACHTVVGIPASDTIVLMGSTKKDDSG
FT                   SRRDFWREKRLFFCTPHTVANDLESGDLDAKQIVCVVVDEAHHARGQYASAEVLRLLHE
FT                   RKVRFRLLALTATPGQGLDEVQKVVETLRIGRIDFRSDQDPDVSRYTHKREMTVEKVKP
FT                   DQAMSHVQDMLCELLRPCCAQLVNMGALGEAGFRMLTFIKNKATNGASRVEPPAWFTLQ
FT                   SAQQAIYRNQHQTAMELSKAYELLLKYGAKSAYDYIDKRGRDKSNTLVHRSDPVSVELV
FT                   DLIRSMSSNGAHHSPKLDRLTSILKQHFRDATADTRVIIFTSYRESVKDIVQALREVPA
FT                   GEDTACKIKVAEFVGQGDTGATGKKRAPGATSRGTKGQTQKEQKQTLDDFRAGTLNTLV
FT                   ATSIGEEGLDIPSVDLIFFFDVVDTIRAIQRMGRTGRARDGKVVILATEGKEYAKFTSE
FT                   QKKYETLMTCLRMPETHFRLDKKCPRIVPDGVTP"
FT   CDS_pept        complement(546484..547875)
FT                   /codon_start=1
FT                   /gene_family="HOG000265097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685014"
FT                   /orf_name="OSTLU_24833"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97259.1"
FT                   /db_xref="UniParc:UPI00015007BB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G0"
FT                   /transl_table=1
FT                   /translation="MRGAFEGVRGGAWGAGAPMPTVPIAHARAPAHATRFVAVSGLGLV
FT                   AVLSTARAADSIVVVAEILDDEMREALIATRRDAMKAMREREMAMCAAMEASRVAAGML
FT                   MMRGAGSASPTRIGKPTRRGATRRSTSKRSSPKKSHTSGSGRTVMGCSSSPSPGTSSPD
FT                   TAPPSPSALPQPSFADSAAEEEYPALPKPLPATPSIALAPSQKQDKLPLPPLKWIDIAT
FT                   KPKHTAKGKGRRFIRRRVERVEKAHWELTLFMSNSHESLDARCEDATKALRDIMRQYQR
FT                   NRLDHDVGLETHKDVLHSVIDHPNSPMYHSCACEEALKLHTDIDGIVGYDFFAETCSCE
FT                   DCLKMYVYLLCDRQCVCPKCFNEATKEGHERAETARRLFASSDDATNVPEKWSDIATHF
FT                   GRLSSQRTLRHIEELLQRLRKPVLALPPTPPSRRRRKPPPKIELHLDGATAPLGSLPPS
FT                   SPSAA"
FT   CDS_pept        <548694..549119
FT                   /codon_start=1
FT                   /gene_family="HOG000198084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685015"
FT                   /orf_name="OSTLU_93050"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97032.1"
FT                   /db_xref="HOGENOM:HBG611621"
FT                   /db_xref="InterPro:IPR008689"
FT                   /db_xref="UniParc:UPI00015007BC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G1"
FT                   /transl_table=1
FT                   /translation="LSDASHKELMALQKAVADMRDAVARAAYKGPEPDFAAMRKDTKMP
FT                   EIVDEFEKAYKGVTKPDAKSPEIEALRSSFVEIEAEAKAHAEHATKRIAELDLELKAIE
FT                   EQRSKLGSITMDEYFQTNPELKKKIDDRIKNDQWFEV"
FT   CDS_pept        549254..550666
FT                   /codon_start=1
FT                   /gene_family="HOG000256695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856504"
FT                   /orf_name="OSTLU_35218"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="ABO97033.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG387011"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI00015007BD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G2"
FT                   /transl_table=1
FT                   /translation="MATSLDEPARGRTSGVDSTSNARLNSQDVEERSTERADSRSALTA
FT                   VDRARGRAGVARESSQPCRPRAVRFATTMPNTITHSIMLARGWSEVSPTDSNWDLFYAD
FT                   VGWIHENVPYKSGAHMAEHQRVNHFANHVELTRKDLMAKNLNRAKRQAAKKGGTEAAKC
FT                   FDILPLTYVMPHEALMMQRAFRDHGGLWIMKPIGRAQGKGIFMVHKLSQITKWLAEREK
FT                   SGAENICIDNYVAQRYISNPYCVGGRKFDMRLYVLVLSYRPLRAYLYREGFARFTAARY
FT                   TCDKESLGDEMVHLTNHSVQKRDANYDASKCDLRWSARSVRQYIAAKHGTATSDALIEE
FT                   ITKLIINSLLSVAPVMINDRHCFEMYGYDVMLDENLRPWLIEVNASPSMSVDSASDRAL
FT                   KTALFEDVLNVVDMEKQFDRTSDTAKRVGGFDLIHDGVVVEENLRLLGALNDDRESSLA
FT                   RTQMVYDEKMAM"
FT   CDS_pept        join(complement(551176..551220),complement(550919..551114),
FT                   complement(550706..550851))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312933"
FT                   /orf_name="OSTLU_32734"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97260.1"
FT                   /db_xref="HOGENOM:HBG609963"
FT                   /db_xref="UniParc:UPI00015007BE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G3"
FT                   /transl_table=1
FT                   /translation="MSGAARWTGGAAAAEEDRAKLEDFERRVDPNDKEQMDLLEQMKQH
FT                   TEKLEKMREFEDPRLSFTTPEFKEAQRIFQENFKAKKLWQTDRVWDGETIPVERADVDE
FT                   TRRARRRGRESLAARRRRETDFEG"
FT   CDS_pept        551486..552631
FT                   /codon_start=1
FT                   /gene_family="HOG000265098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685016"
FT                   /orf_name="OSTLU_93051"
FT                   /product="AEC family transporter: auxin efflux "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97034.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG559766"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI00015007BF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G4"
FT                   /transl_table=1
FT                   /translation="MVRAGAQIFFASVRAVLEIFCVGAVGVLGARRGWLDRKTCKTLST
FT                   FNGNFFLPALLWVSLSRSVSASALRKLWLLPVTCVAHVTLGLALGLGVVRWAPVKPGFR
FT                   TVALMSSGFGNSLALPVVVARAIIKNPRIGNLTFTSDDNDRAVLYLSSYVVVLSGLMWT
FT                   LGPFLFRRRVAAKVSLEGGDGGEMSEQAERDRTLMRQRSFANRTLDFTRTFFNPAIASC
FT                   VLGVATGMAPPVRDIIFNPGRALSWIGGSAEMLADAAIPSILLVIGASLAYGPDYSLAD
FT                   RKTSLAIVGVRFAIIPFFTIGLYYAFRNVSGIAPDDKTFWLVFLMLGTTPTANNMMLQA
FT                   QMFHDDDRAGAGVGTLLFWQYLACPVFLTAFVSWYLAMIDR"
FT   CDS_pept        complement(552711..553460)
FT                   /codon_start=1
FT                   /gene_family="HOG000265099" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161271"
FT                   /orf_name="OSTLU_12738"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of cytoskeleton "
FT                   /protein_id="ABO97261.1"
FT                   /db_xref="GO:0005200"
FT                   /db_xref="HOGENOM:HBG609964"
FT                   /db_xref="InterPro:IPR008374"
FT                   /db_xref="UniParc:UPI00015007C0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G5"
FT                   /transl_table=1
FT                   /translation="MTSRAATKLARLNERFQSFYGDLEQEKTHRRALESDRMHAIEGRL
FT                   DALEGELKRASEAEKKARAESAGRLERMLRETEATLSARATAVEERLSASVTALTTAIE
FT                   SVHEALSAEKEQRTMEVETMTTSLSRRVEDFGAALDDERLARLEREAEMIARVGQEVNE
FT                   LRTKVEAERNTRESAVGKLASVVEEVRHQSAAGEGDFHAVVLEELGTLKLGLQKERAER
FT                   MEEDELIVQAVGEYSKTIQNGLRIANQ"
FT   CDS_pept        <553703..>554359
FT                   /codon_start=1
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685017"
FT                   /gene_name="COX11"
FT                   /orf_name="OSTLU_7271"
FT                   /product="Cox 11/CtaG family of cytochrome oxidase assembly
FT                   protein-like protein"
FT                   /function="copper ion binding"
FT                   /protein_id="ABO97035.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="HOGENOM:HBG525908"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="UniParc:UPI00015007C1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G6"
FT                   /transl_table=1
FT                   /translation="AATRAVTHRARPSTSARGFAASANAPKRPRGADADDANADFAKYL
FT                   FALVVGVVGATYASVPLYRMFCQATGFGGTTRRATLEDKLKSDAWSEARRDEARGREIT
FT                   IYFNADVAEGMPWRFTPTQKSIKVRPGESALAFYTAKNLTKTPVTGVATYNVQPNKCGA
FT                   YFNKVQCFCFEEQRLRGKEEVDMPVLFYIDPEFASDPNMRDVKSLILSYTFFKSDD"
FT   CDS_pept        554566..556119
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161272"
FT                   /orf_name="OSTLU_32738"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97036.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00015007C2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G7"
FT                   /transl_table=1
FT                   /translation="MTTVPEASSPRPGDALDALRAQLTCPLCRDVFTDPTTLPCNHTHC
FT                   FECVARALGGKSWDASACPECAAPTVMKDLSVNMTLKSFVENFKSVDAELREALGAMRE
FT                   LGGTEAMDCDGDDGDDVGAGDRGGTLADGGVMEGDDAREREAKACEKLAETIRAIDATL
FT                   AVIDKKLAVYKAKDEALESHTQPRTQTQPGTQGTLDIESMTLSELRRLYRNVLGRSAAS
FT                   TRKKPWFVKELSQYDRDVMAAAMAATQPESPKVVVAYSSSALRCGGSQDEKFAEVERVI
FT                   KSIDAGAVFMGMKDLTSECTHLIMDTGSKDRVVRKRTVKYVDAIARGLYVVHEDWLADC
FT                   AERGSFSNEEAFELKDGTGTGSDGASHSFADGPRRARVCRETNQRRLFEGIRVRVQCCG
FT                   DALPASALENILRLAGAIIEPASPKTPRRSSRRHSSAVRDHDAVPDSEDEADDSRETDS
FT                   VVEDVAGDGEDEDDVVVTLVDDLTPRSTFKSISKPVNWKWALECVTRWELLPTLKWLKR
FT                   "
FT   CDS_pept        complement(557835..558551)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312934"
FT                   /gene_name="CYN21"
FT                   /orf_name="OSTLU_32742"
FT                   /product="Peptidyl-prolyl cis-trans isomerase, cyclophilin-
FT                   type"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ABO97262.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI00015007C3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G8"
FT                   /transl_table=1
FT                   /translation="MRVCTLDDGVAVVEGAFPSAVDVDGCYWEKELERVTVTLEKANRY
FT                   DAWEKVLESDLPPPGDVTVTCKCYFDVSVNGKARGRIVFGLYGKHAPKTVENFRALCTG
FT                   EKGLSAKSGKKLTYEGSCLHRIVKGFVCQGGDFTLQNGQGGESVYGEDFDDEAFGISHD
FT                   DAGVLSMANRGPNTNGSQFFITTAPAPSLDDKHVVFGRVLEGMDVVAACEAVGTESGQP
FT                   LGQVAITACGELQLSD"
FT   CDS_pept        join(complement(561397..561504),complement(559725..561263),
FT                   complement(558840..559661))
FT                   /codon_start=1
FT                   /gene_family="HOG000196946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161273"
FT                   /orf_name="OSTLU_35422"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97263.1"
FT                   /db_xref="HOGENOM:HBG317989"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="UniParc:UPI00015007C4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0G9"
FT                   /transl_table=1
FT                   /translation="MQRADARDADPARAARWLDEAKASVKEHAFRMKRAADEDNLREAL
FT                   KCASLMLGELRATTPAPRGYYELYIAASDELMHLRRFFGDKSRHGRSCVELYELVQHAG
FT                   NILPRLYLLITVGATYVELGEGSARDVLMDLVEMTRGVQQPMHGLFLRAYLSQMSKGLL
FT                   PDKGSRYEGEGGNIDDAVEFLLQNFTEMNKLWVRMQHIGPSNGKKRREGEREELRDLVG
FT                   KNLLALSQLEGVDLQLYRETVLPRILEQVVNCKDELAQPYLLDVLIQVFPDEYHLATFE
FT                   EVFSTMSMLRANVRVGSILNALLGRLLSYAEETPEAKSEFEAADVFPKSFECCQAIIGA
FT                   HDDVPAKEIIGMYAALMAFARKLQITEAGTLDDILLALANSLQSKLPITDPEVAQQLST
FT                   LLSDPLESCELSVVLSLKSYPKVIALLDEDTKKKVALGVVQTLVKNRSTLTTVDHVKML
FT                   YDFIDCVVSADAKEASQAMEDVEKERSAAIAEEQNVVARVVHLIKAPEDNHELQLEMLN
FT                   TAYDILLKGGPRRIRHTFPALVFAGIACGRDIVPADANNDDKEAISFTTPIEVKSPWLK
FT                   KSLHFVHKSITALTEVAGRHEKALKLFLEAAQLAAVANLESIAYEFFERAFVLYEENIT
FT                   DTKKQVNLLFIIIGTLHKVNVFGADSRESLVHKTTGYSARLLKKPDQCVGAYTCAHLFW
FT                   TETVKDSDSVASCLKKSVKIANAVRDTFGGNAANRIEALGLYVGILNKYLYFYDKTPEG
FT                   CTSVTVEALQALIDMINTELSSVGDVRNAESIGALRDVEQSYANTLTHIRQQKHKVEDG
FT                   TADRYSTLVV"
FT   CDS_pept        561942..562586
FT                   /codon_start=1
FT                   /gene_family="HOG000243517" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685018"
FT                   /orf_name="OSTLU_32744"
FT                   /product="Predicted protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="ABO97037.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG670413"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00015007C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H0"
FT                   /transl_table=1
FT                   /translation="MAMLFPLCWVFDRTRRSALSFCNDVWATVSTALFFPIVVEGREHL
FT                   PRHDEAAVYVANHASFMDIYSMFHLRRPFKFISKTSNFLIPVVGWSMFLTGHVPLKRME
FT                   RRSQMETLKKCREMLADGGSVLFFPEGTRSATGKMAAFKKGAFSVAAKENVPVIPVTIV
FT                   GAHEAMASGKEYELHNAGIKVIVHPRIQSTDADDLCARSEKIIKEALVNNS"
FT   CDS_pept        562820..564541
FT                   /codon_start=1
FT                   /gene_family="HOG000265100" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18312935"
FT                   /orf_name="OSTLU_32745"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97038.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559756"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00015008BD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H1"
FT                   /transl_table=1
FT                   /translation="MPLPLDVTARVAVARAVSDVDARAVVAFALAFALVVALVVVARAR
FT                   RVLARANVAAVRWRPKFLWRLYQRSARSLLRRVEDRFSRTARDGGGSGRRAFGAVVGAC
FT                   PFVHVGEAKLARDVLRGTTVKSPLYHAFEAFSGTGIFTAEGEDWEGKRGEVLRAFHAVG
FT                   LQALRDRAVEESARIVRGMKLELERGGTREMETLALPTLQRLALRVTFGYLTGNSLAEA
FT                   CAEVGRAQADVESEYLAAATTLRHLIPARARSIWIFSDFLYGLTPVGRLEAKNIRTTRM
FT                   LSSLALRTAKKDSPLGMLRGGEMHLRERAVRVGDDEFPKGLLDETTTLLFAGHDTQSAT
FT                   LSWGLLRLVDNEKIQNELRVSLFDDVIVEALGLPSKRRKKRASSDGKKAAWATSAFAPM
FT                   LESVIRETLRLHPVAPLVVRMLSADVSSAEMTIPKGCAVGVWLSSVHRDDAVWDRPEEF
FT                   DPKRWTATSHARTGSTGSFTEDSEEDSSLGPASGKPASGLKHKGVGYMPFAYGPRSCVG
FT                   QHLAQVTMRVALAHLIEAFEFAPSADVDASTPSVGFTVTPSTGAPLRIRLATKIDP"
FT   CDS_pept        complement(564671..565225)
FT                   /codon_start=1
FT                   /gene_family="HOG000265102" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008005"
FT                   /orf_name="OSTLU_93054"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97264.1"
FT                   /db_xref="HOGENOM:HBG609966"
FT                   /db_xref="UniParc:UPI00015008BE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H2"
FT                   /transl_table=1
FT                   /translation="MASARCANARELACGRASSNRVASRGRRAVCAPRRAVESSGLSEI
FT                   VTLDSGIKAGFIVFGARVAALGLGKAKQGSDVDRALEDCAARGIDVSDLYYAEDQGEQR
FT                   WYLVGNWKVPRAGDAKYGDGRMSQELKSRVRYHDAKAVADEAGVSYVDIDEHTALYPTT
FT                   PKRALELRRRLTAAGFETKWD"
FT   CDS_pept        565270..565926
FT                   /codon_start=1
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161274"
FT                   /orf_name="OSTLU_12740"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97039.1"
FT                   /db_xref="HOGENOM:HBG591261"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI00015008BF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H3"
FT                   /transl_table=1
FT                   /translation="MVLYYTPADAATTGHVIYVGRDKVENEDLIKYGLEHDVWFHVDKL
FT                   SSAHVYLRMRPGQTMDDITAEELRDCAQLVKANSIAGNKQNDLHVIYTPWGNLLKRGDM
FT                   DVGQVSFKDESNALVRRVKVKTRDNEIVNRLNKTKVEAYPDLHAEREAFEESVRQAKKE
FT                   AYRIEEAKRLEEERARKADIEARDYKHIMVDEKMKSNKEMAKKYESYEDAEDDFM"
FT   CDS_pept        complement(566114..567355)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685019"
FT                   /orf_name="OSTLU_32748"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ABO97265.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00015008C0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H4"
FT                   /transl_table=1
FT                   /translation="MSGEGGFDDANYDRGMEELLKDDQDENGEGGITEWTEVHETFDTM
FT                   NLQENLLRGIYAYGFEKPSAIQQRGIVPFSKGFDVIQQAQSGTGKTATFCAGILQSLDY
FT                   SVHECQALVLAPTRELAQQIEKVMRALGDYLQVKCHACVGGTSVREDTRILQAGVHVIV
FT                   GTPGRVYDMLRRRALKSDSIKIFALDEADEMLSRGFKDQIYDIFTLLPPKVQVGVFSAT
FT                   LPPEALEITRKFMTKPVRILVKRDELTLEGIKQFYVNVDKEQWKLDTLCDLYETLAITQ
FT                   SVIFANTRRKVDWLTDNMRARDFTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDLLA
FT                   RGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTAEDERLLQDIQRFYQ
FT                   TVIEELPSNVADLI"
FT   CDS_pept        <568166..>568729
FT                   /codon_start=1
FT                   /gene_family="HOG000151758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856505"
FT                   /orf_name="OSTLU_8148"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97040.1"
FT                   /db_xref="HOGENOM:HBG289809"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00015008C1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H5"
FT                   /transl_table=1
FT                   /translation="LFTGLVQGKARVESFENLNDEFARLTLRFPGNALEGISLGASVAV
FT                   NGTCLTVTAVDGDAASFDLIVETLRATNLGKLIVGSEVNYERSARVGDEIGGHTVSGHV
FT                   HCTAEIVEVVDSEHNRKVVFETSDRALIKYVLPKGFIAIDGCSLTVGDVDKATGRFNVW
FT                   LIPETLRVTVFGAKSIGDTVNVEIE"
FT   CDS_pept        complement(568905..570092)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008006"
FT                   /orf_name="OSTLU_32750"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ABO97266.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG609967"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00015008C2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H6"
FT                   /transl_table=1
FT                   /translation="MGGHARARAAPGDFLGAKPSTRDFALEDLFRVDFASGDEGEGEGE
FT                   KRATIDGGREGDAVRAAATREAREGRAAADDWDALARAWDEVEARAPARDYAWEVLNSL
FT                   PSVGGDIMTCKEDEMDCFAYGGAHSVPYIAPEWLERPNGDVEDGVSDNEDEDEDEGDAH
FT                   RFTKAMRESSSFLLDDEDEFMRTVDAPVDFITEPEAFAARREARALARDAREPAIDFAV
FT                   KSALLCGDEEEDDFSGQDCSAMADESAYEFQEHFATAADGRVFRVSSALVTPSSSERAN
FT                   VEDSANHRGLTDSEDSDADLVAHSAKKSPKLIAGSTTKRKRRPDGRGRRAKAYKKIKKD
FT                   KGVCATDVYVMANGKKMRRGCLHCGTVKTPQWRMGPEGKKTLCNACGVRYMKGIL"
FT   CDS_pept        571156..576612
FT                   /codon_start=1
FT                   /gene_family="HOG000265103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856506"
FT                   /orf_name="OSTLU_32751"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97041.1"
FT                   /db_xref="HOGENOM:HBG381444"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="UniParc:UPI00015008C3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H7"
FT                   /transl_table=1
FT                   /translation="MGDGSSKGDVDAQRLASVASTAEAMEELGYACAHAKDSLIEILGK
FT                   LPKLDDAGLAKVVGMIARTSSGKLETSRGEAALVSLAKSAGIAAPSAEALRLTTWNGDV
FT                   VVDAVNATYKDLNWENAMEKLDQPEFGCPDASSFQLICDMYSRATGKSFPAKALCAAPW
FT                   GKNQAGQIEALRQLLGSPQESCDWGSLKHVDVEGTLAGPWGCLDLMSTLCSLSETGHRD
FT                   AARGALEPGAGRSPETVCITLAQVCDEHNALARDAFGALLPPYVATSHPKSGLVLSNVW
FT                   GRHSVAVIRAMVDAHTSSPAAADRIFDVCQELNALQVIIDRSPFPLAIEMVSIASVRAG
FT                   VNLEQWLQEKIKANGGAFVSACMRFLRAKATQEGGDKGATPLKPEVLQTFLKVLQGAQQ
FT                   TMPPDLQAELRQLVAQIQNSPNKGRDSSAASDDLSVQAGTAQGFTPDVEEEANRYFQRV
FT                   YSMQQSIGELVEVLRAFRVSQVQRERDVFSCMVHNLFDEYKFFPKYPEKELRITAVLFG
FT                   QLIFHNLVSNITLGVALRCVLDALRKPQGSKMFAFGSDALEQFKRRLTEWPQYCQHLAQ
FT                   IPNLAQAHPDLLHLFSKGNDQTVALGRSEPSMNTAANADAQLAAGVAGMRIGGGDSGGE
FT                   GNHPPLPRSLSSGMNLPPQPPGPPPAGESAPAPAASRLTTRGMSTPEIGQIARVSSGGQ
FT                   IAAAASGAPSGFATSLNIDTLVAASAEAKQPDAATADKVHFLVNNLSAENMEEKAAEVK
FT                   SKVSADLYEWFAGYLVVKRASIEPNYHALYLELLEKVGDKNLYAAILQATYRNIKVLLS
FT                   SGKVKTNSGERSLLKNLGSWLGQLTISKRKPVLQRDLDLKELILESYESGRMIGVVPFV
FT                   AKVLEPAKDNMIFKPPNPWTVAILSLLCEIYNERDLKLNLKFEMERLFKHLDVNIKDIE
FT                   PSMLLASRMRERQNNPDFVADKNFAAPVPLQSAASEGSLQQHGVVGRSMDEEEKTRLQT
FT                   QSLEGALPNMQAHVRVAAAPNLPESTRAALLRLLPVALTQGIREIVAPVVERSVTIACK
FT                   TSQELVRKDFATEADINRVRKAAHLMVSSLAGSLALVTCREPLKASVANQLRALLQQSG
FT                   AGAGSEASALEAAVQSATVDNLELGCALIEKAASEKAIRDIDESLAAAVIVRQKHRESG
FT                   INQPFFDAAIMQGRYPAALPESLRPRPGQLPTAALRIYDDFAQLPRAPSGPPPPSGAPP
FT                   AFARQPPFGQPQPPPPPVAYPGMPPPPPPGAPPPLPPDVPSEGVADGAQDAGKDSAKGP
FT                   PSGAHPHGQPDPAGLREKVAAHFDEWARVQDLPVTDAANVAFMQRLVESRLLAEDTQER
FT                   FLRILVELAVTHCLGSEVPSATPQASSQLSFAAIDAYVRLVTRLVRRQEEPLASRLAFF
FT                   GRALVAVVRTAMRDTDERNVAFNARPYFRALAGLLNEMHAPDNALDSSHPQVLAAFASA
FT                   FLALQPLRVPGFAFAWLELVSHRCFMPRLLIDHEQKGWPLLQRLLTAILRFMEPHLRTA
FT                   DLSEPIKLLYKGMLRMFLVLLHDFPEFLCNHHVNFCDIIPPNCIQLRNLVLSAYPRNMR
FT                   LPDPFTPNLKVDLLPETQQAPRINADADHAFRSSPMREEVDAFLTTRKSENLSQQLIHR
FT                   LMLSPSAALAAGTKYNVPLINAFVLYVGVQAIQANRSKDASSGIAQSAPMELFSQLIES
FT                   LDMEGRYLFVNAIANQLRYPNCHTHYFSCVILFLFSEAKFAIIQEQITRVLLERLIVNR
FT                   PHPWGLLITFIELIKNPRYNFWGHAFTKCSPEIERLFESVARSCLPQQDKEGVPKPSPV
FT                   PAS"
FT   CDS_pept        complement(576778..577716)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685020"
FT                   /orf_name="OSTLU_32752"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97267.1"
FT                   /db_xref="UniParc:UPI00015008C4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H8"
FT                   /transl_table=1
FT                   /translation="MDAGDDYSEFATRRGAKANGRAATAGDGRGTRFRLWRDDGDDDGR
FT                   ARRWAGDLDSAGARSGGIWEVGGKATRDARRDGEGVARALDFDDDDGGGWEGAAASTTT
FT                   SCASSTSRLRSARGDDDVAVFDEEAARDEAAEAEAEDDEARGALRGALDAVDLASRNAI
FT                   SRRFDVESVKELARECARARRAAGVRDLRFVDDADDELARESRLEEARAKCRAKVAEAE
FT                   ADFLRREAEEVKEKYISRYGDAGRAWVASLSARVDEWHADCAQKLTTVATSPRYADVDS
FT                   SGAATLAATKWLHLLDASPTKRRRSLAARED"
FT   CDS_pept        578692..580140
FT                   /codon_start=1
FT                   /gene_family="HOG000278604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856507"
FT                   /orf_name="OSTLU_32753"
FT                   /product="Predicted protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ABO97042.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG703946"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI00015008C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0H9"
FT                   /transl_table=1
FT                   /translation="MEALKDGGVGGRGTRKSREAASTRRDFRARDARCVVLAGGADETN
FT                   PLTRGRARSAVHLGGAYRVIDFPLTNLINSGMRQVYVLTQYNSHSLVTHVNRAFPMEMF
FT                   GNNNEGFVEVLPTSQTREHGETWSMGSADCVARHLTHGSLTKHSFDMRLEDECLQRHGS
FT                   LEACAANQTDGITIVLAAEQLYTMDFNKLLEAHLKSEADVTVATCDQVTAENASRLGIM
FT                   DVDEHTSSILSFIEKPSADQLLEFMQCSTENELLECKLNANMGVYVFNNSALEELLRDS
FT                   KNPAEERHEFGRDIIPHAVNAGYDVRSYKHSGYWKPLRTLADIYEANISVATGGDAASL
FT                   IDFDRLVYTKPNFLPPNTFYGSSLTERSIISDGCVIRDGAKIINSIVGPCTVIDKNVDL
FT                   EGVVVVGRDEILKRSGGDKVADIGANTIIRKCMVDSDAVIGANVRILNEAGIQELDRTE
FT                   DGYIISEGIVTILGGAVIPDGFTI"
FT   CDS_pept        complement(580350..581423)
FT                   /codon_start=1
FT                   /gene_family="HOG000265104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856508"
FT                   /orf_name="OSTLU_32754"
FT                   /product="DMT family transporter:
FT                   phosphate/phosphoenolpyruvate"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97268.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG610285"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI00015008C6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I0"
FT                   /transl_table=1
FT                   /translation="MSALKALAREIAGRPSSRAPSAELTRALYTLKATLYLLAWGTCSG
FT                   LIILVNDAVLNRYDFPYPIAVSATGPLLSWMIAAILVLTNSVKLERTLSLKEWLVTVFP
FT                   IGFFTAVTFAAGNQLYLYLSVSFIQMMKSLSPCVVFLMLVVVGLDTATKEKVIAVGTMT
FT                   VGMAVACATEETFTVLGLSLMIIGEGAEAMRMVLFQHFMGNRGFGLLEGLFYTCPANFF
FT                   FLSVGVAIFEQREITLRGDLAIVRANPWPFVAVSVLGFLVMVTTLGVIKTCGSLTFKAA
FT                   GQVRNVAIIMFSVVFMGEKTTPVQLVGYAMNVLGFAYYQKYKTDEDVSKITASSDGEVE
FT                   REKLLDSPRSSNGSADL"
FT   CDS_pept        complement(581649..582059)
FT                   /codon_start=1
FT                   /gene_family="HOG000243306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685021"
FT                   /orf_name="OSTLU_32755"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97269.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00015008C7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I1"
FT                   /transl_table=1
FT                   /translation="MDEDLPRAHIKRLVKHKLSTLDNVDAKGQSFEPNIQKEALTAYGE
FT                   CAKIFIHYLTATANDVCRDHKRSTISDADVLAAIEECDFGELVDDVRATLDAFRDAKRT
FT                   KKARDAEAKETRDEGDDDEVEKRDDGGGDGAA"
FT   CDS_pept        complement(582212..583936)
FT                   /codon_start=1
FT                   /gene_family="HOG000265105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008007"
FT                   /orf_name="OSTLU_32756"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97270.1"
FT                   /db_xref="HOGENOM:HBG561986"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniParc:UPI00015008C8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I2"
FT                   /transl_table=1
FT                   /translation="MGSSDDAKSRDARERTNNFIRIQHSAHIPVGMNFLRDAALEMIPE
FT                   GDRGAVGDVIRMVRSLFHYGAMEKRDRVKKDFALANVKVGEEKSVGYDGARLNPTAFEA
FT                   ASVDFVGQFCTMMADAEYTLLTQKEWELASAEDFLFTLPVHVDWSCHDKALLKTFLSKN
FT                   PALAAGLSQFSERALVFKRGTGLAKAKGLFIMQKIEMLLSMLIKEPLLAILGQKQPVFV
FT                   NANSSDSKKTFGDGKTVEDRNASVIERLTLRRLMPNIFVLFRKLFSTLEIQEPTFKEVV
FT                   LLYRMARPLDDDAAGPSGCGPLIIKSYVDIPMADLEMIFPEKTVSVKLQEMIQNGIAIV
FT                   VAIGTLLWAFVTGEIWTKKMQTLLIACAGKLGQSYTAINVARTRYSGMMAKDLIQKSRN
FT                   AQEGMLMHLLESMEDQEIKEMMLAFVILTVRGKSMTLKEIDIECEDFLRNVFGVDCDFD
FT                   IEGSMIKLLREGLVEQRAGVLYAATPLKTALALLDNKWDNIFDYNVDAVDGGREDALAR
FT                   YANLHPDTVEASLRDALNSTDKERAKVVNDLKAQNDVLTKEVGELSNSLKGFNWRYS"
FT   CDS_pept        complement(584222..585388)
FT                   /codon_start=1
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312936"
FT                   /orf_name="OSTLU_35655"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97271.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI00015008C9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I3"
FT                   /transl_table=1
FT                   /translation="MPPSRAPARFTGAKDFRARILISVLSGKPCVIRDIRVKTAARGGG
FT                   DDAVGLRDYEVSLLRLIDKLTNGTRVDISEDGTAVRFDPGVVKGGRALTHECATSRGVG
FT                   YYVEPTLALGLFAKKPIELTLMGVTNDDADVSVDVFRTVTLPMLKKHFGVDDGLALEVE
FT                   RRGCPPNGGGRVRLTLPIVKTLPTLDWCDEGLVKRVRGVTFTCKVSPQNGNRMVDAARG
FT                   VLNAFIPDVYIFTDHHVGPEAGKSPGYGLSLVAETTTGCVLGADAASTACASAMSEAAD
FT                   LEWADDAEARVPEDVGRRVAEALVAEIQRGGVVDSTHQSLALILLAIGPEQVSRIRLGQ
FT                   LTPRAIETLRALKAFFGVTFHVQPEPESGTVFCSVVGVGLKNVARRST"
FT   CDS_pept        complement(585593..586231)
FT                   /codon_start=1
FT                   /gene_family="HOG000262754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161275"
FT                   /orf_name="OSTLU_32758"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /function="uracil phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="uracil salvage"
FT                   /protein_id="ABO97272.1"
FT                   /db_xref="GO:0004845"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006223"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="UniParc:UPI00015008CA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I4"
FT                   /transl_table=1
FT                   /translation="MLVLVPPHPLLKHWLGVARNVQTPTPIFRAAMAEIGRILIYECGR
FT                   DWLPTFEAQVQGPLAIADVEFVNPEKPVAVVPILRAGLTLLEESASVLPSSVTHHLGYV
FT                   RDEKTLEPKMYLNKLPASFAEDAQVLISDPMLATGGTIVAAVEEIVSRGASPSNIRIIC
FT                   VVASPPALTQLSERYPGLRVYAAMIDEVLNDDGYVVPGLGDAGDRAFGT"
FT   CDS_pept        586578..587405
FT                   /codon_start=1
FT                   /gene_family="HOG000218563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20856509"
FT                   /gene_name="CMS"
FT                   /orf_name="OSTLU_24843"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /function="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase activity"
FT                   /biological_process="terpenoid biosynthetic process "
FT                   /protein_id="ABO97043.1"
FT                   /db_xref="GO:0016114"
FT                   /db_xref="GO:0050518"
FT                   /db_xref="HOGENOM:HBG672839"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="UniParc:UPI00015008CB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I5"
FT                   /transl_table=1
FT                   /translation="MLSRRATVIAPARAAPESARRVARTRARRGANVRTRAASEVTQDV
FT                   ADGAVSFVLLAGGVGKRMGADMPKQYLPLMGTPIALWSLRKFAKMAEVGEIVVVCDPSY
FT                   DDVFQSEAIDKPLVFARPGKERQDSVYNGMQAARAGAELLAIHDSARPLCAATDARRCF
FT                   NDAKKYGAAVLAVQSKATIKEVNKDLSIDKGLDRSRLWEMQTPQVMRPELLRAGYDLVN
FT                   SKGLEVTDDVSIVEALGERVQVTPGSYFNLKVTTPEDMFIAERLMTEQGDAVA"
FT   CDS_pept        join(complement(587816..588249),complement(587693..587699))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008008"
FT                   /orf_name="OSTLU_16225"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97273.1"
FT                   /db_xref="UniParc:UPI00015009B0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I6"
FT                   /transl_table=1
FT                   /translation="MAYKMVGRSRAGLALALALALAALAASQDTDGTNFVGSSSVVPDD
FT                   SATTPDDTIDPLNAEAIVTLTMIEDPFRLDGADWSESSMDDASRDVTVDDATVLEVLDL
FT                   AFHGGSTITSHEHFPRRFGPRDIDFVTSFDVEPFGIVDRRCE"
FT   CDS_pept        complement(588524..589039)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856510"
FT                   /orf_name="OSTLU_32760"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ABO97274.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00015009B1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I7"
FT                   /transl_table=1
FT                   /translation="MSDDDDDDGAPLCCGEILARVAIDGHDALRLLTIDCGGDAPLKIA
FT                   TNAPNVDVGKKIVVARAGATLRDGTRVTARRVGGVVSEGVVCDSTMVGWSGGGAGTAAL
FT                   LPRDHAVGARAPKTRPRLDGKTTDEGARDAAARETQKAREREEKKAALAAKRAARDAKK
FT                   AAKKDGES"
FT   CDS_pept        589242..593498
FT                   /codon_start=1
FT                   /gene_family="HOG000265106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856511"
FT                   /orf_name="OSTLU_16226"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97044.1"
FT                   /db_xref="HOGENOM:HBG609971"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="UniParc:UPI00015009B2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I8"
FT                   /transl_table=1
FT                   /translation="MAVGTRRERDASRMSRAHDADDAADARPWRWRRCGTFHASEGGIW
FT                   GTSGTTTARAATRWENAPLEGFGLRFASDAEEETTTRARALEACARETLGEGGLTNEML
FT                   EETARATTTPSAASDDAATISNIETRLASTRAMLRGLGVDEAKTKAVMARAMDAWGGEI
FT                   RERERIVDALETRLLEGDEDEEALNYILRRAVARLRVLKTSGARSRVGLRACVASATAS
FT                   VAAASTTAAVAAKSTPIAKKGRGGMFSCCGADSTAIDDDAQELAYAPSESAAVECEPLT
FT                   CVVRLSRVGEETASAYSSTSRAYSSTSRASSREGGVLFNATTPLLTVSEDDTIEFNFYA
FT                   GDAHESVDESAVDANDRMRANAVMSPHVGETSGKIRGSATICVADLAETTRKDEPHVLT
FT                   IFIERPKSGGSPGQVYGKAIVRIDKFVESFDDGTTQIATAKGDVLKDAAVLFAALDKSS
FT                   VPNVKQLVRSFVDQRGACPSIAALAEMITLCIDWRLERPQLDRLRHCTMEVFAAIAVNR
FT                   ITASEKQRFDELSALMSKQLETELCNILPTAKVAEQELVDVLDMEYSASIARAIIPLFA
FT                   LTLGSISATRLVLRLKKVVREAMRKRCVEHMVRENPTKGPPTVACVTSMICKLTKRLPL
FT                   DAAILSQFPSEVEALSEAASASSAFIANIITEVFQAIASMRSPPDYDSGMMALDDALCA
FT                   HRRALKRYDLVLAMQPISSRFIDRLLQPALDETLGTVHHALVAWVKQEIDGERTNLEPV
FT                   DVERGAMHSMSCVNLFCVLYNIDRAAQDHILHGERAAFNATSLSQMCYEVFKTYVNIYE
FT                   RACLEAIQNARLHLMQDSKGQNTKTANVSDVKSLMVGNFYTRLSNIHQCILAIEPFMEE
FT                   MPLLWCSSKSEFDETLKRQASSEYGIDDDQVILFEDDEVHVFDEKRMLDTDFFANRIVQ
FT                   KLRTVRANVIASLTELIEERIAPFIRVAILDKEEKTRSAAVRIVFMMIDSELKLMNERL
FT                   APGAFRLALSSMHKGVCDAIEQLILHRPIEEGALEASERWRGLPTLTEMQHSLVVELMA
FT                   DVREFFHCDGAGEPESILKDGEGRLRRLLNLWFTPTIEIMREFWQLKEVLSRSIVSAHG
FT                   KQIRLRSIGGVAVQDILRFLRQRSNDATAMDLYNEQSMLITKMSLKALFGEQLMSIDSL
FT                   LGAWVCRDGSGLIGRFYITATQLAFSTSGMSIDHPHDSQTAVVREIRRIANISRIDAAD
FT                   GTPGLRITFDDRRSFTFSEFGGMHTELNIQARERDSCVAVIRTNPCFLQRPVFMHDIQV
FT                   AQISDHACETLDEVVSVETAQRMEPPTLPADEEVIATCVCARANGLARDLGKFTVASQS
FT                   CVFLPVNGSGRGVLYKTMTSTKRMPQLRPFGWKNADIIIPIRHYEEPVLRLTGMTLVEA
FT                   QSVFDALSSAITAYKS"
FT   CDS_pept        complement(593576..596938)
FT                   /codon_start=1
FT                   /gene_family="HOG000265107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685022"
FT                   /orf_name="OSTLU_93057"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ABO97275.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG609972"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00015009B3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0I9"
FT                   /transl_table=1
FT                   /translation="MPGFQSPFKRTDTDTSDPPRADDAPASTASPAASKSETTHSGSDS
FT                   GPKRKRDETRTAPRDATPTGARKGAEALMDISLSEVSIGAGLERRESDGAGAEDGGVSE
FT                   TTKTRGAARSETPERDAMDDVWTTFHDSLKRAELAKRISSEDEMTNTVSEVRRVSERLR
FT                   DLWSTNATKASDLARHMSQRCWNFAIEKTALETTAESGIVKKEMIGPLLDLRYFACELL
FT                   DAALGFADGFAVSAGAPEISSLAVGISNHLTLAKLLHDAGEFKAAEEQFVIGESYGNSF
FT                   LNRNGEFDAETMLQTIEAATSRAKNCFYLGNVAGARDFFQDAKSLSESEKNKGNETMCV
FT                   TTLISAKINLAENFVVSEKLQSADDEAVFDRKVGFLVKELIAAYYDLFTITPNSWSTSS
FT                   HQDNAAHFDLDEKLVCEDHRLVRADGLYIRILHNLARLFIHGRRYNEALKVLDKMKIIK
FT                   SYAKKCENSDNVLARDLQALTESFLMDNMLIEAFSGSGEISKACSILENVLNDENSVVN
FT                   VLHTCCVNLAKSECGAGAVASCIAPLAKRLSGCPKARRQEMITDIFEALLDTTLTVDEQ
FT                   VANDVLSYMDRLLTDTDSFKEIGFSRDGQSRAYAIIWNAASDMYMQNKYSLARKLFGMT
FT                   LPLSSQRKSKTVSNAAVPVIRLQVMCDLENGDIEQAKESLRSLLADKTATDVSTTLLNV
FT                   KFQLISDDVSGLGESIRTFAKAGESDALLYVAGELDGSKHHATAADAFRSLYDMILNNM
FT                   GTDNMMKQETFIFCSYLRHVKMAKMGDFDSKTFSESAELFSEFMKRASNLNLLTDVRQA
FT                   RYLADFSWNTGLDAYEKSSETEAAYQFMFLCALVISKLNKIPEGLDADDRAEYGYRQAV
FT                   ALLLSIASLTSYNPATDVGDEQSRKEREAKNIARSKGAMANLHSLLKNAEEERYEELRK
FT                   VASVLEYEIACAQRDVALQGKIIEILSTKTLDDEASINTLLMIADRGAAMRTSDLVTVS
FT                   RAYEAVGKAMKKYLIQDVALIARLMRKQIQLASRVYKSKDDVIHSLYDSAEEFLALHPS
FT                   YPPVEAQWLLSTCFNRAVRHERSMRTKEAIDWLKQTQKLISALEEILPDAVETYSSIIN
FT                   DNLAVLTVELDAA"
FT   CDS_pept        complement(<597092..>597484)
FT                   /codon_start=1
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685023"
FT                   /orf_name="OSTLU_10513"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ABO97276.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00015009B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J0"
FT                   /transl_table=1
FT                   /translation="LKAIYKAFLESDKDGSGRVDVNEFVRMLRVDRTPFVERLFSMFDT
FT                   DRTGLIDVKEFIVGMANVGGEARDNKIQFAFSVYDLDGSGYIDSSELRKIICATNMSTD
FT                   KQIERKVEWLMRQCDTDGDGNISFEEF"
FT   CDS_pept        complement(<597851..598075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685024"
FT                   /orf_name="OSTLU_35710"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ABO97277.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00015009B5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J1"
FT                   /transl_table=1
FT                   /translation="MYAQPDAGGLSKDDIRQAFREFDLDRNGYVGAAEIAHVLASMGEK
FT                   VTDDEIDEMILMADTDGDGQISFEEFHRLM"
FT   CDS_pept        complement(598230..602219)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312937"
FT                   /gene_name="BRD3501"
FT                   /orf_name="OSTLU_93058"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ABO97278.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG609973"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00015009B6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J2"
FT                   /transl_table=1
FT                   /translation="MAREEELTEYERERQAKIERNKALMERLALAKLASEAGIGGEGDG
FT                   PGRGRGRGRGRGRGRGRGPRVKREPARQSSRVEKLRKESRLTSWRGTRIERPLRTHWAF
FT                   EVDADVGSLGTATEEDRGLNGRLVPKNYFVEGYCGDEPYAAWTDDVGWHHLIWGNDRVK
FT                   ENKRHVRTDEKGSATASGAAVIILQECARRRRRLYEDFIVERAEKALDLLMGSPTPSWY
FT                   RPYYPTYIDERARALWAPIVKHAPIPVVKEDELDEEEKTRRAFRKQFKENKFQNWEVDK
FT                   IDVLDGEIASHCVQCGISKEETPKMRLGPDKRRSLCTACGLFYACMGHTYRPMGFADNL
FT                   NSTVEFKDLQINGYVEVKEEKNVEVTDDAEARCERVAVTLSVSDAGDLVLNVDVVEDDR
FT                   MEVDVAADDGLSRYERTEKDWERHSEPLSTQYPAVNRFLPGAPVSTSTMLMRTTRGVVE
FT                   DYPIDAVDWSSLPHFTKLVTLASTGLITNRQVMADELPEERLYQRAVPYAAHSHLKRMV
FT                   ETGRYEKYQLNLTESERYKPVEYEWKPDQIDGDTLFGYSEEQVQDSLEAHMERKVEAAA
FT                   MDDADETKREMLANIALEDLDAKRTFEYQVLRSIESFEKAAEKSERDAERERERERRRR
FT                   DAEEEEVRREAEMELHGGRRVVCMKESIGYSAEDLAAYEGEEDIPDPIAITCAGHVGML
FT                   QTMCKSRAERIHDVASDKIVGGGEFERMSGCGSSKKWRNSCRVLNPDDTPGITIGAHLV
FT                   ERGDEKGDDVIGRRIAVWWATEQLFYLGNVEAYNVANGDHSIRYDDGQLEDVALCMQRV
FT                   KWLDSDVLVPNDEEEAEDEKAPSRLHVRPPGVAGSEEATVRVPLGGFSVYTRLKPSTTT
FT                   MKHSERRKCFEILQAVRKVEADGRSLSEPFERLPSRFTLPDYYEIIKCPVDCAAIERML
FT                   RKSMAGYPNVWFFLVAMELMFTNCQRFNDPASMLYRDAEVLRGVYLKAVQERFPGHPVP
FT                   SKNIYDNVDEPAWDKPVDDGVIEDEDDPFPQKYVQPELRQSNTQAAPQRKRRARYDSDS
FT                   EEYVPKRKSQRSAPRDRRVPKNPLDCAIYVLSRVHGNAMPLNSLYEIMVEKGVDCGLWG
FT                   RRPLAALGALLRQNPLVFRDARGGEVWELVNKVDVDTDEEIDYLADDGREEMSEDTAEA
FT                   SPPPEKIEMTKQETSACRSVLAAIRASKDKKGRKRADPFELLPTRKALPEYYRAISAPI
FT                   DLGSIQKCLNAGGYPSTWMFCVALELMLSNCQNFNESSSTLYKDAEVLRGVIAKTIQSL
FT                   YPGHPVPERDSPYDAAKCVEPRWRPPADKGAPKPKLRFTMKTVSK"
FT   CDS_pept        complement(602523..603413)
FT                   /codon_start=1
FT                   /gene_family="HOG000185005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685025"
FT                   /orf_name="OSTLU_35257"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97279.1"
FT                   /db_xref="HOGENOM:HBG332706"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI00015009B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J3"
FT                   /transl_table=1
FT                   /translation="MRAKTSWSKCSTSGSLAPEDVSAFETHGYLVLTDFASPTEISAMR
FT                   ARAAEIVDKFDANANRESIFSTVNQSGQKRATDEYFLGSADKVCCFFEEGAFDERGELR
FT                   VPKHLSINKIGHALHDLDPVFRAWSRSEKVKNLFKTLGSPRNPQPVQSMYIFKQPSIGG
FT                   EVVPHQDSTFLNTDPPTCVGIWLALEDCTLENGCLHALSGTPDVARRMVVDHDGTRAVE
FT                   FIGDAPTHDLTVAEPLDVPAGTLVVLHGQNVHYSRPNLSPASRHAYSVHYVDATATWRP
FT                   TNWLRRSPDFPFVPL"
FT   CDS_pept        join(complement(604499..604720),complement(603629..604435))
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18312938"
FT                   /orf_name="OSTLU_35514"
FT                   /product="Predicted protein"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /protein_id="ABO97280.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI00015009B8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J4"
FT                   /transl_table=1
FT                   /translation="MSHGVPNAAAQAVLVKSEPMPADASVVRGYDFEGALDYDALMRSL
FT                   YTTGYQATSLGQAIGEVNRMLRWRLSDEAIFLGWTSNLTSSGTRETIKYLCKNKMIDVL
FT                   CTTAGGVEEDFIKCMKPTYLGDFALRGKDLRGKGLNRIGNLIQPNDNYCDFEDWIMPIL
FT                   DAMLREQNEEGVKWTCSSVIKRLGMEINHEDSIFYWAAKNDIPCYCPALTDGSIGDMLY
FT                   FHSYKNPGLVIDVVADVRAMNDESIKVKRPRKTGIIILGGGVAKHHICNSNLMRNGADY
FT                   AVFINTAQEFDGSDSGARPDEAVSWGKITMDAKPVKCYVDATIAFPILVAETFKKNFEP
FT                   RA"
FT   CDS_pept        604936..605844
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856512"
FT                   /orf_name="OSTLU_32767"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97045.1"
FT                   /db_xref="UniParc:UPI00015009B9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J5"
FT                   /transl_table=1
FT                   /translation="MGEDAKTETAYGAIARDVDVEATPLEGERARRETLAAKVRGRKTL
FT                   GLAAVALAGVGAVARARAPEMFTASLGRAPLVPALGLADGAYYARGGKHRLRDPFLNGV
FT                   PMKQMTDAQKSANVVNWCRFRNVASNGNFRCGVTCRQDGENGSNAPEVFYIGSTPADDD
FT                   GNVYRTISRKGEDGNMYVCYSDWSQNNGWNRKVMKCPTSGSRAVLTNSTSLPEGAKLTI
FT                   SEVPAAKKHTQNVEYDMGTLYTFVNKDLASRESGKGLCRDFGSSIACHARQNNIADVNA
FT                   QFEFIPVVPDDASGDVSACPA"
FT   CDS_pept        complement(606004..606804)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008009"
FT                   /orf_name="OSTLU_93059"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97281.1"
FT                   /db_xref="UniParc:UPI00015009BA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J6"
FT                   /transl_table=1
FT                   /translation="MAHDADDGDVVRLNALLSKWREPKMQRVLPRLVIPDATNRANSGV
FT                   SLEHAHGIAMSICEDGFNENHDVPVVVRERARDMLKSDAYRRWEAFSRANARVLPEVSA
FT                   RTWASRRWAYATLGSSHLNLALKLIEYDVPSVFERRWERSRRIRYGDALTRDAGLREAI
FT                   VNGLPSVVLRSETPPEARREISLMLNRAEDVGFRINERGEAVRVRDGGDEIKELTVFEA
FT                   LSRTLDSEELSSLARIKYGLDLDDAEAGYVADAAANTASLRSRL"
FT   CDS_pept        complement(606851..607723)
FT                   /codon_start=1
FT                   /gene_family="HOG000265108" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008010"
FT                   /orf_name="OSTLU_16234"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97282.1"
FT                   /db_xref="HOGENOM:HBG561478"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI00015009BB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J7"
FT                   /transl_table=1
FT                   /translation="MRASTTAPAFARPARARRASPKSRANAGVDVPTLLNNVPHARATR
FT                   RWFYEDATKSIVAAVTARERRIKIKSEFPELNVNGDVYRVGTTLELVRETAAALARDGL
FT                   RVKICVQRSMGQGVFQALPLSLSGVSKLLGMMDWEPGTEGMIDPSGGIGAADGEGADCF
FT                   ILVQPQNIVGYSVLPYIEEMEAVVGDKPMIMINPRLDDVQSAGNVMSVRGRKERMDAVA
FT                   AWKEVYHFRLLYRKPYFFPIYGALRFAYYENEWELYKRTGARELEQYVLLGTYPSEPTP
FT                   DEMTKKIWG"
FT   CDS_pept        607836..608966
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685026"
FT                   /orf_name="OSTLU_32770"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97046.1"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniParc:UPI00015009BC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J8"
FT                   /transl_table=1
FT                   /translation="MAAPEASAATGADEDAYDDAVETRDDEAEVEAEVEEEVEEIVVDG
FT                   AVGAMQRSGELTRELREEAEEEDEASLEEDISREEALSTATEMIKSVANGDEALDAARL
FT                   GSLLWALSNALLEDLTDRDDLRVPGNSLETFPVELVRDIMANIETLVIALTFEPEDAVT
FT                   QRSGQKIPAIGSHRVAAAEILAVLLQIGCQDIDERIAKLKLPSDGQFVLVSLVRMFFKY
FT                   NWSSALHATVIRLILAALVSPHEPLWAPMFEGGEESLQGSLAKSIKEALATKPISTRLG
FT                   NVGSVIILANALCELEACDDVERASVRTTLQEDPAWRATVEGENNSLAKLNEEQAGGLC
FT                   GPKPTKSPAFMDSGMGSNVISSQELLRMLQHISLGQ"
FT   CDS_pept        complement(609049..610371)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161276"
FT                   /orf_name="OSTLU_16235"
FT                   /product="Predicted protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97283.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0001500AA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0J9"
FT                   /transl_table=1
FT                   /translation="MRADRAAPDDAGDDAWRLGFPREPSREVASSLRESDARLERRWRA
FT                   FVANGRDARARGELVRAFARANGVGREARPRLWFAWSGAEAAKRASDTTYEEYLRAAEL
FT                   SDDAAAATTRDAQIEMDLARTFPEHARFAETGDALPALRRVLRATATSAAAGYVQGMNY
FT                   LGGFLLLVMETEEDAFWTLHVVVNVMFAGYFTEGLKSLRADLDTLDHRFRCVSSEAHAK
FT                   LESMGLAVKYFTARWLMCALIGCASVPIVLRVWDLIFVDADREPRETIMRSSLAILALQ
FT                   APWIRAAEDMSSSVECIREAGSTIDNIEAYLQRVSLLREMHFPSKPAPAPAVTSTSRKR
FT                   TSRYEPPPTPARAAMTPVANTLYASLVSFFSPTPSKTAVSTPRASGLAPKRLWSFEETQ
FT                   ATPKRTRVEADGSGSHAQSSMFAKSKTPLKSPARSPLLAAR"
FT   CDS_pept        complement(<610644..>612971)
FT                   /codon_start=1
FT                   /gene_family="HOG000198085" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16685027"
FT                   /gene_name="HMA2"
FT                   /orf_name="OSTLU_611"
FT                   /product="P-ATPase family transporter: copper ion; heavy
FT                   metal transporting P-type ATPase-like protein "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="metal ion transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97284.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001500AA8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K0"
FT                   /transl_table=1
FT                   /translation="SSSSTVLFAIEGMRCGGCSAAVRNALDARDDVEAAAVNLVTETAA
FT                   VRFKTTSMIVGSLDASIESAVAEIGKKGFKMTRRELGRAAEAAAREASARREEEMERTK
FT                   WDLYKAWGLTAACLGTHLTHHLHALGLHEYAHTEVLNALAQPWIGATLAMGALLGPGRK
FT                   ILVEGAQAFANGAPNMNSLVGVGSLAAFGLSTAGALNPQLNEYGQWTNDFFEEPVLLMA
FT                   FILLGRALEGRARARASADLRSLSSLLPLDARLVVPDRASEEGEDPADHSVMLDVDRAA
FT                   VKPGDLVRVVPGEIIPVDGVVVAGNAGVDEATLTGEPVLVYKTRGSDVNAGTGVFEGPL
FT                   TIQATSSGDSSIVAGITRTIEEAQGRAAPVQRLADAIAGPFVFGVMGISAATFGFWTLA
FT                   GDAMFPGALMEAGSFGAAPWMGPIKLATDVLVVACPCALGLATPTAVLVATSLGARNGV
FT                   LLRGGDVLETIAGVDAVVLDKTGTITRGKPKLKSVYATSGDDDWNILSVAAAVEATTTH
FT                   PLAKAVARAADLRFETTDNLTPVPRASASETEPGRGVSATVNGERVFVGAPSWVDEKVR
FT                   GVGPSSDSFEEAWAESETCSLVAVGVEGRGVMGMLTVTDEIREDAAATVQRLKESGITV
FT                   HILSGDRQAVVTAVAGELGLGADSVALGGMLPGDKANEIEKLRAKGLKVAMVGDGINDA
FT                   PALVTADVGIAMSRGMEATGNAAGVILLNDAISQVADSVQLGKNALGKIRQNLGWALAY
FT                   NAVGIPLAAGVLLPEYGFTLNPS"
FT   CDS_pept        join(complement(614506..614664),complement(613438..614271))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20008011"
FT                   /orf_name="OSTLU_16237"
FT                   /product="MC family transporter: succinate/fumarate "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ABO97285.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001500AA9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K1"
FT                   /transl_table=1
FT                   /translation="MPAPANAYDVPALRRLRGAASASERTEKRSAARAAALLPLVKGVS
FT                   GSFGGVIEACCLQPVDVVKTRLQLDKSGQYKGVVDCFKKIHAEEGVGALWKGLNAFATH
FT                   LCFKYMLRMGTNATFQAALRDEEGKLTTGKRMAAGFGAGVVEALCIVTPFEVVKIRLQQ
FT                   QKGSVNLKYKGTLHAARTIMKEEGVMAMWNGAGPTIARNGTNQMCLFTAKAHVDSFLWG
FT                   KHDGDGMALHPVQSLISGGLAATIGPVATGPFDVVKTRLMAQSKAGVIKYKSFLHALYL
FT                   IPKEEGMLAMWKGLLPRLMRIPPGQAITFMVADGVVSHFEKSFSQEDDD"
FT   CDS_pept        join(614876..615011,615131..623466)
FT                   /codon_start=1
FT                   /gene_family="HOG000265109" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685028"
FT                   /orf_name="OSTLU_32774"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="ABO97047.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG609978"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0001500AAA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K2"
FT                   /transl_table=1
FT                   /translation="MEGILRALSGAKAQTNAREGDGGDGFAANLRAQLPALMSVINPTN
FT                   VCMEENEVKQALALLKGALKKHPGAFALGAGTSAVRVFANVFALSAVSDASAEFHEQVH
FT                   SVLYALMSVASKSDLVGMHELCKGCVELASDSKRVLELFPGKRYGGEFGAADDDFEDEA
FT                   SRETIVLCCFDTALAHVKRSEETSGRNGEAGTNGLSSSTSTGLMIEVQSLECAMNVTNT
FT                   ACKLLECALLTNPQNVAPLTTSELLFTLSRLLVIGSRDVQLSAAAVLKNLIADIPIVLV
FT                   PCDTILAAIATLLTGRSLRRDDKVILELVYALKELAGEDVLRKHVNVLATSILTAIESA
FT                   RDESVRAVLFDVLRMCLLMRPSLAIQAITLLPHAVATKGSDALVECLAMAFSNAREQDV
FT                   DDEDEVEKRSRLNEGEGEDVHTVTFDYDTRSEWIESCIVTSMEFLGGPDSAYAREGGGS
FT                   QLQRADSMELENSLRDSAPSEYQRILAISVIVRSIAASTGSMRIRRIAAQVTYKWLGWI
FT                   RAYDGDASDAPTTRMYALLAEAANCLVNVQTDKENKAPPLLSTKDISLDILTWPWTSIA
FT                   KRDPSALLDDETIEGDRMAKLAALNLAVSLASSETSGEKVSSEAARQVLTRAFADQDAG
FT                   VRSSAAIAVSFVHVLASNPPSGIGALQRLSSLKDAKEISVRNAFATALGGLAAAGVLHG
FT                   IQKAAGNEAIRNAARLHGNRAVTAAFKTCSHELGSDEAKNAMKLLADSMQAFHEVVKRE
FT                   VIKAVHSIDGDDVAAGAPKTPGKFNRNKRRLTAGTPNANRQRSDAQKAPSLNAALTLQD
FT                   LNSAGQLEGVILDRADPDGLVAASGLRSLRYVFEIFSAAGDFTEDGETLKGARALAQAA
FT                   LRTAHHKSPHVREALCEAASAIVSDDILLEMAPPKNERPEDRRRSSSAALLHAEAVVNA
FT                   QLTSGLQILRNLKESIDTAPDSFIKESTLRTFAAVAETLTIPGATSAAVIVYFKNIIDM
FT                   DLTAQNCAIYLLRRLAKKRQVRTRELLFGVQDVAAQIGTLLPLHEHSIATLAELAKMSP
FT                   RQLLEEILPLSMMRLIRTAIGAGSEKQEDLSILQAYAHLLNKDLHQLVADYSYEAIAEL
FT                   INPRTLKPLSEQESNAFKSFLQKYSKDDLLTLISNQKFYIMKALITRAGAAMKDEQEDM
FT                   ITSAATMMTVFKALADAAQSDAHEVSDFFRPHFTRMEMVLFDKSGDTLSHKRYIRSLTI
FT                   MVWIIGKHLPQFAPKVMAHLAHALNNPELRRTALQSWKILVQVLSERPAHLQRAADQIV
FT                   VAMLPYLDANAQKDDEHGSDKIAQARALEDANQAAAVIDELVLRRGDVMRGNLARLPML
FT                   PDVQRLEASNARIAQERGLVSLRQLLGSLTESLADESLAVRTTALTEIRRRVSNPDNGM
FT                   EIQGLIQGVEGTAADPIMSALVAALLKCCEGEGSSEASRRVQRAAAQCLSELGAIDPGR
FT                   LLIASQQVQALNSESITVASILLVDHLARTVRGANDSDMLDAAAYAVQCVLIHVGCRPE
FT                   SVDEDDAVGLELPKGHSADGIEFWESLPDEARVVLAPCLTSMYSISGMSKESNVKQRPL
FT                   YGSPTAGTTFNKWIVFWCRTLALEASGENAPLFKAAVSVFRHDIRIALFLLPYMVLDAI
FT                   LDNEERKNEVYLEIVAALTDAAGGDRASEDQNFSGSSTSHGRTELAAQTIFSLLDQLKG
FT                   WADAQQDASGVNPVHSLMRDLSFTLLAKAAQRCGASARSLMYFEDYLRSNKMVLNQATC
FT                   VKQHDIMDVDVSFLATIYQGLAEPDALVSIPRLRATPQPEDQLLQHEEAGEWEEALVHY
FT                   ESALQRGEEPMNNLGISVAEWGRLRCLQGLGHLRTVQREVENLIRTRPDAPPTLAEAGA
FT                   AAAWRLGQWDDLDSLLGKIDSENSSHVNSGMKRSHRQMHVAPSALTPSGMPLTVGVGTQ
FT                   LNADVPQLSADAAIGRVLLALHKNDGHAFQVACASARDALITPLRAASMEGSYLRAHAA
FT                   LVQLHLLQEAESSYNAVVLTEEARKAAAAAKTRIPTDSSDIPLCAVKEFQFWHDRLDRT
FT                   PPNVATREPILAFRRTIYKLLGAKLAASKTWLEQAKVARSAGHYGAAQLALLEARSEIG
FT                   MSLPLALEQAKLLWAGDSHQRAVLEIEEALKDQDAVAAHPEHAAKAVLRLARWATVTGQ
FT                   KQKKEILTLYASVIKSHKSWEKSHFHVARYMDEWMKDATKRELNGEIGANLPASVRRKG
FT                   IGGDDEEAIDLLSETVREYGASIKYGHRHIYESLPRMLTLWFDIGDRVYEAEAEGMENR
FT                   NSAKLKKVFAEVLFAINTFSDQLPLYKWLTALPQLTSRLAHNDRKVRELVQTLVTRLLI
FT                   NYSDQVLWALVPMARSRDAVRAKSAKDVLTNAKHGKQDKTGMRADRELINQFALVADQL
FT                   VKLCNYAPKTQAKNGRPPRTFSLMKTFPDLAALMPTRVMIPVQKSLTATLPPAGTNPTD
FT                   HRPFPPGTATLFELGDAVSVLPSLQRPKKLTMLGSDREKYAFLCKPKDDLRKDLRMMEF
FT                   TTMLNRLLARDAESRKRRLYLRTFSVIPLTEDCGIIEWVPNTTGFRHIIQGLYADDGLY
FT                   HKNSHTEVKELYEKCKGRNPTSWSREVLSRHPPVFHRWFLERWKEPAAWFTARTAFAHT
FT                   AAVWSMVGHVVGLGDRHGENILFDCKTGDAVHVDFACLFDKGLELEMPERVPFRLTQNL
FT                   VDGLGVGGYEGVFMRVCEITLTVLRSHREALMSVLETFVHDPLVEWTKSSIRDASRGGR
FT                   STSSSTRGKDALEKIRSRLEGVVVGVGAAPSLPLSPSGQARRLVEEAVSLSNLGSMYIW
FT                   WMAWH"
FT   CDS_pept        complement(623595..624053)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16685029"
FT                   /orf_name="OSTLU_32775"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97286.1"
FT                   /db_xref="UniParc:UPI0001500AAB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K3"
FT                   /transl_table=1
FT                   /translation="MRTTARGTKREEEATFTLNAPLAALVAASVLVTGAIDADEAEAAR
FT                   SGGRVGGGSFRASSRSRASPRMSAQSRAAPPIGGYGYGYNSVFMPMPIMPMYGFGFGFG
FT                   GMGFLFNLMFLFFVANTVLGFLSQFAENADDRRDDGEDDDFPPYDRRY"
FT   CDS_pept        complement(624539..624976)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686049"
FT                   /orf_name="OSTLU_16239"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97287.1"
FT                   /db_xref="UniParc:UPI0001500AAC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K4"
FT                   /transl_table=1
FT                   /translation="MIRSFGKAKRAIRGDDDDGDVRASCDAVTLLALERTFYSSLNFLG
FT                   VMTLTGVGLTAVGRGGKVPIAFGAIIYGSCILAAIELAVLHRRRVDACRRVDFDGDLRV
FT                   DDSRSIVVLYAALVLFTCSVDLVYAIVHPLLDRTQAVSVHS"
FT   CDS_pept        625204..626589
FT                   /codon_start=1
FT                   /gene_family="HOG000265110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686050"
FT                   /orf_name="OSTLU_32777"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97048.1"
FT                   /db_xref="HOGENOM:HBG561948"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001500AAD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K5"
FT                   /transl_table=1
FT                   /translation="MPRATVLAGSYERFVFGYAHARGAASDASDGATTTTLAKRFTVDA
FT                   HLASVKAVACAGGLAASGGSDDLIRVYHCDASGAMADLGTCVGHGGDARALEFYAPRGY
FT                   APTRLLSGGADGALMVWDASDNFELLKTMRAHRGGVCAISAHRSGKVALTSGCDAHVAM
FT                   WDMRRGRVAYKFKTPERVEGLAFTCDGSEYVSRLTQKITLTDVEAGSVVTSFTTPAKTL
FT                   TFDARGRMVYVGCEGGDVLVYDARMAAKEGAVSRIAKAHPQRVRGLAITSAKGDETVGD
FT                   SGPSALVTAGSEGVVRAWDLRRASGPRDENPGTPVAEINSGARYTCLCAMPAETVPDAP
FT                   KPKLPAPKPRADAPAKKQADKSSKVSTSKDNKPASSKRHDMKQKKRPDIGGDDDFEVVP
FT                   EEHEPAAKREPSRFDSDSDGDAPYAKPAGGKKRQKQRQGPAYEKTATSARRKANNIKHK
FT                   KRR"
FT   CDS_pept        complement(626608..627366)
FT                   /codon_start=1
FT                   /gene_family="HOG000265111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686051"
FT                   /orf_name="OSTLU_93062"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97288.1"
FT                   /db_xref="HOGENOM:HBG609981"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022777"
FT                   /db_xref="UniParc:UPI0001500AAE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K6"
FT                   /transl_table=1
FT                   /translation="MRFRRVGTKASTRSRRRRACARRTSSEASETTAVRTWRDAKRFAD
FT                   AGQGARTTVLTSREGARGAFIKADCDANESVTFEEACEAIFEHGERVYARAECTTTLAV
FT                   EANVGAVGEVFAEDVALRNCGVWFGAAGNVTPLHYDLCHGFLIMIRGVKTFTIFHKDDF
FT                   RAMYQRSDRPELSRVNLDAWYAGDADERDRFPDFEDATPLTFTLYPGDMIYTPPFFWHH
FT                   VRTHDGEPAISVLVPFDLDAEEPVHVSHLY"
FT   CDS_pept        join(complement(629100..629982),complement(627737..628824))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856762"
FT                   /orf_name="OSTLU_16241"
FT                   /product="Predicted protein"
FT                   /function="double-stranded RNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97289.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI0001500AAF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K7"
FT                   /transl_table=1
FT                   /translation="MRAALMSERARGFQPGIATTLNWLSEISFGARKTREKFVKGPLDA
FT                   LAAAYGEFLYDLPYRRQDGSLPPGGERTIEDAVRRLKRSEKARRLDAEREVRDFWRAGG
FT                   ETRTGFDQMAAEYTMALVMDLERGVIACEMEEDSRAVEAMLGEPTLSALCEALERIKQI
FT                   CLCSSAADAAKMAYGYPELLLTSSSAIVARLSQLKTMIPGADVGAILRQDSKSFLQRDI
FT                   PEIKERFRALRDAFPRVNVARLVEYDPSLLLLDVNVGLNALRELWTEEEFAQSDEDNPF
FT                   FAEELSLAIKTLAASPPSFSRVLVPDSRRLMGGAPPPRLGPSAKSQKRLKLDVFGGDQW
FT                   FKRKCEDAYREKPSLELWHDLSSRLIEADIVPTRLRDVTQQHVSTSDVEMHALIGDKIF
FT                   GAALLEEIVGNRLCKDTGEATRQYSEVASNASMAQLVSECLPQHVQGGREVEEHSAGTL
FT                   VEAAVYMVNQMAGGPQAVQQLAKWFVYNVVVEGKKQRRFTNPKGLIIELNGHTMSHRIE
FT                   GTADHEPAFQARCVWPKEAPREQQRETTAIGKSKKEAEANAAKEMLEIYGHEIYNAPAQ
FT                   ESAKLKEKKDLKMENAYGHLLTLGGVLVGECINTASTNETARYVATVRLGNDEARAEAT
FT                   SKKQAIRLASQQILEANGEYD"
FT   CDS_pept        630367..630834
FT                   /codon_start=1
FT                   /gene_family="HOG000242265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686052"
FT                   /orf_name="OSTLU_32781"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ABO97049.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG654657"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniParc:UPI0001500AB0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K8"
FT                   /transl_table=1
FT                   /translation="MAAYVAENAAGAVVHASDDATPWIDVDQRRIDAFATCANDHQYIH
FT                   ARDAPGGAIAHGFLTLSLLTPATAARTTPAWSTRAVNYGLNRVRFVRPVRAGARVRARA
FT                   IKIVAARALPDAAGAETEYLVELETAPSASSASAERAELALVASWIVRHYV"
FT   CDS_pept        631309..632238
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686053"
FT                   /orf_name="OSTLU_16242"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97050.1"
FT                   /db_xref="UniParc:UPI0001500AB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0K9"
FT                   /transl_table=1
FT                   /translation="MGAVRTMRDGTTRGEGERDAREGTRARGTTTTTTTTTSLDAFDAR
FT                   LARARERAMLAREETERVEKWLRDSAAATRRGEGARGEGSRGRRSDDDGGVKMAMASEE
FT                   DVEVEEYDYGVEEERAMRSSMATTLVARESMSSLFVPQRSPARSVIHRPIPRRPLSASV
FT                   EGTEWTTLRAKATRSGDTRTNVSIVSDEDGRSAFQSLARDNRAGLDGLGDMVARTTISS
FT                   GVLDDGGLDGGMSTPPRPHRSPLRPPVARPRNRTLSEDFSSPVRLSSSMELRHSTSSRM
FT                   TLLESVAHEAEYERARMSEKSYDDSEPR"
FT   CDS_pept        complement(632316..633329)
FT                   /codon_start=1
FT                   /gene_family="HOG000265114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686054"
FT                   /orf_name="OSTLU_24848"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97290.1"
FT                   /db_xref="HOGENOM:HBG710131"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniParc:UPI0001500BA8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L0"
FT                   /transl_table=1
FT                   /translation="MISSATTTTTRCATLTKASHRATPGTRSRRGAAATTRTKAQKFAR
FT                   LSTSSGDDDDRSLAPVAAAPAPREDEVLPDNLFDAVGQAAKATRDAMQRGVAGSIVELL
FT                   IPELWDPMSGNVMSESGDQLKVWEISREFLSKLSASGATGVKAVFPDAGAAAMLRARWG
FT                   DDVAFEVASVDDRNLVTDDFEGVLVFAAPDPMSLEKVQKATGRANELGYPVVLLNPRLA
FT                   SGDAGVGLNVRRMRDNFLGKMTVTYSLRPLPWCNGSLYKSYPSAWKLFLEDPEEPGRFK
FT                   LIDEYAQRPAGEELDDIVDAALRPVGEDGEATEKTAAEKVLGMMREMQRFAKSLSN"
FT   CDS_pept        633362..634417
FT                   /codon_start=1
FT                   /gene_family="HOG000265115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313182"
FT                   /orf_name="OSTLU_32784"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97051.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609984"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI0001500BA9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L1"
FT                   /transl_table=1
FT                   /translation="MSAVARSAQGTPLDGAPLATTAVVIAVAISFALALAANGDFARVC
FT                   ASPRLAFEHPLSSYHRVWTSTFSHGSFPHALLNCLAFVPMASALERSIGTTHFAWLFAT
FT                   FAHAAYALSASAATALWMALGYRASYESCAIGMSGVVFALIVCETNVNDVERRSVFGLF
FT                   TVSSEYYPIALLLFIQLLMPGVSFIGHAGGIAAGWLYVRGYLNFLLLKETHVEYLEKLA
FT                   ICAPARALASFVPSNADRGARPNAEASSTAFPAFSTVRAIPTRMSEVTRNAFAGNFPGQ
FT                   GRKLGGDGSTTGEMANLVRVDPRALDTLVELGFAEHAARRALQECDGDSQRAIELLTES
FT                   AAHDANSDEIV"
FT   CDS_pept        join(complement(635463..636786),complement(635376..635388),
FT                   complement(634969..635350))
FT                   /codon_start=1
FT                   /gene_family="HOG000217922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008255"
FT                   /orf_name="OSTLU_50098"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ABO97291.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001500BAA"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L2"
FT                   /transl_table=1
FT                   /translation="MSAATATNVTNDAKASNATANADGTTPAAQQPGAGTSSLYVGDLE
FT                   TSVTEAQLYEKFSSIGPVVSIRVCRDLITRRSLGYAYVNFQSPNDAAHAIDVLNFQVIN
FT                   GKPIRVLYSQRDPAVRRSGVGNIFIKNLDKAIDNKALLDTFAQFGTITSAKVAMDGQGN
FT                   SKGYGFVQFETQEAAQAAIDNVNGMELNDKQVYVGPFQRRAERSNTGEAKFNNVYVKNL
FT                   SENLSDEKLREKFAEHGAVTSCVIMRDEEGKSKGFGFVCYEEPEGAAAAVEKLDGYTED
FT                   EKTWVVCRAQKKAEREAELKAKFDQERRERMEKMAGANLYIKNLEDGTDDEKLRELFKE
FT                   FGTITSCRVMRDASGVSRGSAFVAFSSPDEATRAVTEMNGKMVGAKPLYVALAQRKEER
FT                   RMRLQAQFAQRMPGAGMPGGMAPYMPPPGVPGAPMYYGQPPPAGHAGQGVPGAQRGRGG
FT                   RGGPAGGRGQRQNMRYNAAAAMPMPPMPAEAANPMAILASQLSAAAPDQQRMILGEALY
FT                   PLIESKDAANAAKITGMLLEMDQSEVLHLIESPDALTSKVQEALAVLKAAAEEGA"
FT   CDS_pept        <637610..638803
FT                   /codon_start=1
FT                   /gene_family="HOG000198086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686055"
FT                   /orf_name="OSTLU_93065"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97052.1"
FT                   /db_xref="HOGENOM:HBG143922"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI0001500BAB"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L3"
FT                   /transl_table=1
FT                   /translation="LEAIIERDYFPDLRTNRLKAALLEATRRGDARAIAAVHREMNVER
FT                   MRRVGSRGGVVGTPSIGGSGTTARDAEASWETETPQRANDFEDDDEEEEFVDYEDYEGR
FT                   GIEGMRGRSTAYEEDRHLSVNGFLAKYTSEDNASFTEIVKQSEAKRALKKRHLEAVTAP
FT                   PSRRAALIAALASHPQPSSALALVEGAEVAESDPSAAKVVAVVGHDSLYTAPNGVALSL
FT                   KERQRIVASEPKVTIAANTRFVAPKPRTDGSEGKRAALKRYERVHTPSMTPGVEGSPIM
FT                   TWGQIISTPLRLEDTEEELAGAGKFSMKGSSARERKLRELTARNASGSATPTPRTRRGA
FT                   PTPNGLSKAGKSLLRRVTTPARRAATTPRDSDLRKSYSGRTPRTTPASHGGLLRLDD"
FT   CDS_pept        complement(638875..641100)
FT                   /codon_start=1
FT                   /gene_family="HOG000265116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856763"
FT                   /orf_name="OSTLU_32787"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97292.1"
FT                   /db_xref="HOGENOM:HBG609985"
FT                   /db_xref="UniParc:UPI0001500BAC"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L4"
FT                   /transl_table=1
FT                   /translation="MLGMIPSARASATERVALLGTSTSAAASEDRALEDEPTTSPGRRT
FT                   RRDGLVSVRGIVSLVSFVAVVVAVAFGYVREGERHARARRFASLGATGYPGDGYPGDGY
FT                   PTNEYPTDGKVHHLKVKPVGHAIWLGSELPNVKRAFLNQNKKILHKVGWKIKLWRSADI
FT                   TPENFPYTYHTIKRALKYNLKHHENVFSMIGDLMKFEIMYHHGGLYMDTNIELLRDPTD
FT                   LFSVTATLGKEVFLVADPGGDKRFASAGFMGALEKHSALFASLITNKEYLDAIPFDEHC
FT                   IANAWTGPMYLTLKVLHFDNAVILDRDTAYPLLCGQDGRDMCLEQVDHEALVGERVSKK
FT                   GSKLVVDKNDPEKIWRIKVPCKEIRKLYPDATALDHFSLGKSWTGCDPEVKTQRLVDWT
FT                   LNYVHDPSSFIFDFILDQVRWSEADNVDVMTEKLVNRRMGLLGTADVSAQLVVLANTAR
FT                   SGAQLMSELLRQAFNADEDTVVWEDDTGFHSDIPLYNRFLDIGDLWSERALEMDWVTRD
FT                   MKPKILQLGVDEDVFNNLVNHPRTFLDQLLLGAARHGYRYVMTRIGWNNALGGARATRR
FT                   IARTILDEFPKANVFFLERANILAQYASLAAAEETGVWMKFSDPLKPESKDETIPTQVV
FT                   FDFEKFKQTFQERHDWIEFFMNEMRARKRQYVHLVYEEHLATAARQVQTLKRIKEAYGW
FT                   DIDVNPTYLRNSVHLVPTQETELRQRFDNPEAIPELLTQAFPLDELV"
FT   CDS_pept        641861..642757
FT                   /codon_start=1
FT                   /gene_family="HOG000265117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686056"
FT                   /orf_name="OSTLU_24852"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97053.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609986"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="UniParc:UPI0001500BAD"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L5"
FT                   /transl_table=1
FT                   /translation="MLVVTFMVKESDRTSARVRFNEGFWLVKGVIWLGLLVAAFAVTLN
FT                   DYSGLVNVDRFFAAVFLLIQLIVLLGWVYDLNDKLMSGMDEGGNRSFALLLTSSAATYA
FT                   FAFTLVGFLYKLWAPSSECHRNIALITCMLIVCVIFSVISLHARVNGGLFTSGAMTFYC
FT                   MYVLASALASEPNNYACTPASKDGDLSSILSVIGFVFALFALGVTAHSASSKSAFAGEG
FT                   AEGSEDPTSTFNVTFFHFVFFTASSYCAMTFTEWTNGRSAAGWESAWAKVAAAYASAAL
FT                   YTWALLAPFVLRNREFR"
FT   CDS_pept        complement(642833..643033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686057"
FT                   /orf_name="OSTLU_32789"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97293.1"
FT                   /db_xref="UniParc:UPI0001500BAE"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L6"
FT                   /transl_table=1
FT                   /translation="MATATATATPTMAMAMEGSGQEISPFAGAVDVAALAVLAYLAKLG
FT                   NEKAARESSAKTKTSRTTRRK"
FT   CDS_pept        643457..644452
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161527"
FT                   /orf_name="OSTLU_32790"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ABO97054.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500BAF"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L7"
FT                   /transl_table=1
FT                   /translation="MRQSSAVTGTRARTTRGARAARPRATTTTRAGLNVDLRGKKAFVA
FT                   GVADDNGFGWAISKALSEAGAEVILGTWVPALNIFETSYRRGKFDESRKLSDGSMMTFS
FT                   KIYPMDAVFDAMDDVPEDIATNKRYAGNEKWTVSEVAKCVEEDFGKIDVLVHSLANGPE
FT                   VAKPLLETSRKGYLAAISASSYSNVSMIQHFGPLMNKGGAAISLTYLASEQIIPGYGGG
FT                   MSSAKAALESDTRVLAYEAGRKWGIRVNTISAGPLGSRAAKAIGFIDKMINYSLSNAPL
FT                   KEKPLEAIEIGNTAAFLCSPLASGITGATIYVDNGLNAMGLAETAPEISG"
FT   CDS_pept        644720..644971
FT                   /codon_start=1
FT                   /gene_family="HOG000039916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686058"
FT                   /orf_name="OSTLU_32791"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ABO97055.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG690556"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniParc:UPI0001500BB0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L8"
FT                   /transl_table=1
FT                   /translation="MSHLLVTLRRGTAGKPKTILQTLSALGLRKTRDARIVPNDAGARG
FT                   KLNQVKHLVSVETLEDAERRVEALAKKRALRTPIVSEH"
FT   CDS_pept        645126..645785
FT                   /codon_start=1
FT                   /gene_family="HOG000231116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313183"
FT                   /orf_name="OSTLU_16249"
FT                   /product="Predicted protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="ABO97056.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG482410"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001500BB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0L9"
FT                   /transl_table=1
FT                   /translation="MWRTCDAVAFDVDSTVCEDEGIDELGAYVGAGERVEAITKKAMEG
FT                   GMPFGEALQARLEAMAITREQLETYVAKNPPKYSPGIKELTAALRASGKEVYLVSGGFR
FT                   QMIAPVAKGLGIPVENIYANTITFNEDGSLKGYDAGEFTSRSGGKAEAVKHIKSSRGYN
FT                   TMVMVGDGATDLEAKIPGGADIVVGYGGAQRRAKVEAEADWFVLDLFVLAEALKGA"
FT   CDS_pept        645999..>649466
FT                   /codon_start=1
FT                   /gene_family="HOG000198087" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686059"
FT                   /gene_name="CHR3508"
FT                   /orf_name="OSTLU_16250"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="ABO97057.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG611632"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001500BB2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M0"
FT                   /transl_table=1
FT                   /translation="MDAAERGAIASMPHDDAPTTTAGTTELFGKIDGETVRFLVQSSFA
FT                   GDQLDELKRQIAMLRRLRAGDRFVLPGQGTPRATKERVFGLLDLGCGAELRLSDATKTY
FT                   FTHAEWMYSYRELPLFSQLSDERSTDAAKAKFARKRDGDGRAELNLADVNRLATKPVEI
FT                   LEREGKRLLEHAHLREIERLREEADALNEMDDDGQRLALENRIKQLELVRVQQRVRNEL
FT                   VFAQQEIMQMPERAYKKMVKDNIKILAEKKKKAEKKEKQEQTAFYRSVLAMRKRINEES
FT                   NNARDERLARNKAVLKMHEKLNREFMRKARDENSERLLRLEALKANDLAAYRELLAEAR
FT                   GRETDMTAEGEGDKYEALTSFLNATESYLTKLGGKIAAVKIEQARSEAAAAAASEAEAK
FT                   GLTEEEVKVVAEEAANSAAIDHGEAILDGAADGGDTKERYYAMAHSTQEIITHQPRMLT
FT                   FGKLRDYQLVSLQWMISLYNNKLNGILADEMGLGKTVQVCALIAYLFESKQNFGPHLII
FT                   VPNAVIVNWKAEIRRWLPKLSTVFYVGSKDARAKIFQQQVLQLKFNVLVTSYEFIMRDR
FT                   SKLSKVAWKYIIIDEAHRLKDREGRLSRDLDKFRAQRRLLLTGTPLQNELSELWSLLNL
FT                   LLPEVFDSSKVFQEWFGGNSKVSNDADGEDWIEREKKVIVISRLHQILEPFMLRRLVQD
FT                   VESKLPPRVTVIVHCPFSAFQSACYDWIRKTASIRVEPGTRIGLAAQQNFRGYLPLQNR
FT                   AMELRKLCNHPSLSYPPEKGGDFRGPNLVRAGGKFWILDRLLVKLQRSGHRVLLFCTMT
FT                   KLLDLLENYLQWRWTTPDGQDLKYCRIDGNTSLEQREIAINDFNAPHSDKFIFLLSIRA
FT                   AGRGLNLQTADTVVVYDPDPNPKNEEQAIARAHRIGQTREVRVIHFEAVDDDIVQKKKG
FT                   SKKEEVGWGGPNRSYCESLESSVRNVIQKQKIEMAAEIVDAGRFDGQTTHAERRETLEN
FT                   LLQQQANGTRTGVSVPPLKELNGKIARSQEEWDLFNRLDEELDWPGALLSSAECPSWIK
FT                   YTQDEIDQAVFANTKVGQSSVTQFNENMGRGARSTNNLNASGSAVWTHADRQEGDFIDR
FT                   TGIADDDGDEDEESDDVAVREDSIEDIGDIDIDDIEDAEDDDDTTTLNT"
FT   CDS_pept        join(complement(650969..652333),complement(650662..650890),
FT                   complement(649583..650625))
FT                   /codon_start=1
FT                   /gene_family="HOG000265118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686060"
FT                   /gene_name="HIRA3501"
FT                   /orf_name="OSTLU_24854"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ABO97294.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG559653"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001500BB3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M1"
FT                   /transl_table=1
FT                   /translation="MVVVYKPEFVAHDGTAPIFSVDAAPDGSRFATAGGDQKVKVWALA
FT                   PVLEREIEADENAPKCLATLSDHFGPVNCVRFSRNGRYLASGSTDTSVLVYALREGPGK
FT                   AAFGSADAPNVENWTIAARYRGHGSDVIDIAWSPDDSMLASCSLDNLVIIWDCRTGNPV
FT                   ATLRGHTSFVKGVAWDPIGKFLATQSDDKTCIIWRTDDWTQVAKVEEPYQASMGATFSM
FT                   RLCWSPDGKAVTTCNSYKKPSHTASVLERGSWGSNFDFVGHKGPVVAVRFSPVLFHDEK
FT                   RDKVHTVIACGSQDCKLTIWTTNRPKPVCIVRKCFSQSVVDLCWTPDGYTLLACSTDGT
FT                   LCTFKFDPAEIGEKLDDTAAEAFLSETYGDIKRNRAPMLEDPTLLGFAAAAPGELDDVS
FT                   KGVKTTPPPPKRIQPAPIRSNNGVAQNGVATISAQRETVSNDGRRRIVPVAATGPSDAT
FT                   NGLKRRIEPTAMNGGNGVQSAFEAPSAPAPKRVALQPTQVQQVPPTTPSMPQRSQIPTT
FT                   ALPAPPPLPVAPAPEADEGSEERAPLLLEAKNHHERSYVELVCSQAGKMKWTDRIDMKA
FT                   THLSGNKNFCAVALEDGSLQLYTPCGRRYMPSLLLPDRAAFLVSGKDDSSLLIVTRDYT
FT                   LLVWNVAVGKETCTLKADCSALVRSSSRSGVALATVRLSKSGAPIFTFTNGYAYVYHSD
FT                   LQTWARVADQSFMRSEFTSRLRQPGSSGFGEMQALQIAAARAAAHVGPAALLQTSGLTA
FT                   RRETGRHLEILVAGAAMLQSADEFKSWLAAYVRHLATECGDDPRTTFVGAESQLREVCT
FT                   EFLGPLSASTSVDTWASEILGIKKRTLLREVIIPTIAANGSAQRLIAEVVTLLEAAEQR
FT                   EKDATKI"
FT   CDS_pept        <653030..653446
FT                   /codon_start=1
FT                   /gene_family="HOG000218681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686061"
FT                   /orf_name="OSTLU_35651"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ABO97058.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG726290"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="UniParc:UPI0001500BB4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M2"
FT                   /transl_table=1
FT                   /translation="ARQWSPIALAFLGDAVFELYARGVFFYPPAKPLEYDLKTKRLARA
FT                   EAQDFLLRLLIDGDALSEEEVSIVKWGRNAAYGNIPTRLKGKGKGGHGTYRNASALECL
FT                   VGYLYVVDRARLQEVMTIVMSETAIEGALALSSK"
FT   CDS_pept        complement(653529..653792)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686062"
FT                   /orf_name="OSTLU_32796"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97295.1"
FT                   /db_xref="HOGENOM:HBG559655"
FT                   /db_xref="UniParc:UPI0001500BB5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M3"
FT                   /transl_table=1
FT                   /translation="MFGRVLAIATSSQSATCCAGLSAFGVVVCAALSHLFKKHYAHLGS
FT                   DWKAPGMTHEIASANLSQAAGLYGLFLGLSIANLYVNRARGR"
FT   CDS_pept        654709..659148
FT                   /codon_start=1
FT                   /gene_family="HOG000265119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686063"
FT                   /orf_name="OSTLU_32797"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97059.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG559649"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI0001500C9C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M4"
FT                   /transl_table=1
FT                   /translation="MRAARYRRARRRVDDRDSGRGRGVVALCAVVVALARVRTSGGEAI
FT                   WGLETVYDGLGYNPEFPTQVCGPSKDGNSFRAAGCKPAITEKDSYGTAGDPGFSFARYA
FT                   YKGKSYGPPYNNVADVAACTYSLTYAAAEAAGLEHCFYAPYTGGVPTTTVQKTTTNLGY
FT                   STLGWRLPLAEWRDKLPDYVVERYELPPLRLGFEEGTFWPNWKLLSSGLPNFAVTKTCF
FT                   LEAHSGDYQLCSAYPTERREDIHGVLQVQSISFALGRGSLFFEANGGDKNVPDIPQDPY
FT                   PIASHGKGALGVALTRISDGYRVLTKPVRARRYWETLRWEESLLAQYYGEVFRLEIFDY
FT                   RSGSFGWLAVDSFVIPQAPVIITEVTPSIGPRVGGTRITISGQNFGSSVDDKTVFIGDK
FT                   ECIDLRMSYSRCSSDTTVCAGALSCTTPAGSGVGLTVAVVIGDPTVVRIAGPRGGFQAG
FT                   FCGDESTEHPFSECAIDAIDAVAGARKRGFTYADPPTVTSTPVTSAIQDIQYEYTLIAT
FT                   DPDENDLLTYTAITLPTFLQFDPTTRLLTGVPLRSDVQCRSNNWHPASERCALGATYQV
FT                   EFEISDSIYRVQHNFEVKVTTNETSLLVDKSFHWENALQIFEKYEAVVALGSVTESLKA
FT                   LENRNVTSPTEIVGFNYRNPLNDEDKTIRNALIAIAEKPNIDEVDVDAAIQWLQTNNSD
FT                   AVNLDMIQALKEQVAVQKRGDVSSGASAPALQGVSWKGWLNYFKKLGTSLGAGSAVYTN
FT                   VAGLPVPAGATKMLTREKIIVIKLSTPCNSTALNTDRYIPSCDAVVGMSSQHEVWLGFS
FT                   DYGTTLEDVIVFPEDFEFADLVTSAVFTQDVPGFLGQLTRRMVAQSAKLQEIATLGETH
FT                   LVWFDTSTSMLTVNMTIKSSPVKAVMQLATSYPYPEPGKYGLPEISVVSCDNVAYDYEN
FT                   ALISFSNTMTRTGGSLTSRLAALANDVSTFASRCKNLCNGQGLCQDSQLPPVCQCYQDY
FT                   FGDDCSQVTCPNDCSNNGACDSRQVCTHFPESGETDCSGGTGKCACNYPYFGKDCSLKT
FT                   CAKNFIVFEGNSTHKLDVTAGTQPIKDKYTALGLDVYDVKISETNGDQPAAWAIQGDEL
FT                   SLAHLVGSAYVEFTSSEDGETARSLEPFYVDSIPSRGVAIEAQYFAQEYRTFVKREQQL
FT                   LDLFGKSSSECNAAGACAFETGTCFCATQYYGAGCEFQYCANDCAGHGTCNKLTGVCTC
FT                   ETHYVTDETYGCALKDYSLISTTCTDEALDREVDDADLRVRPLHASCLFGTRLGSPVTG
FT                   TTTTYITDLQGNVCLDCSGYTLESNSRIYFYEDEPCTSSAGNREDFCDNTKESYDTIVR
FT                   GIGMIPAGDSGSTLSFNLAAMRTSDIQFSIFKAKAGIVREHLADIDAGGCGACTDDNPQ
FT                   CGAIFTIAVDGVTVWTSLVNNKYSEINIDISAASTMTLSTAKYTPPYWRSNVLPGLAGQ
FT                   DAPAVWCDGAAWADAEFY"
FT   CDS_pept        join(659331..659456,659695..661794)
FT                   /codon_start=1
FT                   /gene_family="HOG000265120" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686064"
FT                   /orf_name="OSTLU_32798"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97060.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG609989"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="UniParc:UPI0001500C9D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M5"
FT                   /transl_table=1
FT                   /translation="MRSVQLGTHAHNALLGVTSAGDGRCVSTVAKDGVVTYDVEEEKRE
FT                   RTLALDRGRKFACAVACGSNGRYYACLEKEQESDSSYLCAWETEQSANAATVGEASKEC
FT                   VTTLDLGRSGRVRELVAVDGGALVVTTTGEVQLFGMSAEHIDKARTSGELGSRRVETAS
FT                   VLPESVGALVVTTDGNFQGRKIATFLARAQTVTLAWELDIEHPDGAAKARVASAASDGE
FT                   TFMVLWDDGVWALHDASDGSLKHKLRLDGLDVHCDEATSGKRSKKSEDTSPLASAASLC
FT                   LSQDYYAVVANSKEENTVVVAVFDSRYGAVHLAEDVSRGLEHKVGRTSGVSLAATSGNL
FT                   IVGLSDQVVSVQFDLPELSLASLVGSLSIHSQPEASAAAIRVLGAETASTALVPPQHAA
FT                   VTPGWKLEELKLDGQGVVSLSNVWDDDDAQTREKKVRSTAEALASGSKKAGSSLQTLMK
FT                   SLPIPQILIESAISGGLNHRVWDSVTLLLAGGHIRGSSTARQLVTALLEEDMLDEVKDF
FT                   LVYAKDVSAEDIVAILHSAMMRDEDDPGLKKRASANKKLAEKVLDEAEACASDEKFNGE
FT                   AKQKLFARAQLLVSAYDSFAPWAQQLHPLIARPLDPTMGMLVLRDLSKQDAVSLLQYLL
FT                   VWANFYASSGGYFARINTLVEPGIPSAHAVVTWTSALLDAQFTTFCLSDDVAEPVRALR
FT                   ESSSQMLDMMRSLAALGGAFRHVGENSPLPEQHGVQSTTYTVESVAW"
FT   CDS_pept        662411..664513
FT                   /codon_start=1
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16686065"
FT                   /orf_name="OSTLU_32800"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97061.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001500C9E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M6"
FT                   /transl_table=1
FT                   /translation="MGRRTYASESAEALRRNIGISAHIDSGKTTLTERILFYTGRINAI
FT                   HEVRGKDGVGAKMDSMELEREKGITIQSAATYCRWKESDINIIDTPGHVDFTIEVERAL
FT                   RVLDGAVLVLCSVGGVQSQSITVDRQMRRYNVPRLCFVNKCDRAGANPWKVLAQARDKL
FT                   KLNAAAVQIPIGLEDEHEGVVDLVRMQSVVFSGENGQTLTVGEIPANLKELADEKRKVL
FT                   IECVSEVDEELGDLFLMGEEPTTEQLLAAIRRATIANTFSPLFMGSAYKNRGVQLLLDG
FT                   VVDYLPAPSEVQNVALDLKNEEAPVVLSNDPSKPLVSLAFKLEEGKFGQLTYLRVYQGQ
FT                   IDKGMTIVNTSTGKKLKVPRLVRMHSDDMEDVNSAPNGDIVALFGVECKSGDTFTDGSV
FT                   NYAMTSMKVPDPVMSLAVSPKSKAESGNFSKALQRFQKEDPTFRVHMDEESGQTIISGM
FT                   GELHLDIYVERMRREYKVDCEVGQPRVNYREAITKRAEFDYLHKKQSGGQGQYGKVVGY
FT                   IEPLENTTEVIFENGIIGNAIAPSFIQAVEKGFKEAALNGGLVGYPVEGIKIVLTDGAS
FT                   HAVDSSELAFKLAALAAFRQSFHNASPKLLEPIMKVDITVPSEFQGTVIGNINRRKGTI
FT                   NDSTAEGDDVIISSMVPLSQMFGYSTELRSMTQGKGEFTMEYGSHQAVTQDVQAELIST
FT                   LGKVKN"
FT   CDS_pept        complement(664550..665233)
FT                   /codon_start=1
FT                   /gene_family="HOG000192708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686066"
FT                   /orf_name="OSTLU_87850"
FT                   /product="Predicted protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="ABO97296.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="HOGENOM:HBG559647"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001500C9F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M7"
FT                   /transl_table=1
FT                   /translation="MSPATSPTSTSTSRRLVRGVVFDMDGTLCVSAALDFTEMRRRVGC
FT                   ETSDILGEVDSWNEARRTKAYEIIGEMEREALKTTVIAPGAMEVAATLDGMGIPRALVT
FT                   RNAASSVEFFHDTVWTMAPFSPWLSREFKPYKPAPDSLLHICELWGCSPSEIIMVGDSA
FT                   KDDVVSGNAAGALTVLLDSGRTGKWAEEFGVDKVPEQMVPHFVCADMNELHVLLTQSGH
FT                   FEFKK"
FT   CDS_pept        complement(665481..666791)
FT                   /codon_start=1
FT                   /gene_family="HOG000214327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686067"
FT                   /orf_name="OSTLU_46171"
FT                   /product="Predicted protein"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ABO97297.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG559646"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI0001500CA0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M8"
FT                   /transl_table=1
FT                   /translation="MAMINIGASNAGDQFYRYKMPAIQSKIEGRGNGIKTNVTNLVEVS
FT                   KALARPPMYTLKFLGNDLGAQTTFNEKEGRAIVNGAHDAGKLAQSLESFIKRFVQCFSC
FT                   GNPETMIEITKRETIHLKCKACGALSDVDMRHKLCGYICKNPPEIKKDKKEKQLRRAER
FT                   EREEAGAAIDDEERRRRKSEKKEKKEKKEKKEKKEKKEKKEKKEKTDDAPAEAGDASSA
FT                   SEADDDDDDEVQWATDTSAAAAKARAIEQLTDGAANMVTVVADKMADAAIEDESSEEEE
FT                   DPRVSKLRAYAAKNDAVKTAEYLVSDALGVESKEMGVLFLLEAVFDEDEAIPPQIKAKK
FT                   DYLSAACPDAALQRALLCAFERYVTETATSGFKAFSLILNQLYEFDLIEEDVIKAWNED
FT                   VDAASCIDVEPKVAQAVRKQAAKFIDWLDESEDEDSD"
FT   CDS_pept        667144..668631
FT                   /codon_start=1
FT                   /gene_family="HOG000265121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686068"
FT                   /orf_name="OSTLU_24859"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97062.1"
FT                   /db_xref="HOGENOM:HBG559644"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniParc:UPI0001500CA1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0M9"
FT                   /transl_table=1
FT                   /translation="MGARDGLRHAQFKPMKRAMDGAFGDREHGAAANVEGTTRAHASDG
FT                   SSFVMTQPSGLARSQQVFLAQKFLNLPAMPSYVESEGGMVLDRVVLNAGRGNWWTTLTA
FT                   RARAQRAWNTEQVQEGKAHRALLDPSMYALGGRFRANALENVAVKAIGELGSVKGVTRA
FT                   FAKKFKLSDEKDDDAEAALNPRGRVSVQAKLPSHLLSVDLSHNERYQTDDRYVDGPTSA
FT                   SVSVSSRGRRAINYRVSARKWLGDLVPFDRKHGGGMRTPPRKELQAGVSYEQQAVLWRG
FT                   RRRRKPKSSSAVSGYTALPQVPTITVGGIYGAVVRKSLDDDYKDGEQTELQNFGSLSVN
FT                   AQVGSFARPLLDFTSINLRLDAGGMGTPNKPLDAAAQTPLPLADRLITMGGRLKANPVS
FT                   VTLSLGQQLLGPLRFRAEVRASGAEALSATRAGLSALKERKTMTEVRESIQKQIVKPEV
FT                   VYGLDCALPPTIGSARVVAWYNATRQEAMAELRLFDL"
FT   CDS_pept        complement(<668873..>669751)
FT                   /codon_start=1
FT                   /gene_family="HOG000198088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686069"
FT                   /orf_name="OSTLU_10246"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97298.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG716038"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="UniParc:UPI0001500CA2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N0"
FT                   /transl_table=1
FT                   /translation="KKYIELPAAEPADGGRGGNVYLRVDRTCDSLLHLHERKTWRAKKG
FT                   YHGSAAEHASGGRERHRVAPDQEHMYIPVPPGTVVRRKRTGELLGDMTKHGQTLLVAEG
FT                   GGGGLAARRQQRQVNRKMRNGKEEDFEASDIAIDTASLVSTVGEDGEELSIELLMRVVA
FT                   DCGLVGLPNVGKSSLLKAVTRASPEIANYAFTTLMPNLGVIKTEDDLAPTGESSTVMAD
FT                   LPGLIEGAHKGLGLGRAFLRHLRRTRSMVCVVDASGQDPVSDYVVVRQELKLYNPEYVK
FT                   RPHILVLNKTDL"
FT   CDS_pept        complement(670513..673335)
FT                   /codon_start=1
FT                   /gene_family="HOG000200829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686070"
FT                   /orf_name="OSTLU_16259"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97299.1"
FT                   /db_xref="HOGENOM:HBG609991"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="UniParc:UPI0001500CA3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N1"
FT                   /transl_table=1
FT                   /translation="MNGDGGVVVDVAVEMPRSFFQEKDYLDHRYHFKRAVYLDVLHKKL
FT                   SKSSEWSCEVMDQHRDARKPYITVHFGEKQNKKALRLFLTIDPETFASVRLLPNRANVR
FT                   RLARGDVRPASPHYNQSIAEDMYARMHAQFFAAASKKAKSLPGAVVLFKRWAQGRRLLD
FT                   AADGVSGFFISMLFAYMLERGGQLSSSMDTSQMFRAAINALAKPGFFKKGLYASGKPAE
FT                   AGEWQRAFANVFLGPCGHVNIMARMSASAVQELIHEAILSASELKRSSHSAFSNVLLGQ
FT                   CPAAVRYDLHMHVDVMVNADEGECDLGGRRTAESDVARIVTRALSDRAKLVRAFEPQSS
FT                   SVDTVGSASCKIWVGVILDPEHALRLVDIGPSSADDKEAKEFRKFWGERSELRRFKDGR
FT                   ICESVVWDFVPPTNRHHIPAIVAEQALKLNLANVDEIEWSSKMFDEPLSKIASSKEGTS
FT                   PASLLQTLDRLAKRMKDLKEMPLKVNNVQPLSGAFRGTDPFPPTPHPLAHGAGVGLGKS
FT                   EDDIAVCPKTLDIMVSLEGSGRWPEDPDAIAKTRSMMAIQLAESLRKSYAMPSVIAEEA
FT                   IDILFEGYAFRIHVNASAGGPHVKATEGKLIERASHAGLIASIAARFPMYGLSTQLINR
FT                   WVSSHMFSPHLSDEAIEALVALLFVNPGAALPPMSREVAFLRFLNLFASHIWFDPVVLD
FT                   PEGIVSDAEIESIDRTAKTAPAMCIVTPHDRSGIRLTQSGPGAVVLKRLVSIAARAQSE
FT                   MQAVLEGVSKHSMFETECWERFFKPSLSGFDAAFVLRRTALPFPKHALFPSKRLYKRMR
FT                   AQFENEMSVVDEDEEETLAQSIKLAKLPPKLLNKGPDKAREALLIGFDPTECFIKDAED
FT                   RVGGTALMFVDKYGGDVVGVAFKPNAVHADAALPDSLSWLPNPDPPAREDVIEEIATIA
FT                   GADFVEKVLT"
FT   CDS_pept        674145..>674510
FT                   /codon_start=1
FT                   /gene_family="HOG000174091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686071"
FT                   /orf_name="OSTLU_8830"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ABO97063.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG398346"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001500CA4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N2"
FT                   /transl_table=1
FT                   /translation="MNALTQIKNTQKATMREIESGMGEEASWHARYKHSAYVYAGGLAF
FT                   NMTEGDILAVFSQFGEVVDVNLVRDEEKGRSRGFAFICYADQRSTVLAVDNLNGATVVG
FT                   RTIKVDHVDDYKMKNEDD"
FT   CDS_pept        complement(<675554..676213)
FT                   /codon_start=1
FT                   /gene_family="HOG000030005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686072"
FT                   /orf_name="OSTLU_35517"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97300.1"
FT                   /db_xref="HOGENOM:HBG561971"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0001500CA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N3"
FT                   /transl_table=1
FT                   /translation="MRTSSSFGAPSRSAASRFVRASSRRSIVARSFDAKAPAPPSTRRA
FT                   FTFVRHGQSTWNEEGRIQGSSNFSVLTAKGQAQANLTKDVIALDKFDVCLRSPLARARE
FT                   TAEIAWGTRSGTAFVDVDDLREIDLYAFEGLLKEDGMERYGQSYANWKKNPSEFEIDGH
FT                   YPVRELWDRATRVWNEALLARRETKILVVAHNAVNQALIGSALGLGPEYFRRIVQSN"
FT   CDS_pept        complement(676329..676820)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008256"
FT                   /orf_name="OSTLU_32808"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97301.1"
FT                   /db_xref="UniParc:UPI0001500CA6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N4"
FT                   /transl_table=1
FT                   /translation="MGASPTNGTSPRGRDARKTTRWLDGKENDARGRPFRRGIDEEDDF
FT                   EEDLLDARGEDEDEDGVSASARAVGRHGSARGILSPSGSFAEKRQRSKVRFESSLPNGF
FT                   PERKPSMTKLSSGAFDDSSAREEAVTPFVGLVMVFLTVAFVAWFNDVLVRSVSSVSAWA
FT                   "
FT   CDS_pept        677247..677744
FT                   /codon_start=1
FT                   /gene_family="HOG000265122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686073"
FT                   /orf_name="OSTLU_32809"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97064.1"
FT                   /db_xref="HOGENOM:HBG562013"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniParc:UPI0001500CA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N5"
FT                   /transl_table=1
FT                   /translation="MRGVKKENLPSKVCVVCDRPFTWRKKWENCWDEVTTCSKSCNGKR
FT                   KSERQRENKETRGEDEDEDARAAHKKSVKAQKAERRARLEFNGNPTSGQKACDECSKMV
FT                   NELIRCQTDATKRWRMVCGSCWVKVSGGVVDGDANHPHYRYGGLWKNRRAQNADGGEPL
FT                   VC"
FT   CDS_pept        join(complement(678761..678916),complement(677775..678656))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856764"
FT                   /orf_name="OSTLU_32810"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97302.1"
FT                   /db_xref="UniParc:UPI0001500CA8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N6"
FT                   /transl_table=1
FT                   /translation="MLARVERRVIDVDIARGRQTAHVGALARSTAANMRRSLSVIALIL
FT                   ALCFASERFTGVRAVEEFDAERDLLKFVEDSRTETLAVLALFRPGSVHQAAIDAFTDAE
FT                   NTFRSYGHDDVTFGRALKLKSEHALAKVFIPAPHYMDSDHMTEMTESLQRNVSSIVRFA
FT                   FFTLIPPYAKWPEFPDNRGTVDEVQRANLHAKNDMPKVFVFMLKEFADEYGVRIHKTLE
FT                   KVGEAISGFMVLIHVVPPTTKDLIYLQTAVYEGEEQEYMDVLAGGRLAIVGYDPVSKKR
FT                   DAEARLIDSFNENTLIQFCNKYLAMLPEEAQRGRMPFPIKRADKRSKNTIGLGKYATKE
FT                   AKAEL"
FT   CDS_pept        complement(679133..679471)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161528"
FT                   /orf_name="OSTLU_93071"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97303.1"
FT                   /db_xref="UniParc:UPI0001500CA9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N7"
FT                   /transl_table=1
FT                   /translation="MERECTSTESRQGFVKVAAMSFDTPFTSNKCTFGGSTPIDATCMC
FT                   FDRSSRCEKFSPSSRRKCEFDIRRPRCAWFRVKLIPLVIRDRIITGVERDARLTLRWRA
FT                   RGVRIEII"
FT   CDS_pept        complement(679769..>680935)
FT                   /codon_start=1
FT                   /gene_family="HOG000198089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686074"
FT                   /orf_name="OSTLU_87857"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ABO97304.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG320246"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001500D92"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N8"
FT                   /transl_table=1
FT                   /translation="LYASLFVIWGAVLHHGEVYSHVVAQRRCSWPHGANGTRVMVTADP
FT                   QLVDEYTYRELGRRSRALAFAEAVCDAYVRRTMKAGLRRFAPRNVVFLGDLFGQGARRN
FT                   DDEWRALRRRVDAALWWPRNGDGGPLYHTVAGNHDVGYSEVIRHHPRILARFEEWYGKS
FT                   NFVERIGGVDFVGVNAMVLDGKGPATDETWAFVDGLSAQKKEPYVKRVLVTHLPLPNPS
FT                   QRCGPFRNSQAIQGRTLGSDKEIIYQDYLSDESAQRLLRAVEPVLVLSGHDHDQCEVTH
FT                   AYESALAGGTVAVTEITVGTVSALNGNDQPSYLMLTVPEAAGESFDASGSGLIQHKLCF
FT                   LPEIREILRTYAHVGVVSVLTILGPPLGELIAAAKKFEGRPVIALCFR"
FT   CDS_pept        join(<681675..683288,683472..>683843)
FT                   /codon_start=1
FT                   /gene_family="HOG000198090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856765"
FT                   /orf_name="OSTLU_850"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="ABO97065.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="HOGENOM:HBG588608"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI0001500D93"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0N9"
FT                   /transl_table=1
FT                   /translation="LNDGDVYRGPWNDHSPVGYGRYSWANGNEYVGEFHDGKPSGRGTY
FT                   EWAHGGVYKGNFEHGLMHGEGTYTASDGAKYHGSWRRGKKHGLGIQHFTNGDCYEGLWN
FT                   DGVGHGPGTYRWKALEGEEGHDEFDGEWLNGKMHGWGTLRWGSGDRYDGNWSVGQISGS
FT                   GVMTWCDGSSFSGRWKCGKKDGSGAFMLSGGESSSVTRNNIKLSVQINRSARPKTSFDD
FT                   SEGEEIIAADLGNTYLLLCECSEDQILKKEVVETDGVAHKHSLWTSPMASRSRKVRKVR
FT                   HGETIYKGHGSYDLMLQLRVGIRWSVSSMQEFSDVALQTCSFDVSLKQQFPRGGSAKTP
FT                   PHFARTFKWKEYRPEVFRHLRARWRVDPAQFMLSLCGDQALRELSSPGKSGSVFYISHD
FT                   DQFIIKTMRKSEMVRLKSWLHVYYQHVHDYPETLLPKFYGLYSIKAAGTARKVRVVVMS
FT                   NLFSAKHPIHKTFDLKGSTHGRFTKLENATPHTVLKDLDISRKFRVEEGKRDKLIEQLN
FT                   KDCIFLQKLRVMDYSLLVGVHFGFAHGMEEVSPSEQASLRPPPGTDDLIAHSTGAAKSK
FT                   LGVAMAAVSVHGRILTKQPPVESPIEEHTEPQDVILYLGIIDILQEYTTSKNLETKMMG
FT                   VMGKKSFSSIDPTNYAKRFLNFMSNLF"
FT   CDS_pept        complement(683870..684418)
FT                   /codon_start=1
FT                   /gene_family="HOG000265123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686075"
FT                   /orf_name="OSTLU_32813"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97305.1"
FT                   /db_xref="HOGENOM:HBG609996"
FT                   /db_xref="UniParc:UPI0001500D94"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P0"
FT                   /transl_table=1
FT                   /translation="MDDPPWYKAQRARKLTLDEHKEVWTKAWEMYKQSWVNVFRRDEGE
FT                   EEEATSTRDESEDARRSAVRETSTTIKSDDKDSNEGRLLADEAKQTLRAGKAGFKPFVT
FT                   YLYETRGRAYRDGVREFIKAYREGFREASEELETGESFSRKAASLISKAEDVLEKAEKT
FT                   ETDKIDDDGADEKSSSAVK"
FT   CDS_pept        684797..685921
FT                   /codon_start=1
FT                   /gene_family="HOG000207528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313184"
FT                   /orf_name="OSTLU_87859"
FT                   /product="F-ATPase family transporter: protons "
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="ABO97066.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="HOGENOM:HBG388608"
FT                   /db_xref="InterPro:IPR004907"
FT                   /db_xref="UniParc:UPI0001500D95"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P1"
FT                   /transl_table=1
FT                   /translation="MTTTYWLVSLPLRGSSADAAWATLQRHTGGSNDLSLNYKMRCPDL
FT                   RVGTLDSLLALSDDLVKVNALAEQVVEKVRRQFGELGDATTSERELRVDGESVERYLTT
FT                   FEWDEAKNPARRALKETVEKLSERLSRIDEEFKLKCGQLATSKNHLNAIVRKVGSGVNA
FT                   QDLSDKVNPEDLVQTENLTTLVVQVPKLKTEVWTSSYETLASFVVPRSSKIIHVEDDYE
FT                   LRTVVLFRRVVDAFTTAAREIGCTAKEYSHDPEASRAAKSQRGALEQEVVQRRDSLLEW
FT                   CQISYGEAFSTMMHVCTVRVFVESILRYGLPPDFQAVLMRPNMKHVSKLRKVLNQEFGK
FT                   DASSHWDDEIGGDEKSGGGLVEDMYSYVSLTMKV"
FT   CDS_pept        complement(686041..687624)
FT                   /codon_start=1
FT                   /gene_family="HOG000265125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686076"
FT                   /orf_name="OSTLU_32815"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97306.1"
FT                   /db_xref="HOGENOM:HBG609997"
FT                   /db_xref="UniParc:UPI0001500D96"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P2"
FT                   /transl_table=1
FT                   /translation="MDTVDTMQVDTAPAEPVLSNVSLEILSIISAAQREHGLRHRDYAR
FT                   YRGYCARRLARLYQACKMKHGKGRFVKKPLVANTIADERALLVPLVQSERAWAYAMEMK
FT                   DLTNVKRRRSDLRQHMLRRLKKAVTHANELATFCERLGNDQTALEGDAYANYIGGVCAV
FT                   EQGKDYVGAITKLLRAKLAYAKLGVLGDQKRLELYRERTEDLADLVRFAHYKQGRTADL
FT                   KAMEKEAAIGLSSNKVFTMKVEAPPEIEDKIRWHAMDFELKNRDARVLIAQAQDCLAKV
FT                   DALKNATGHKAGMLFAKGIAFYDEARMKLNDDVEKETAKALYQQGDDEDKADRIKLTEI
FT                   ALSLIVKDKLIDRNKFVCDQLDKKLSGRAKKEKADKKLNFGDLARMYDAATVDYEDLME
FT                   TAPMLLRLKPEDADKHIEEFEVDCEAEVMLLKARQNVALACHYVQVGNSKEAKAYFEIA
FT                   TDLATDAEGRDCAGEIQDEATELLKEIEVRVAKAQRKLQEADDSVTKSQSGSDLTSKVA
FT                   EKFSKLFSFR"
FT   CDS_pept        join(complement(688688..688693),complement(687792..688595))
FT                   /codon_start=1
FT                   /gene_family="HOG000265126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313185"
FT                   /orf_name="OSTLU_32816"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97307.1"
FT                   /db_xref="HOGENOM:HBG410783"
FT                   /db_xref="UniParc:UPI0001500D97"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P3"
FT                   /transl_table=1
FT                   /translation="MTNATKGEVMPSIIIGGGRVGQALRDMGVEGDVVVRRGEAFPSEP
FT                   KTGPIYVATRNDVLEDVIKNCPADRREDLVFMQNGMLQQFLDAQGLGANTQALIYFAVA
FT                   ALGDKPTDGVTELNPEGLTAATGKWADAVAARFHNGDLSCHVLDAPTYEGSMYEKLIWI
FT                   CAMMLVGAQHEGAKVGDVATTYKDEVVALIEELLSGTTACTGAKFAPGAVDRLIAYAKT
FT                   VAHFPCGVKEFPWRNGYFYGLSEKAIADGKSDPFPTHTALLKNIGAI"
FT   CDS_pept        complement(688864..689907)
FT                   /codon_start=1
FT                   /gene_family="HOG000150085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686077"
FT                   /orf_name="OSTLU_32817"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97308.1"
FT                   /db_xref="HOGENOM:HBG730260"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniParc:UPI0001500D98"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P4"
FT                   /transl_table=1
FT                   /translation="MKLLGIEGGGTTWIARAIEIDVEGGASVSSASSARGEEHFNKRDG
FT                   GREQRFETTTPEETLRTIREWIEINAWDADAIGVATFGPLELNPDKDKYGYITTTPKAG
FT                   WQDVDVLGSLFGKKDATEEEERAWRGRARLHTIDQVPLAFETDVNAPAMLEHRALKHEL
FT                   KHVHLVGGESCCYVTVGTGVGVGVVCNGLPVHGMLHPEAGHMFVKMRAGETFAGTCPFH
FT                   GNCVEGMVGSGALAKRRGVSAAELASLPDDDDIWEHAAHYLAGMCVNLILTLAPERIVL
FT                   GGGVMQRECLFSKIRANVRDILQGYLAVDQIMDDAYLRHFIVPPAWGYQTGLTSALYLA
FT                   ERALQRE"
FT   CDS_pept        join(690199..690269,690408..690484,690647..690780)
FT                   /codon_start=1
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16686078"
FT                   /gene_name="RPL37"
FT                   /orf_name="OSTLU_32818"
FT                   /product="Ribosomal protein L37, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO97067.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG460460"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI0001500D99"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P5"
FT                   /transl_table=1
FT                   /translation="MGKKGKGTGSFGSRRNKSHTLCRRCGKRSYHIQKSTCAACGYPSA
FT                   RTRSYNWSVKAIGRKTTGTGRMRYLKTLPRRFKNGFREGTEAKKKVAA"
FT   CDS_pept        complement(691020..691967)
FT                   /codon_start=1
FT                   /gene_family="HOG000165140" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16686079"
FT                   /orf_name="OSTLU_16269"
FT                   /product="MC family transporter: uncoupling protein "
FT                   /function="binding"
FT                   /biological_process="mitochondrial transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ABO97309.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006839"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002030"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001500D9A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P6"
FT                   /transl_table=1
FT                   /translation="MAREGDATATRTKTKTPLVNPFLGGLAASAFSASFAEFCTIPLDT
FT                   VKVRLQLRGASATATATTRGRGAGMLGTMRAVAAEEGIGALWKGITPGIHRQVLFGGLR
FT                   IGLYEPVKTFYVGEEHVGDVPLHLKIAAGLTTGGIGIMVASPTDLVKVRMQAEGKLAPG
FT                   TPKKYPSAVGAYGVIVRQEGLAALWTGLTPNIMRNSIVNAAELASYDQFKQSFLGVGMK
FT                   DDVVTHIASALGAGFVACCVGSPVDVVKSRVMGDSTGKYKGFVDCVTKTLANEGPMAFY
FT                   GGFLPNFARLGGWNVCMFLTLEQVRKLMRDNNIM"
FT   CDS_pept        692390..693214
FT                   /codon_start=1
FT                   /gene_family="HOG000265127" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008257"
FT                   /orf_name="OSTLU_32820"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97068.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="HOGENOM:HBG561201"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI0001500D9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P7"
FT                   /transl_table=1
FT                   /translation="MDEVGTLTVSDDQLKRERYVASNRFRVQEGKGPAFEKRWAERPSR
FT                   LAKLPGFRYFTLMRRVEPPSDVATTYDEDEANYVSFTIWETKDGFDGWRKGDAFKEAHG
FT                   GGTIFGFMSMLVSSLMILKGGPKPAFYDGLLSLSAAPSENSRKWQAEDGWRQIPADGKN
FT                   PIDADVFVAMNRFKVRPGKEAAFEKQWAERESELKEMPGFTTFLLLRRDAVTPDDGYNY
FT                   STYTVWENRAAFDNWRATKKKPAAREGEPLFEGAPKPVFYEGVLALLDAAGA"
FT   CDS_pept        complement(693267..696011)
FT                   /codon_start=1
FT                   /gene_family="HOG000265128" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686080"
FT                   /orf_name="OSTLU_32821"
FT                   /product="Predicted protein"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="ABO97310.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG609999"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR015697"
FT                   /db_xref="UniParc:UPI0001500D9C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P8"
FT                   /transl_table=1
FT                   /translation="MAQDAKAATLGRKMEALRERWRGGEDEDVGTRVALMLLRLSRRPM
FT                   TTTLDEMSDGGAVSVGAFDALSSEDAYAFEDASDAAGAFGEAYDDEHDASGASTLSEWS
FT                   DDDSDDQSDGRDGGNDGLVEGYASEGDDPGFSWRDGLLGDCVPPETSTETKDLGKTASA
FT                   APELEYISEIVAQTRQFQSVLRDSNVHRGDERLIASIAAKNLQSETSLVQEALHALRSG
FT                   SVELDRVTLPHVSCMTLDGALISIRRMASVLTRLKEMKQTSLALGPTIQAFTQALDSRA
FT                   QWIKSTLVPLEKRLAGESTIRGQPTLLELRTTVRRLEAKIDALERCALTAFPHEGTPAA
FT                   EAASHCLTTVYELAVEHQATANIHGFAVTMPIFVDTIQPYLQGLQRWLAFGILDDPAEE
FT                   LFIAKGRAIDDFVGSKEHWLHGHVLRHDIETPCFFREFMLDILDVGRSLELLHHTENET
FT                   SQKVPTLDVHLIDSFCFHLRKHLSAIHASPETFGGDDASERARALVDGVKVNTSGLNNI
FT                   FETPTSLVGIRNVNTDVVRDMILSRPTRIVPTRRVRSKTALQGSASTLNAWLDEFLTTQ
FT                   VPSCPISLAVQQSIGVHILKRAKEVQVVLSRSLRDSLDIKKELYALRAVFLGGAGDAAM
FT                   HFFSAIFGILDDPDKINAKWNSTTLNELLSDAFAADNSGEFPECRGVQVEIIPEAEENI
FT                   FSRVVIGTGALEKIASLRYSFDVKWPHNIVIPPSTMAQYNAVAVFLGQLRRAHTAMQSV
FT                   ATARWSEHIRCARGSGMGGAKARHLEPRLRHFITSLRDHVIVRILHVDWDVLMKKIDDA
FT                   MTLEAIRAAHDEFLQDATKRCLVSPDPTWTLVAEQIRTILAVACEYAACQAGDGAVSEE
FT                   DAMRLSSAFEEAYGYIERVLQAKLDIGSASTRDVEDLLYAIKL"
FT   CDS_pept        <696548..697333
FT                   /codon_start=1
FT                   /gene_family="HOG000198091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686081"
FT                   /orf_name="OSTLU_93074"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97069.1"
FT                   /db_xref="HOGENOM:HBG317034"
FT                   /db_xref="InterPro:IPR021325"
FT                   /db_xref="UniParc:UPI0001500D9D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0P9"
FT                   /transl_table=1
FT                   /translation="VEDEDEFAIFRFTLGIPGFDDEDIPRAVGALGALGLCANRFAAGT
FT                   DGASDALARSEIVGVGLCLACALAPELGRALKGDERGGAAKGRSNADVDGASSVFALSE
FT                   DASESAKEDCAWASYAILTNTLASGVVFVDGRGNARLARGTVRGRDDGAPDSNKADVLA
FT                   RVGRAWSEVSSTIGTDKIASSAPPSAEEEYHASRWEIDRAGANVWGFLPPTAETVFARR
FT                   SPENGGVLIAWSDASRGFSKKDRSWLQALARKLDLAFAS"
FT   CDS_pept        join(697643..698158,698264..699244)
FT                   /codon_start=1
FT                   /gene_family="HOG000265129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686082"
FT                   /orf_name="OSTLU_16272"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97070.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG561968"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500D9E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q0"
FT                   /transl_table=1
FT                   /translation="MESDYGIVDGFDEPPHAFIKSLLSKPIIVRKLADKFFGGDKTRVE
FT                   DEYEALTEEELDKFFISEFGGGTFRAGREYSFILYGASGYTGSLCLEYILKTVQNLGSR
FT                   VTFALAGRNEAKLRKRWADVTSRYPTEYEPGFITCDLANPVAIREMVLQARVVVNIAGP
FT                   FMLTPADMLAEACIEYDTDYVDVNGEVPFTKKLIKYHDWAKANNVLVVPNAAGAGGIPD
FT                   VGCFYTVRELRKRIGKDVPVSKMHMYLYGSAGGAPSGGTLATRAAMTAAMKDVAGLMAN
FT                   PFALGGSIEGGSRPEDADRNLSQVEYDPDYDAWKAPFTYAFYETRLIRRANWLLRDLGR
FT                   FPYGRNLNYLEHLILPTEKSARDLQSSNTSSKAEEEKLRKEGRLFKLGEGLDESARDSI
FT                   WSEYWFDAVTPEGEKIRTRLTGKDGYDETAHMAIELAILCSEYREKLPFRGGVLTPGVA
FT                   GGDPYIEALHSTGLNFEVLSNDAKVDFSRLANAIVASSAA"
FT   CDS_pept        699486..700238
FT                   /codon_start=1
FT                   /gene_family="HOG000149137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856766"
FT                   /orf_name="OSTLU_16273"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97071.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG725108"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001500D9F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q1"
FT                   /transl_table=1
FT                   /translation="MSTSSAVPLTLATFDVDGTLIRASGADANKFHKDAFAHGLLEVYG
FT                   IDDARGIDVVQHHGSTDMLIVAAVARFHGVPEEVIYERMDECTAAMSRYAVEKKADAAE
FT                   GLELLVGVRALLEKLAARDDVAVCLVTGNLEPIGWAKMQRLGIDEFFTAPRYGGFGSDH
FT                   TDRGELVAIAANRTKEYLGVRAEKRFHFGDTPADVKAAEFAGATAIGLLTGIFSKEELV
FT                   ASSKLDDPIIFDDLSDTAAVVRALGLEE"
FT   CDS_pept        complement(700266..700799)
FT                   /codon_start=1
FT                   /gene_family="HOG000265130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686083"
FT                   /orf_name="OSTLU_93077"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97311.1"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001500DA0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q2"
FT                   /transl_table=1
FT                   /translation="MVVFGGRELATGRDANDVWEYDLRWNASAGIYDGMWTRLHEGGTG
FT                   GGAKPRGRSGASACALRGNLYVFGGYGGGVGDFDDLWVFNRAAGRWSAISPVGGTRPPR
FT                   RSGAATTTPHGEQGAACLVFGGNGMNDVWEFNIDTNAWSLVRDNTATTSAGGATLAPRV
FT                   VVVASTLLAAAFAM"
FT   CDS_pept        701478..703001
FT                   /codon_start=1
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20008258"
FT                   /orf_name="OSTLU_32825"
FT                   /product="Predicted protein"
FT                   /function="NADP or NADPH binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="ABO97072.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG286913"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500DA1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q3"
FT                   /transl_table=1
FT                   /translation="MTATARATAANGAGEKSRIGLCGLAVMGQNLALNVAEKGFDISVY
FT                   NRSSDKTDVCVERAKKEGLGAKLRGYHEMKDFVASLAKPRCVIILVKAGAPVDATIAGL
FT                   SQFLEPGDCIIDGGNEWYENTERRSKEAAEKGLLYVGMGVSGGEEGARNGPSMMPGGSK
FT                   EAYDIIADILKPVSAQTDSGACVTYVGPGGAGNFVKMVHNGIEYGDMQLISEAYDVLKT
FT                   VGGLTNDELAAAFTEWNEAELESYLIEISSIILAKKDDQSGKSDDFLVDKILDKTGMKG
FT                   TGKWTVQQAAELSIAAPTIASSLDARCLSGLKDERVNAEAFYAKLGLAPAGAMGPADKK
FT                   QLINDVRYALYASKVTSYAQGMNLIRAKSNEQGWNLNLGEMARIWKGGCIIRAGFLDRI
FT                   KNAYDRDSKLPSLLVDEQFAKEMIEREASWRRVVTAAINAGVSVPSMSGSLAYFDTYRR
FT                   ARSPANLVQAQRDFFGSHTYERTDMEGWYHTLWSDMNSADSITTSGYKA"
FT   CDS_pept        complement(703181..704248)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686084"
FT                   /orf_name="OSTLU_32826"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ABO97312.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001500DA2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q4"
FT                   /transl_table=1
FT                   /translation="MGADDDGDARDGDARAALATLTNYEKLGRIGEGTYGVVYKGRCKT
FT                   TGDVVALKKVRMDRERDGMPLTSLREVRILQRVRHENVVRLLRVIQGDALNNVFLVFEY
FT                   CEHDLARLIDNVKTTLTTSEVKSLMTQTLRAVEYLHERFIFHRDLKLSNLLLNQRGELK
FT                   LCDFGLARTFEPIDRGSYTPKVVTLWYRAPELLFGCDTYTSAIDMWAVGCIFAEFLKHE
FT                   PLFPGSTEIEQLNMICALLGSPNSHIWPGWDALPHARKFKLPEQPYNFLEINFPKLSAA
FT                   GVNLLDVLLTFDPEKRGTATEALAHPFFQESPPPKPPAEMPTYPSTHSAPERGAERRNA
FT                   KRSRGALDERIGAVF"
FT   CDS_pept        704575..705567
FT                   /codon_start=1
FT                   /gene_family="HOG000265131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008259"
FT                   /orf_name="OSTLU_32827"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97073.1"
FT                   /db_xref="HOGENOM:HBG610001"
FT                   /db_xref="UniParc:UPI0001500E85"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q5"
FT                   /transl_table=1
FT                   /translation="MVAVFVLGAATLGTVVINVKRNAMKKMSGSMFEDEARRAAAAKER
FT                   VDGIAKLLEEVNAKANAAEEKLEAAMREKNAIERVLEEMERTKANMKVENMELRDSVTV
FT                   LKNDLNNATERHQLVVRKWRDELVTYREKSPQDFLAEVIGLVSDMDNEVTIEVIPPEAP
FT                   RAAKVHEEVRLEECEWEYNPRLAVADSTRLLMLANSGRVVKKTREEKVKKVTGVKPVAS
FT                   PHRATTPTRAALGKLTNTGVQRAQGVAHKAARLVQANHVANTPPPKVATSDRSIEFGEC
FT                   LLFEKQLKSPVRAPKIGGGRAGVIGGFEAEDVMPLPSSPATIMDIAIRR"
FT   CDS_pept        join(complement(706414..708540),complement(705643..706386))
FT                   /codon_start=1
FT                   /gene_family="HOG000192862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008260"
FT                   /gene_name="CHR3506"
FT                   /orf_name="OSTLU_12759"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="nucleosome binding"
FT                   /biological_process="ATP-dependent chromatin remodeling "
FT                   /cellular_component="chromatin remodeling complex "
FT                   /protein_id="ABO97313.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016585"
FT                   /db_xref="GO:0031491"
FT                   /db_xref="GO:0043044"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI0001500E86"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q6"
FT                   /transl_table=1
FT                   /translation="MELERVREDQNKKIAGDNKAGKWKFLLAQTEVFAHFLSGTKAANE
FT                   AANKGKRGRNKSHAAEESEDAELVEHAEDYQAVRLTSQPTCIKFGKMREYQIAGLNWMI
FT                   RLFDHGINGILADEMGLGKTLQTISLLGYLAEYRGVTGPHMVVVPKSTLGNWMNEFKRW
FT                   CPMIRTFKFHGNAEEREAQKAKFLVPGGFDVCVTSYEMVIKEKTALKKFHWRYIIIDEA
FT                   HRLKNENSRLSIVLRTFSANNRMLITGTPLQNNLHELWALLNFLLPEVFGNAGQFDEWF
FT                   ANVEDGEGGSGAVVSQLHKVLRPFLLRRLKTEVETSLPPKKETILKIGMTEMQKTFYKR
FT                   ILQKDIDIVNSGADRSRLLNIVMQLRKCCNHPYLFQGAEPGPPYITGDHLIESSGKLAL
FT                   LDKLLPRLMQRGSRVLIFSQMTRLLDILEDYLMYRNYQYCRIDGSTDGAVREDHIDAFN
FT                   KEGSEKFCFLLSTRAGGLGINLATADTVIIYDSDWNPQMDLQAMDRAHRIGQKKEVQVF
FT                   RFCTDGSVEEKVIEKAYKKLALDALVIQQGRLQENKKNLGKDELLAMVRFGAEKIFDSS
FT                   TTSITDEDVDAIMARGEEETKALNSKMQGFTEKAIQFSMGAENSLYEFEDEDDKNVAAL
FT                   PEGIDMKTIISSNWIDPPKRERKKNYNESDYYRSAMAQAARPSKPMGPKIAKLQQMHDF
FT                   QFYNTARIQEIYDKDKDKKKEEAKAAQDEEAPTEAEEDDPNAPPAITEEEKAEQESLLS
FT                   QGFTEWSRRDFQAFCRLSEKYGREDVESIASEMEGKTLKEVKDYAAVFWKRYEEIADHP
FT                   RIISNIEKGEQKIQRQHDMLKAVREKIAKYKNPWRELKLTYGPNKFKSFTEEEDRFLLC
FT                   SIPEVGFGNWDELKAQIRQHWQFRFDWFIKSRTPKELGRRVETLISLIEKEAQDRGDKK
FT                   RDAEAEAEADGSAQKKVKVEAEGVTA"
FT   CDS_pept        709586..711115
FT                   /codon_start=1
FT                   /gene_family="HOG000236212" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008261"
FT                   /gene_name="SUT1"
FT                   /orf_name="OSTLU_32829"
FT                   /product="SulP family transporter: sulfate; sulfate
FT                   transporter of the Major Facilitator Superfamily "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97074.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG564176"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniParc:UPI0001500E87"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q7"
FT                   /transl_table=1
FT                   /translation="MVPESLAFTFVAGTTPIVGLHAAALMGLCTAALGAQPGVISGAAG
FT                   ATAVVIAPLVASHGVEYLFACVALAGAAQAACGALRLGKFIRLVPQPCMIGFVNGLAIV
FT                   IGKSQLETFVGLTGTTLATTIGLTAFTMALIKLLPRASFAPKGVPAPLLAIASCATLTN
FT                   VMKIATKTVGDVAPVSGALPSFHIPNVPASLETLAVIAPYALSVAAVGLIETLLTQQLV
FT                   DDITERRTATHTECIAQGVGNMVNGAFGAMGGCAMIGQSMINVNSGGRTRVAGITCALA
FT                   ILSYVTFGASFIERIPMAALTGTMLCLVFDIFDWTSFSRVKKIPKTDAVVLLLVTGVTV
FT                   VTNLAVAVFAGVVLSALGFAWKSSQRIDVVRSRTSSSETLCELYGPLFFGSVQSFADKL
FT                   DPRDEELDRVVLDFAHSKVWDSSALVAIDELAEKYRNCGKTLTLRHLSPDCAKLLKKGG
FT                   DLVEVDVDTDPVYAVAANLDAETLSAVTKTLGGRKGLSLAEENALKRQYLR"
FT   CDS_pept        complement(711140..712372)
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856767"
FT                   /orf_name="OSTLU_35696"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97314.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI0001500E88"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q8"
FT                   /transl_table=1
FT                   /translation="MGILERIKDIELEMSRTQKNKATSSHLGALKARLCKLRSELLNPP
FT                   KAAGSGPGEGFDVVKYGHGRVALIGFPSVGKSTLLSQLTGTESEAAAYEFTTLTCIPGV
FT                   IHYNDAKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLILMVLDACKSEAANSRYAHK
FT                   DILTRELEAVGLRLNKKPPGIYWKKKKAGGVQLNSTVPGGLTKIDEKTVIRVLQEYKIH
FT                   HAEVLFREDCDVDQLIDVLEGNRKYVRCLYVYNKVDALTIEEVNTLSRRPDSVCISCYM
FT                   NLGMDYLLKRVWDAMGLVRVYTKKMGTKPDFEEPVVLSDSRGGIAVKHFCAQLHADLPR
FT                   QLKYALVWGTSPKHYGQRVGLKHDLEDEDVVQIVKSDRHHYEDGVGRFSTKKRNDPARI
FT                   QDRQKKEKLKT"
FT   CDS_pept        complement(712596..713153)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686085"
FT                   /orf_name="OSTLU_32831"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ABO97315.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001500E89"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0Q9"
FT                   /transl_table=1
FT                   /translation="MAASEREVDRTEVYLRYLPRSATEASVRELLKDAGTIERVWMSKD
FT                   AQGECKGFAFVNFRKNKEARECVLRYNAHPKNYLDGKHVVIEHAKAWDGHAEKKIAACS
FT                   YGSACAKADCWFSHPADWAFAKTTGTRASGDEKGSGKKRDSGAAVRDGKVRKKVRSKTR
FT                   LGAKARQRAKKRAEKEAADGGG"
FT   CDS_pept        complement(713276..714013)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19161529"
FT                   /orf_name="OSTLU_32832"
FT                   /product="Predicted protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ABO97316.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI0001500E8A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R0"
FT                   /transl_table=1
FT                   /translation="MSEISPLASPRAEANGEREWGAPRHERSLSESLESAQTSAWAREA
FT                   GRGGSDKGRETSARQGLPPTVIGAPAHHARARSYSQADAHEPSLRTVLEEPRGANGGTT
FT                   TEEEKRERRMQANRLSAAKSRMKKMRRMVELEQTCEETLTRVNALSAEVEALRAEYEEL
FT                   RARNEELTSTLSTPRGPHLDSASKEFLQSLSGVDGSFTGMTIDAKGYDDEAFAETLNIA
FT                   RASSMERLFDSDGFFVSSPRMDE"
FT   CDS_pept        join(714532..714585,714756..717253,718529..718595)
FT                   /codon_start=1
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008262"
FT                   /orf_name="OSTLU_12762"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97075.1"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI0001500E8B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R1"
FT                   /transl_table=1
FT                   /translation="MSRYMGNFARPENAIKRAEELINVGQKQAALLSLHEIVTSRRNRQ
FT                   WTKVLEEVMFKYVELCVELKKGRLCKDGLMQYRNTCLLVNVQSLEEVVKRFLKLSTERA
FT                   ETAQAEFGATLDADVDLEAEFTPESLLAKAYRLDHENEATEKETVTPWFKFLWETYRNL
FT                   LDILRNNNKLEGLYAMVVKDVFKFCLKHKRTTEFRRACDLMRTHLNNMVKYKDMRDRPD
FT                   LSLPETQNLYMEVRFEQLKAATTLEMWQEAFRSIEDIHGLMLLLRRSPKPQMMALYFAK
FT                   LTEIFWIGKNYLHAAYAWMKLYSVSKTYNRSLTPEDERALASGVVLATMCITPYTEKSV
FT                   FGDMDSDHQFDRDSRMASLLGYHIDRSRSISDVLSRELLAAEIKRSGLLAKVDDDVKRL
FT                   YALMEQSFSPLDLCKKADVLFNVLQGTTIEVSEASPVSSFDFNSFLPRLRSLGIIRMVH
FT                   QQSKVFETMKIDSLKSSVPFMPYHEVERILVQAIRSDYISVRIDHETGSMNFVGDRLET
FT                   GFVKTHLSRAARLLQEGMSKLAPKTPADVGARVLGAELRAAIEAEHKRALARKVVIERR
FT                   KEEAERAAAEQEKEEEAKRVAAQRKHEENEAKRLEQEARAREEKRIRAEMEEKEKQEAL
FT                   ELLAEQAKRAGKKAPIVLEEGVVLDKRAIMQDAIQEQIKARQEQERKLNSLAKRMDHVE
FT                   RAKREESISLIEKAYKERSVDDEKYHAEQQVAMAAKHRAKWEAESAEKQRLMRMEGPRA
FT                   EFARGVMIRRAEQFAAQEEERARKLEQMKKHKEAERLLQAKKDYIKRLQDIEAAVKHEK
FT                   REKDRIAQAERRRQQEEEEAARRQREQPPARGGDDRWGAPRVRPAPIARVANISWKTIP
FT                   H"
FT   CDS_pept        719383..720672
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686086"
FT                   /orf_name="OSTLU_35344"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="ABO97076.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG602178"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001500E8C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R2"
FT                   /transl_table=1
FT                   /translation="MEVLYDKNKPLFLFRDVPVNERAALFGKKLQLCSYCFDFTDPAID
FT                   AREKEIKRQTLIEIVDYVNQGTGRFTEQVLEHINFMLAQNLFRTLPPTSSEQTGLVNAA
FT                   MFDPEEEEPSLEPSWPHLQIVYEFLLRYVVSNDIDIKNGKTYIDQSFVLRLLELFDSED
FT                   PRERDYLKTILHRIYGKFMIHRPFIRQAINNIFFRFIYETEKHNGIAELLEILGSIING
FT                   FALPLKDEHKTFLKRALLPLHKPKCVGMYHSQLVYCVTQFVEKDPRMADVVIRGLLKYW
FT                   PVTNSQKEVLILGELEEVLELTQSAQFANVMVPLFKQISFCINSTHFQVAERALFLWNN
FT                   DYIVNLVAQHRHALLPVCFGALEKNAVGHWNPVVGGLTINVRKMLQEMDPELFAQCRER
FT                   WLADQERLAEDEKARQARWSRVERLAGASA"
FT   CDS_pept        720854..721888
FT                   /codon_start=1
FT                   /gene_family="HOG000265132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686087"
FT                   /orf_name="OSTLU_32836"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97077.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG622182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001500E8D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R3"
FT                   /transl_table=1
FT                   /translation="MRASSASPRAHRAFPSHTARKTSREKASSRSRAVAAASTSDAPGP
FT                   FGDDRNLLVVGPGVLGSRIARVWLSNFPGAVVVGQTNTDAAHDGLRSVGVTPRTKDFGA
FT                   DDPTATRRFPYVVFSAPPSGSEDYPGEVAAALKYWDGSGAFAFTSSSAVYKNEAGEACD
FT                   EESEVYEIGTNPRVDRLLKAEKVVLDAGGVVCRLAGLYHSERGAHKYFIKTSSLDSRAD
FT                   ALVNLIHYEDAADLCFAAMTKGAKSHIYLGTDGVPITREAIARVSVESGVYGADAAAPA
FT                   FTKTDGPLGRAMSNSRTKTELDWSPRYESFESFALRQGARDSYAPWNAPTRSRGWTPAG
FT                   ARHV"
FT   CDS_pept        join(722211..722516,722741..724474)
FT                   /codon_start=1
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686088"
FT                   /orf_name="OSTLU_16284"
FT                   /product="Predicted protein"
FT                   /function="transketolase activity"
FT                   /protein_id="ABO97078.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI0001500E8E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R4"
FT                   /transl_table=1
FT                   /translation="MSAKVVTRAAVAAPPGVSADTVNDAINTVRFLAIDAINKSNSGHP
FT                   GLPMGCAPMGYVIFREAMTHNPKNTKWFNRDRFVLSAGHGCMLQYSLMHLTGYPSVSIE
FT                   DIKQFRQWDSKTPGHPENFITDGIEVTTGPLGMGICNAVGLAMVEKHLAGRFNKPDCEI
FT                   VDHYTYCVMGDGCNMEGMSGEGASLAGHWGLGKLIVFYDDNHISIDGHTDISFTEDVVA
FT                   RFNAYGWHTQHVENGNTDVDSIRAAVNAAKADPRPSLIKVTTLIGYGSPNKSNTHDVHG
FT                   APLGKDETAATRENLKWKYGEFEVPEAVKAYMDCSEKGTAAEAEWNAKWATYKSKYAED
FT                   AAELESIMSGKLPSGWEKSLPTFTPEDKGVATRIHSQTMLNALGGAIPGFMGGSADLAP
FT                   SNMTLMKQFGDFQKDTPAERNVRFGVREHGMGAIANGMKLHSPGIIPYCATFFIFTDYM
FT                   RCAMRIAALSQAGTIFVMTHDSIGVGEDGPTHQPIEHVASFRAMPGMDMARPADGNETA
FT                   AMYKMAVENSMNGAPTTLALSRQVVPNLAGTSMEGAAKGAYVVQGAAAGEACDVILIGT
FT                   GTELELACQAGAELESKGKKVRVVSMPCWEAFERQPAAYQESVLPAAMRAKTVSIEAGT
FT                   TFGWAKYAGASIGHDDFGASAPAPILYKQFGITADAMAAKAMSL"
FT   CDS_pept        725374..725694
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686089"
FT                   /orf_name="OSTLU_32838"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97079.1"
FT                   /db_xref="HOGENOM:HBG610004"
FT                   /db_xref="InterPro:IPR009769"
FT                   /db_xref="UniParc:UPI0001500E8F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R5"
FT                   /transl_table=1
FT                   /translation="MLRKCVPTKPVLVGKRASTRFFRGAGDTEGYEDRYLECCIECGTS
FT                   ASAKYLYNMFSGLSARSDEDLAIWIEGAREDELPERVLGAVRLRRISPKCLTKLTKLPL
FT                   VR"
FT   CDS_pept        complement(<725786..>726736)
FT                   /codon_start=1
FT                   /gene_family="HOG000036278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686090"
FT                   /orf_name="OSTLU_4604"
FT                   /product="IISP family transporter: SRP receptor alpha-chain
FT                   -like protein FtsY"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="receptor activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /protein_id="ABO97317.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI0001500E90"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R6"
FT                   /transl_table=1
FT                   /translation="KLASVLRKKTAMDVERVFNGTSKTRERLSAVNDVLALWRMEDFDD
FT                   ALEELEETLLGADFGPKAATRVTDGVRARVERGECKTGGDVRRALKASIVEVLTKAGDA
FT                   MKIGLNETAGEPSVVLVVGVNGGGKTTTLGKLSHRFAESGAKVMMVPGDTFRAAAAEQL
FT                   ATWAERTGAVMSDSPPNTKPGAVCYKAVDEACARGDVDVVLADTSGRLHNNSQLMDELV
FT                   GVKNSISKRLPSAPHEVLLVLDGTTGLNMLNQARVFNEAVGVTGIILTKLDGTSRGGAV
FT                   VSVVDELGIPVKFVGVGESMQDLQSFDAVGFVDALF"
FT   CDS_pept        join(727581..729344,729507..730448)
FT                   /codon_start=1
FT                   /gene_family="HOG000265133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161530"
FT                   /orf_name="OSTLU_46066"
FT                   /product="Tic110 family transporter: chloroplast inner
FT                   envelope protein Tic110"
FT                   /protein_id="ABO97080.1"
FT                   /db_xref="HOGENOM:HBG561483"
FT                   /db_xref="UniParc:UPI0001500E91"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R7"
FT                   /transl_table=1
FT                   /translation="MPANVRGGAKAALTAVVGGGAAYGVSVADKKRFTAAPKSLWNSLQ
FT                   GRDPLSVTAEEVNAMGAKFGIANMGQSCATAMTELYDVYLMSLVPQGLDPVQGWEAAAL
FT                   AQFRQTLGIDDASAAQAHLEAGRRLFRKRIELGSTDKETDLESRKEFQKLVFISTQTFG
FT                   EEQARFLLPWKRVFRVSDAQVDLANRDNASQLLRTSLSKSNAIANVDAAAIASAADYKA
FT                   SLNLDDDAAGEIAQDLATAHVAGIVNGTITLNKERGSARDVGTICKNVEQVLAYNVKLE
FT                   GAQGSFPGVGPVTLFGGEFDSKMTELKDVFRTYLEEGIKGYSFSAALNDNLGKLRLVFG
FT                   MGNKEADDIILASTTASYRLALRDAVKSGSLDNAESPAKVLQGLCEGLRFPPEVAAGIH
FT                   EENYRTKLESIISSNKKLEDADVEALARVRKLLCVPKGVVEKLHFEICGEIYRTAVRSA
FT                   LSVPTESFTPALRDRCKAAKANVRLDDETALKILGAEARKQMSGFIRTSKSIRNKTDAQ
FT                   KEIRKMIFYNQGVVTPLVQDVTKAKAEAAAEELASLLKEAQEAAAKEEAEEKAKAAAEA
FT                   TAAEPEAAAEPTEVTLAEDMDVVTRQAMYREYLMFCMTGDQVNAPMGVRINIERDQSEF
FT                   KRLSQLGDILGLNMMEVGQVHKDLADKAFRTQAEQMLGDGRGLTADRAEKLKEIQTQLN
FT                   LPEDEAQKIIKGITSQRMMSNVQQQIASGTLDAAEVRKMIEAGVEIERMIPEDKRMNLF
FT                   RKNAERRLGDGSGSADIEALTGTLVEDLKIDGEKAKTELKNIAAEKKRSQMIQGVAVLR
FT                   QKKAADVLLCCRNLVACQAVAPEAKLEWKVESEVFDMYSVFVQECSDVEERKVLQSALS
FT                   ISDESARKLEQVVADGAFKFSEDSLDEALF"
FT   CDS_pept        complement(730586..731710)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856768"
FT                   /orf_name="OSTLU_32841"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ABO97318.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniParc:UPI0001500037"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R8"
FT                   /transl_table=1
FT                   /translation="MATKAAGVALALATCALATATSGAIGRVANRDGASPAPAAPLAIA
FT                   GGALLRRRFRTREAAFARIFEPGARACADRGLKLGIAALGAKLSLREIGETATAAAPAI
FT                   AATVTTGLAATPALRRAASERFGPASGLTRKVGALLAAGTSVCGVTAIGGLAPAIGASQ
FT                   REIGVAVANVAAYGTLGMLAYPWAAKRLFPEGGVPAGVFLGLSVHDTAQVVGAGMTFRD
FT                   AFEDEMAFKAATVTKLTRNLTLALAIPYLAYAFRSADAGAGAAAKRPALVPGFLIAFVA
FT                   MAALRSLGDATESVRDDARWKRFHKATGDFASNVVLPTSMAAVGLCMSASALSGVGVAP
FT                   FVVGACAATSVGVVAACSVKALDAAGAFRGIGAS"
FT   CDS_pept        731889..733664
FT                   /codon_start=1
FT                   /gene_family="HOG000265134" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686091"
FT                   /orf_name="OSTLU_32842"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97081.1"
FT                   /db_xref="HOGENOM:HBG610006"
FT                   /db_xref="UniParc:UPI0001500038"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0R9"
FT                   /transl_table=1
FT                   /translation="MTAGARTTTTLERYTPRDADPDEVFEEMILDWRANPRVKLRRRRE
FT                   WGWDARDAATTAALSAAWTLGPATLAWTAAKAYVNRGSAMERRKKKWGVVMALAASELG
FT                   WYAHRRGVGKRFDDDENMKATPTRRDFDRFLQLRYDGVLDFNAYIRGWMKTWKSFAFGE
FT                   RENPFRATPSSPPLSRASTPGIDRAESPAFHRETALDFLRFGFHDALSAEEIGERKERE
FT                   LRTFMEEIEAHWNLKFDDNAARESFEFMFHTKEKLGALHQPLLFTAWVNGVAGVTGLAL
FT                   HALGFKLYHGANGCSYWANCEIVENNWKRRRARTATRETRHGRGVETRPVLCGDAGDAS
FT                   DGDTKPIIFVHGLGVGLAPYVPHIAQLLRSRPNRKIAMLTLPHISMRAVPKVPELDDMV
FT                   DTVVEITKKHAFRAPALYGHSFGTFVVARTCQRFCVSSIVLLDPVCVCLCLPQTVGILY
FT                   QLNKSWVDFRNRLMEGPRTLATASFWRDGNALLYFLLRDYFLLREIGVMTALRRKFWWA
FT                   RYNLWADDLPVDSLIVLESNDLLLDTDAICRHVLRQSKARIIWQEKFAHGEFCMPWGYG
FT                   LRSDVVDFLDALKNA"
FT   CDS_pept        complement(733767..>734390)
FT                   /codon_start=1
FT                   /gene_family="HOG000106336" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686092"
FT                   /orf_name="OSTLU_35596"
FT                   /product="ABC(Binding protein) family transporter: iron
FT                   compound"
FT                   /function="iron ion transmembrane transporter activity "
FT                   /biological_process="high-affinity iron ion transport "
FT                   /protein_id="ABO97319.1"
FT                   /db_xref="GO:0005381"
FT                   /db_xref="GO:0006827"
FT                   /db_xref="HOGENOM:HBG708630"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniParc:UPI0001500039"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S0"
FT                   /transl_table=1
FT                   /translation="TLSDVLDVILQIGILCGVKEKAVTLLTQLRSRLRTIARVVATADE
FT                   RPKVMSLEGIKPLVAGGHWLPEMKSIAGGIDELHEPGVSAERMRWEQVLSYGPDVLLLV
FT                   PCYIGKSSEETMERTLEQLEHLASQPGWWVIPAVRDRRVFVLSHEMICQAGPQLVDGVE
FT                   TLARILHPDLFPMELRQGVCYKFNLEEGRSCRPKQLRQHFVEWR"
FT   CDS_pept        join(complement(735594..736859),c
FT                   omplement(<735405..735542))
FT                   /codon_start=1
FT                   /gene_family="HOG000289958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686093"
FT                   /orf_name="OSTLU_35645"
FT                   /product="Predicted protein"
FT                   /function="cobyrinic acid a,c-diamide synthase activity "
FT                   /biological_process="cobalamin biosynthetic process "
FT                   /protein_id="ABO97320.1"
FT                   /db_xref="GO:0009236"
FT                   /db_xref="GO:0042242"
FT                   /db_xref="HOGENOM:HBG634910"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="UniParc:UPI000150003A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S1"
FT                   /transl_table=1
FT                   /translation="MKVVVVAGTHSGVGKTTIATALMLAYARRGLRVRAFKVGCDFVDP
FT                   MAHRSALRSQSGDARESENLDGYMMSAGAVARVVAKHAETCDVAIVDGVMGLYDGRDGM
FT                   SEDGSTAQMAKWLEAGVLLVVDCNAMARSVAAVIKGYREFDAELNLVGVVFNKTGGEAH
FT                   TEYLRESLLAAMAHVDVFGGIPKDTNGPTFDPTSAATTSDDAMEQKIQHMAMLLEQNVD
FT                   LDALFEAMPAYEISPRVARDLALERAMREELEAGPSKPKVRIAVARDEAFCFYYPENLA
FT                   KLEDAGAELVYFSPIAGEGLPSDVQGVIFGGGYPEFHAQALFKNRPLRSAVTAFATAGG
FT                   VVYAECGGLMFLSQSLSAPDGSSPRSMCGVAPFATRLTSSVKTGYAEITIAPGNPLFNE
FT                   GEVVRGQTFRYSEIHGDRPSKMRQERKFGKGKNSINLDGFAWNNVLVSQLHLHFGANPS
FT                   LASSFVESCR"
FT   CDS_pept        join(737589..737642,737765..738082)
FT                   /codon_start=1
FT                   /gene_family="HOG000248742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18313186"
FT                   /gene_name="PRPL18"
FT                   /orf_name="OSTLU_16290"
FT                   /product="Plastid ribosomal protein L18 large ribosomal
FT                   subunit"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ABO97082.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG602198"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniParc:UPI000150003B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S2"
FT                   /transl_table=1
FT                   /translation="MTPKEAKRQQRHRKIRSKISGSSERPRISVYRSNQHVYVQVIDDE
FT                   NQKTIAALGTMSASVKAVIGSEEWKGKTVESAEQVGKMLGAVCVEKGITQAVFDRGGFL
FT                   YHGRVKAIADGARAAGVAM"
FT   CDS_pept        738395..739432
FT                   /codon_start=1
FT                   /gene_family="HOG000265136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008263"
FT                   /orf_name="OSTLU_32845"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ABO97083.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000150003C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S3"
FT                   /transl_table=1
FT                   /translation="MHAQARTARAVDVARTTSKKQKHHSQRAVSARAAATSETTTSVGV
FT                   RIGSASVKGTVRKQNEDRFSTYAPKTKPEDGTPSLIASVFDGHGGKAVSEWLRENLNEF
FT                   ILGEWKQADFPLDALRTACLKADQVLVAPQEGFFASFGERGVGGSKCGSTAVIVALYEE
FT                   GGSKRLATANVGDARILLVRDGKALQLSVDHVPDDEAERKRIDRGNPNLRQSLVKFTEG
FT                   SWRVGGVLALSRAFGDSFLKESGRFEGIGEKNADYGSGFGLNAEPDCYIEQITAADSWV
FT                   MLSSDGLFENPERGGGGGWTNQEIADFLTSAPADAEPETLAKELIAQAVAKGSTDDVTV
FT                   QLLRL"
FT   CDS_pept        complement(<739635..>739913)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686094"
FT                   /orf_name="OSTLU_9570"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ABO97321.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="UniParc:UPI000150003D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S4"
FT                   /transl_table=1
FT                   /translation="WQCQSCMYEYKPKVGDDFYPVSAGTQFKDLPDDWRCPTCGAEKVK
FT                   FKSLGKQVAGFEQNQGYGLGTNAMTEGEKSQLIYGALAFFFLCFIAGY"
FT   CDS_pept        740471..741154
FT                   /codon_start=1
FT                   /gene_family="HOG000265137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856769"
FT                   /orf_name="OSTLU_93082"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ABO97084.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG610007"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000150003E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S5"
FT                   /transl_table=1
FT                   /translation="MPGRTWTRGDATTTAKEAVKTKPAVKSSPAQTKKRQATWSREDGE
FT                   AKRGGNGKEGTQARLRASAAAFEPASAKAQREALEAKMKAVEAEKAKLKAALEAAAAKK
FT                   AQDAREKKEKEEAAKADAARRQRAAGNLLSGFRGVRKQCEERVDEIAKPVENLSQEEIE
FT                   RRAVQRVVLAGTDWQVLDLPPGSQKKWVTKSYRELAKILHPDKCAAPGAKEAFQKLNKA
FT                   YKALS"
FT   CDS_pept        join(741166..741179,742194..742893)
FT                   /codon_start=1
FT                   /gene_family="HOG000249463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686095"
FT                   /orf_name="OSTLU_12765"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ABO97085.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG559580"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI000150003F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S6"
FT                   /transl_table=1
FT                   /translation="MTTTLALFNDIAPVYDRLNDGLSLGLHRAWKRAAVKWIDCSPGME
FT                   ALDVCCGSGDVAIKMSTFVGATGRVTGLDFAANQLKYAAEKERDLRAASADASARMGKI
FT                   TWIEGDALNLPFDDESFDCATIAYGLRNVSDIPRAMGELRRVLRRGAKLAVLDFNNPED
FT                   PTTAAVQGFMLDNVVVPIADLNGVAAEYRYLRPSIERFPRGREQVNLARDAGFREAKFY
FT                   ELAPGGLMGCLVCTK"
FT   CDS_pept        complement(742952..744211)
FT                   /codon_start=1
FT                   /gene_family="HOG000265138" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686096"
FT                   /orf_name="OSTLU_32849"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ABO97322.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG610008"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI0001500040"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S7"
FT                   /transl_table=1
FT                   /translation="MAPVWALCAVSGTNAGTRLGRATATAFSAAGSVAYVDAWTPSSEK
FT                   KTFISALVWMLAMRLMSGAFAMDAVMVAFARACAWGLAGAAAPSETTLLSVGAASVMEM
FT                   CVGIYRDVGTRARASESSALAGAFAIAGVGLLLASARLVCWPTPASKATQFGVLSLALS
FT                   VPEWFYRVSNPGKSNMILGVVRYTMKTNMETLTSLTKLWCTGLAVALGVAYNARAMPLT
FT                   MRRKAFHFLAIVMFAPTLMPNSGLGELIRVAFAVAFALFACVECARVFDAYYGHGLFGW
FT                   KLSVLLAQFVGDGVVSLIILDHFSLLLGIAVPVWLSGDSKSLVPWAGVLTLGVGDSFAS
FT                   IVGGAIGRRKVFGERSSKTLEGAIAFAVSTFVAASYVGVDISASKLAGACVATALFELS
FT                   VEGVSDNFVLPLYFAALVAP"
FT   CDS_pept        complement(744539..745516)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313187"
FT                   /orf_name="OSTLU_32850"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97323.1"
FT                   /db_xref="HOGENOM:HBG609473"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001500041"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S8"
FT                   /transl_table=1
FT                   /translation="MKDGDDATRKSRHLRDKRDAKLYGKMRELMTSDRGAPGAKAKVRN
FT                   ALKRVDSEFNQRGPDIALDRRDAEVMGLCRDVVSKEAWKRWSANACQDAVKNDSIERLK
FT                   FLHECECPWGKCRFEATSLKILYVCAEHGSTECMKYLLKHGCKFSNHACTTAAEFGFLE
FT                   CLKYLREHGHHWDRWTCTGAARNGHLEMLKYAHENGCPWDENTCSSAAKRGHLECLKYA
FT                   HEQGCPWNTLTCYNAASNGHLECLKYACTHGCPDSAPYAKALKEVVLPDADERFVVEVA
FT                   LVFHRSGEISMREFLPLWAEHRMFYRKAHYEAVRKFHASLRLNR"
FT   CDS_pept        746131..746649
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313188"
FT                   /orf_name="OSTLU_16296"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97086.1"
FT                   /db_xref="UniParc:UPI0001500042"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0S9"
FT                   /transl_table=1
FT                   /translation="MIVDVPRDARAKTRAWAVVIVAFVFASSAAAGVRASESGVGGAPS
FT                   ARRSLVDVTGAAFFDVFGFELSASAAFDPICEFLNPFLHPDYRLSACAEEQAAAAEYED
FT                   EYEAYGEGRDRIVMDPEGTFVNGVTGNVAGGIGGGGIGGVAGGSAGFIGGGLGGVGGGV
FT                   GAGPIGRRL"
FT   CDS_pept        complement(746800..748851)
FT                   /codon_start=1
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20008264"
FT                   /orf_name="OSTLU_16297"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ABO97324.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001500043"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T0"
FT                   /transl_table=1
FT                   /translation="MAHIDAGKTTTTERVLYYTGRSHKIGEVHEGAATMDWMEQEQERG
FT                   ITITSAATTCAWNDHRINIIDTPGHVDFTLEVERALRVLDGAICLFDSVAGVEPQSETV
FT                   WRQADKYHVPRLCFVNKMDRMGANYFRTIDMIVKNLGARPCPLQIPIGAEEDFAGVVDL
FT                   ITMKALVWKGEELGASWDVVEIPDDLKEKAEEMRANMIEMAVEQDDDVMEKYLEGEEPT
FT                   EEEIVKCIRKGTCSLSFVPVLCGSAFKNKGVQPMLDAVLAYLPAPTDVPDVQGTDVDDA
FT                   EKKLTRKADDDEALSALAFKVMTDPFVGSLTFTRVYSGIIESGSYAYNSVKGKKERIGR
FT                   LLEMHANEREDVKVARTGDIVAIAGLKDTTTGDTLCDQGKQIILERMEFPDPVIKVAIE
FT                   PKTKADVEKMSTGLIKLAQEDPSFHFTRDEETNQTVIEGMGELHLDIIVDRLKREFKVE
FT                   ANVGAPQVNYRESISKPGEVKYTHKKQSGGSGQYAEVKIKFEPLEPGSGFEFTTDIKGG
FT                   TVPKEYIPGVASGLEQMMGSGIIAGFPVVDLRATLFDGSYHDVDSSVMAFEIAAKGAFR
FT                   EGISKCAPKLLEPVMEVDVITPEESMGDVIGDLNSRRGAVNELGDKPGGMKTVKAFVPL
FT                   AEMFNYVSKLRGMTKGRANYSMKLARYEPVPMAIQTELAASRKEKEAK"
FT   CDS_pept        750073..750753
FT                   /codon_start=1
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008265"
FT                   /orf_name="OSTLU_32853"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ABO97087.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI0001500044"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T1"
FT                   /transl_table=1
FT                   /translation="MASYPAPIVVEPRGGDANAAMILLHGLGDTGRGWAGAAGQIPTPA
FT                   GAHVRWVFPTAKTMPVTLNGGMRMTAWFDLNALDERSIVDDRGEIDASVEYLNALVREQ
FT                   MDKGIPSEKIMIGGFSQGGAIALTAALRSEVKLAGCVAMSTYLPLRADYPDRFGAHAKS
FT                   LKIFQAHGTSDMVLQYSYGKMSAELMQAAGVDVDFKTYNGMAHSACAEEFDDVADFLKA
FT                   RLAG"
FT   CDS_pept        complement(750849..752492)
FT                   /codon_start=1
FT                   /gene_family="HOG000265139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686097"
FT                   /orf_name="OSTLU_32854"
FT                   /product="FBT family transporter: folate/pteridine "
FT                   /protein_id="ABO97325.1"
FT                   /db_xref="HOGENOM:HBG610010"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="UniParc:UPI0001500045"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T2"
FT                   /transl_table=1
FT                   /translation="MATSKRDDDARGARVRADDDDPSSAASASARASCAPLSDVVAFHE
FT                   RLRGVFGWQLLAFVFSADFFVKGAAKHMISTTSLPYAQRYLKFSAQAFQRFEVLVSFPW
FT                   MLKPFMGMVTDTTPVFGYRKRYYLATFAVTGLVAIIVLATKTFSSDDATWYTVFVLATN
FT                   MLLAFGDSLAGARVFEAMSEVQRIGGDLMTYSWTVATVGSIFGTLLAYIGLSRGDYKLI
FT                   FWLVTPFVAQFAFTTAYGLLPEERVGSDFNAHALAKKYWNVFVVTVTITLASVGVVSMQ
FT                   LVDAFETDLALCVSTCFGILLIMTGVVYAHLERDEACLLIYVAVDRVLGVNVRQAKTYW
FT                   YTEGAKCVPDGPHFSYVFYSVTTFLFSLGAQMIGIWLFQKYLSRSKIRSVFLACALTKV
FT                   IAKLGDIWIILRWNIAMGIDDRSAYVMGEGIIEGIAYVLTYMPANAVLSKIVDKEVSCT
FT                   MYTLLAGVVNVASGVALTLGSASMTFVGIHTDLVHGHCNFDQLIPLLIVCGIILPLFSI
FT                   PLIYVLIPDWCMHDDRSGSIEESVKAEEKK"
FT   CDS_pept        complement(752605..753483)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686098"
FT                   /orf_name="OSTLU_35682"
FT                   /product="FBT family transporter: folate/pteridine "
FT                   /protein_id="ABO97326.1"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001500046"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T3"
FT                   /transl_table=1
FT                   /translation="MCLLLGVVQFLQPENKYVDLAISFGITLVLSVSIYVALPRSIANV
FT                   TFFLFLTSVLSVSFGSAMSYWFTVDEKCNPGGPHFDYLFFSVYTSIIARICTAIGVYLF
FT                   QVFFSNANVRVTFWVSAILSSMASISDYCIVKRWNLRVGLSDKAFYLIGDTVLEPMVGM
FT                   MASMPSMVLMSKMCPENMEATMFAILASFNNLGYSLSSALGVFAMDVAGIKTDLTSGEG
FT                   GACDFSGLPSLVFYCGMLLPLVSIPLTFVFVPNINMQDVVDLDTGKAVASSADDANEAP
FT                   TERVPLLAKST"
FT   CDS_pept        complement(754511..755269)
FT                   /codon_start=1
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686099"
FT                   /orf_name="OSTLU_32856"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97327.1"
FT                   /db_xref="HOGENOM:HBG752660"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0001500047"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T4"
FT                   /transl_table=1
FT                   /translation="MARSTTTRPRADAVAVSIIVPTYDERMNIATLYHLAREAEAAFDD
FT                   DRGRWEIVVVDDGSPDGTADVVRALRDAHEDAFLVLCERGRKLGLGTAYAHGLRRARGR
FT                   EVVVMDADLSHHPKYISEMLTKRRREKLDVVSGTRYALGGGVCGWDLRRKLTSMVANYI
FT                   AKAALNPGASDLTGSFRCYRRDAFEDLVARSTSRGYAFQMEIIYRAKKAGYTVGEVPIA
FT                   FVDRVYGESKLGASEIVDYLRGLARLFFTV"
FT   CDS_pept        complement(757826..758740)
FT                   /codon_start=1
FT                   /gene_family="HOG000265140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856770"
FT                   /orf_name="OSTLU_24874"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97328.1"
FT                   /db_xref="HOGENOM:HBG610012"
FT                   /db_xref="InterPro:IPR006735"
FT                   /db_xref="UniParc:UPI0001500048"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T5"
FT                   /transl_table=1
FT                   /translation="MTLGLLGGGGDGGATGAESRSAYLEMYAWNGGTTFSRKKESLGGF
FT                   VRYSAQSTVRDRDEAEEDLARWFTCALTEEPLESGENGVVVDRVGALYNKEPVLKALRD
FT                   KAIDGVALPKRIEHITGMKALVTCKFEKRRADKSSKVESSSVNARNFRCGNAEAVFACP
FT                   ITGLDFNGKTKFVVMRPSGVVVADKALREAKAAVEEMNDGLKLADAPPPIPVNPRGEEL
FT                   ELLKAILDEEKAKKDSKKKAKRGKSDATRGDAGENAAKRKKFVAQAPKNADAAVYASLF
FT                   TSSADPADDKDDDFLARNARKAW"
FT   CDS_pept        759225..760670
FT                   /codon_start=1
FT                   /gene_family="HOG000254245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313189"
FT                   /orf_name="OSTLU_35440"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ABO97088.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG716333"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019872"
FT                   /db_xref="UniParc:UPI0001500138"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T6"
FT                   /transl_table=1
FT                   /translation="MDDDLVAAFSANLLSKSYVNQGAQSLRAHDKVFARLLANRRMLGR
FT                   GLNDVAIEFLVHKLSVMDSNNFIDNVGVGEREGRVFSDMVRRRCYSMTHGIGRSGDITA
FT                   EQPKACGSSAAHALAQCMARDALRLAGMRDLGKRALVLPLATGMTLTLVLSSLRLMVRN
FT                   SADGGVDAAAPNVVIWCRLDQKTCVKAATCAGLEIVVIEPVLNGDQLDTNVHAIERAIE
FT                   DVGVDRLVAVVTSTSCFAPRACDDVETVAKLCEKKNVAHVINNAYGVQSRVLCERVSKA
FT                   WTVGRVDAVVQSTDKNFMVPVGGAVVCCGKRNEALVEAVARNYPGRASASASMDMFITL
FT                   LSMGEEHWLRLLDEREKLYDYMHAELSKVAEEEGERMLRTPGNPISMAMTLSCARGISP
FT                   TMFGSMLFSRCVSGTRVVAPGEVKTVGGIEFHGFGASHSAYPETYFTAAAAIGTTRADV
FT                   DRFASVLRKTFKDFKKKSQPAAA"
FT   CDS_pept        complement(760690..762120)
FT                   /codon_start=1
FT                   /gene_family="HOG000265141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20008266"
FT                   /orf_name="OSTLU_32860"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97329.1"
FT                   /db_xref="HOGENOM:HBG610014"
FT                   /db_xref="UniParc:UPI0001500139"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T7"
FT                   /transl_table=1
FT                   /translation="MRALADAIAGSAIGEDGRRAAEIALETLKMEATRALSGLAGAAST
FT                   TNAARDDACDEMFLWATQRGAMFKFVANVSEGGMREARASAAVDAGDAAARVPWDALLG
FT                   VEQAVLSSSAPICEVLKQLTAMGDQIIMTIWLAAAMSGQDSRLYEAWAPTLRALPRAPC
FT                   TALAWDVDTMRLVMDHDQVERLIDYQRKVRVQYDALFPALCEQVPEAFPASVFGDYSRF
FT                   ALAYDIWTSYAMKVQDPQTLQIYEVIVPGVFLCNHALYAHSVRYTSLERGTRAFRLELA
FT                   RGARPGDAITISYGRLDNADLMAYYGFTLPSNPYDRVVLSSLASQANEEQTAALARASE
FT                   MCGVDLTELPACIALDGSLDRVLTQMRIMSAPQRFMEWCERIDGYHPYTVVDGELEYKV
FT                   LCELRSHLCHLVAERQASEGSLSHRLSTVHHESTHSVANATRWYLSGQIGIMQSALARV
FT                   DVLLASYGSGKRSRDEIE"
FT   CDS_pept        763644..766673
FT                   /codon_start=1
FT                   /gene_family="HOG000167329" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16686100"
FT                   /orf_name="OSTLU_35452"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ABO97089.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG356508"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000150013A"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T8"
FT                   /transl_table=1
FT                   /translation="MEIDEDLHSRQLAVYGRESFRKLASARVLVIGARGLGCEIAKNVV
FT                   LAGVRAVSVCDSGACEAADASAQFYVDEASVKANVTRARASVGKLQELNPAVEVNCVET
FT                   CDEDAVKAHSVVVCAGETSEAEAVAINAMCRANNVAFIKTDVRGVFGNVFCDFGDAFNV
FT                   LDVDGEEALSCIVASVSNDSPALVTCIEDERVELQDGQRVTFSEVRGMTELNGLSVVVK
FT                   NVKKHSFELDLDTSAFSPYVGGGIATQVKETKTLKFASYADSLESPGDFLLSDFAKMER
FT                   SPQLHLAFGALDAYVAKHGASPTPGSDSDAEKFVAEAEALNATRKAVDEVDKDLLKTFS
FT                   KTCRGHVSPMAAMFGGIVGQEVVKACTGKFHPLFQWFYFDSVESLPETLTEEDLAPRGD
FT                   RYDGQVMCFGTKMQDKILSQKIFLVGAGALGCEFLKNFACMGLSCGPSGGVTVTDDDVI
FT                   EKSNLSRQFLFRDWNIGQGKSVCASNAAKVINPNLNVTALENRVSPDTEDVFDDGFWEG
FT                   LDVVVNALDNVNARLYVDSRCVYFQKPLLESGTLGTKCNTQMVIPNMTENYGASRDPPE
FT                   KSAPMCTLHSFPHNIDHCLTWARSEFEGAFEKAPAEANSYLSKPEEYAAAALSNPDASA
FT                   RENVEKVAQVLLKTACSTYDECIAWARTQFQEQFHDKILQLTFTFPEDAVTSTGSPFWS
FT                   APKRFPRPVIFSTSDASHMTLIRAMANLKAELSGIARPAAGVNDDAALVQLVDKVAVAP
FT                   FEPKKGIKIETDPKANTAASSIPEGIDDEAVIKDVLAKLETKRAGLGGDYRLNVIEFEK
FT                   DDDTNFHMDAIAGLSNMRARNYDIGEVDKLKAKFIAGRIIPAIATTTAMATGLVCLELY
FT                   KVFKGAKIEAYRNTFANLALPLFAMAEPIAAKQDKFKDLSWSMWDRWILEGDFTVQQVL
FT                   DHFEAKGLIAYSMSVGASLVYNNIFPKHKERLNQKLSELVQTVAKMEIPAKRRHFDIVV
FT                   ACEDDEGEDVDIPMVSIRFR"
FT   CDS_pept        766941..768065
FT                   /codon_start=1
FT                   /gene_family="HOG000049437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686101"
FT                   /gene_name="SAT1"
FT                   /orf_name="OSTLU_87889"
FT                   /product="Serine acetyl transferase "
FT                   /EC_number="2.3.1.30"
FT                   /function="serine O-acetyltransferase activity "
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ABO97090.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0009001"
FT                   /db_xref="HOGENOM:HBG754554"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI000150013B"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0T9"
FT                   /transl_table=1
FT                   /translation="MTTHARFASNAHAARAPRRPRARANPRARRQGNGGDSARRAVSDG
FT                   GLDAAREAARERDVAAKWAGGASKASSSSSPSPSLVDRAKRAAGRAKTGEDASTSSGEG
FT                   FEGESCLLGDGIWERLREEAKTDLEGEPALASYLYSTVLAHKSIEDVLAFVLANKLRNN
FT                   VLLDSQLLELFSSQYKKYPELGKKCLADMQAVYERDPACDRYLAIVLFFKGFQAIQAQR
FT                   VAHSLWLEDRKALSFLLQNRISEVFHVDIHPGAVLGQGMMMDHATGVVIGETAVVGENV
FT                   SILHGVTLGGTGTSQGDRHPKVGDGVVIGANVTILGNINVGADTKIGAGSVVLDDIPEG
FT                   STAVGIPAKVINRGAPQQPSLSMDQTSYITDYFI"
FT   CDS_pept        768392..769603
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686102"
FT                   /orf_name="OSTLU_32863"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97091.1"
FT                   /db_xref="UniParc:UPI000150013C"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U0"
FT                   /transl_table=1
FT                   /translation="METVTAALIVCLLVWLAAVFTRWRTRTRDERGRAPSRWTSESEHR
FT                   SAPEKASEAMPCADAREIEKSTHERLPRASAPARMLDKKRDVMAKASGHGPPPPPVSRW
FT                   NQRPLHMTIPSYAGCKITRGALTYNSEIPFEFETSVFAGRCLIRFRDCPPPPAAAAPDA
FT                   ARRLEEYFRGRARTFQCVVQGKFKRRIRADETVTGHEFFQPLLGIPGKRFVKTLVHILR
FT                   AMNPSLRMSLFARKPQVWTFLGASAQVISIDTPGDEPDITRGSFEENNSKFGGAFASGR
FT                   LTSAQRRRLLADVKKAKQYSFSTDDVYTFDFYQHVFDPKTFTLNILGLDAFRVDVARHV
FT                   GDQPPQIMARTSRPGEYLFCFCMWHERALARETNDERPSRAHTSPSPPASPRNPRGASS
FT                   KLRF"
FT   CDS_pept        769779..771026
FT                   /codon_start=1
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19161531"
FT                   /orf_name="OSTLU_32864"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ABO97092.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG330750"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000150013D"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U1"
FT                   /transl_table=1
FT                   /translation="MAHLVAASNARPSTRNVSAAAADEPDADADAAATTSSGAKKGRYR
FT                   RDKPWDHDGIDHWSVTPFTAEDNPNGVLEESSFAVLFPKYREKYLRETWPSVTKALKEQ
FT                   GVSCELNLVEGSMTVRTTRKTFDPYIIMKARDLIKLLSRSVPAPQALKVLEDETNCDVI
FT                   KIGGMVRNKERFVKRRQRLIGPNGSTLKAIEMLTGCYVLVQGNTVSVMGGWKGLKMVRK
FT                   IVEDAMKNTHPIYHIKELMIKRELEKDPELATQSWDRFLPKFKKKNVQRKKPAKIGKKE
FT                   RAVFPPTQPMSKIDKQIESGEYFLSKEAKERKAAYDKLQKQKDTSTDNHKKRQAAFVAP
FT                   KEDDKPARSKSSKAKEEDVDAITASLKAKAKAKKEEDKRSKASASSFVMGGEAKSSKRD
FT                   REDKTEKKSKKSKKDK"
FT   CDS_pept        complement(<771093..>771977)
FT                   /codon_start=1
FT                   /gene_family="HOG000240556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686103"
FT                   /orf_name="OSTLU_10269"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ABO97330.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG286166"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000150013E"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U2"
FT                   /transl_table=1
FT                   /translation="NTVGAEYDAWTEEEILEYYWGEHIHLGYYKDEDLKRGAGTLFGHR
FT                   VKDFIEAKEDFVDEMYAWSKAEANNGGAKPRKILDVGCGIGGATRRLASKCAGATAEVT
FT                   GITLSTKQAARATALAAAQNIPNAKFEVMDALAMEFDDDTFDMVWACESGEHMPDKKKY
FT                   VEEMVRVLKPGGTLVIATWCQRHTPPALTKEEKSKLQFLYDEWAHPYFISIQDYCELAE
FT                   GTGAMKNVDGDDWTKQTIVSWRHSIWAGVYDPLPVFTRPKIWYKTLRDIICLERMRRAF
FT                   GEELMQYGMIRGVK"
FT   CDS_pept        772719..773177
FT                   /codon_start=1
FT                   /gene_family="HOG000154889" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686104"
FT                   /orf_name="OSTLU_32866"
FT                   /product="Predicted protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="ABO97093.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000150013F"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U3"
FT                   /transl_table=1
FT                   /translation="MTLNDGTVIDDTRSDARQGQPVTITLGDDSLFARIGEELATMTPG
FT                   DVRENVTLAAKDAFGERDDAKVQRFPLSPEEAQSMASQVQVGQLVQLPDGARALCLGLD
FT                   GESVTLDLNHPLAGQDLCFELELVSIAEGLNIFGTPMVSFTPPQPASR"
FT   CDS_pept        <773296..>773895
FT                   /codon_start=1
FT                   /gene_family="HOG000198092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18313190"
FT                   /gene_name="HslV"
FT                   /orf_name="OSTLU_10404"
FT                   /product="ClpYQ (HslUV)-type protease, proteolytic subunit
FT                   HSLV"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="HslUV protease complex"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ABO97094.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0009376"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG288822"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="UniParc:UPI0001500140"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U4"
FT                   /transl_table=1
FT                   /translation="RPARDRASFSAAATSSPHATTVLCVRKDGETVIMADGQVTMGSEI
FT                   VKPNVKKVRIIEPGVVGGFAGATADAFTLFERLEQQLEQHPGQLTRACVELAKQWRTDK
FT                   FLRKLEATMIVADKESSFQITGSGDVLEPHDGVIGIGSGGSYALAAARALVDVPGMKAF
FT                   DIAKKAMTIAADTCVYTNHNFTHQIIGGPDATTKAEE"
FT   CDS_pept        complement(774061..775335)
FT                   /codon_start=1
FT                   /gene_family="HOG000265142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686105"
FT                   /gene_name="PPR5"
FT                   /orf_name="OSTLU_24879"
FT                   /product="Pentatrichopeptide repeat (PPR) protein "
FT                   /protein_id="ABO97331.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0001500141"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U5"
FT                   /transl_table=1
FT                   /translation="MAPHPRRAAGAKTPREAKKKPSSGKRAGYKPHGSVVYETTEALSR
FT                   IAESALDANERRRAIFDALARAMSADDNPRPLRADPRAFTTFISRLNRGKRFDAALDVF
FT                   AAQKALGVERNAVNYNAAMVANVKAEKPEEALKLFEEMREIGHEPSVISFNVAMGACAR
FT                   AGDGARALKLFDEMVGQNMDVDAVSINTAMAAAELVGDEARLEELRAGSHFKRAGDVDE
FT                   PAPTRVVKDDAKKDSDASDDEDSDDDSDDDSDEGEPEAVADDVGDANVVLSEEEEAKRA
FT                   AARKRKREIKKKLLAEYAANVGGARDDEDEEMAKRRRKDERRAKFEEKRRARKEATRAK
FT                   RPWSAAAAHAKKKENKTSKAAKRTAMKADPKVWIEDVPSEDEVLYDDDGERVLPAIKGP
FT                   SFLDDPNAAKLMNASGGEDFWSVGF"
FT   CDS_pept        775455..776303
FT                   /codon_start=1
FT                   /gene_family="HOG000201088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856771"
FT                   /orf_name="OSTLU_32869"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97095.1"
FT                   /db_xref="HOGENOM:HBG610017"
FT                   /db_xref="UniParc:UPI0001500142"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U6"
FT                   /transl_table=1
FT                   /translation="MDIFGSRLRAQEGAFFKSEAERDIEKLAARRRARNADGAEALLAS
FT                   GDDEKDARASSSSSASGNDYAKAGSAARGGVDKLGSVYAEELRLPGTTTNARATHLRRT
FT                   VGRGDETKRDGLRRAASDGRDSIFAAQTLGSKLNRRDWMREVSADLRRAAAERKALSPM
FT                   EIKALETSQMAQRHAMVGGLRALAYGTVLAFVGVVGGSVAASSLFQIDSHGDFERKFRA
FT                   TFEPHVQAARASAEPYKRWIAADGGEGVASRVSLLENSAMVSRLRAKLGRRKDDGHSGP
FT                   F"
FT   CDS_pept        complement(776503..778425)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686106"
FT                   /orf_name="OSTLU_16311"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /protein_id="ABO97332.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI0001500143"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U7"
FT                   /transl_table=1
FT                   /translation="MSARDHAVMFVVDVSALDRCVVACAGDDEDEARRNGHVATTSARA
FT                   IVASCIRGCVNAKTQLRTPSQRDHCFGLTLFGARDTSNDVAAAALDDDGEGDEYAGIVT
FT                   ARQLRPPESKTGLEYERDILETAAAVDGAADVPEALAVACDSLIRQYSPEGVNAATKKR
FT                   LAGCVKDIVLITDATGAATMQSAVDDEFVATLLDGMKAQNVRLKVGVVDACEMSRARGD
FT                   AGVRVTASATFREPDFEALRQACDVLAAADAGNDSAVVGASALLLDLQIKRVRPTSGYR
FT                   GFLSFGFNAGVNVALYKLNTEAVPVKLNRYSEELADRPEESHQTLVETTYRNVNDLDGE
FT                   FVPPERHVKAFRYGKQHIPIDAETESRLSMRFEKSMKVIGSISMDECPLWLSVGEPSVC
FT                   VPQPSTKTTGLSQERAAADATALSALARALDDAKLALLVRGAFTEGTTSIHIGALTPRL
FT                   TDAGDFLLYTPLPFKEDYNEYSLPSVPASARVDAEDPRLVDAREFVRANSLDGDRRATT
FT                   MPWESLNPTLRAYRDLFEARALGAQASLKRRPSLALGVAEASACDFAARFGLNAAQDRS
FT                   ARPRLAADEGAAKAPSPLRVSASLPERPQSQPSFAVLVDVVKTEDGEEEALVSPPDLDV
FT                   FDDME"
FT   CDS_pept        complement(779219..780019)
FT                   /codon_start=1
FT                   /gene_family="HOG000265143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686107"
FT                   /orf_name="OSTLU_32872"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97333.1"
FT                   /db_xref="HOGENOM:HBG561954"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI0001500144"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U8"
FT                   /transl_table=1
FT                   /translation="MATATATHRASIVVDAQSRCRSRQRVRGRASSSSSSSRASASVSA
FT                   ATTDDKDDAKRELLRAVAALRRGNASARDVASAIKRVESFESNGDARGRWTLAYSANLD
FT                   DDSNVKASASPLESLGVSDEIVQEVTKTLYSVFFKFAPWLAGSAETNRTGARNVQVVDV
FT                   DAGVVRNEVELDVASLPTLPMSTLTIGVDGEIETEDALARRAFVTFTSFDVQLRFARGE
FT                   AKTPKVSIPLPRPRGSLNTTFCDDSMRISRGGRGGVFILTRLHG"
FT   CDS_pept        780070..780912
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16686108"
FT                   /orf_name="OSTLU_16312"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97096.1"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniParc:UPI0001500145"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0U9"
FT                   /transl_table=1
FT                   /translation="MDATTTTGATASRASAKARELAIARALAACERTAPDSSVNERKRQ
FT                   QILESLRDGLKSIEGDVDAAIWKAYATRIDRLDVLHSTTRGEVASTSGAPLNETSVDAP
FT                   PPTAGAAATTRRAYRPSFAKTTTPRGVVACITEVVSKDDDECAASSAARRSLHGPPSTK
FT                   TLTAEDEVELRRQRAIQDGLTDEMSELASGLKANALALERGLGRSSAAVAELESRLGAN
FT                   VHGVKSSAKRQDAAFRANRRGSCWTWLILALVGVLFAWTYVVIKVSSDRTKRSRAKAL"
FT   CDS_pept        780986..782440
FT                   /codon_start=1
FT                   /gene_family="HOG000265144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20856772"
FT                   /orf_name="OSTLU_32874"
FT                   /product="Predicted protein"
FT                   /protein_id="ABO97097.1"
FT                   /db_xref="HOGENOM:HBG407598"
FT                   /db_xref="UniParc:UPI0001500146"
FT                   /db_xref="UniProtKB/TrEMBL:A4S0V0"
FT                   /transl_table=1
FT                   /translation="MRDAHPAKRIAIVGGGISGLALAKFLRDVDSDRRRFELHLFDTGE
FT                   RACGGRASSKALAGVDVDHGLQYFTLSSDVARESFARSLVDAGALTRWSDDVVGTLDAA
FT                   SGRFTSFSDGAERFVGVDGFRGMSEELVKHCDVVHRPQWVGAMHPVRRDDDGNVVEWAL
FT                   ASNESDRAKQLGTYDFVVVAHNGKCAHRLASTAKDEDGRSACEKVKSSLRCGFGVKPRD
FT                   ELSRENKLVLSSVWSVMVVFDGVHEFGDGFEGAHVVDGGPLSWVSNISAKRGALLKEGA
FT                   KETRVVLQSTAEYARENKVPQEAVPRTKSKEVMETLVGALEKSLKLEPNAMLSKVALYK
FT                   TQLWGAANPLNVCNVPCVLDLRTSTAAIGDWCTSGPACVESAVLSANALAQALDDYFPD
FT                   ATPGAATKALNAARPRWTLPNGATSAQGGFPGTSVPEMREASPVPERRRGGGRGRGPRG
FT                   RGGGRGGRGRGRGAHESTARLVRMAL"
XX
SQ   Sequence 783246 BP; 152675 A; 238331 C; 236941 G; 155299 T; 0 other;
     ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac cctaaaccct        60
     aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac       120
     cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta       180
     aaccctaaac cctaagcatg agggagggag gcgcttcggg agaagtgccg taaccgaccg       240
     actagctaat acttattaca cctcacccta ggttctctgc gtcgtactga ggcatgaaaa       300
     gtcacgatca ttcgcatcct tcctgtgcac ctgcacgaca cccgacggcc agcactcgtc       360
     gaccagcacg gcaccgcaga cttccccctc gacgctccgg acgtctccgg actaaaacct       420
     aaaaatagcg atatggtgac gtgagcggtt tccgcgagcg ttttcgtcaa aaacgcatca       480
     aaacgttcaa tggcttgcaa gaggcgctag tctacaagct atcgtgtcac acaccgcgcc       540
     tttttcgttc agaccgccgt ggagaagcaa aaacacacgc ttcgacgatg gcgacaccac       600
     ggcgctcgcc gacatacctt ccttgccaat tagagcgcac gactccgcga agagcgtcca       660
     ccgacacttt cgctcgtcca cgcacgctcg taaatcgaac gtgtacgcat cctgggttgc       720
     gttttcgtta tcgccaccac caatgacgaa ccactgattt ccaatcgcta cggacgcgtg       780
     cgccgcgcga ggcgatgggc gatcaccgtc ttcgttgtcg ccatcgacag ttccccactc       840
     gcccttgacg acgtcgtaca cgtcgactgc gccgcaatcg cataactcat tgccagtcga       900
     accgccgcaa acgagcaaat atcgttcgtc gacactcgtc gctgcgtgcg aacttcgtgg       960
     acgcgtccca ttcgctaatt tcttccacac cgtcgtcgtc ggtgtgaact cccaaagttc      1020
     atctaagtcg tctcccgtct tcgcgtcgac gccgccgaag atgaaaattc gatcgccgat      1080
     cgcagtcgaa gtgtgaccgg atcgcgcacg cggaggcgtt gaaacctcat cgcttgtttc      1140
     acaacgcacg tgcgtccact tgaaatcttt cgacgcgtaa tcggcggtca aatcaatggc      1200
     gctcaccgtg agactgtaca caccgtcgac gtcgcagtca tccgctgatt tccctctaaa      1260
     ggcgtacagt ttcgatccta tcgtcgcgct cgccgcgccc gcgcacgtcg acccaggcca      1320
     ctgcaatttg cgttcggccc acgcacccgt ggccaggtcg aacgcccaca aatcaccgag      1380
     taatcgcgag cgtgagcctc gaccgtgcga gaagaagatg gtgtcgccgt ccaccacagc      1440
     ggacatatgt ccagaccgcg cgcgtggtga gaccttgctc aggattggaa gtctcacaaa      1500
     ctcatcgtcc gccgcgctgg cgaacatttc atctaaaaac gccgtcggtc ccgtggagga      1560
     attgaacgcg agcgcgcggc gagcgtcctt cgtctgcgcc agtcgcgccg attcccctag      1620
     tgccccgctc gctaacgcgc gataatactc cagcgcgcac tctttcgccg tcgcaatcat      1680
     cgctcgtttc tgtttttcgc tcatacctcg cacgagcatg tcaaaccaat cggcgtatct      1740
     cgaacttatc acttcgcaat acagctccat cgcgcgctct gggctaatat tccccagcat      1800
     gctccacgcg tcgtacgcca gcgcgcccgc gggatcccac aaatcccacg gtcgcgttcc      1860
     ttgacacggt ccacgcgacg cttgtcgctc cagcgcgtcc aggagcaagg ttttgtcctc      1920
     gtcaaacagc accgcgtcct caacgccatc ggcatcgtgc gcgcgcgaca tcgcctgtcg      1980
     acccatggtg actatggcgt cgagcttggc ggcggcattg ttggatgtcg aagcgctcgc      2040
     gcgcgcgcgg aacgcgcacg cgagataaaa ccgttcagga ccgcgcatgg gaggcgcgag      2100
     atgacgcgat gcggttggtc cgcgaacggt cgttcgggac gaccgtgcct ctcgcgcggt      2160
     tcgccgcaca cgatggcgcc gcgaacgtcg atatcgacga gatgaacgac gacgaaccgc      2220
     gaaacgcctt cgagcgcgca gcgcgctcac tcgagtgtcc ttggtacgtg gcgatgatgc      2280
     gcgacgcaga aactacgctc gacgacctcg cgaaaagtgt cgagaacgac gagaacgagg      2340
     acgacgcttt cagaacgaaa gcaatttctg cgctctccga catcggcgtg gagacgaaag      2400
     acacgatggc aatcgtggat cacgtgcttt catcgcgcgc gcgcgcgcgt gcgcccgcga      2460
     tggcggtgac gcacggcgac gctcgagacg tcataaagcg cacgcgcgga ggcatttatg      2520
     acgaatcttt tctcagcgcg atcgagccgc tgtatgattt acacatgggc gcggaaaata      2580
     tgggaccttt gttgtacgca atcgctcggt tttgtaagcc cgcgcacgtg ttggaagttg      2640
     gcgcagggta cacgagcatc tttttgctcc aagcgatgcg agacaacgcc gatgaaattg      2700
     cgacgtatcg agcgatgatt cagcgtcagg aggcgcgcat cggcgacgtt ccttggacag      2760
     cacctgatta tgactatgaa aagctcgacg cgtcaactct tcacatcgtc gacaactgcg      2820
     cgcacgagca tactacggcg catcgagtga aagaggttgc tcaggcgctg gggtgcgaat      2880
     cgtttttgcg cgtccacgtc tgcgatgcgt tcgacagcga gctaccaagc acgttggccg      2940
     ttccagatgt caagtacttc gacctgttgt ggatcgactt aggcgccgca aaccgcatcg      3000
     aaggcttctt cgacgcctgg tggagtcgag tgaatccatg cggtggtttc gtcgtcgtgc      3060
     actcgacgct gacaaatacg ctgtcgcgta aatggctgga aaagatgcga aagctcgccc      3120
     gagacggggg tcgcgacgcc gagactggag catcgcctta cggggagttc gtcactgtga      3180
     gtttcctgga accgcataag atgttccaaa actcgtgctc gtttttccaa cgacgccaaa      3240
     gctcgtggac cgaacgcacc ttgacgaagt atccatagcg tagcttagcg taggcatagt      3300
     tcgaataacg gtacattttg ttttcctata ttttccattc tagaacatga tctacatttt      3360
     gctctcgtcg ctatatttgc acccttcttt cgcgaggtaa gtgttccaaa cgccgccgtc      3420
     cgcgcattcc cacaggctat tgtcctccac aatcggcatg ctcaccgaag gaactttacg      3480
     ccagacgcta cacttgtggc actgtttcca gttcacctct tcgtcctctt gcatgcccgc      3540
     gtcgccgccg acgattttgc ttacgtcaat gtcaacgttg ccgaggctga gaatgttcac      3600
     cgcggcggcg ttgccagtga cgactgcacc gtgcacacat tgcggtccag taattgaaca      3660
     cgcctctccg gcgaagtaaa gccgtccatc gtgctctgga gcggccaaag cctcgacgtc      3720
     gagaacagtc gtgccggtgc gcgcatacga atacgcgcca aaagagtgct cgtcgtttcc      3780
     ccagttcgtg acgatgtagt catctggcac aggaagtgac ttcaaccgaa acatcttctg      3840
     caacactcga caaacgccgc gaacaatttc aagttcatct ttaccgtcga agtcgtgcgc      3900
     gtacggcggg gcgacatgcg ctaacagggt gtgttttttg ccgtacgcgt ctaaattcag      3960
     aaagcgataa cgtggatcgg tgacttggaa gaatttcgac ttcggccaaa acatttcttt      4020
     gaagcgcatg taaaccttat tttcggtacc cattcctatg cgttgaatcg cgcgcaactt      4080
     ttgatcgctc aacggcggcg tgaactcgat gcgattcttt tttaggacac ccagtggcac      4140
     ggtgacaacg acgtaatcgc acggatgctg cgtcccgttt gtgcacgtaa cacagtatga      4200
     cttctgcttt gccttgatct gttgtccaaa ctcgttcatg aaagatgtct cgtcgacttt      4260
     cacacgattg acgacgtgct catacttgat atcgagcgcg ccatctttct ccccaattaa      4320
     tcgatctatg agcaggtctt tgtatccatt cacgaccatg ccgtcagaaa aatctaactg      4380
     tttgttttcc accttgcccg gcggccgttt tacggcggag tccactgtgg acgcgtcact      4440
     ttcgctttcg acatatgatg tttcatttgc gttgactggc ccatcagggg cgagaatgtc      4500
     tctgatttcg tcttgcacat ttcgctcgaa gacgaaggac aactctcgca taggcgcaac      4560
     gaacgcccaa gtgattactg gtatcgaatc atacactggt ttcacctttt caaaacgttt      4620
     cttcccgtta agtaaagagt tcacgatttg gttcgtcgcg tagttgaagg cgtcttccaa      4680
     ggagcaatca gaattttcct cgatttcatc gtaacctctc gccgacggcg acgcgataaa      4740
     atgctgcgcc tgtaactgtt cgttttgtgt gctttttatc ggcacgcaca gcgaccgctc      4800
     aatgtcctcg gcatttttaa taaacattat ttcagtcgcc ttgcgcgaga tttgaaacgc      4860
     ctgcgcaacg tcttgttctt tcacgcgtcc gccctcggcg ttataccacg acgacttttc      4920
     tccccatcca gcgctgtaac cgccacctgc cgtgttgagc gcgactttat gcttcttggc      4980
     aatcgcatac acaggattgt aatcgtggca accatgaatg aacgatgcac cgagatcaac      5040
     ctgcacgctc ggtaagcccg cgctcgccat ctcccgcatt tcaacggtgt tgcagcgccc      5100
     acctggtcgg ctgcgcgact ctaaaacaac tacggatgca ccatgatttt tcaaacttct      5160
     cgccgcagcc agtccagccg gaccggcacc gacgacgacg ataactggtg acgggtttcc      5220
     gccccacggc acgttgaccg gtttcgctgg cttttcctcg attcgtttct tcggtacagg      5280
     ctttttgacc gcgtcgttga cgtcgcactt cttcttggtt gcctttgttt ccaagtcatc      5340
     agcagaaagc ttacgtttgg gtgtcaccgg tttcgatttg atgaccttca tcgtcgtcga      5400
     cgccaacgca tctttcggaa caccattttc gaccaccacc gctgacaccg tcgtcgtcaa      5460
     ctccggaaga gttgaaggga catccagccg ctgacctccc tcgtcatata ctcgcttcca      5520
     cctttttcgc aaatcttttg cgtagacgcg agctcggtcg aggtatcttc ttatggattc      5580
     gttagagcgt aaacgattca tgtgtgtgcc tatctcgact tcaccagtcg ccgagcagtt      5640
     cgtaaacttg agtttctctc cggtggtgcg atcgattctg atgaacgctt tatcaatgtt      5700
     ctgtggatta tccttgcgcg cttgcgcgaa aacgtacacg tcgccatccc accacgtaat      5760
     tctattgagc ggtgcgtcaa attcctcgtt cgtctcgagc acgtcgtgca gcggtttcgg      5820
     cggtagcgct ggcgccaaga ctctgaagta ctgcctcttc ttcatcaact cggtcgatgt      5880
     cttaccggcg ttcttcacca acaccatgcg atcgcacgtc tctcgtaagg tcttcgcgtc      5940
     agtgtgaatc gcgtagcgcg cgcagttcga gggtggaagc aacaaaactc gattggaatt      6000
     gagcaatcga acggcgcgta gtttcgcgtc tgacaccttc ttgacgtact ccttcgcatc      6060
     caaaagcact cccggtatca actcgccgtc aaattcgtct gctatactca ccgcgcacca      6120
     cttggcgctc gctactttcg ctgtcttcgt cttcgctact ttcgctgtct tcgtcttcgc      6180
     cgcgttcgct gtcttcgtct tcgccgcgtt cgctgtcttc gtcttcgccg cgttcgcttg      6240
     gctcgggcgc atctcgcaat cactgaattt cacgtcatgt cgcttcctcg cgggcggtaa      6300
     aggcgcgatg acgtcttctt cgttgtcgtc gtcgtcgtca accgccggca tgtgagactc      6360
     ccgtgagatt cctcgagcgc ttgccgcgtg gttcgacaac gcgaccgcga tcgcgccgcg      6420
     actgtcaggt gcgttcggtc gactccgtcg cagtccgttc gcgcgtgcgc ccagcgtcga      6480
     cgcagagcgg cgcgcgcgtt gacgaacttg gcccggcgcg cgagcgcccc gctgtgcggc      6540
     cgttcgccac tcgacgtcgc tcgtcgtgtc gagtcaaggt cgtggtgtct cgatgcgaca      6600
     tggcgacgcc aaggtggcgt tcgtgagcga caatccaggg acgtcgtacg gtgaagtcaa      6660
     cgccgtggtg ttcgtcgtcc tcgtcgccgc gtgggcgtgc gtcacagttc gcgaacgatg      6720
     caagtcatgg gcgtcgacgt cgacgaagac gacgctttta gtgggtacag agacggcgat      6780
     gctcgccttg gcgactttgg cgagcatgtt tgcggtgacg aaggccttgg ccgtggcctg      6840
     cgccgtggcg ggaggctgct tcttgtactg ggcttgtaat gcgcgcccag cgctgggaag      6900
     ccgcgccaac agcgccgcgt ttacttgcga agatgcgctc acgctgtaca ggtttacgct      6960
     cgctatgatg accgtcgtcg ccatcttggc cgtagacttt accctctttc ctcgacgttt      7020
     gggcaagacg gagacgtacg gtgtgtccct catggacgtc ggcgccggtt cgttcgtatt      7080
     ttcttcgagc gtcgtctcgc gattcgctcg aggcaaggaa aagcgaaact tgcgcgcgag      7140
     tcggcgtaaa gtgatgcaag tcatgctgtt gggtttagcc aggcttgcga tcacgaccat      7200
     gatcgggtat cactccgtcg agaccgagta cggacggcac tggaatttct tcttcactct      7260
     cgccgtcatt caagtgtgtg cggacacgct tccaatcgca gcgcacaggg cgttgccctt      7320
     cggtttattg atttcgttcg cgtatcagta cgtgttatcc tgtcacggct tgagcgcttg      7380
     gatcctgcaa gcccccgatg tgcgatcgca cgagtccgag acgaatgtcc tgacaaggtt      7440
     cgtctcgatg aaccgagaag gcgtctcgag cgcgtgcggt gggtactttg cgatccatct      7500
     catagcggcg catctcggca acgcgctctc gaaaccggtg ttgaactttt caaggtggct      7560
     acaaacgatg gcgatcgtga cctgtgcttt ttggtttgcg gccatcgcat ctcacgcgta      7620
     tgtcgaacca acatcaaggc gcgctgggaa cgcagcgtac gtgctctgga tcgtcgcctt      7680
     caatctgcaa gtcatcattg tttatgtttg tatgacgtgg tttgcgcgaa gcgcgaacgg      7740
     acgggggaag tgcgacattc cggtattggc gagcgcgatc aatcgtcgac aacttttcgt      7800
     gttcgtcgtc ggaaacgctc tgactgggct gacgaatttg gcagtggaca cgataaatgc      7860
     cgacgctaac acggcttggg gagtgatgtc gctgtacttg tcggcgatta gcatagttgc      7920
     gctcgcgatg gatcgtagaa aatgatttgc agattcgcga agcagtacag cgttccgcgc      7980
     gatgagcacg tcgccgtcga cgtgcgtcgt tcgtgcgtcg acggagggcg cacgatcgag      8040
     tatgacgtcg cgtatctccc gtgcgacgtc gccgtcgacg ccgcgcgagc gaggctcgcg      8100
     aaaccaacga attgacgtag cggatagaac gtagcggtga aactgaattt ggaagatgtt      8160
     ggaatgcaaa acgattcacc cacgtcgcca tcgtcgaagc gtgtgttttt gcttctccac      8220
     ggcggtctga acgaaaaagg cgcggtgtgt gacacgatag cttgtagact agcgcctctt      8280
     gcaagccatt gaacgttttg atgcgttttt gacgaaaacg ctcgcggaaa ccgctcacgt      8340
     caccatatcg cgacgcgcta ctggggagcg cgtgcggtgg cgccgcgata aagcgcacga      8400
     atcgtaggcc gtaactcgcg ttcgatcgca cgccgaagca cgacgcgacg cgtcgacatg      8460
     ggcgtcgatc gcgctcgcgc tcgtaggttg accgagagcg agaacgatga cgacgacgac      8520
     cgaagtctcg acgcgcgcga ggaggttgga gatggtgacg acgagagtga cgaagaagat      8580
     gtggacgggg atagtgttgt acgcgcgtct ctggaacgcg caagcgagcg agatgcggag      8640
     attgcggatg agagggatac gcgagtgcga atacttctca ttcgcgaacg ggacgccgag      8700
     ttcgcgcgag atccaaaatt taaatcgcga tcaatcgccg agttgaacaa cgaagccgtg      8760
     cgatatttga aagccggaga cgatgtcaag tgtgtggtgg cttacgccaa ggtgtttcga      8820
     aaggtttctg aaaacaacgt cacgcacccg acgctatacg tgtgccactc aaatcgcgca      8880
     ttcgcgtact tgaacttggg tctatttcaa gaagctctgt gggatggcca tcgcgcgcag      8940
     acattggcga atgagcgttt cacgcagtta caagatgacg acgggagtgt caaggttttc      9000
     gtgaagggtt acgcgaggaa gggtttcgcg ctcatgggtt tgcgggaacc gaaactcgca      9060
     aagctcgagt ttgagcgcgg attaaccatg agcccgaccg atgaggaatt gaagcgcggt      9120
     ttggaagagg caacgcaagc agtcattcgt gatttataca tcggacgcgg aaaagagaaa      9180
     caatatgccc tgccgagctc cgggaaaacg agtgagagaa tttcgtcgct gccgtactcg      9240
     gcgccgcttc accgtgtgca tcctcgcgat atgctgccca acacgctatt gaccccattc      9300
     caagccgaaa atgattatca tctgaaggac acgtacaatt atatgacgat tcaagccgat      9360
     attcgcgtcc cgaagagaca tttcaaggtt ttacaagacg acgttcggcg cgccaagttc      9420
     tctacggcga ttaaatgcgc aatcgacaag atgcacgacg acgccaaaga tgcacgagtt      9480
     ttgaatatcg gttgcggtgc gggattaaat acaatgttgg cgttgaaaca cggtgcgcat      9540
     cacgtgacgg ctaccgagcg ctggctgtac ctcgccatgg ctacgaagga gaatttgttg      9600
     aacaacggat acagtgatga ccaagtcaaa gtcgtgtaca agcgtccgac tgatctcgcg      9660
     ttgcttcgcg atgtcccaat atcgtgcaac gtgtgcgtgt gcgatgtatt tgacgacggt      9720
     ttgctgagtt cggggatcat tcccgccgtt aggcatgcct tggacaagct attgttgcca      9780
     gacgcagtcg tcattccgtc gagcgcgacg ctgtacgccc aagccgtcga tatgcgcacg      9840
     cccgcctttg acggaatcaa tctcagcgcg atagacggtt acagatggca cccaacgtac      9900
     attgcaggca ttgatttatt cgagaacgcg tacatcactc tgagcgatcc tgtgcaagtg      9960
     ttccaatttg acttcctcat gccgccagac tgtagcgaga agaagacgat tgatttaacg     10020
     tttacgaagc gcggcaagtt caacgccgtg gtgttttggt acgagatgac tttgattgat     10080
     gatgtgaaaa tttcaacaaa acctggtggt gaagattgtc cttcttcgat gcgcgccgct     10140
     gtccagttca tgcccgggaa aatatcaata gaagaaggca gcgtgttgcc actcacgtgc     10200
     gcgcacaaca cagtcggtat acagtttagt gtcgaagatg cagagtacga tcaagtgacg     10260
     aaaaaagatg ccagttttcc aaaatatcac tttcacatgc ttcgcgatga ggggcgtctg     10320
     cacgcgtatt cggacgccct cgggcgtcaa gttgcgcgaa tcaaggctcg cggagacacg     10380
     tgcagggcgc tcgacatcgg cacgggaagc ggtatactcg ccatgctcgc cgcgcgagcg     10440
     ggtgcggatt ccgtcgtcgc ttgcgacacg catccatcgc tcgtgagcgt cgctagacga     10500
     aatgttgccg cgaatggtta cggatctcag gtgagcgtcc tgaagcgcga cgcgacgcaa     10560
     ctcgaacgcg gcaagcatgc gccatacgac ggcgttaatc ttatcgttct ggacgtcttc     10620
     gacgccggac tcaccggaga tgacgtgttg gacatgatag aagcagcccg taagcaattg     10680
     agcgcatcta cgtgcgcagt cgttcccgcg gcggcgacga tttattgcgc aggcatcgaa     10740
     gcgtacacaa gcgaagtcga cggtttcaac atgagcgcct tcaacaagta tagatgggac     10800
     agcacgtacg aggcgacgta catgcgagac cagccttacc gagtgttgac aaaacccaaa     10860
     aaagtattcg aattcttctt tgatgactcc cagaagagca agggcaggga aaccgtgcta     10920
     aagatggaga caatcgcgca cggctacatg aatgcggtgt gtttttggtt tgatttgcac     10980
     atggacgaag aagagacgat tacgacggca ccgctaggga ttggaaaggg tggtacaatt     11040
     gaaaatcaac gcattctcgg cgactttgac ggtgcgcatg cgaaaaaggt catgtgcgaa     11100
     tctcttcgca gagttcgagc gaacatggcg tcgaatccac gaagcgaaga ctttgaaagc     11160
     gactctgcgc gcgagggatc aagcgacagg accgtttttg tctccgatgc cacgtcctta     11220
     ggagatgatg aattcgacga cgacgatcgc gaggagcact attgggggca ggcgctgcaa     11280
     tacctcgaac gcggcgtcca ggtgcgcgcg ggaaagaaaa tcgcgctctt ggccaagcga     11340
     caaaacggcg gcgtgcactt tagtttaaaa gagggcgtcg gaaattgggt aggaaaacca     11400
     ccgtggaaga ttgaatgggg cggcggcgcg tccgtggaga gcccacattt ccagcgcgtg     11460
     cactattgcc aattgctcgt caacgatttt ctgatgcgtc tacgatgcaa acggttcgcg     11520
     ccgatcgaaa aagacatgaa gatgattctc gcgcattgcg gtgcgctgtt tctcgagcct     11580
     catagcttga ctgacatata ccatcactta gtcatgctag aagtgtactt tgattgggaa     11640
     gacttctccc cgggaacgaa ggttgaatcg atgacgaagc cgtgtttgcg cctgtgctaa     11700
     agcacacaaa ctttttaaca cacatttact tctcctctta tgcattaaaa caacgtaacg     11760
     tacaacgact atttgtggcg ccgaatttcc gaccaagacc atgactaccc tcctctaaaa     11820
     ctgcaagttt gcgattcttt ccttctccgc ctgtcggcgc gccaactcgg ctcgtccggc     11880
     cgcggtcttt tgcagctcgt gcaccgtctt ctccttccca cccttcaccg cagcgccttg     11940
     cgtcgtcaca ccacccgaag cggcgtgcgc gtccgtccag tctgcgaaca caaacgggag     12000
     tttggcgtgt ttgctatccc agtgcgcgac agccgtcttc tcgctcggcg cgccctgcgc     12060
     gcacacggga catttgaact tggcgtgtcc cgccgctcca ccgagtcggt ccgccttacc     12120
     gctcttccca ccgcccttgt tcgtgagcgc ggccgcagcc ttactcgcga gctccttcgc     12180
     cgtgtgctgc gcgataatat tcgccgtcag tctcgtggtc gcgtcgcgcg tcacgcgtgc     12240
     gtcgcgccca tcgcgcgtcc gtccgcggcg gcggtcatcg cgcggcgtcg tgcggcgtcg     12300
     cgcggcgtcg cgacgcgacg aacgaacgac acgatgaacg aacctttttc ggcttcgcct     12360
     ttccagccat cgcgcgccgt ccgtcaccgt cgaccttcgc gtcgtcgtgc gcggcgccca     12420
     ggcgcgcgcg ttcgagacgt cgccgccgtg tcgggcggcg agactgctta ctacacggac     12480
     ggcgacacgc gcgcgacacg tcgctcgccg tcccacgcgc cgttccgtct ttactcggcg     12540
     cgctcgatca cgatggcgac gactcaagaa gtgaaactgt tcggaaagtg gacgttcgat     12600
     gacgttgagg tgcgtgcgct ccatcccgac gccgcgcgac gcacgcgcgg cgacacaccg     12660
     gcggcgatgc cgatggcgat cgcggcgttt tagggtcttc gcgagggcgt cgcgcgacgc     12720
     gatcgcgcgc gcgctgcgcg tcgatgagcg ctcaaaatga acgatgagac tgacgaacgc     12780
     gcgtgttgga ttacagatca acgacatctc gttggaggtt cgtcaccgag acgagcgatg     12840
     cgcgcgaacg cgagcgagac gcgggcgcgg aagatgattg gaaaaccctg gcgcgtccac     12900
     ggacacgtcg cgggcgcgcc cgcgcggcgc ggcgcgcgac gaacgcgaga cgcagacgcg     12960
     gagtggacga ggggcgatat aaagcatcgt ttcgctcgct cccgtcggcg tggacgctcg     13020
     cggaacgacg acgtcgtcgg tgccgtagca cggggctttt gactgggacg tcgcgcgcct     13080
     cgaggacgca acgggggaac tgcagaatat gtcgtcgggc gtgaagcgac aacgtagacg     13140
     cgatctcgaa actgaccaca catctgttcg tcacgtctcg caggattaca ttgcggtgaa     13200
     gccgaagtac gcggtgtacg tgccgcacac cgcgggtcga ttcgccgcca agcgtttccg     13260
     caaggcgcag tgcccgattg ttgagcgctt ggtgaactcg ctcatgatgc acggtcgtaa     13320
     caacggtaag aagttgatgg ctgttcgcat cgtgaagcat gcgatggaga ttattcactt     13380
     gctcaccgac caaaacccgg tgcaagtgat cgtcgacgcc atcatttacg ctggtccgcg     13440
     cgaagacgcg acgcgaatcg gttctgcggg tgtggttcgc cgtcaagcgg tcgatctctc     13500
     cccgctccgc cgcgtgaacc aagccatcta cttgttgacc actggtgccc gcgaatccgc     13560
     cttccgtaac gtcaagacga ttgccgagtg cttggccgac gagttgatca acgccgccaa     13620
     gcagtcgagc aactcttacg cgatcaagaa gaaggacgaa ttggaacgcg tcgcgaaggc     13680
     taaccgataa ggggtgaatc tttctggcgt cggagactat agctcatata ccggtgtaag     13740
     aaggaaagga aaatatagct tcaataaacg cttgcgtcgc gcgcggagtg atgcgtgtgc     13800
     gaggatttcg atttatttca cttctaactt ttgctgatta tgccaagcaa caacgtcgtc     13860
     gtacttgagc gcaccaccga aacaatcgag ggcagaacct acggtgatgt cgaccatccc     13920
     tcgcccagct gctttgacaa gttcgagatc gtccaagctg cgtgccccgc ccgcgtacgt     13980
     cactggaata gggcagaatt cgccgagaag ttcgacgagt tttaagtcga ttcccagctt     14040
     catcccttcc acatccacgc cgtgaactaa aaactcatcg cagcatttcg ccaaacgctc     14100
     catcgtcgac ccgtccacgg ctaaatcggt ccacttttgc cacctatccg tgacgacttt     14160
     gtaccggccg tcggcgtcgt ccaaacggca gctcaaatcg agcacgagtt tgtccgcgcc     14220
     gaccgcgcga atcatctcgc tcagcgcgtc ctcgttcagc gccccgtctc taaatacata     14280
     gctcgtcacg atcacgtgcg aagctcccgc atcgagcaac tccgaggcgt tcgtcgggtt     14340
     gacgcctccg ccgacttgta acccgcccgg gaacgctcgc accgcctctt tcgccgctcg     14400
     caacgtcgcc tcgtctttgc tcagcaatat cgcgtggccg ccgtatatgc cgtctctttt     14460
     gtacatctca gcgaacgccg agctcggggt ttcagtctca aaattcgtcg ccggcgtctc     14520
     cgaacccgcg tccccggggc gcgcatcttt gagcgtgctg ccgacgattt gtttcacctt     14580
     gccgtcgtgg atatcgatgc acggacgaaa ccgaaccgcg cgcgcgtgcg gcgcgagcgc     14640
     attcaccgcg acgacggtcg ccgcgcgcat gtcgagccaa caccgaacgc cgccgccgcc     14700
     gacgacgact ttgccgccgc gccgcgacga acagtgcgtc ccgaaacgaa cgctcgcgaa     14760
     cgacgagggt ttagaattta ttatgtgctc gtgtgtgcaa acactcacaa tacctgccac     14820
     aaaagttcaa tgcgcgtgct cgtggatccg tggataaaag acgacggcga cggcgttggc     14880
     gacggcgacg gcgacggcga cggcgtgggc gatggcgccg acacaccgcg ccgacgcgcg     14940
     cgacggcgac ggcgacgccg agggtgtcgg cgccatgacg cctctcatga cggtcaccga     15000
     gcgcacgccg atcgggatga aacactggaa gtttcacgac tgcccgagca ccatcggcgc     15060
     gagctcggac gccgaggccg tggcggcgta cgatgcgcac gactttcgtg ccgacgtcgt     15120
     gggcggcggt gacgacgtcg aggcgcagtg cggtgatacg gcgacgtatt cgagagacgg     15180
     gacgttattc gcgtgcgcga acggcgatac ggtggaagtg tacgacgcga gcgtcgaacc     15240
     tttcgcgctc gccgcgacgc tcgacggctt gccgggagcg agcgcgttga acttttcgcc     15300
     gtcgaagacg tatttggcga tttatcagaa gcaaacctcc acgggagcgt caaaggatac     15360
     gaaaaacatg acgatatgga acataacagg tttgacgacg aaccgcgcgc cgccgcgcaa     15420
     agtgtacgaa gtgttccaaa ggcagtttct caaagccgag tggccgtact ttcagtttag     15480
     cgacgacgac tcaaccgcgg ttcggtgcgt gagtaatgag attcaaatca ttcgtccggc     15540
     tgagggattc gacagacatg ctcgacttcg agtgccttct gtggcggtgg cgaaaatatc     15600
     gcacggatcg acgccaagag tggcgtgctt cgtacccgaa gtcaagggcg cgcctggatc     15660
     ggttcgcatc tacgagctcg ctcagcacac agaagagggg gtggtggaga acccgacgcc     15720
     ggtcgcacgt aagtctttct tccgcgtcac tgaagtagat ttgatgtggg ccccagatgg     15780
     ctccgcggtg ttgattctag gctcgagcga agtcgacgcg acaaacaagt cttactacgg     15840
     cgagagctgc ttgcattacc tcaaggcgga tggctctttt gagggtgcgg tgccgctgaa     15900
     caaggaagga cccgtccacg acgcgcagtg gtcgccttgc agcgacgaat tcggtgtggt     15960
     ttacggatac atgcccgcga aagcgacgat ttataaggcg gcacagtgtg agcccaagta     16020
     tgaactcggc gcgggtccgc acaacacgct tcgatggaac ccgtttggac gtttcgtcgc     16080
     tctcgccggt ttcggaaact tgcccggtga cgtcaagttt tttcaaaaga tgaaggatgg     16140
     taagtacaaa cccatcggat cgacgcgggc atcgtgttct gtgacgttag aatggtctcc     16200
     ggatggtcga agactgctca cgagcacgat agctcctcgc ctgaacgtcg acaacggatg     16260
     gaaaatttgg aggtacaacg gagatttgtt gctccacgaa gagcgtgcga agatttatga     16320
     ggcgacgtgg cgtccagttc ccgacggcac gtacgaagat cgcccgattt ctcccgcatc     16380
     caagcgtgtg gagagccaag gcggcgcggt tttgacgaat gcgtcggagg ccacaaaagg     16440
     ggcgtaccgt ccgccgcacg cagcgaaaac cgcgtaccgt ccgccgcacg ccacgagtgg     16500
     aagtggtaac tttagtctcg ccaaggcctc ggaagaagac atgaaggctg gaaagtttaa     16560
     ggcggctggc gccaaggaac ccgccaaggc ggacgccggc gtcccggggg cgggcgcgca     16620
     actttcagcc gcggcggcta aaaacgcaaa gaaacgagcg gcgaagaaac gcgccgcgag     16680
     cgcagccgcg gcgttagaga aactttaatt cgagttgaaa tactaatccg agttgaaatc     16740
     acatcgcatc gccaccctcg tcgtcgcgcc gccctcgcgc gtggtgttcg ttctgcgctc     16800
     tgactgcact ccatatgtaa aaccccggtc ggtcgcggac ggcagtcgac gcgacgtttg     16860
     gaacgcttta tggcgacgtt tgggtttgcc cgcacgccgc ggcgcaccgt acgcaccgtg     16920
     gcgccgctga cgacgcgtga cgtggacaac gaagtcgttt cgatcgcgcg acatgtcctc     16980
     gcgcgctccc acggacgaac tcgcggcgtt cttggactac ttgccgtcgc atccacacgt     17040
     cggcgcgggg gctgcgttgg acgatggctt agaggcggac atatgggatt cgatcgagct     17100
     cgaactcacg cgtgaagtcg acgcgaggac ggcgaacgat aatggcgatc acaacgcgtt     17160
     agacgtccgc gaaggacgat caactcgagg acgggacgcg tcgacaaagg acacggcgag     17220
     agggacgaga gggcgtcggc gagcttcgac gacttcgagg tcaaggtcgc gctcgttgac     17280
     caagcacact cagaaggatg cgttcggact cgtgagaggg gcttatgaaa cggtggaatc     17340
     gaacgcgagc gatgcctcgg tgaacaccat gatgaagcaa ctcaacgatg cgctgaacgc     17400
     cgtctccgcc ggcttgggcg acggttgcct cgcacagatt tggtttgttg aacgcgaaaa     17460
     tgacgacgta ctattgcaca cggtgactga gtacgtgcga gtgtgcagtg aacatcgctc     17520
     ggatgccctt tgggcgtttc accgcggatg tacgtcgttc atgttgaacg tcgcgatcgc     17580
     gggctcggat ggtttcacgc ctggctcggg ggcgccggga cgcgtattcg cgacgaatag     17640
     accggagtgg acgccatcgg tgcagtgtta tcatccatcg gagtttccaa gaaattcact     17700
     ggcgatcgaa tgcgggtgtt acagtcagtt gatcgtaccc gtgaacgcga aaccgcaatc     17760
     cacgacgccg tttgcgttgc ttgaaatcac attcctgcat gtgttggaca acatgggttc     17820
     ggtttactcg cacgtcgttc gcgaaatgac caacgcggga ttacacactc caatatccga     17880
     aacgttagcg ccgccgccgg tgctgatgga taaaattgcc ggagaagttg cacggttgaa     17940
     ggtagcggag acgcaaaagg gcttgcagat gatatgctcc cgtcttgaaa ttccgtttgc     18000
     gcaaatttgg atccctcacg acgtggatgg cactctaatt tgcgtgggga caccttatta     18060
     tcagaagtcg aatcattttc ttcactatag gaacgcatct atgaatctcg caatatctca     18120
     gcacaccggc tccttgtcca aggtttggaa aaacggttcc atggtgtgga tgcatgatct     18180
     gagcacgcta tctcatcgcg actttctttt gaagcattca tgtgatttac tcaagttgca     18240
     agcgatgtgt atttcgaaga ttgcgttgaa aggtgtgaca tcaggtcaac cacttcaggt     18300
     gctggtagag atcttcctcg atcccagcct caagtctccg cgcgatcagg caaagacagt     18360
     gcagtcgttt tggtcctcgg ttgaggcgga tttgaacgct agtgtggtga cggataccga     18420
     caaaacatgg ctcgaagaga tgaaaaagaa ccagacagct tcttcaagcg gggcaaatcc     18480
     ggatgccgcc ggaacagcat tgtggggtat cacccttgag gttttgcagc aaaactttca     18540
     caagcatttg aaacaagcgg cgagcgacct cggcgtcggg agcacaacgc tgaaacgaat     18600
     atgccgacaa tacggtatcc gtcgttggcc gcgaagaagt cttaatagca aaaatggtca     18660
     tatgtctgat atattggcaa agagtatcgc cactggcgcg actatgagcg acgacggcgc     18720
     tggggagtct gtccacggag gcgctagttg cgtgtcgcac acttcagaaa tcggcgcatc     18780
     aggtacacta ccctcacaaa gcataaagtc tcactcactc agagatatcg ccacgttttc     18840
     gccgacaaca tcggagaaaa ataagagagc tctcgagcaa cgcgttcacc gaggtggcaa     18900
     tctcggcgct ttttggcaag gcgaaggggt gtcaaaaatg cagcgcggca tgagctggca     18960
     tgggaacaat caggcgagag atgcgcttga ttttgacttc ccaaatcgct acgagcaaag     19020
     cgttcatggt gtgtataact ttaatatgcc gccaccaccg atggaccaaa gtgttcgagg     19080
     ggcgagcacg tacaacgccc tctccctgga cgcgtccgaa gaaatggcga gttttatcga     19140
     taaattggtt aaagaacctg agaaagaacc ggtggttgtt aaggtacaag tgcgtgatgt     19200
     gctcatacga gttcgattgg tgacaaatga gagatatgtt gaactcgtcg atgcgctgac     19260
     tgatttgctc gatctacaaa tgtcttcgtg caagctcaaa tatcaagacg acgagcaaga     19320
     ctggtgcttg ttgcgtaatc aagaagattt cgatgagtgc tgggctttct gtacgcgacg     19380
     tggttcgtcg tgcacgatgc gtgtaaaatt gacgatcgaa gaaggagttg agacaaaatc     19440
     tctattcaag ccgcagcgcg cgcgagctga agtgccggac gcacaggcga aaccaatatc     19500
     cgtaaaagca agtgttggcg aagacgtgct acgattcaag ttaacgacag agatgtcgtg     19560
     cgatgacatc gtagccaagc tcaatctcgc agaaaattcc tctcaaagtg tcactttgtg     19620
     ctatcaagac gaggacgagg actggattcg actcggcggt gactatgact tagctgagct     19680
     tcggcacgtc ggcagcgcca cgggagcgct taaactgcaa gcaaactatt agtgtttttg     19740
     tattgtacaa aagtttttct gtagaaatgc actcgctgtt ctgtctcaat cttctcacaa     19800
     tgtcttacac aaacgtgagc ggcgctgaaa cgcggagcgg ctaaggctgc tgaagaaaag     19860
     ctaaggctgc gagcaagacg atctgcacca cgaaaccggg agctaacgat ggatcgggca     19920
     ataagttcga gtacatcagg gtcttacgcg cgccctcgcc gacggcatcg agcaaaccag     19980
     cgtacttttc gctctcgtac tccaaaccgc cttcatctat gagcgccggg aatccaccag     20040
     ggacgtatct aacgtccgtg tacccagctt gcacgagctc gtacgccgcg cgcaagctca     20100
     acgaatctcc acggtcgctg acagcggttg aaccattgag tggggcgatg tcgagatcgc     20160
     cccctcgcaa atcgacgagg acgacggcgt cccggcgatt tttcgtcacc tcagccacga     20220
     cgtctacgaa cgcgacgttg cgttccttca gcccaccctt gatggccaag aagtacccac     20280
     tcgcgcgtct caacacgttt tccatgggca ctaaatacgg tgcgctcttc gttcccacca     20340
     gcctccactc cgcgtgttcg agcggttgtc tcacgtcgac gacgacgcct cttctcttcc     20400
     ccgacaacat ctccgccacc tcgttcgccg tcgccgcgcg caccttttta ctcttcacca     20460
     gcgtttcgta tatctcaccg tatttcgggc ttcccggtcc ctttcccggg ataacgctcg     20520
     acgccgacgt cgacgtcgac gcccgcgtcg tcgtcgctct cgccatcttc ttcgtcttgg     20580
     tcgtcgttcg tcgtcgttcg acgcctcgag gcgagttcga cctcgccgtc gacgcgctcg     20640
     acgcgcgcat cgtcttcgtc ttcgtcgcgc gtcgcgcctc gcgcgtcgcg cctcggtgcg     20700
     ccgcggagtg gttcgacgcc gacgcatccg tcgcggcgtg acgtcgaccc acatcgcgtc     20760
     gcgtcgcgac tctgtccgac gcgcgcgcgc tcgaacatgg tcgcgacgcc cgaggagacc     20820
     aacgtcggcg atcgtctgag cgatttcgtc cgcgcgctcg acgacgagcg gcgcgcgcgc     20880
     ggcgcgagac cggcggttga ggtgcgatgc gacttttcct gcgccctcgc gctcgacgcg     20940
     gggaaggcga atcgaacgat acagaccgtg ccggggacgt tcgcgagggc ggcgatgaaa     21000
     ccgttcgagg cgatgaaatc gctcgtcgcg cgcgcggaga acgcgggaga taagaagacg     21060
     acgctcgagg tgctgcgaga cgcgcgcggg tgctttcggc cggggacgct gacgctcgtg     21120
     ctggcgccgc cgggacacgg gaaatcgacg ctgttgaaat cgatcgcggg agtgaacccg     21180
     ctgccgatcg agggcgagat cacgtacagc gggctgacga agaacgagct cgaggcgaaa     21240
     ggggtgtcac tgcataggtt gtgcgaatac gtcacgcagc tcgacgagca cctgccgtac     21300
     ttgacggtga aggagacggt gcaattttct catgaaaacg cgtgccacgt gccgagtgat     21360
     gcggaaggga aggctgctta cgacgataaa gtggacaagg tgatcaatct attaaatttg     21420
     gacggatgca aggacacgat aattggtaac gatctcatca gaggcgtgtc tggcggggag     21480
     aagaagcgcg tcaccatcgc cgaagcgatg gtgaaaaatg cgcaagtttt gtgcatggat     21540
     gagatctcta ccggtctcga tgcggcggtg acgtacaaca ttgtagctgg tttgaaggaa     21600
     tgggcgtctc gaacgcaagg tacgggcatc attgctctcc tccaacccac tcccgaggtt     21660
     gtctcgctgt tcgacgacgt tctccttctc aaggaaggtg caacggtgta tcacggtcct     21720
     gtggataacg tcgctaccta cttcaaaggc ttgggattcg ccccacccgc tgtcaactct     21780
     ggcgccgatc tcgccgattg gttgatctct ttgctcgttt cacccacgga aacgctgttg     21840
     cgcgccggaa cgcaaccgtc cgacgcgatt cccacaaacg ttgacgccat ggtgaagtcg     21900
     tggcaatcca cgcaagcgta cgagtcgagc attaaatcga agtgtacacc agccgacatc     21960
     gaactgaata cgccgtttgc caagaatcag tattctctca gttaccctcg ctcattcgcc     22020
     gatcacttca agtctgtgtt caagcgacag gcccaagtga cgctgcggaa caagctcttc     22080
     ttgcaagcgc gcatcttcgg tgcgtgcgta acgtcactca tcctaggttc ggtatggttt     22140
     gacttaccgc tcgaacgtgg gttcgaaaag cttggtatgc tgctcttctg catcttgcac     22200
     atctccttct caaacttttc tgaactgacg ttcagcgtcg agcaaaagta cgtcgcattc     22260
     aagcacttgg acgcgaaact tttccccgag ctatcttatc tcgcgtcatg ggccctggtg     22320
     catcttccga ttgctatcgt ggagactctc atcttcagct gcgtgctgta tccaatggtt     22380
     ggcttgaact tagctttcaa acaatggggc tttttctact tgcagttggt gctcgcaaac     22440
     gtcgcgatgg cgtccttctt ccgcgtcatt gcgttggtat ctccgacgat ggaagtcgca     22500
     caaatctacc cgggtccatt catcgcagtt atgatcctct tcgctggttt cttgatcagc     22560
     ccggagctta tgggaggttt ggagttcatg tactgggttt cgattttcgc ctactgcttg     22620
     cgttcgctat gtcagaatga gttcctgtcg ggtcactaca acgttttagt tccgaacgac     22680
     ccgatcacgg cagcaacgtt cgtggccaat aatccgcagt acagctcaac ctcgatggag     22740
     agcctttgtc ggcaaaattt gatcacgccg tgctcaaaca tgggagaaat cattctggac     22800
     acgattggca tcaccaaaga tacctcttac aaatgggccg gtccggcgtt ttgtctcgga     22860
     ttttttgctc tcacctttgc cgttggattg cgcacactgc acacaacccg cattcaacgt     22920
     aatatcgggt ccagtcgcgc cgaagataaa gctcaaaacg atgaagaagt tattcaaatg     22980
     atcgacgtcg cggccgccca aaaggcgatg gattttaccg ccatggccat atcgtggaaa     23040
     gatctgtgct acaccgttga agtggcagcg gcgaccccca aaagtggcgc catggatgac     23100
     agcacaacag acaaaaaaga gaaaaccgtg tcaaaacaac tgttacacaa tatttcatcc     23160
     gctgcacaac cgggtcgcat gctcgctctc atggggagct caggcgcggg caagacaacc     23220
     ctgctcgacg tcatcgctgg tcgcaaaaac acagggctta tctctggaga tatcaagttg     23280
     aacggacata atgtgaaaaa agaaacattt gcccgcttga ctgcgtactg cgagcaaatg     23340
     gatttgcaca acgagttcac tacggtgcgc gaagcgcttg aattcagcgc caagcttcgc     23400
     ttgcatccgt ccatctccga tgaaactcgc gttgcgttcg tcgatgaagc gctggagatt     23460
     ttagagctta actccatcgc ccacagaatg atcggcacgt ctggaagtga caccgggttg     23520
     gccccaggac agcgcaaagt gctcacggtg gcggttgagc tggtgtcaaa cgctcccgtc     23580
     ttctttttgg acgaacctac atccggactg gacgctcgca gcgcgttgat cgtcatgaag     23640
     gaagttaaga aggtggctgc gttagggcgt acggttatca gtaccatcca ccaaccctcg     23700
     atggagatat tcttgatgtt cgatgacatg cttcttctcc agcggggcgg ctatcaagta     23760
     tacttcggcg aactcgggaa gggaggctcg accatggtga attacttgca atcgctgaaa     23820
     atggctcttc cgcttccatc gggtatgaat ccggcgagct ggatgctcga cgttctcggt     23880
     ggcagcgact cgagcggcgg agcctcgagg aagaaaggta gcatgaagcg cagtgccagt     23940
     ggcatcgccc tcgacggctt gctgcttgat caaaaattca tgtctagcgc cgagggtcag     24000
     gctgcgatga agttggtgaa cgccattagt gagcaaggag cggatgaaaa aatgtttagt     24060
     ttcgattctc cgtacgctag aacgttcaaa acgcaacttt tggcgatcct ttcgcgtgcg     24120
     aacaagtcgc aattgcgcga tgtcggctac aactgcggac gcatcagtat cctcacaatc     24180
     ttgtacattc tctttggcgt catttacctc gacttgaaga ttacagatga agctggagtg     24240
     caatctatgg tagcgtgcgt gttcatgacg acgattttca ctggtattat ttgcatgaac     24300
     agcgtcatgc cagtgcgagt tcgggagcga gcggtggcat tccgcgagcg cagctcgtac     24360
     atgtacgacg ctattccatt ctctttggcg acggctatca ttgaagtccc ttggatcgca     24420
     atcatcagct tagtcaccgt gattccgatg tatttcctcg tcggtatgat tccaaccgca     24480
     cagcgtctct ttttccatat cctcgtcaac ttcttggtat cgttcacgtt tttgagtttt     24540
     ggtcaagcca tcgcgtgcat gtgctccacc attgaaactg cgcaggcggg cacttcggcg     24600
     ttcattccca tcgcgttctt attcggtggt ttgtacttgc cccttccgca gattccagtc     24660
     tactggcagt gggcttatta catcaatcct gtggcgtacg ccattcaatc cgtcgtcgcg     24720
     ccgcagttcg agcgacgcgg gtgctctggc ccatacccca gcggcaactg cccgacgatt     24780
     caagcgttcc gaggctctta ctttgaaacc atcgacactt taacgtacgt cgaacaaaag     24840
     tatgagatca agttctcaga acgctggatc tcgtgcggct acctctccat cttcgccttc     24900
     ggcatgcagt tcgtccactc cctctttttc aagacgagca acgtcgtgaa gcgatgaggc     24960
     gcgagcgcga cgagttcgcg ccgatcgcgc cgatccctag accacacacg ttcattcagc     25020
     ttacccaatg caatcaatct agttcatcac gcgttcgaac gccgcgttgc tccgcggcac     25080
     gaaccgcaga cgagtccccc gtctgcgcgt gggctcgtcc agctttgccg gcgcaaccgg     25140
     cgcaaccgcc gcctcacaac gcgccgacgt gtgtcgtgcg ctcggcgtcg gcgaatcgat     25200
     cgcggtcggg ggtgagcgag ggaatacgac tcatcctcca tcgcgtcgtc ggccttttta     25260
     cgtcgtcgtc gtcgtcgtcg ccgtcgccga cgtcgtccgg acgcgcattc acggaccttg     25320
     cttcccctct cgagacgtca tgagcgtgaa cgcgacagcg gcgatcgatg ggacgtcgag     25380
     cgcgaagacg aacgcgagcg atggcggaca ctctgattct gctgcggtcg cgaggaggtg     25440
     agacgactcg tctcgactcg aacgcgacga tggaatagaa accgccccgt cgacggacct     25500
     cgcgagcccg cgcgaagcga agaggcgact gaccgattac cgtggtctcc ttcgaaacga     25560
     ctcgtgcgaa cgaatagatt gcaaagcgaa ttgatgagcc tgatgacgag cgccgatagt     25620
     ggcatctcgg cgtttccaga tggcgataac attttttcct gggtggggac catcgagggc     25680
     gcgctcggga cgtgctacga gaacctcaag tacaagctgt cgctgacttt cgcgaacgat     25740
     tacccattca aggcaccgac ggtaaaattt gagaccccat gctttcatcc gaacgtcgat     25800
     cagtacggaa acatttgctt ggacattttg aaagaaaagt ggagcccggt gtacaacgtg     25860
     agaacgattt tgttgagcat tcagtcgttg ttgggcgaac cgaataacga ttcgccgctc     25920
     aacgtcgccg cggcgcagct ctgggcgcaa cctgaggagt acaaaaaggt gctactgaag     25980
     aaatacaagg aagattcgat gtaaggcggc aggtcagaga gcactagcgc gtgggacgac     26040
     ttccaactca cgattcgcgc cgaggtcgct ttgcggcgct cagccgagat ggtatgcgtg     26100
     agccacgcca cgctgcgcga atactaggcg acgttggacg tcgtgtcgag tcacgcgatg     26160
     taacattcat catatcccac aaccatccca caaccaaaac cgcgtaaatc gccacgctcc     26220
     tgcgtctgca actgcaaacc tcgactggcg cccgcgatgg agacgagctt gcgttacgac     26280
     accacctcgc gttcgctttc gctcttcgcc aaggaaagat tcacgaattc ggaagacgtc     26340
     gttctcacgg tacgcatcgc gatgagacgc attccaacga cgcattccga cgacgacgcg     26400
     ctcgtcgcaa tccgctgacg caccgacgcc ttcttctcgc gcgcaggttt ctgggagtct     26460
     agacactcgc gatgggcgca tggacggtaa agcacacgtg cgcaaacgac ttttctcccc     26520
     ggcgaagtcc tcgccgctcg tacccgatcg cgcggacatc ggattgacgt acgagacgaa     26580
     gctggacgac gtgcgctacg gcgcgcgggc gcgcaaaacc gtggacgtgt cgccgtcgaa     26640
     ggatgggatg agcacggtga cattgagagg cggggtatcg tacggggtga aacgttctaa     26700
     gcccttgatc gagggtacga tagaactcac gcacaaggtg ttcaactttc aagaggacca     26760
     agacttgcgc ttgcgtgtcg ggtacgattt ggtgaagcgg gaaccgtacg cacatattcg     26820
     cgaaaacaac tggagtttca agactgattt ccaaaagagt tggagcgtgt actatgactt     26880
     gtagtatgta atcacaagat gtgcgagatg gttattaaaa gcgatataac aacttactgt     26940
     acaaggcgcg atatataaat ttttccggag tcaggcgggc gggcaattca cgaaagagcg     27000
     aacaaatcga accaatcggc cctggaatat gattgtttat tgtcgtttga aagcgtgtca     27060
     ctttcacgac gctgctgcgg ctgaaaaacc ccaaaagtcg tcgtcgtttg cgccgtttga     27120
     gttgaacgtt tgacgcggcg tcttggcgcg ctttgcgatc cgcgtcgctt tcggattttt     27180
     atccaagacg cgccgctgat gcgaagttct ttgctgtaca gagtgcggta tgagtgtcgg     27240
     tgattgcgga gggagaggga ggcccggcaa acctatggac gcgctacgaa cgctttccca     27300
     cggagtgcgt tctcgttctg gcgtattcct ttcatccagc tgtggcgaat catcactgcc     27360
     aatcatgcct ttagacttca ccgtggccac atcgaactct tttacagctt cttttctcag     27420
     ctcgtccact tcagccatcg gacgcttcat ggcgaccgtc tgcggggcag gctttcgctt     27480
     cgtcgtcacc ttggccgttt tttgaactct cagtcgcgac ggattccttt gagccttcga     27540
     gccatctaaa gtctgcgaac gcttaatgat atccccgacc gcatcgagta gtacagctgt     27600
     ttctaattca tgatcgctat cctgaggatc gttttcgtcg actctgttgg cggaatacgt     27660
     taaaaactcg agcaacgcgt cttggcgatg cgatattttc attcgttccg agtactctag     27720
     ctctgcgagc gtcttatggc agtcttccgg cttgaaaatg ctctgcaaac catcttcgtc     27780
     gctcgcctcc atctcgcctc tcggtacgac gagcacaccc gaacgcgacg aaatgaaaat     27840
     cttctgctcg cccgtgcgca aacacttgac gccgagcgcg cactttaact ccgctcttcg     27900
     atcgcaatgg cgagacatga gatcccagag tccgtctgga ccgagtgcat ctatcatagg     27960
     cttgacatac gggcccggaa acccacgaag agctttcaat tctaacgatt ctgcgtcgac     28020
     gaggaggtag tcggcgtcac cgcccaaacc ttcgcgcagt ctattcgcca tgctcgcgtt     28080
     gcgctcctgc gaatcgtgtt catccatcga cttcccaccc gattgtggat gaaacaacat     28140
     cttgttcgcc cattccagct tactctccac gatctcacgc aaatctcctt gagtcgcggc     28200
     gacgcgaact tgcaccgtcc cgagcacgac ttgttgctta atggcctcct ccgcgtttgt     28260
     aaatacgtac gcggtctcgc tgaacgttcg cgcgctatcg gtgacgtagg ccacgcgcaa     28320
     acacttgtcg caccccgatt cccgcttcgc aggacgtcgg ttcatgctca acgacgctcc     28380
     acggcgcgcg tcgagaccaa cagcctcgcg caattacaca ccccgcgcac gcccgatgtt     28440
     ttcgatcgcg cgcgccgccg ccgccgcgcg cgacgcgtca gagtccgggc gcgacgctgg     28500
     tatcgtctgt cgtcgcgctg cgatcgtccg cgcgacttcg ggatgctgta tccgacgcca     28560
     tgtgccgcga gatcgttcgc gcgcgccgac cgcgtctccg cggacggttt tcggagacgg     28620
     gcctgcgtct cggttcgcaa acctccgatc gggttccagg cacccgaggc gcgcgcagtc     28680
     cggcgacaga tttttcatcc ctcggcgcgc gcgaaatcgg tcggtcggtg ggtgccggat     28740
     ttccggattc ccgtcgacgt cctcgcgcgg acgtcgtcgc gcggacgtcg tcgtcgtcgt     28800
     cgtcgtcgtc gtcgcgaggc gcgtcgcggc agtggaagac gcgagcgcga cgcgagcgcg     28860
     acgcgagcgc gacgcgaacc gacgcgaacc gacgacggtc cgcgccgccg cgatcgaacg     28920
     gcgcggcgcg accgaggcgc gcgcgcggcg gtttgcgttt gatttggaat ctcgtcgttc     28980
     gttcgcatcg acgcgcgagt ttcgtcgggt tgagggcgcg aacgcggacg acgcgcgagc     29040
     gagggacgtt ggatgaacgg aggaatgagc gatcgacgcg tgatcgcgct tgaagatggt     29100
     tgggggaaca tggaggtgcg tcgacggacg atttggaatc aaacgctcga ggacgccgag     29160
     agctcgcgag gcgcgggaga aacgagacgt actgacgaga tcgtgacgtt tgacgacgcg     29220
     caggatggta tcatgaaact tagacgcatt ctagatcagg aggatgcgga atcgttcacg     29280
     tcggaagagt acatgaatct ttacacgtgc gtaggacgac gcgttgaccg ctcgcggggc     29340
     ggttgggggc gcgcgctcgc gcgctcgcgc tcaaagaccc cccgaaacaa gtggcgcggt     29400
     gatcgcatgg actgacgcaa tccaacaaca tttacacgtt cttgcaggac gatttacaac     29460
     atgtgcacgc agaaggcgcc gtacgatttt tccgaagagt tgtacaagcg ctacgaggcc     29520
     gcgtttaacc aatacatcaa ctcaaaggtt ttaccggcgc tcgtggaaaa aaagggagag     29580
     tacatgctga gaagcttgat gagtcgatgg gaaaatcaca agataatggt tcgctggctg     29640
     tctcggttct tcaactatct cgacagatac tacgtccagc gccatcacta cgcgacactc     29700
     aatcaagtcg gcgtgggttg cttccgaaga ctggtgtacg aagaaatcaa gccgagcatg     29760
     aagacggcgg tgttggccct catagacaaa gagcgagaag gagaaaaaag tgatagaggt     29820
     ctcatcaaga gcatcacgtc aatcttcgtc gagatggggt tgggtacgat ggacgcatac     29880
     caaaacgatt tcgaaaacga cttgctcacg cacacatcat cattttacac tcgcaaggcg     29940
     acgcagtgga tcgctgaaga ctcgtgtccg gcgtatctca tcaaagcgga agagtgtttg     30000
     catagcgaac gcgaacgtgt gcaacaatac ttgcatcaga gcaccgagtc gaagttgata     30060
     tcaaaggttg agcagcagct cctcgagcag tacgaaactg agctgctgga aaaggagaat     30120
     agcggttgcg cagcgctctt ggttgacgac aagaaggagg acctagcccg catgttccgt     30180
     ctctttagct cggtaccgaa aggattggcg ccgatagctc agattttcaa aacgcacgtt     30240
     caaaaagaag ggatgagcct ggtgaattcc gccgaacagg cggcggcggc gatgaaaggg     30300
     aacaaggaaa agccgacgac gtctacgtcg attgaacagg tctttactcg aagtgcgatc     30360
     gacctgtacg acaaatatag tggttatgtg aacgattgct ttggttccaa cgcactcttc     30420
     aaccgcgcgc tcaaggaggc ttttgaatac ttctgcaaca agggcatcgg tgaaatctcg     30480
     acggcgcagc tactcgcaga ttttgcggat aagctgttgc gaaagggtgg gagcgaaaag     30540
     ttgagcgatg agaagatgga agagacgctg gataaagttg tgaagctctt ggcatacatc     30600
     agcgataagg atatgtttgg ggagtttgct agcaaaaggc tttctcgacg cctgttgcaa     30660
     gacacgtctg cgagtcagga ttatgagcgc tccatcttga gtaaactcaa gacgtcgtgc     30720
     ggcgcgcagt ttacatcgaa gatggagggt atggtgaatg atgtgcagtc tgcgcgagac     30780
     actcaagatg tgtttgagag atgggtagac gaagacgctg ctaatcgcaa gacttgcatc     30840
     gatttcaacg tcaccatctt gacgcacggt ttctggcctt catggaagcc catccaggtg     30900
     gagctgtgtg acgagttcgc gcagtgtgtg gaaacgtttc aaactttcta tgatgctaag     30960
     atgagccaaa gaaagctcac gtgggtgcat caactcggag cagtcgtgct aaacgtcaag     31020
     tacgaagcca agactataga aatgcacatg caaacgcccc aatgctctgt tttgttgctc     31080
     tttcggaatg aaaaagagct gtcgatgcaa aaggtcatag aaaagacaaa aatgccagct     31140
     gatgccgtga agcgagcgct ctattcgctc tcgtgtgcca agtataagat tctgaacaag     31200
     tcccccgagg gcaagacggt gaatcccgaa gacgtctttt cgtttaacga aaaattcacc     31260
     gatcgttcgc gacgcatcaa gattgcattg ccacctcccg atgagagaaa agctacgatt     31320
     gagaacgtcg tacaagatcg ccgtcatgcc atcgatgcag ccatcgtgcg agtgatgaag     31380
     actcgcaagg cgttggcata caacgagctc gtcgtcgaag tcgtgaacca actccaacag     31440
     agcttcctcc cggaagcaaa gatgatcaaa atgcgagtcg atgacctcat caacaaggaa     31500
     tacatcatgc gcgacgaaga aaactcgcaa gttttcaagt acatcgccta gttagtttac     31560
     tgcaaatgag agatacgcgg cgcaacactt gttttcaatc aaggacgttc gtaacaaatt     31620
     acaactcggt ccgctctgtc tccctccccc atactaatgt gtctaacaag tcctctcgca     31680
     cgctcaaaga gtgacgtggt tggggcgctt gtacttgatg atcgtcttgg aggccttgct     31740
     cgggtgacga gtcaccttgg tcacgaccgg gaaggacaag tcgtcttgaa tgaactggcg     31800
     cgtgttctcg cggcgaacat ccttgtcggc aacctccgca atcttaatga tttgcaagca     31860
     cgaagcacgc acacggtggc gggaagccat ttcctcgtag agcgcatcca ccgccgcgtt     31920
     catcgtcgtc tcgcggtact ccttatacga gttgtggtaa cccgtgcggg actggtaacg     31980
     gatccagatg ccgaagttct tcacggtcgt cgtgtccgcc tcaaagatct attcgtcatt     32040
     gtgaacgaat caacactcgt cagtctctca ttccgcgttt ttcatcgtcg cgacgcgcgt     32100
     ttaacacgat tcgcgtcgct caaagtcgcg ttcgcgtccg cgtcccgctc tagggctttc     32160
     acccatccac aaagacgcac ctcgttgcac gcgatgattt ggccgttcgc cttcttcacc     32220
     ttcttgaggc gagacatgaa gtaccagaac ttcgatcgcg ccttgacgtc atcgagcgcc     32280
     cacaacttca tgcggaacac ctccggctcg gggtgcgcat cggtcggcac gtgtcggccg     32340
     acgacttggt attggtggta ctgcgtcgag caatcattcg cgcgttttct cgtcagtcga     32400
     tcgttcgtcg agcgcttcga tcgcgcgcat cgcgagcatg aaattatctt cccccgaacg     32460
     cgccgccgcg cgcgcgacgt ccgcgcgcgc gtcccaccgc gcgcgcgtcg tcccatcgtc     32520
     ccgtcgtcgc ccgtagggtt tcgccgcgat cgctccgtcc gacgctttcg cgtctcgcgt     32580
     cgcgcgcgcc gcgccgcgcg cgccgcgcgt cgcgcgcgcg cgtcatcgtt ttcgcatctc     32640
     gcgctgtcca ccgcgcgcgc cacgcaccct aattttcgcc atcgttcgcg acgcgtcgag     32700
     taaagaggtc gatggcgcgg cgcgatggcg ctcttcaccg cggggcgagc gacacacgga     32760
     ccctccgggt atcacacacg ccaccagaca ccccccgaaa cggccgacgc cgacgcgcgc     32820
     gccgcacgcg gcgacgcgcg ccggcgacgc gcgcgcgatg tcgcacgtct cggcgcgcgc     32880
     ggcgatgcgg tcgtcgtcga cgtcgacggc gacgaggacg aggacgagaa cgacgcgcgc     32940
     gcgcggaggg gatcgcgcgg cgcgcgggga cggtggagga ggcgcgattg cgacggtcga     33000
     gcgcggttcg gcgcgcgcga cgacgctcgg aacgcgcgcg cgacggcgag tcctcgcgcg     33060
     cgggacggcg tcgagcggag acgagggacg agagcttcga agacgcgcgg cggcggcggt     33120
     ggggcgagcg gcggcggcga acgcgagcgc gagcgcgtcg gcgaacgcgc ggcgaccgag     33180
     agtggacgat ggaacgcgcg atggagcggt cggggacacc gcgttcgagc ggtcgggggg     33240
     attactgtac gtgcgaaatt tctttgaacc cgagacgttc gagcgcgtgg cggcggagtg     33300
     cgaaaaattg cgcgcgagcg tgacgccgga aaatagagcg tgcgcgcggc agaggctggg     33360
     tgtcatggta ccgtcggata atttcgtgca cgaagcctgc gtggcgagct cggtttctga     33420
     tcgcctgcga tcgttattgc tcggtgaaaa tgacgacgcg ggtgcgttgg tcgccggcga     33480
     cgtacccgtg gaattcagag tgtaccccgt cggcgggtcg atggactggc ataaagacgt     33540
     cgcgttgtac acgaaaccgc agtatgaaat agtattcacg gtgacaaaca cgagtgatag     33600
     tacgacggag tgggaagatg agagaactgg aatgcgttac ggcggctgga ccgagccaaa     33660
     ctcggtcatc atcgttcgcg cggatggcgc tccgcacaga gtgacgggcg tgacgagagg     33720
     tgagcgttcg atcatcaagt tcgtgctcac gcaaacgctg gagaagacgg atgatttctt     33780
     tgataacctt ctcatctaca cgtagtcagt tagtggctaa acaagttgtt gtataataca     33840
     gtttagcgag gcatccgaaa tgccaagtat cgccgaaccc atcgctcgta atcctcgcgt     33900
     atgatctccc aaatcgcgag agacagctgc tctttcttcg tcggagggtg aatcatcgtc     33960
     ttcactactg tgtttcgcag ggcgatgttc gattttttgt tcacgccagc ggagtgacgc     34020
     caaatcgccg actttgttcg atctgcgacg tcgatggagt caccaaatcc gaatcgctcg     34080
     ccagcttcaa cgattctaag cctgaccgcg ggtgcttgca agacgtgttc tacgcaactc     34140
     gacacgtgga agtctacggc ggcgatcggt atgtcgtcgc ggcgcatgaa accaccccac     34200
     gtcttggctg catccgttgc ttctcgcgcg gcgtcgaatg cgagttcgag atacgaaagc     34260
     cacggcgact tatcgtcaat gatttccgga ttgcgcagct cgtcgtactc gagcggtaca     34320
     tcattacttt ttgccgtctg cttgaaccga ttgaaccata cgtgcgaaaa accgtgtaac     34380
     atggcgacgt ctccgggcat tccgccaaag tgcgcacgaa tcatcaaagc ctgaacgacg     34440
     gtggcctcgg ccgccggcaa cgcggcctcg acgtcattga gcgcgagcat gccactggct     34500
     gaatcgccag cgacgccgta cgaaacgcta tctttgatgc ggatagccgc catttcgcca     34560
     gctatacgag ccaccgcggc gcgcaacgcg tccgtcggct cgaatccttt gctcgtcgcg     34620
     cacatgagcc acgtcaacag tacgacatct ggatgcagga tagcatcttc taatgaaatg     34680
     atcacgagtc tacggacgca ttcgatgagc gcttgcgggt ctaaacacat gtgcatggct     34740
     acgcgcgaag cagcagcagc gcgacctcgc ctgatattct tctgcaatgc ggatttgatc     34800
     acgctcaact tgagctgttc gccatctgca ctcgctcgac tcgcgcgaac ttcagcgtac     34860
     tctttcgcgt cccgtaacgc ttcgcgcaac gcgttctctt gatctggacc atcgtcgctc     34920
     gcgacgtccg tcatcaactt tagcgtcgtc gaacacgtcg taccgctcgc caatttctct     34980
     ttaaccacga cttgactcgc ccacttcgcc gaagattccg ccttaataga tttccccaac     35040
     gacaacgaca cgtcccaacg tgaacgcgcc gcgtcgtagg tcaacaaaaa tatgcgctcg     35100
     cgctcgcgct cgcgctgcgc cgccatcatg ctcgcgaagg cgttcgtcgc cggttttggt     35160
     tttgtcgccg gctgtttctc ggcaacctca gcatcgctgt cgccatcctc tcgacgttca     35220
     cgtataatgc acgtcccgac gtgagattcc aaaagcatct tggcaacgtt ctttgcgcat     35280
     aaaggacacc gttcgaatcg cgacgatgaa tccgtggaag ttcgcgcctt cttcgcgccg     35340
     tccgccgcgc tcggcgtctt aacagccggt gcaaaatacg cggcgatgct ccctcgttta     35400
     tgcgtcatcg cccgagacgc gcgctcaccg cgagttcaca gtgttcgtcg tcacctctcg     35460
     cacactcact cgtatcgcct cgctcaatcc tttcgcgtcg tgcaacgact tcgtaatcaa     35520
     gatttgaact ctcgcgatgg cgtccttggg ttcgattttc gacgtcgtcg cggcgtggcc     35580
     tccgatcttc ttgcgcgata tgggaaagtc gttcgcgcgc gtctccctcg agcgtttcat     35640
     cgacgcgcga cgcgcggacg agtgaagtcg gtgcgcgagg cgctgagttg ttttgatttg     35700
     ctcgggctat cacagctatc gcgctacttc tacagttcta ctcttttcct tcttttcctt     35760
     cttttgcttc ttctccttct tgtccttctt ctccttcttc tccttcttcg ccttttcgtt     35820
     tttccgacgc gcgtcgttct tcgcaacgtc gtcgtcgtcg tcgtcgccga agtcggttcg     35880
     tctgacgccc gtccactcgc tcttcaacac gcctctgccg ccgagacctc gcttcgtgcc     35940
     cttggcgacg tttgtttcgt gcgcggattt aaataaagcc tcttgatcgt tctcggtgaa     36000
     tcccttgccg cgcttagcgc gatcggcgcc gtcttcgtcg tccgcggcgc cgtcgtcgtt     36060
     caagtcgcgc tcgcgtttcg agccgaccaa gccgccccag gcgaaacccg cgcgcgtcca     36120
     ccaatcgctg agtttggtgc tcaaagactt ttcaccctcg tacgacacgc ccgaaggtct     36180
     caccgtcgtt tcgaccgcac cttcgccgtc ggatttgcgc tttttcttgt ccttcttaga     36240
     cttttccttt ggctttttct tcgtctccgc ggcggcgggc gccgacgcgc tcccgcgttg     36300
     aatcccatac ttggccaact gttccgcctc aaactttgcg atgcgttcga gcttacccac     36360
     gcgcccaccg aacgtggatc cgcgatgatt atcctccgcc agctctcgca tgagctgcaa     36420
     atcgctcttc gatccgctaa acgccacgcc gtcgcgtccc gtcgccgtcc ccagtctcgc     36480
     cgcgacttca tcctcgctcg aatcctcgct ctcgctcgag tctccatcgc gtcccgacgt     36540
     cgacgtcgac gacgtcgtct tcccatcctc ctcgcctccg acgacgcgcg caatcttgct     36600
     cgccgcgttc gcgtacgtcc cctcccacca cttttcgtcc cacgcgtacc tcgtcttcct     36660
     cttccccacg cccgcgttat cctcgcgctt caccacctcg atcgcctccg cgcgtccgtg     36720
     tcgtcttttc cccagtccat cgcccctgtc gcgcgcgcgg ggtcgttcgc gcgccgtcag     36780
     tctccgctct tctcttcggg gtcgggcgtc ccgccgccgg tcgtcggtcg cgtcggtcgc     36840
     ctcggtcgtc ggtcgcgcgc acttggacca tcccatcgcg cgcagcacgc gctcgcccat     36900
     gccgccgtac gacttcgccc ccggcgcggc gtcgtgcgtc ggcaccttca tcgcgtcgtc     36960
     gcccgcgcgc gtctctgcgg gcaaccgtac cctgtacgcg agtcgccgtc gccggcaacc     37020
     cccctgcgcc gcacctcgca gcgcgctgca cgcgcgagcg tcgcgagcga aacccgagac     37080
     gcgcgtcgcg agcgatgttt aacgcgatgc cgcgcgcgtc gctctcgccc gcgtcgtcct     37140
     tgttcacctc gcctcgcgtc ggcgtcgatt cggacgtgtc tttgacgagt gttgtggata     37200
     accaccatcg gcgggcgcgc gtcgtcggtc gtcgcgcgcg acacgtcgcg cgcgcgtccg     37260
     aggtcgacat cgacgctggt aagtacatgc tcgagcgcga ggactatctg ttcgtcgatt     37320
     gccgttcgtg gaaggagtac gaccgctcgc acatcacaaa gccgccggcg aaaacaatca     37380
     acgtgccgct cgcgcaggac gcgagcgtgg aggattgggt gaaagccgcg cgagaaaaga     37440
     cgcgacctgg tatgaaattg ttgatcgtcg acgccgatgg ggcgagagtg gcggagttgg     37500
     taagcgggct cgaagccgcg ggctacacga acgcagtccc ggtggcgggc ggctacgcgg     37560
     cgtggaccgc caagtacacc acgttcgggc gtaaagtgcc accgaaaggg aaattcgtga     37620
     gtacggggaa ggaggcgttg aagagcgggt tggatctcga tcccaacgtc gcgagcgcgt     37680
     acgaggaaaa ctggggtcga gcgccgccga agtacggcga ggaggccaag tcggactgag     37740
     accacattcg gccgatcgcg cgtgtaatta aagcattgat gtcagaaacg tacatttcag     37800
     aaataacctt cgcctgcgct cggcgtcgtt tcgtggagga cggttcgccg ccgtccgcgt     37860
     cgcgcgtcgc gcgagctcga tgacgaccgc cgcgacggtg cgagtatcgc cagactttgc     37920
     ctcgcctcgc gctatgagac cgatacccgg tcccgcaaac gccttcgcgt cgcgtgaaaa     37980
     catcgcacac gcgcgcgcga acggtgaagg cgacgaaggt gcgcgtgagg cgacgcccaa     38040
     cgacgcgacg agttcaaatc ccgcggcgac agctgaagat gtcctcgacg ccgcgctctt     38100
     cgcgtccgcg ccttggcgcc gcgcgctgga cgccatcgac gtcgaaaact tcgacccgaa     38160
     tcgtgcggag tgtaaataca acgtcgcttg gttgcgtcgc ggtggatggc gatcgggaag     38220
     ggcgccgcgc gtggcgggcg cgcttcgcga gctcggcgct acgtcgaacg gcgacggcgc     38280
     gggaacgctg tgcgatccca ctggtgagat tagagtcatc gtgcatcggg aattgatgat     38340
     gagtgagcgt gcgcttgcct cgggctgcgc ggtggtgctg cgagacgtgc cggtgttgag     38400
     tgtggatgcc acggcgcacg cgctcgcggt gacgagcgaa aacttagtgg cggtgtttga     38460
     ggcagacgtc gatgcgtacg ctgcgagcgc agcgaagcga acgagaatcg agcgcgaagc     38520
     gttgcgagag cggttaagag aaagcgcggt gatcgaagcg gtgagcggag tcgactggga     38580
     agactttgaa gacgtcgccg gagatttttc cgggtacggc ggcgacgcgc caccctcggc     38640
     tgaaatcgac cacaacgcgc gcgatgaaga gacagtgcac acggacgaaa tgatgaatga     38700
     tgtgacgacc gcgcccacgc ccgatggacc gagtgacttc gcgctgcagc ttgcggcgct     38760
     ctacgccgac gacggggacg cttgagtgct tgactgcatc ggcgatctct tcataacctc     38820
     gcgcgcgaga acgacgacga cgaaccagcg gactcgtgtt gacggcgaga taatcgacaa     38880
     gcgctcgtgc aacgcctggc gatggcgtca atcccgacgc tacgcatcgc ttacgccacg     38940
     ggtaaccacg gcaagtttgc cgaagccaag cacgtattca acagaccgga aaacctcgcg     39000
     cgagcgaacg tgattctgca gcagttcgac gtggacactg ttgaaataca aggctcaaaa     39060
     gtggacatca gcaagcacaa gctcaaagag gcggcgacga ttctttttca agaggcagat     39120
     gcgggcgatt ttgattacct cctcgtcgaa gacgtgtcac tcgatctcga cgccttgaac     39180
     ggattcccgg ggccctattg caaacccatg cttgaagcga tcggacccga tggactatgg     39240
     gacgtgatgt cccggtacga agatcgtaac gcgacggtta cgtgcacggt tggagcgatg     39300
     gccgtgcgag cggggggctc tcgcgagacg aatgtgttta tcggctctat caggggaacg     39360
     atggtgcctc cgcgaggtga agtcaagcac ggcaaggcgt cgtggaacag cgttttccag     39420
     cccgcgggat tcgccaagac gtttggagaa ctgcagttcg tggagcaagc ggagatttcg     39480
     cacaggcgca ttgcgcttga gaagttttta ggaaacgcaa tcgaggcggc gacagaggtc     39540
     aactgttaga agatcttgta gcatgattat tagccatata tagatagaac ggtgtctcgt     39600
     tagtagtacg tcggatcatc gcgcgagttg cgagacggcc tcgcccgtct agcatcgccg     39660
     tcgtcccgaa acggtcgcct ttcgtcttcg taatactcgt ccacttcgta ctcatctctt     39720
     gagcgaccac cgcgacgttc atttttactt cgcgacttgc cgagctcgac cgatcgtcga     39780
     ccgatgagaa accaaatcct aatcaacaat agtgcgcggc tcggaagcga aaataattcc     39840
     tcgacgacaa tgtctcgcca ttctgcgagc tgccgagcgt cgttttgcga cgaaacctcc     39900
     atgacggctt cgtcgtagtc atctaacggc tcgtgatcgt ccgcgaactc ttcttcgtgg     39960
     aaatgccgac ccaacctgcg cggttggcgt ttcgcgccgg cgtttcgcgc cgcaaccgcc     40020
     acgttcgcca ccgcggcgaa tatcgcgagc gtcgtgatcc cggctgcgag tggaagcact     40080
     tgcgatgagg gtgtcgcgct cacaccgacg ctcgatcggc cactgttgcc gtcgaaacct     40140
     agcgtgcttc cgagtgcgcc agtcagcgcg ttgaatggat tttgagccgt ttggcgcgag     40200
     aaggacgacg cgtcgctcgc tgccgacacc cctcgtcgcg ttgtcatcgc cgacgacgcg     40260
     ctctgcggag atttgcgcaa gtcaatcgcc aatgtaggcg ctgttcgacc cgtggcttct     40320
     tcagcgaact cgagcaaagc gccgacgctt ctgtcggcgc tcgcgtggcg gtacaccggc     40380
     cctttgcccg cgggcaaagc gacgatggtt ggaaaagtct tggcgcgaaa gtatttcgcc     40440
     gcaaactgct tcatctcagc gctatcgcat ctcagccggc acacgcgcac ggtggggtcg     40500
     ttggcgtagc acaccgctac cgccgtccac gccggctgca cgtcgtcgca ccatcggcaa     40560
     ttctccgtct ccaccagcag catcaccgtc tcgtccctgt gcgtcagcat ccccaccaca     40620
     tcatctcgcg tcaactcttc caccgcgctc gcgctcacca cggcgtgcgt tcgcgtcgtc     40680
     ggcgcgctca tccgtctctg ttcgctcctc gaccgtctcg ctcgcgcgaa ctccgcgtcg     40740
     cgttctcgtt cgctcatcgc cgtcgtccgt cgactcccgt actctcccac ttcacctcgt     40800
     ctccatcgtc catcatcatt cgtcgtcgga atcaacagcc gctgtccgac gtacagcgcc     40860
     ggcgcgtctt cgtcgtttcc ttcgtcgtcg aaccgaatcc cattcgcctc gcacaccgcc     40920
     tccgcgctcg tcccgtgcgc tcgcgcgatc tcgttcagcg tgtccccgta catcaccgtg     40980
     tgcacgtcgt aatcatcccg atcccgatcc ctcgctcgcg cgtcgttcgt tcgcgacgcc     41040
     cgcgccgtcg tcgtcgtcgt cgtcgtcccg cgcgaccgtt ggcgacgatt ccgccgaaga     41100
     cgacgcccgt cgcgcgtcgc gccgcgctcg atcgcgcgcg tcgacgccgc gccgcgcgtc     41160
     gcgcgcgtcg acatcgcggt cgtctccttc gtgcttcgcg cgcgccgcac tgccgatcgc     41220
     gccgcgcctc gacgtcgcgc ggcgcccttc ccgccctcgt ccagattttt tcgtcttcgc     41280
     gcgcgacggg gcctcgccgg ctcgaggggc cgcgacgcgt cgggtgacga tcgcgcgcgg     41340
     ccaccggtgc gcgctgaagc gacgagaacg caaagaattt tggtacaaat tacaattttt     41400
     cagccgtcgt ccgtttcgta ttcgctctct tcgtcgtcgc cgtcgtctgt ctcatattcg     41460
     tcgtcgtcgt ctgtctcata ttcgtcttcg tcgtcgtcgt cgtcgtaccg cgtaaccgcg     41520
     ggtctacgac cgtgtagagc gcggcggagt agtgctcggc cgaaatgaag atcatcttcc     41580
     gcgtcgtcac tgtcgctatc gatgaagtca gagtcgtatt cgctggaatc gtcgtctccc     41640
     gagtgcacgc cttcgccgtc gtcgtcgtaa cgcacccaat cgacctcagc ctcgcgcacc     41700
     atctcgcgta gactgttaat ttgatgccga atgcgcgctt cgttgatgtt tacccgaccg     41760
     tctgcatcct caatgcgttc ttccgagtct tcgtccgaat aatcttcttc ccatccatcg     41820
     tggtccatgt tcaaaaccat gggctcgatc tcttcgtgct cgtcttcgac gtctgattcg     41880
     tcatcggctg gtcgtagtct cccaacttcg tgcagacgca cggttgactc gtgtgtgttc     41940
     aagatatcat actccaccgt agcgcaaaga gtgtcggaat tcacatccca cgcggcgtca     42000
     atcatgcccg aaggaacgtc gacagtgcaa atatctgaat aatcgagcat gtcgatggta     42060
     caaaaagaat gcttgtacgg atgatgacac ttgcgcaagg atgaaagcgg tggctcgttt     42120
     ctagggtgta aaatgtgcgc catacccacg gtgccggtga ggttgaactt tagcgctgca     42180
     cggtcgagtg aaggcaccac gcggagcaag cgtgatgacc gaatgtccca cacttcccgc     42240
     ccgataatga tttcgtttcc tcccggatgg aaacacgcgc ccgcagcctc tgaataacgg     42300
     tcgaatcgtc gaattggctt atcattcgcc aatcgtacat cccagagtac ttcatcccac     42360
     aaaatcaagt cgtcgcttgg agaaaatgaa acttcgtcgt tgtttttcgt caataacgga     42420
     gggccgccag tgttcgaggt gagcctgcgt gtaacgcgat gtgtttccat gtccgcgagc     42480
     tcgacgactg attcgaggct accgctgaca aattgagagc ccgtggagtt tatggcgcac     42540
     ccagagtgac cagagcacca aagcatgtag ggcgcatcgt ctggattcgg gaggctccaa     42600
     attgagcagc tttccaccga cgtaacggcg aataacggtg tcgggcacag cggaccagcc     42660
     gccgcaatct tgcgaatggc gccactgacc ctccctggcg tggcggctat ttccaagagc     42720
     tctccagata tgtggtcgta cagatgaagc tcgccgtcat tgtcaccgat gatgatttgt     42780
     tccggcacgc catacaagaa agacgcggcg gtgaataagc aatcattgcc ccgaatcgcg     42840
     cgcagcggtc tgaatctgct gtacacaaag tgtcgatcag ctcgacgcat gccggcatcc     42900
     cagccagtca cgttagccca ctcacgctgg cgaagacgag ccgtcaagtt tcgcggtgct     42960
     tcaagaatac gttttggctg aggacactga tgcggcgcaa gcaaagagaa gggagcgcac     43020
     gccgtaatcg gcgcggcgca ctgccgatgc tgagctcgga ggtattgcgt cagaatagaa     43080
     tctaatcgcg aacgcacgcc acaacccgtt tcaccgcgtg gtgcatcgga gaccaacaca     43140
     ccgggtgtag gaaactcttt gtgaacgcgc tccttcacgc ttggcgatgg tgtttggtgt     43200
     tcattcgcac agcaggcgcg ttctgttgca ccaactgcaa tgggtggtgt gataagagat     43260
     ttccgtattt cttctccgtt agtttttcgc tttttgcctc gtcgtgtgct gcaaggagta     43320
     acaacaatac catttgctcc tggtttgctc gttttgaccg aattgaccga agttgtgacc     43380
     actgcgggtg aaagtttgct ggctcgactt gattctccac gccgtggccc tttgcgcggc     43440
     ggcgcttgag tggagccttg ctcgagccca agagtgaacg gttcgcccgc aatcccgagc     43500
     ataccgcgtg ccgcaccagt cattctcgat cgtggtgcac gccgatacat ctttgtgcga     43560
     gctgtcttgc tcttgaaatt tagcttgagg cgcggcgcag gcgaaggaca caaacgacct     43620
     acactcgcgc tgcgacccgg gcgctccatc cccgcctcgt ccacgagcga agccgcggta     43680
     ctcgtcaagc cagccgcgac gagatgctca tgcattattt gtaaaagctc gttgtgcgga     43740
     tatcgaactt tagttgcagc tgcaatcaag tgtcgttcga gtttcgccag aggcggcgcc     43800
     gcagcgtcgg acgccaccgc gggcgtcgtc gctttgacgt ttgcaaaccc tgcggttgcc     43860
     gcgatgagct ccacggcgca tcgatgaaac tctgtggcgg cagcctgaac cgtagcagct     43920
     gtaccgtttt cgcgcttcga gtccacgatc gctagttcgt caaacgcgga gtgttgcgtc     43980
     gtccccgtct cgcgcaaaag ctctgaaaga tgccgcgcta tttgcagcgt ctgtagagtg     44040
     tttgcgattg acgcatcgcg agataacccg agcaaggcac gacaacaaag tgctctagat     44100
     atgttcatag acggctgagg taacgtcttc gacgttttaa acagcaggtt gagcaaagac     44160
     ttaacgccaa aagcctctcg gatatgtttc cgccccgcct caaacgtttc ctccattcgc     44220
     gcgtagtcaa aaactgagaa cgacttgcca tcgatgctgt gagagcgctg taacttccca     44280
     ctctgtgatt tagcatcggt actatgcaag gcgtaagggg gagaaacgag attgcaaacg     44340
     actttcaaag cctcgaccac ggcttcagtg tcgaccgcct ctgccgcatt ctcgacgaca     44400
     tctatgagaa cgtacccaga agagtaatat tcatcaaatt gcgcctttgc cgtgtgcact     44460
     cttccagtgg gatgtgacgt cacaatcttt aaaacgctta aagatcccaa aacgcactcg     44520
     cgaagagttt tttcacccgg agccaaagtg agcaagtcga gcatcacctt cggccctttt     44580
     tgcgccacga aggcttctat gacgagccac gacttggttt gcatgacggc ggcgatgcgc     44640
     ttttggcgac tcactaagct aaatagtcgc tccgtcgcat cgtatccgat atccatcgct     44700
     tgtagcatcg cacgattatt ggtgctcgta ctcttcttcg atttgcccat caccttttct     44760
     tcgatcgctt tgacgtgttg cgcaaaatgc gcgcgcatgt actgtctaag caacaagctc     44820
     acgtgatctc cagtctcttt cgcctgcgaa atctcgttcg gagacatcga tgggcgcacc     44880
     ttatctacgt ctacaaccat cactgccaac gtccgaagga cgtcaaggac gagcttgagg     44940
     ccagcctccg cgtcaaacgc cacgacgacg acggggattt gcatggcaaa cgtcaggaac     45000
     aatgcggctt gacgacgcgc gtactcgttg ctgcaatcca aaagctcgag cgatactttc     45060
     acatatcgtc gtgccaagtc cacctgcggc gacacgagac gttcgagcgc cgtggtgatg     45120
     ctcgcgatac cgaataggca gcgcgtcaaa ttgtagtacg tcataggccc tctgggaatg     45180
     tttagcaaca actttgcgcc accggcgtca atgaaagaaa tcgcaaactt ccgatgcgcc     45240
     agaaacgcac tgacgataga gagcgcttcg gatagttgag gatctccagg ccaagccgaa     45300
     gtttctccgt ggtgccgctt gaagccgtac ttctcaagcc acccgttttc gcggggtccc     45360
     gcgacgagac gcagagagag ttcgaggaca ccgtgcttga gtgcctctgc aaaacactca     45420
     acataatcgc ctattgctcc cacacacgtc aagcgcgctt gcattaacga gcgatgaaga     45480
     tcgtcgtgat cgcccgcatc gagtccgctc gagcaacctt cgccggcgtc ctcggctaaa     45540
     cgcaacgtgt cctcgcaaga aatttcccac gcgggcatgt cttcgccacc gcgacagatc     45600
     aaccgcacga gcggtatcaa caaactctcc atcaccccgt ttcgtatgtt atcgctcgcc     45660
     gcggtatccg tgacgagtaa cgagcaaagc gcgcccatcg cgtacgtctt cagccgccgc     45720
     atgtccaatt ccgccgtcgg cccgagcaag tgttcgttat ctcgcctcgc ctccatcgct     45780
     tgcacgtacg accgaccctc aaacgcgatc tcgctcagca cgttgcaata caaatctttc     45840
     gtcgcatcat cgaacggaag gattgaacat ttttgcgcgt ttcgcattcg gcaccccaac     45900
     ccgcacgcgc gcatcacccg catcgctccc gcttgctcgc acagtgcgct gacgtacatc     45960
     tgctccccca cggcgatgtc aacgatcgac cgccgccact caggcttgaa cggcatgtca     46020
     tcgatcgcct tcagcccggc gtactcgcgt cggagcgcgc tcgagcacga cccgctgaaa     46080
     tcctcaaagc ctcgttcctc gcgttcgatc gcgcgcgcca gcgcgtgata cgaccgcgtc     46140
     gcatcgtcaa tagcgcctcg cgtgcgcgcc gcgacgacgc ttttccacgc ctcctccatc     46200
     tcgcgcgcgt ttcgtttcga ttccgccgcg aacgtcgacg ccgccaactt ctccacgctc     46260
     ggcggcaccg cgtgctcgcg cgttcgacgc ccccgcgcgc gaggcgtcgc ctcgccgccc     46320
     gcgccgccgc tcgtcgtcgc gcgcggcatc gcgtcgccgc gcggcatcgc gcgcgcgccg     46380
     ctctgccgag ccgccggcgc gtcgccggca ttcgtcgacg cgttcgagtc ggcacagacg     46440
     cgctcgcgaa cgcatcgcgc gccgaacgag cgcgacgact cggcgtcgct cggtcgcgcg     46500
     cgtcgtcgga cctcgcgccg cgcccgtcgt ccgcgtcgct cgcgcgcgcg cgttcggacg     46560
     atgtttcgat tgacgacgac gtccccggcg ttggcgacgc gatgcgcgct cggacggcgc     46620
     atcgcgggcg cgcatcgcgc gcgaatgacg acgtgcaacg cacggcggca cgatgtcgtc     46680
     ggaacgcgcg tcgtgggcgc gcgacgagac gcgaggacgc gatggacggg ggcgggcgcg     46740
     agcgcggcgg cgagcgataa ggcgaacgcg acggcgagcg acgcggagcc ggtgaaactg     46800
     ctgacgagcg atgagagcga gaatttgttg aaaatacgac acacggtgcg ttggaaatgc     46860
     gaggcgtggg gagacttgcg tcggtggtgg atcggacgac gacgcgcgag gggcgagcgg     46920
     agggggtttg tgcgcgacct gaaccacgca gggacgaaag gagactgacg atgggttcgc     46980
     tgattttacg cttcgcagag cgcgcacgtg atggcgatgg cggtgcaaaa ggtgtttccg     47040
     agcgcgcagt gcacgatcgg gccttggatc gaccggggat tttattacga cttttactac     47100
     ccagagggtt tcaccgatca agacatgaag aagattcaaa aggaaatgta taagattatt     47160
     cgcaaggatt acccgcttcg cagggaggaa gtgtcgcgag aagaagccga acgccgaatc     47220
     cgggagatta acgagccgta caagctcgaa atcttagaag ccatcaagac ggagccgatt     47280
     acgatttatc acatcggcga cgagtggtgg gatttgtgcg cgggacctca cgtggagtcc     47340
     acgggcaagc ttgatcagaa agcgttcgcg ctcgaaagtt tggctggggc gtactggcgt     47400
     ggtgacgaaa cgaagccgat gttgcagcgc atttacggca cggcgtggga gaatgaagca     47460
     cagcttcagg cgtacaacga tttcaaggcg gaggcgaagc gtcgcgatca ccgaacgatc     47520
     ggtaaggatt tgggtttgtt ctcccttcaa caagataacg ctggcggcgg cttggtgttt     47580
     tggcatccga aaggcgcgca catgcgacac atgatcgaga cgtactggaa ggatctccat     47640
     ctggcgcgcg ggtacgagct cttgtactca ccgcacgtcg ccaggcaaga gttgtggaaa     47700
     acctctggtc acagcgattt ttattccgag aacatgtacc agcccatcaa ggttgaagat     47760
     gaaatgtatc agctcaaacc gatgaactgc ccgttccaca tcgtcgttta ccaagacgga     47820
     tactactcgt acaaggattt acccattcgt tgggctgagc ttggcacggt gtatagatat     47880
     gaacgtagcg gcaccatgca cggcttgttc cgagtgagag gtttcacgca ggatgacgcg     47940
     catatattct gcctcccgga tcaaatcaca gacgagatca agagcgttct cgatttgact     48000
     gaagaaattc tgagcacgtt tggttttaag gagtttgaag tcaacctatc caccaggccg     48060
     gaaaagtctg tcggcgacga caagatttgg gacaccgcgg aaggtgcgct taaggacgca     48120
     ttgcaaatga agggatggga ttacatcgtc gacgacggcg gtggagcgtt ctacgggccg     48180
     aagattgaca ttaagatttt ggacgcaatc gggcgtaagt ggcaatgctc cacggtgcag     48240
     ctcgacttca acctgccgga gcgattcgac ctatcctacg tcgatcgcga gaacgcaaag     48300
     cagcgaccaa tcatgattca ccgcgccatt ttcggttccc ttgagagatt cttcggtatt     48360
     ctcaccgaga actacgccgg ggagttcccg ttgtggctcg ccccgattca agtgcgcttg     48420
     cttcctgtga cggacgaagt cagcgattat accgaaggcg tcgcgaaaaa gctccgcgat     48480
     gcgggcgtgc gcgttgaaat ttgcaccgga caacgtctcg ctaagctcgt gcgcacggct     48540
     gagaaggcaa agatcccggt catggcggtc gtcggtagag aagaagcgga gaacaacacg     48600
     ttggctgtgc gtacgttcaa ggatggcgac gtcggtacat tgtctgtcga cgaagtgttg     48660
     tcacgcgtca ccaccgcgaa cgcgacaaag ggtcaaagct tctaggaaga gtcattatgg     48720
     acgataaacg catcttttgt aatcgctaat cacaactgga atattcttta cttaacacgc     48780
     cgcgtctccg tcatcaatcg aagtcgctgt cttcgtcgtc gctattcaac gccatcttcg     48840
     cccctcgacg aatattcgtc gccttatcta tcacattcat cgccttctta gccgcccgcg     48900
     ggttcgcatc gcagtcgtta tcgccacctt cgtaattaat cacccccttc gaagcgagca     48960
     ccagacgcaa atgctctgtg ggaaaatcat ccgtcccgcc gacgtcgtcg aaaccgacaa     49020
     tataatccac aaccttggtg ttacgaatca gacagagcgt cggcaacatc caaattttaa     49080
     gcttttccgt caaaaacggc gacttctcgg cgttgattct acagactaac gtctccgtgt     49140
     gcttcctcgc caccgccgcg acgtgtttat ccatcacctc gcacggccac gacgaagttc     49200
     tataaaaatg tacaatcatc ttatcctctc ccttcatctt ttcgaaaaac gctttctcat     49260
     catctaaatc attcaccacc ccgtgtccac gctccagcgc gctcttccgc gcttcgtgcg     49320
     tcgatttcat cgcctccaag cgtttccttc gaatatcctc caacgcgtcg ccgtccatct     49380
     tttccaatcg atgcagctca tcgtccacgg aatcctccac cgcgcgcgcc atgtcgtaca     49440
     ccttttgctc caccatggcc tatcgcgttc gagttgcgtc agtcgtcgtc cgttcgcgtt     49500
     cggtcgcggt caacgcgcgc gcgacagctc gaaagtcaaa aaatcaaatc gacgcgcgcg     49560
     cggcgtgtcg ctttcaccgt cgcgcgcggc gcttttcgaa cgcacctgca tcgcgtcgtt     49620
     agcgttcatc gcgcgcgcgt cctccgtcgt cgcacgcggt gtgtcgtcgt cgcgatcgcg     49680
     tcgtcgtcgc gttctgacgc tcggagtgag ccgtgagcgt aaagtcttct ttgagcgata     49740
     ctgattataa aacttctcga acgagcgtcg cgcgcgcgaa gaatcggacg agcgaggacg     49800
     ccgagcgata tcgctcaaac gtcttttctc gcacgtcgtc accgattcgc gcggcacggc     49860
     gccgtcgatt tgattttaaa ggtatggatt ccgcggtttc gccgtcaaag cgacgccgtc     49920
     caaggcgcgc ttcaaatctt cctcgaatcc ttgctccaga ggatctcccg ggccgtacct     49980
     gcgaaggact cggccatcgc gaccgactaa aaacttggtg taattccaag gaatttctcc     50040
     gtcgaacggc ggtctcttta aaaactcgta caccggcgat tgcttcgccg aactcgtgac     50100
     gtcgtccacc aacggcgccg tcaaaaccgc atccggatca tccttgaatt cctcgtacga     50160
     cgccggatcg attcctttgc acctgaccgg tttagccttg accgcgattt tatccatcac     50220
     cggaaacgta tcgacgccga atttcttata cgcgtacgcg cgttccatct cgctcgttcc     50280
     cggcgcttgg cacccgaact gattcgcggg aaacgcgatg atttcaaacc ccctatcgcg     50340
     atacgtctca tacatccgcc tcagcgctgg gtagttgctg ttcaccagag gtcactcgct     50400
     cgccacgttg acgacgacgc tcactttgcc ccgatacgcc gccagcggcg tcggtttccc     50460
     gtactgcatc accgtgagat cgtacaacga ctcgggcgac tccgccgcgc gcgccggcgt     50520
     caccgtcacc atcgccgcga gcgtcgcgac gcgcgccatc gcccgtcgtc gcgtcgtcgt     50580
     cgcgtcgtcg tcgtaagcat cgtcgacggt taccgcgaca cccctaccgt tcgtcgcgcg     50640
     cgtcgtcgtc gccgtcgcgc gcgctcgcct cgtcgtcgcg cgcgtcgtcg tcatcgtccg     50700
     cgtcgcgccc gcgcgcgcgg ccgtcgtcga catgaatcgc cgcgccggcg cacctccgcg     50760
     cgtcacagag tgtcgcgtcc gcatccatgt cggcgcgcgc gttcgcgttc gcgtcggcgt     50820
     cgcgcgcgca gccgacgcgc gcgctcgcgc gccgtcgcga cgcgcggaga cgcgcgtcga     50880
     acgccgacgg cgcgtcgtcc tggaccgtcg tcgtcgatcg cgcgtcgtcg cgcttcggca     50940
     gcgacctgct cgtcgagcgc gtgtcgagcg actgcccgaa cgccgcgttc gcgggcgcgc     51000
     tggtgctgac gcgcgcggac gcgcccgacg cggtgctgag cgaacgacga gacgacggac     51060
     gcgagtcgcg gtcgggacgc gcggtcgggc gaggcggggt gttcgacgcg ttcgcgacgc     51120
     tgccggcgac gctcgagggc gaggcgagac gagggaagaa gacgatcgga atattaggcc     51180
     tgggggcggg cacgtgcgcg gaaatcatgg cgggacatca cgacgacgtg gacatgatcg     51240
     ggtgggagct ggatccagcc atcgtggaac tggcgagacg acacttcgcg gtgggggatt     51300
     tggaacgcga ggggaggttg cgcgtcgtca cgggggacgc gttcgagggg tgcgcgcgga     51360
     gcgagatcga gttcgatgga ctcatcgtcg attgtttcga tgagaattca gtcgtggtgg     51420
     cgtgtttgaa ggataaagcg acgtgggagg cgttggcggc gcgactgaaa ccgggcggtc     51480
     gcgtcgtggc caacgtgagc acgggacgag ggaaaggcgc gaagctggac gacgccatcg     51540
     cgtgcgcgca ggcgctcgcg gacgcgacgt cggatgaagt cacgatttgg cgcgcggggg     51600
     cgtgttcgat atggaacgag ctcattttga gcgggcccga ggtgaattgg cgtcgcgtcg     51660
     cggacgagta cggcgatttc gcgagtttga caaaggattg gttttacttt aaaaagccag     51720
     cggacgcggc ttccggcgcg ccgtggctcg cgaaaacgct cggggtagac aacgatagcg     51780
     catagcaaat acattgtaca ttattataga aacaacacga atacaatcaa tcaaagtcgc     51840
     cgaagacgct ttgaatcgcc gccttcgtca aaccatccgg cgtgtgcgtc gcgcgaaatc     51900
     ccgctcgaat cgccgcctca acgttccgct cgtcgtcgtc gaacaacacc acggtacccc     51960
     taaacttttc ccacgcgtct tcaccgtact tttcgcgcaa aagttcctct atttgtctat     52020
     tcttcccgcc ctcgaccgcg cacccatcct tcacgccgac gcgactcggc gtcgaaatgt     52080
     ccgctcgcgt catcgccccc tcgcccaaca cgcgatcgac gtacgcttgt atgaccgcat     52140
     acttgccaaa actcgttatt ttcacatcca tccctcgtcg attcgcgtac tctgtcgccc     52200
     gcgccgtcgt cgcgtccgtc agtcgtctcg tcgtcgtcgt cgcgtccgtc gaccgcgcgc     52260
     gcgctcgacc gcggcttcga atctcgcggt cgagcctctt cgtctctcgt cgcacctaaa     52320
     aacgctcgaa agcactcgac gtcgacgaac tctcgctcga cgtcgcgcag ctcgagcgcc     52380
     tcgacgcgct cgaccgtgac gcgctcggcg aacgagtgcc gcgcgaggac ggtgagatcg     52440
     aaatcgacgc acgccaggcg cgcgtcgccg gacgcgggcg ccgcgtcgtc gcgcgccatc     52500
     ggtcgcgtcg cgcgatgtcg cgtcgccgac gtcgcgtcgc gtccaacacc atcgcgtcgt     52560
     cgatcggcat cggcagagcg cgacgacgcg atggactcgg actcgcgacg cggcgacgcg     52620
     gcgcgcgcgc gatcgacgcg cggcgcgatg cgcggcgcgc tcgcggcgct cgtcggcgcg     52680
     ctcgcggcgt cgcgcatcgc gcgcgcttcg tcgcagggtg ttgagacacc gccgctgaac     52740
     gcgcacgtga gcgcgcgcgc gcgcgtcgcg agcgcgggaa tggacccgaa catcgaggcg     52800
     acggcggcgg cgtggttcgc gaatctcggg ttccgcgtcc tcgagggcgc gacggcgacg     52860
     acgcggggcg cgtggggagg gacggcgcgc gagagcgacg cgcggttcgc gacgtcgtat     52920
     tgcctggacg cgagcacgaa cacgagcgcg ctggaggatt acgatttcgt cgggtggttg     52980
     ccggtgtcga acgcgatcga ggacgtcatg agcgatcgcg tcgactttaa ggtggtgctg     53040
     ttcgaaacga tggcgacgga gtggtgggag cacgcgagga cgcgagcgga gagcgcgaag     53100
     gcgctgggag acgcgtgcgg atgcggcgcg ggggcgacgc ggtcgacggc gtcgacgtgt     53160
     gggaacgagg attatcatta ttgcgatatt tatccgtgcg tgtgggagcg cgcgttcggg     53220
     agcgcgacgc cggacgagga gacgtggaag accaagtaca tcgagcgcgt gcgcgagatc     53280
     aaatccgccg cgccgccggg gcgtttattg acgataccga tgaccgccgc cccggtcggg     53340
     cacgccaccg cggtgaagat atcgaaactc atagcgcagt tcctcgagat cacggacgat     53400
     ctcgacgcct tcggcgaggc gtacccgttc cttcgtcgcg atttgaacgg cgtcgcgctc     53460
     agcaacgtct ccatcgcgtg ggtcgcgttc gtcgtcgtcg ccagcgcgta catcggtttc     53520
     ttcgccaaca agagcgatcc ggcgaggcga ttcgtgcgtc ggcacatctg ttagcgcccg     53580
     tccagactta gtccatagca cgaatgtcca tagcacgctc gcgcgtcgac gcgcgcgacc     53640
     aaaccaaact caacttccga agcgccgcac acgtcgacga tgcccgacga cggcgcgcgc     53700
     gcggcggacc acgcgcgagg gcagcgaaag ctcgatgagt ttcgacgaca caaagccgag     53760
     gccaaggcgc ggtcgagcga ggacgcgcgc gcgacgcgcg acgacgagaa ggctgcgccg     53820
     agcgaggctg cggagaaaaa acacgacgac gtcgccgtcg tcaagcaaaa gctcgtcaag     53880
     gcggtgaaaa aggggaaagc gatcgaggcg gagcgagacg cggcgcgcgc gcgcgcggag     53940
     gcggcggagg aggcgcggga tgcgctgatg aaggagttgg aggtggtcaa ggcggagacg     54000
     ggggaacgag cggcggcgcg agaggaagcg gaagtcatgc gagagcagtt gaaacgaaac     54060
     gcggaggcgt tggcgtacgc gaatgatgaa tcacgcgagg cggcggatgc ggcgcgcgcg     54120
     gtcgcgaaga aaatggagga agagctagag acgttgcgcg cggcgctgcg ggaggcgacg     54180
     gcgggcgcgg agaaggcgtc gcgaggcgag gaagaaatct caaagcttcg agaagcgctg     54240
     cgagaggcga gcgaaggcaa agcgtcggcg gaaaagcaag ccgagtcgtt caagcgcgcg     54300
     gcggaacaga cgacgagtgg ggcggaatct agggtgttgg aattgaacgc cgaactcgac     54360
     gccaagtcga cgaaattatc cagtctcgag gcggaacttc tggcgctgtc gagcgcggcc     54420
     gaagacgaaa agtctgcgtt ggcggctgaa aatattcggc tggcgagtaa attagatgag     54480
     ggccggttgg cgctcgaaga ggtggaaaag gagaaggaga tgtatctcgc ggaatgcgaa     54540
     agagtgttgc agcaaaacga acaacacgag cgaatggcgg aagagttgaa gcaacgattg     54600
     agggagtccg agatgaaagc agaggcacac gccgatgaga tgagttcact caagacatcc     54660
     caggacgcga acaaagccgt cgccgaggca gaaaaacgca tcgccgaagc gcaatcgcaa     54720
     ttggcgatgg tacaagatga cgcgagccac atgcaagcgg cggcggaatc gcaggcgaag     54780
     gaactccgta cgaagatcca aagtctggaa gcgcaaatcc aaagtttgga agtggcgttg     54840
     caagcgcaac gagcgacgcc gacgccaccg agcgctaccg acgaatccat cggactacgc     54900
     caagagttag attcggcgaa tcaacaaatt aagcagcttc agagtttgct ctcggacgct     54960
     cgcgcaagcc aagccgcctc gagttccttc acgaacaaaa agaacgaaga cttcgcggac     55020
     acagatatcg agggcgcagt tctcacgggc ggctcatacg cattcgtccc gcttcaaaat     55080
     cagatgaagt cgttgacaaa cgcgccgatg ctccaccacc cgattgcgct ggaagttgcg     55140
     agtaactttg acagagcatc tgtgtacttg caacgacgac cgttcgtccg tcttgcgctt     55200
     tccgtgtacg tcttcattct gcacttgatc attttgtttt aatacaacga attggcgagg     55260
     cctagcgact aaaattctat tcatccccga cgcacttggc ttgacgattc ctgatggcga     55320
     ggcgacattg ctcaacctcc aaaggacatt cgtcttcacc atcccaccca ccgatgagcg     55380
     ctatgagcat atcaacggga ggtaacggct gtaaagcttc gatccagcgt tcgttgcgcg     55440
     cacgtttggc tcttactcga cgctgagcat tctccttcac gtctctttcg agttgctgtt     55500
     ctcgcgagcg aagaaagagc tttggaagtc gatcggcctc agccgtcatg atttcctccc     55560
     tcgtgcgttc cctcgcaccg gtcgaagact tgaaattgct cacgaccacg gcgacttcac     55620
     gaatcttgtc cgtcgtgcgt tttcccacgg tgagtaaagc gagctcggtg gcctttttgg     55680
     tcaggacgtc ttccgcggtt tccgacgtcg cgtcttcgaa ctttacaggg aaagcagcgc     55740
     tcttagagta ctgcactgac gttccttcga tggccatctt caccgtgagc gtcgagggcc     55800
     agcgctccgt gtatgcctga tgcactttga tggtggagta caagtcgcgc gcgcgcgcgc     55860
     cgagagtgag cccaattctc tctcgttcgc cgcacgtcaa tggattgtac catcccgctg     55920
     gtccacccgt gacaccgacg tcgctaccta cgttttttgg taacggcttt ggtaccatcg     55980
     tgagcgtcat cgaagagctg agcgtattct tttcgtgcac cttgtgcacg acttcagagt     56040
     cgtcgacgcc atgcgcggct ttgcacaaag ccagcgccct ttcgcgcgtg agtcctacga     56100
     gcgcctccaa ccgcttcgcg tttagctcgc gaacatccca agcggtgcgt aaattatgca     56160
     acgcgaggtt cctacgaatc aaaggttcgt tgcactttgg caaatgcgaa ctcggcagtt     56220
     ggcgaaagca tctttcgaga tcggcttcgt cttcaatgac gacgacaccg ttcggtttcg     56280
     ctaacttcga agcgattttc gccaacatct tgtttcgcgc gacgccgacg gacacgctgt     56340
     acccgcactc ttccgcgatc gctcgacgta tggattccgc aaacgccttt cctcgctggg     56400
     atggcttggc accgttttcg agctgcacgt acgcctcgtc cacggacgct ctttgataaa     56460
     tcagcgtgcc accgtcgacc cgcaaccgtt cacacgcagc gtacagcttc gcgtgcaatt     56520
     cgtacgaagc gcgcgtgtac ggctcgtaac tcaacatgtg atcgtccgtc gagtgcacgt     56580
     gcaccacctc gccgccgtgc ggcgtcaaca acgcccgaca cttgtccgga ttcatgtgtt     56640
     tcgtcgcccc taactcccgc gcgcgatgat cgacgcatat gatatcccca tgctgccgca     56700
     ccgccaccgg cacgtctctc aacctcggat tcctttgttt ctccaccgcc gcgaaaaacg     56760
     cgtccgcgtc cacgtgcgcg acgcatcgtc ctcgtcgttt cgacgtcggt ctttcccccc     56820
     cgaacccgtc gtcggtcgcg cccttttctt gacttcctcg cgtgcgcatg tcgtttttac     56880
     ggcgtcgatt gatacatccc gatcatgtgg ccgtccggcg ttcgcacgca cgccaccgcg     56940
     ccgtgcgtct cgtactgaat cttcccgtcc aatcgtcctc ccagcgtcag cgccgcgttc     57000
     acgcgcgtct gcacgtcgtc cacctcgaag tgcaatatcg gcgtgtaccc cgtctgcagc     57060
     tgcgattcgt gctcggcgcg ttgcagcgcg agcgtcggcg cgtttcccgt cgtcgaatcc     57120
     gcaccgcgcg aatcgagcgc gagttcggcg aacgtttccg tgcagacggc gattcggaga     57180
     ccgagggcgc gctcgtagaa ggcggcggcg cgcgggacgt cgcgctggag gagcaggatc     57240
     tggcgcagcg acgggaacgc gcgcgtcatc gacggacggc gtgtggcgcg cggcgcgagc     57300
     gcgaagatcg atcgaggcgt cgggacgcgg ccgtcgtaaa actacaaact aaaatagacc     57360
     cgcgagctcg gtgtcggcct gcgcgagctc gatgagcaaa tcgtcgtcga agaatttact     57420
     cacggtgacg tcttcggaca tgcccttgcg acgacgcgtc ttgaccatga actcgcgagc     57480
     gaggtgaggg acgggggcgg gttcgagggg acgcaacacg acggtcttgt cgagaggatc     57540
     gcccggaacg acggcccagt ggtcgaagta ggactgaccg aaggcttggc cttgggtgtg     57600
     gtagcgcagg tcggtctcga aaccaaaggt ttcgatggcg gggatgagcg ccttgacggt     57660
     gtacacgggg gtgccaggtt ttggggcatc gctgacgacg tgtccgcgac gtttactgag     57720
     cacggtgtag atggcgctca tgcaatcggc gggagattgg atctcaactt cgtaaatggg     57780
     ctccatcaat cgcggagtgg ccatgaggaa ggcgctgtac gcgcagcgac gcgcggtggg     57840
     gatgatttgc ccgccccctc gctgaagcgg ggcgtcggcg acgacggcgt ctaaaatttt     57900
     gaacttgacc tcgcggatag gctcatcgca cagcggaccc tcgcgcgtgc cccactggaa     57960
     tccttgtaca acggagtcac gaatcgccgc aagcaatcct ttgtcgactt cggacggcaa     58020
     agtgtcgtcc aacaacgcgt tggggccggc cgcgtcgggg ccaaacgccc agacactctt     58080
     cgcagcgagc gcgtcccact cgtactctga cttgaagaaa tcgctcacct gtttcttcgg     58140
     cgcactcaaa ttgactttgc cggtctcgat atctcgcgca agtcccttgt cgaggggctc     58200
     ggcgatcatc gtgagtttgt tctttttgtt cggcgtctcc gcgtagcact tgagcgagct     58260
     cgtctccacg acggtttcgt taaagcaaac cacaggatca ctcaccttga cctcgatttc     58320
     gctgtacatt tctcggagat ccttcattac gctatctaaa aacaactccc ccgtgcccat     58380
     gattgtgtgt tcgccgcttt cctcaacctt ggtcacgcag gcggggtagg atttggtaat     58440
     cttgcgtaaa ccttcaacca ttttcggcaa gtcgctcggg ttgagaggct ccgcagcgat     58500
     cttcatcacc gatttgttat cgaactctaa cggtttgaaa gcgtacaagt cgtcgtcgta     58560
     ccctttcggc atcttctccg gtaccaacgt ggcagttgtg gtgatgcttt ggtctatgcc     58620
     ttcgatgagg acccaagcgc ccgcgcgcgc ttccttgatg ggaatacgat aacgcgcttc     58680
     atatatccac atattcgtca cattcttcac cacgctgtct tcttcgtcat ctggggagaa     58740
     gttttcgccg agaacacgaa cgcgatcgtt cttcctaagc gtcccgcaca tcacgcgacc     58800
     gagcgcgtcg aacgccgagc aatcgctttt tgggatgagt ttggaaacca tcaccacggc     58860
     tggtgcgtcc gggtcacacg cccgcattgc atcgacgagt ttgccaccgt tctttaccgg     58920
     gccgctgtaa gcgcgctcaa tcttcatagc cgcgccttct tccgccgtcg ggatgtgtgc     58980
     ggcgagcata tccgccagcc cagacgcggc gccgaaaatc ttctggcacg tcatcttgag     59040
     cagcggcttc gtgtttgctt tcgtctcctt tggcttcagt ttgatgccaa attccttcaa     59100
     cttatcagac acgctgtcaa tagtttcacc gacaacttgg ctgaaaactt tgtacaacgg     59160
     ttcgaggatg aactgcacga aggtgcgctc gccgccgccc ggcggtggct tcttcttgaa     59220
     catccgcgta tcgccgtgat aatacacatc gccccacatc ctctttgcga actccttatg     59280
     atcgactaac acgccgttca catcgacgta gagtttggcg aacgattcta aggtgaaact     59340
     aaatccgtac aaagcgctcc caaagcaaac cttgccgttt tccggactca ccgtcggcag     59400
     agctccgtcg gcgtctggtg tgtaaaacgt ctcgatcaag ccgttgattt cttcgatcgt     59460
     gtgacggagc ttgtgatagg catccgcggg cggaagcttg agctcgacaa tcaagcgatc     59520
     aatcttcgat atgaagacgc acacgggcaa accgtctcgc gccgcgtgct tgatttgtcg     59580
     cgtcgtcgaa gtcataacac cttcgcacgc atcgacgaca agcaacactc catccgccaa     59640
     ccgcatcgat gccgtcactt catcgctaaa attcacgtgt cctggcgtat ccatgacgtt     59700
     aaacaccatc gtcttccctc gactcgtctg caacggcagc gtcatcggcg tcgacttgag     59760
     cgaaatccct ctcgcctgct catccatcct cgtatccgtg tacctcagct gcttatcgtt     59820
     cgccagccag tcataattca cgtcgtgcga acactcgagc agcatgtcaa acagcgtcgt     59880
     tttcccgtga tgcaaatgtc ccgccacgca cacgttgcgt cccattcttc gcgactcccc     59940
     gtgcaagccc accaggaact cctcgctcac cttcatggcg acctccgcgt cttgcgactg     60000
     cacttgcgcc cccacgcttc ctcccacgta tctctgtccc gcggcttcga tgttcttcac     60060
     ctttaccggc gccacgatgg gcgtctcgag cgcctgcgcg tcttcgttct ccacgagcgt     60120
     ctccgtgccc tccccgtaca cctcctcggc ggtcgggtag tactttttat cctccgcgag     60180
     cgtgatcgcg gacgcgttca agtcatcatc gtccatcgcg tcgtcctcgc tcgcgtcgga     60240
     cgcgtcgtgg gcgtcctcgc gcgcggcgtt cgtcgccgcc gccgcgcgat cgtcccgact     60300
     ctcgtcgcga cgcgcgacgt cgtcgtcgtc gtccgacgat ccaatctcgg ggccgacgta     60360
     gtttccgaac tcatcgtaca ggttcgcgtc catcgcgtcc aagttcgcgg gcgcgccgcg     60420
     cgcgcgtgtg acgacgcgcg gaaagtcgcg caattcgcga cgacggtgca aacccccgcg     60480
     gcgccgcggc gcggcgcggc cgcggttcga cgcggcgagc ggtggggaag ccggtcggtg     60540
     aagacgacgt gaaacgctaa taaacttgaa tgaacgtatt acacaaagtt tgctcgcgcg     60600
     atcgcgcggg cgcgcgaagg cgacgaacgt cgcgagtgac catcgagcgg cggcgcggcg     60660
     cggcgatttt acgcgccgac tggctcttct cttggttcaa gattgatcca aacaccttcc     60720
     gggaagcaga tggtggtatc gtacatgatg tttaattctt caccgagctt gtcgcgaccg     60780
     ggtccagctt tggaaagctt gaacttttga accgtgctgg cgagcatggt ggtcgcggcg     60840
     agcaaggcga agacgccgcc gatgcaagat cgcggtccag caccgaacgg ggtgtacgta     60900
     aagtcgcgac cagcagtcat gcggcggcgc atgcgctcgc gcgcttgctc gagcttcgcg     60960
     ggatcacctt tggcgaccgc ggatgcttgc ttctccgcct gcgcgtagag cgcctcgtcg     61020
     gtgaagcggt cgggatcaaa cttttcagga ttctcccaaa ctctcgggtt tcgccccatg     61080
     gcgtacgtgg ataataaaat aaagtctcca gcttcaacct tgtgtccgct gggcagcgtg     61140
     tccgcgcctt cggcgaggcg cgggaacaag ttgatcgggg cgtatttgcg aagcgattcc     61200
     ttcacaactc gctgcgtgta aggtaatcgg ccatcttgca catccttaaa tgtcggcggt     61260
     cgaccaccga gcgcctctaa ctcctcttcg atgccacgct gaatgtgttc gtacctcgcc     61320
     acgtgccaga ggttcacggt aaagttggac gccgtcgtcc tgtgacccgc cgccatgatg     61380
     tcgttgatat ccccccataa atcggcatcc gaaagaggat tgccgtcggc atccttcgcc     61440
     ttgaccaata catctaacaa acaataatct tcctcatcac ctgccgctaa gcgctcctta     61500
     accaccgctc ggcgctcgct catgagcttt gtgccaacag actccaaaat cgcgtactgc     61560
     tccttgagct ctcgcactcg accgagaccc aaaaagttct ggagcttgag aatcggcccg     61620
     ggggtgatga agagctcgcc catgatctcg ctactaccgt tgtacgcgtt caagagcttg     61680
     gaaatattat catttttgcc ctcttcgcct cgaagcgttc tggcttcgtg cgcctcgcac     61740
     tgctcaaagt cgtacgcgaa cgcaaccttg ccgatgacat cgagcgtaac ttgctgagag     61800
     tcgacgtcga tgttgatttc catcggctta cccgggttca tcgccgccgc cgacgtccac     61860
     gtgttgcaca tgtacgcgat gcgctcctcc accgtcgacg aaaactggct cagcgaaaac     61920
     gagttgatga acggcttttg gcacatcaat ctatgatcgc ggttgtactg cccatcgctc     61980
     ccagtgatgc ctttattttg gatcacgtat cggaaagcgt ccggaagcat tcgtaatctg     62040
     tagtttttcg cattcgtgaa gcacacgtac tcgacgattt ccgggtccaa aatcgacacg     62100
     caaaacggcc cgatggcatt cttgatcccc acgcactcgc ctttctccgc cgcccaatcg     62160
     agcatggcga tcggcatccc cactggatgt tgcgctgcct tcaccaacga cttcaagaat     62220
     gacttactat cgatcatcgc cggattccca tccgcgtctg gccgcgtcgg cggcggtccc     62280
     gcgaacccca gcgcctcctt cgccgccgtg tacgggcacg cgcctccctc tgtttcgccc     62340
     tcgaccgcgt cttcaccgcc gaccacaaca ctctcaccgc tcgacgtggc cgtggcgacc     62400
     tcatcgtcct cctccgcgac gagctccggc gcgctcgacg cccccgagcg cgtcctcgcg     62460
     agcgatcgca tcccgtccct cgacgccccc gtcccgcgaa tcgccgcgcg cgcgcgcgca     62520
     tttcgtagaa agcgcgcgtc ggcgcgcgcg cgagcgcttc gcggcgcgtg cgcgcgcatc     62580
     gtcgctccgt gaatcatcgt tcaaagtcga cacgcgcgcg ctggcaaaga tatgcctcgt     62640
     gcgcacgaat gcgacgttcg cgcgcgcgcg ggtcgcgcgt cgaggcgttc gagcgacgcg     62700
     ggcgcgcgaa ggcgcgttga gcgagcgttt cgcgcgcgcc aacgggtcgt cgcgcgcgag     62760
     acgcggcggc ttctggccgc gatacggcgg cgacagcgcg caaccatatc cacaaagttt     62820
     ggtctatgcg taaacagtgt cagtatttag tgtcgatttc gtctatgtag tgtccgcctt     62880
     cttcacgaac gcgcgcgaag cgcgtcgacg cagaaggaga cgggatcgga aacatcgctc     62940
     gggacctcga tcgcgagcgt gttgactcgt gcgagatcgc tggatgacgc gcgaaacgcg     63000
     tcgatgggga cgacgaacga gcgcccgcac tgggcgtcga tttcgtagtc ggacgacgac     63060
     gaccccggat cgagacggaa ttttctgccg acttgcgtct cgacggcggg agtgaggacg     63120
     gtgccgtttc gccattgctt tcgcgtgcgg tgactgagac caatgatgag cgagacgtcg     63180
     aaattgtccg tgcacgagat gcgaatccaa acggagacgc tcgagacgtt ggcgaatggc     63240
     tttgccgata tttcacagag ccagcaatga aacgcgacgc gtcctcgcgg cgaaaattcg     63300
     ccgcagagcg cagacgaaga ctccatacgc ccgtatcctt cgcggttgat gacaagccag     63360
     cgatcgcgat acggcaaaag tgcccatccc gcgccgaggc caccatcgta aatcttcgct     63420
     tcgacgcggg cgcgcgcgcc gagatcgacg tctagacgtc tcgaatcttc gccgcacgac     63480
     accggacgaa actcaatgtt catctttcct tgaatggggt gcgcaagctt ttcgaacgca     63540
     taaaacgaca aatcgaaatg aggtaccgga ccacagcaga tctcttgagt gccgtattcg     63600
     tagtcgcacg ggcaagtgtc gatgattttc actttgatga cgagcgactc atcccagcac     63660
     cgcacgaact cgtattcagt cgacgtagca tcatcgcgct tcgccgggcg cgctggaacc     63720
     ttccgtccgt acgaatcgag agcgtcggga tcgacttccc aaaagccgcg ctcgcgagaa     63780
     tactcgattc gcccaccgct aaagtctttt agcacgaatc cggagacgca tcgtacctcg     63840
     aagcacgacc cacacgcgcc ttcgtggagt ttaagatcgt aatccgccac ggcagcgacg     63900
     gcatcgcgcg cgtaaggtag gttctcgttg ctttctagtc cctctccttt gttgacaaag     63960
     ccgcacgcgt tgccatagag gtcgccaaaa atttgtttgg cgaatgtctt cttccatgcg     64020
     tcgggggcgt cgaagtacgt cgcgcgagcg cgagaccacg atccaactgc cgcgtctact     64080
     cgcacggcgc gcgaaacaac gacgatgaag gtcgtcaaag cgatcgaggc gcgcatgatt     64140
     gtgagcacat gtgctgtcgt cggcgtcggt tacaattctc caatgtcgag tcgatcacgg     64200
     cacgtacgcc gcagccgaag cgacgtcgcc gtgtgtctcg aaatactcca ctaatgtcgc     64260
     tagaaatcta tcgctgctta ctgtgtcgct atcgatgatg aggcaacagt gcttccgtgc     64320
     ccgcgtcacg gcgacgttca tgcgccgact atcggagagg aatcccacct cgcccgatgc     64380
     gttcgaacgc actgcgctga taatgatggc ttctttttcg cgtccctgga atccatcgac     64440
     ggtagacact tccagatttt tgagcgcgtc gtctctggcg cgaagttcac gaagcaccgt     64500
     gacttgaccg ttgtacggcg tgatgacgcc gatgtcgtcc acggcgacgt cgtggcgagc     64560
     gacgagacgc ctgaccactt ccattaccac cgccgcttcg tcgggatttt ctttgctttc     64620
     gccatcctct tctacgcgct cgtccatatc gcagccggcg gtgtcgatca agagtaaaac     64680
     gggagggtcg tcctcgccgt cgcctcgaag tcgatgcgtc gcgacggatt ccgccgcagt     64740
     gagcttacct tggtacatcg cctccgagga ccacgtcatg atatcagcat gcatgcgata     64800
     ctgcacggta agcatacgag caactaaatc gccgtacatg tcgtgaagcc gttgaaaaag     64860
     cgtgtcgctc aatcctttcg cctgcgcttc atccgagatc accgtaggcg gaagctgcaa     64920
     atgatcgccg gcgagcacag tcttcttacc ttttaagact gctccccagc acgcggcttc     64980
     gagcgcctgg gcggcttcgt ctatgacaac gacatcgaaa tcttgaaatt tcaacgttcc     65040
     cgacagcgct ccactgagcg ttgagcacac gacgcgcgcg ccgtcgacga catccctcat     65100
     cgccgccttt tgacgattcc gttcctcctt tgctagcact ctcagctcct tgcgaacttc     65160
     gttccgttcg acgcgatctt ttctgtcgtt gagcttcaac aactttctac gcaatatttt     65220
     gctctccttt gcgcaatctt tagcgagctt gctgttatcg ctcgccagga gttgtgcctc     65280
     gagtgacgcc gcgagcacgg acggcagcaa tcttgccggg tgaccgacgc gtaccaggcg     65340
     catttcgcct ccttcgggaa gcttgatttt catcaagcgt tcgactaagt tgtctatggc     65400
     tatatttgag gccgtgcacg cgagcacgcg agagccgcgc gcgacttcct gtgccacgta     65460
     ctcgaccacc gccgtcgttt tgcccgtacc gggaggtcca tgaatcagtg caaagtctac     65520
     gcagcgcaac gcgtgctcga tcgcaccacg ctgcgacgcg tctaaagcgg tgttgatcca     65580
     ttcgacctct ttcccagttt tcgaaactcg aggcttggag tccccgaacg cgacgccgac     65640
     tagatgcgcc cccggctgtt tcgcgtcgct cgaaccccca tatttcccta ctcgctcgac     65700
     cgcggaaacc aaccttttgt gcgtcgcctc gttggataac cgttctaaac gtaacgtgcc     65760
     gctgagctcg tccggcatgt catcgcacgc gagctcgatt tgcgtatccc gaattctata     65820
     cacgacgccg ctcgccagcg gttcgccctc cgccgaagac ttattcggcc tcaagcaaac     65880
     cacatcgtgc ggactcagct tatgcggcgg caacggcaaa gcatccgaac cattcggccg     65940
     actcgcgagc tctaaagtca cgatcgtctg cccgagcaaa ccgccgcgaa gatccgtcgc     66000
     ggtcaatccc aacagcgctc gaccgcgtct cgccgccgcc tcgggagata gccctcgcaa     66060
     tatctcctgc gcctgcgcct cctcggcctc gcgctcgagt tcgagcaaat ccatcgtttt     66120
     cttcgtccag cgcgccaaac cgtccccatc gctcgcgtcc tcgccgaaat cgcgcaattc     66180
     ctcgagcgtc gccgagacgc ccagccgtcg acgcagcgcc tcgaccacgt cttcgtcccg     66240
     cacgcaaacc atctctcgat aaatccgcgc gttcgcgctc aggtccccga cgacgattct     66300
     tcggtcgctt cccgcgtcgc cgtgcgaggc gtgttcgagg ccgtggcgtt cacagaacgc     66360
     gtgcaactgc gcgcgctgtt tcgcggaaag cgctggagag aactcgacgc gcgccggttt     66420
     accgccgcgc gcggcgtcac cgcgcgccat gatcaccgac gcgcgcggtc gatcgcgcgg     66480
     tcgatcgcgc gagggaggtc ggcggacgcc gcgcgcgcgc gcggcgctgt ggcggtgtga     66540
     ccgtcttcgc gtaaccgtca gccgagtgcg tgcgccgagg ccgatttctt catcgcgcgc     66600
     gcgacgaacg acgcgacggc gcgtggcgac gcgctttaat tatagtaatt atttcaccgc     66660
     tatttggagc tcgcggcgat gacccaggcg agctgacgca gagttcgtcg cgtgacgtcg     66720
     acgcacgcgc gctcgtcgcg agcgagttgc tcgaacgagg cgtcggcgac gtcgaggagc     66780
     gtcggcgcgt ctcgaggcca aacgtctcga agagcatcgt gcgcgcgacg cgcgagcgcc     66840
     gtcgtcgcct ctttcgtggc ttcgataaaa atcttgacgt cgtcgtcgta cccggcgacg     66900
     cgttcgcgcg cgagcacggc ggctggaacg gggtcgacgt cgagccaatc gccgccgcga     66960
     atggaatcga cgacgcggac gattttttcg agcgtcgtcg tcgagagttt tgctaatccg     67020
     tcgcacacgc actcgtcgcg cagttcgtcc agcgcctcct cgaacgcagc gacggtgtcg     67080
     gcaaagttgt cgcggctcga tccagacgtg ctcgcgagcg tctcgccaat ctcttccgct     67140
     ctcgcgtcga cggcggcgat gagcgcgacg agcaccgacg actcgacatc gtgtgcgcgc     67200
     gcggcatcgt cgccgagcgg tacggccacg agcgtggccg ggtcaccggg cgacgccggc     67260
     ggcgccgcgt tcgccgtgga ttgttcggcc gtcaacgtcg cgtcgagctc tcgaacgagc     67320
     tctcgaacac ggcgctgcgc gtcttcggac gcgccgttca ataacgcatc catcgcgcgc     67380
     tcacacgcga cttcaacgtg cgcttgcgct gtcgccgcgc cgaagtcagc cagacgctcg     67440
     accaaaatcg cagccgcgcg ctcgtcgtcg tcctcatccc ccgccagcac gtccgccgtc     67500
     gccttcacca ccgacgtcag cgcgctaaaa gcccccatac ccacgctctg cgtcttcttc     67560
     gtgacgttcg tcgcgaacgt cttcgggtca ctcgctgcgt tttcaatcac tccctcagcg     67620
     ttttccaacg cgcgcttcgc cttgttcgcc gcgccgccga acgcggccca agcgcccgat     67680
     gcgaacgtct ccgccagccg caccgcgtcc gccgtcttcg gcgcgtcatc tcgggcgtct     67740
     tcgtttccat cctccgcgtc gtcatcgtct tcgcgaacga cgcgcgttcg cgcgccatcg     67800
     tcgccgacga cgtgcgacga aaacgtcttc aagtctcttc gcagcgcgcg cgccgcgtcc     67860
     gacgccgccg cctccttcac caccgccttc gccttcgcca agctcgcgct cgcccatcca     67920
     cccaaattca tcgccaattt tcccacgtct ggcgcgtcca acggcggtaa cggcggcggt     67980
     ttcgccgtcg acgccttttc cgtctccgtc gtcgtctccg tcgtcgtcgt cgtctctgtc     68040
     tcgccctcgc tcgccgcgcg atccgcgtcg tccgtcaccg acgacgaacc atcgtcgcgc     68100
     gtcgtctctt ccggcgtcac cgccttcccg tcgcgcccgt cgcgcgcgtc gtcgtcgtcg     68160
     tcgtcatcgt cattctttcc gtcaaacaca tcatcgtcgt tctcgtcgtc gtcgtcgcgc     68220
     gtctccggtg acgcgtcgcg cgcgtcgccg tcgacgcctt cgctcgcctc gtcgtcgtcg     68280
     ctcgaatcga gccaggcgtc gatctcgtcg tcgtcgtcgg acatcacagc gcgacgcgct     68340
     gtgactccga aacgatgttc gcgcccggac cgcgcggtcg cgcgcgcgcg cgcggccgcg     68400
     acggcgcgtg cggggacccg atgttttact acctcgcctg gcgctcgctc gaggcgatcg     68460
     cgcggtgctg gcgggcgacg cgcgacgcgt tcgggttcga gccggtcggc gcggcggcga     68520
     cgctgggcgt cgttttcgtc gagcgcgtcg cgcgacgcgc gccgggcgcg atcggggacg     68580
     ccgcgcgcgt cgtttcgagc gccgcgatgt gcgcgcgcgg gcgcgggcgc ggcggcgccg     68640
     cggagaggct tcgggacgcg gcgctcgcga cgtgctcgca cgagagcgac ttcgcggtgg     68700
     cgtgcttcgc gggatcgatg ttcgctaaga tggcggagac ggagcggcga gtgcgggaag     68760
     cggtcgggac gcgcgcgagc gcgccggcga cggtggcgtt cgcgctggcg ctgggaatgg     68820
     cgacgaacgc ggcggcggcg gcgagcgcgc gcgcgctcgg atacggcgac gcgtgctggc     68880
     gcggcgcggg ggggctcgtg ttcgcgctga agacgtatcg ggcgagggtc gattacgcga     68940
     gaggatatcg cggacgggtg agcttttttg gattcatcga cgtgccggcg gagacggcga     69000
     gcgtggcgga gattgtcatt ttggcgttga tggattcgtc gccgacggcg ttgaatctgt     69060
     acggcgcggg cgccgccgtg ggattcatgg tggcctcgtt tgagcgagaa acgatgcgcg     69120
     gcttagcgtg cgcgacgaga ggcgtgaaaa aattgctcgg cgtagcgctg ggaccgagcg     69180
     ttcgcgtcgg ctcgcgcgtc gtgttggcgc gcatgcgcaa cgcgtcgctc aacggcaatt     69240
     ggggaatcgt cgtcgagacg cgcggggatc aggtgacggt gtctctggac gtcgacgggc     69300
     gaaacatcac ggctttacga gataacctaa tcgtcgtcta aattctacgt ctacgcgctg     69360
     ctgtaaaact aaactgtacc gattgccgaa cgcttcacct tcgcacgacg gcgaaacgat     69420
     acaccggtcg ccatttgcct tcgcacacga tatcgcgctc ggtgaacgcc tcgtacggat     69480
     ttgcccgtag ccatcgtcga tttcgaaccg gctttacgtc cggaagcggt tcccattcaa     69540
     atttgtgcgc ggcgtcgtgc tccgggacgt cgtccaaaga agcgggcacc tcggattcgt     69600
     ccatatcccc cactcgcgcg tacgtcgctt cgtcgatgat aaagtcatcg ttcgcggcaa     69660
     cgacatcgta catttcagac gccaacgctt tcacgtccga gcaacagaag agctcgccac     69720
     cgctcggaag gacattcgcg agcgctcgcg cgaattcggg cgtcatcacg cgccgctcga     69780
     agtgtcgtcc tcgactccaa ggatcgggga actgcacgca caccgcgcgc acgttcggta     69840
     agttcatact ctccaacgat acgttcacgt tggctgaaac gaagtgcacg ggcagacgta     69900
     atcgcgcctc attcgcccgc acccacgcgt tcgcctgccg caccagcggc gggtaaattt     69960
     caacccctaa taaattaaac tccacgccct gcttcgctcg cgtgaacgct tccgcgcgtt     70020
     cggttgataa agccttaatg aaaccgccct tagcggtgcc gacgtctact aacagcggcc     70080
     gtccgcgcgc gtctccgaac gcgctcgacc aatacgcttc gtcgagcgtc aacggcgcct     70140
     gaaacggcgc cgacatcgga ttggtcatct tcttcattcg tcgattcaga ttcttcttct     70200
     ttccatcgtg cgtcgtcgcc gcctccgtcg tcgtcgtcgt cgcgacgttc aacatttcgt     70260
     tcgcgtctcg acacaacgtc tcgtccgcat caccctcttc gaacgcgcgg tgccgcgagc     70320
     acatcgtccc gccgtccctc gcctttgccg cgcaaaaccg tcgttttcgc ggcacgtacc     70380
     gcgcgcagcg cccctcaccg ggttcaccgg cgagcgcgcg ttcgaggcgc ttcaattctt     70440
     cgtactcggc gagccacgcg gggtcggcga cgatggcgtc gagcgacgcg cgcgcgccgg     70500
     gtcggtcgac ctcgtagtcg tcgtcccggc ggcggagcgt ctcgcgcagg acgcgcgcgc     70560
     gcgcgacgac ggcggacgac gacgggtcgt catcgccgac gtcaccgacg cgggaggaca     70620
     tcgcgcgcgc ggtcgcgcgg tcgcgcgtcg cggcgatgtg tcgtaaagcg ctgtcgtaaa     70680
     gcgtaaagcg acgcggcgcg gcggcgcgtc ttacaaaagt gaaaaatgcg tcatcgcgtc     70740
     gcgcgcgtcg cgcgacggtc gagtcggtcg acgtcgatcg ataaaggttt gattccgtcg     70800
     gttcacgccg atttggcggc gtaccacgcg gcgacttccg gaatggcgtg aaacttttcg     70860
     tagtacgcga cgacgtcggc gaaggcgtcg agacactctt tgggcacgtg atcgatcccg     70920
     ccgctgcgaa atctgcgcaa cagcggcacc aacgcgcaat ccgcgatcgt cacccggtcg     70980
     ccgcaaagaa acttgccgcc cgcgacgcgc ttggagatga agccgcagta tcgcggaagc     71040
     tcttcgcgga tccagcgctc tcgcatcgcc ttcgtcgtcg ccgcgtgcgc gtccgaccct     71100
     ttctcgagat tatacttctc gggcgccatg ccgaccgcca agttcgggta ccacgactcg     71160
     cgcatgtcct ccaccagcga caccgcctcg tcgatttcgc tcgcgcgttg ttcgtcgtac     71220
     aatccggcta accgtccgca gtatctcaaa atcgcatccg attgcgccat cgcttcgtcg     71280
     tcgacgtaca tcacgggcag ttgtccgtac ggcgtcgtcg gtttcacgct cggccagtcc     71340
     tcgaacgcga cgcggtcgtc tcggaaggga atcttcgcga tcgacagcgt caatcgaatc     71400
     ttctccgcgg ggccttcgat gttaaagtat tgcaagcgca gcgcgggcgc ggcggcggcg     71460
     gcggacatgt cgaagccgtc gtttattcgg tcgcttcgtt cgctcggttc gcgcggatcg     71520
     cgcgaaagtg acgcgcgcgg gtggacgctg acgatgatga ttgatgatga cgaatcgcgt     71580
     cgcgtcaacg ccgacacgct tcgacacgct tccatggtga aactagtcgc gaaggcgcgt     71640
     tacaacaaaa tagagcgtcg cgaaggagcg agactaggac gcgcggatcg atcacacgaa     71700
     cgcgttgctg gcgctgaggt gctggatcaa accgagggcc aaatcgcggt cgacgccgct     71760
     tcgctcggcg acggcgcgct gctcggtgaa ggtgagcgtc tcgaatttgg agagtaaacc     71820
     gccgtcgagg acgtcgaggg gggcgagtaa ttgcacatgc ttgccttcga agactttggg     71880
     ggtgcgaaac gtgcgcgggt tgcaaccgat cggtgagcgc accgtggtgt tcaactcgcg     71940
     ttgaagggcg tggagcttgg cgtacgtcgg ctcgtcggtg ggcatgaaga tgcccaaagc     72000
     gccgtcgagc gtgccgaaga agacggcgtg tcgattggtg cctttggggc gttctcccgg     72060
     cgcggctttc gcggtcgtac cttccacgtt aaaacgcacc atgcgagaga tgggcgaacc     72120
     gacgtggtac gccgaacgca cgaggagttt ctgtcctttc cacgactcga gcgattttgg     72180
     atcgtagcca aagatgcgcg cgttgccgct catgtcggac ccgagcaaac tcagagtggc     72240
     gccgtcgatc aagaactctg tgctcacgac gtccatgcga tcgaaatcct tgctgagctg     72300
     aatgatcgac ttctcgaagc cgttcgcctt ccagcggaaa aagtgcaagc ccttctctaa     72360
     atcgcccacc aggatgaaat tcttcacgac gttgatgctc acggtgtgaa ttggggtgtc     72420
     gaagaaagcg acactattca attcgacgcc atcccacgtg tgcacggtga gcttggtacc     72480
     gaccgcaaca atcaggtgac cgtcgagcgc cgataacgcg gtgcacgcca tcttcgcttc     72540
     gcgcacgcag cacacttgtc ctttccatct gtacccatcc atggattcgg cgtcgcgctc     72600
     ccacaccatt tgaaataaaa tgacgcgacc gcgacacggc gtgtcttctc ctccaggcat     72660
     cgccgtaccg acggcaagaa gtgaaaggag tgccccagtg ttaatgtctc tcaattggac     72720
     atttcgaacg cactgcacgt gctcgcccgg ttcgagcgcg tgttgccacg cgctatcgag     72780
     cgatccagga acgaggagtc gcaccgagta ttgtaactcc atgtcatcgt tcgctttcgc     72840
     gcgctcgcgt cgcacttttg ccaaggcgat accgtggaca ttatcttgct ctatttcccg     72900
     ttcgacccaa ggcacaggag ctgatgtaac cagtgcgtag agcttgaaat ctggcaggta     72960
     cgtaatcgtg tgcggcgtac acttgagcgc caccttgcgc accggccacg cagcttcgta     73020
     gtgcatttta ctaggcatct gacaaatgcg cacgccaccc aacgcggtgc ctagaatgaa     73080
     accgtgcgga cagttgacgt tgtggaatac cgtgaatgcg acgacctcgc cttcaccacg     73140
     cgtcgggaga gctaatacgc gagacctgcg aacgatgagc cacaacgggt ttgggcctgc     73200
     gacaaagatg ccttgcacgc cttgtccttc gccgacgtta ccgatgcgcg tcaatcgcgc     73260
     gcccgctagg gagtctctaa gctgacctgc ggcgcctatg ccagcgacat tcaaaccaga     73320
     accttcaacg tcgacgttga cgcgagaaaa tcgcaactca ttcttttcga gcggttcgtc     73380
     ttgtccttcg tacgtcgtcc cggcgggaac aatgaaaccc ttatacaaga gcaacgtgcc     73440
     atcgccacgc actgcggtga gcaaagggcg ctcgtgcgca tcttggaatg aatcgatgcg     73500
     aatatcgaca atctcaggga cactggactc agcgttgacg ggtgtttgcg gactcaatac     73560
     gcgcatgccc tcggacagcc catcggcgca ccagatgcgc gtgcagctgg gcaacgaaaa     73620
     caattccaga cttccaccct cgcgcgtcag cgcgacgatg gcctcgctgt tgttgcacgc     73680
     gccgctcttc ttgttccctt ccaaacccgt aatggtgcca ttcgtcgcag ctcgatgaat     73740
     ccatccgctc ttgcgttcgc ccccgcccgc cgcgtctgcg gcttcaacag aatcatccac     73800
     cagagcgaac gccgttactg aagatgttgg gatcgccccc gtttccatca acgaaacact     73860
     catctgtttt tcgtctccgg acaacaatct tatcgaacca tccgatagcc gaacgatgat     73920
     gtaaggatct aaaatctgtg cggacgcgat cgcggctccc ttcggtgcgt ccatgtcctg     73980
     caaaccgacg tcttgtacct tcacgcctcc ctttaacacg cggatgcccg ttcccgtgac     74040
     ttggaccgag cagtaatgtc cgaaaatatt cgacgccgcc aacgtggctt gattcgtgat     74100
     gaactcgagc gaggcgctca cttcttgaag ctcctcgccg gtttccatga tcatcgtcga     74160
     cgacttcatg ctcagtaaca aatgatgatg gaaaggttcg cgttcttctt tcgaaccttc     74220
     tttgcgatag tgcaacgtcc acaaaccttg taaattgggc agcgtaccgg attcgacttc     74280
     ggtgacgagt tcaggctgga cgccacgagt caaaattgcc agcgcaccgt tcttcccttg     74340
     accgcacgcg gtgatgagct cggtgcgctc gttcttgttc gaacccatgg gcgcgctcgc     74400
     gccgacggcg atatccacca caggcgcgac gccgagcaaa gagtccttga ccttcaaatc     74460
     gtaaccagca accttcaagc ctgggatgat gccggccaag ccttcgcgct tcttctccgt     74520
     ttgcacggcg tcggtctgca cagtctccgt tttcgtcgtg ccgtagagca acgcctcgag     74580
     ctcgtcatcg tcatcttcgg gactcggcgt cgacggcgct ggtggcggcg cctcggcggt     74640
     tttggcgcgt ttgcgattcg ccgcgccgcc cgatttagag cgcttaccct tcgacttctc     74700
     cgtcgcctca tcctcgctct cgtcttcggc gtcgggaagc atgagaggtg ccgtcggttc     74760
     ttctttaggc gtgaacttca ccaaaagcga gtcaccaatg cgacttccta ggaacaacaa     74820
     atctctcgac agcagacaca tgcccgaaga gagcacagcg ccgccggcgc gctgaagcat     74880
     catgcgacgt aaactacggc catcggtgtg aagagctaag agcaacaacg caccggtttt     74940
     tgttgtcacc aagacgcgat cttccgacac aacagacgcc tgagcgccat ctaacgtgat     75000
     ctctaatccg caatcgacgg cgcgcgccgc gcacgccggc ggcgggttcg ccatggcgtt     75060
     ctcccccatt cccgccgcgc gcgcggcgac ttcggcgtcg ttcccttctt gcggcccacc     75120
     gtgaccgaaa gtattcaacc cgagcacgga cgagctctct tgggattcgt gcagcaaaaa     75180
     gtcttgcgaa aacaccaacg cgccgccgag cggcggcaag agcgccgtca acttgtacga     75240
     gctcgacggc aagttctgcc gacgccaaat caccgtcccc ttttgcttgt caacgtccac     75300
     gctcagcgcc acgatctcac acgtatcttt gctcaggtta taccgcccag cccacgtcgg     75360
     cgtcttttcg tacaaaaccg ccagcgccgg ctcgccgtat ccgtgcaaaa aacacgcgtc     75420
     gcgaatcaat cgcacccccg gcaggtgcag cgggaacgac tcgcgcacgc tcgccgcggg     75480
     tcctcgcacg cgtccctcgt cgtcgttcgc caccagcccc aaccccccgt ccacgctcgg     75540
     cagcactcgc accttgcccg cgacgccgtc ctcccgcagc accaccgccg cgcaccgacc     75600
     ctcgggatcg ctcaccacca gcggcgcctc tctcgacatc cgcagcgtcg ttcccagtgg     75660
     attacacccc agcgcactct cgaacgagtg catcgacgag cagcacacgt ccccggtcgc     75720
     cgcgtcgtac tccaccacgc tcagctttcg ctcgcgaatc gcgatcaaca gcgcgtctcg     75780
     ctgattcctc ggcgccccga accgtcgtct caggacgctc atcgacccta tcgcgccctg     75840
     cgcgtcgaac tcggcgcaca cgtcgagcga ttcttcgtca ccgcgccgat tgacggcgta     75900
     cacggtgatg cgattcgcgc tcgcgacgat cagattcggg tccccgccgt cgcccacggg     75960
     gcgcgtgaag tacgccgtca ccgcgtggtc gacgcccgtg ggcgggtgca cctcgcggtg     76020
     caccgcgtgc gacatcgcgg cgccgcgcgc gtcgagggcg gcgcgaaatg caggtcgaat     76080
     gcgatcgaag gcgcgcgtcg ctcgacatcg cgacgccgcc gacgcgccgg cgcgtcgatg     76140
     cggacggcga cgcggacgac gacgacgacg acggcgacgg cgacgcgcgc gcgacgcggg     76200
     acgcgcgcga cgacgacgac gcgcgcggac gcgcgcggtc gacggacgac gcgcgcgcgc     76260
     gggacgttcg aggacgacga cgcgggcgcg cggacgacgc gcgcgcgcgg cgacgggcgc     76320
     gcgggagaaa cgcgggcgcg ggacgacgcc atgggcggcg cgcggcgagg cgcgggcgcg     76380
     gaggacggga cgacggcggc ggcggcgacg gcgagcgcgg cgcgagacga cgcgggtcgg     76440
     aggaagacga aggaacggcg cgtgctgttc ggggtgccga tgtcgccgga ggtgtacgcg     76500
     atcgcgttgg tgtatttcgt gcagggcgtg atcgggctgt cgcggttggc gaaggatttt     76560
     tatctcaagg atgagctgcg cttggggccg agcgagacgg cgatgatttt gtcgatttcg     76620
     caagcgccgt ggttgatcaa gccgctgtgg gggtttctga gcgattcagt gccgcttttt     76680
     ggctatcgga gaaagtcgta cttgatggcg tgcggcgcgg tggggtgttt gggttgggca     76740
     tccatggcga cgtgggtgga cgcgccggag acggcgctcg tggcgttcac gctcgggtcg     76800
     ctgagcatcg cgtttagcga tgttttgatc gatagtatcg tcgtcgcaaa ggcgagaggt     76860
     gaagaacaag gggtgtcggg atcgttgcaa tcgctttgct gggggttcgt cgccatcggg     76920
     agcatcgtga gttcgtattt tagcgggagt ttgattgaat cgtacggcac gagattcgtc     76980
     ttcggcgcca ccgcggtgtt tccgctcatg atcgccggag cgtcgacgtt ggtgcaagag     77040
     aagccgatcg tcgagaccgc gcaggtgtcg agcgagggcg tgttgagtga tttcaaggcg     77100
     atgtcgggga aattgttcca agtcgccaag cggcgagaca tttgggcgcc ggcgttcttc     77160
     gtgttcttgt ggcaagcgac gccgagcgct gggacggcga tgttttattt caacacgaat     77220
     gagctcggat tttcgccaga gttcttaggc cgcgtggccc tcgtgcgcgc gttttgcgcg     77280
     ctcggcggcg tggcgttgta caacggttac ctcaagcgcg taccgctcaa aaagatgttt     77340
     ttgtggacct ccatcttggg caccgcgctc ggctccactc aacttttact cgtgagtcgc     77400
     atgaatttag agttagggat tagcgataaa gtgttcgcgc tcaccgacac cgcggtgttg     77460
     acggttttgg gcgaagtgag cttcctgccg gtgctcgtct tggcggcgaa aatttgcccg     77520
     gagggcgtag aggcgacgtt cttcgcggcg ctcatgtctc tcttcaacgc cggcggcgtg     77580
     acgagcgagt ttctgggcgc tgggttgacc aaatcgctcg gtgttaccgc ggacaacttc     77640
     gacaacctct ttttgctgtt gtccatttgt ctcgtcaccg gtttactccc gctcgcagcc     77700
     atcaacctca tagacgaagt caaggacgac gacgcggacg acgtcgagtc ggcgcaaaag     77760
     aacgcgtgag ttagtttaag agcgcgacgt agacgtagaa attattacat tatttactac     77820
     agactcgtgt aaccgccatt cgcgcgcaac ctcgcctcga acttggtcgc accgcggagt     77880
     cgaaccgcga gacgagcgcc cttcggcgcc gccgaccctc ttgcgacggg accctccggc     77940
     tcgccttctg aggcggcctt cacagggaaa atatatacgg gtgatctaag gaagtagaaa     78000
     actaaccaat aattgccgcc gtgcagtgcg gttcgttcgt tcgttttgtt tgcctatgtt     78060
     ctgaaaaacg ttggaggaca aattttgatc taccgcagga taccgtgttt tgttttgcgt     78120
     gaggctgaaa gatggtcgaa acatgcatgt tgtgatctgg aggatcgagc gcgtaaacga     78180
     gtaaacaaaa gaggttcacg taaacctgat caagagcgcc cataataaat gctatcgaag     78240
     caagcatatc aacatgatgg atgactgcgg agaataaatc caagcgaagc gcgcgaagcg     78300
     cgtgaatgat aaagaacaaa cagacaaact ttttctcgca ctatcggcga aggaggatcc     78360
     aaaataacgc atcggcgatc tacgaatgaa acgacgcgac gcttgaaaac actcaaaaag     78420
     caaacctcgt ccaaagcgcg acgaaacgtg cgaaaaacgc gcgcgcgtcc gcgttcgcgg     78480
     tgacattctt tctgcgcgtc gcgatcaaac gtaccgcccg agggcgaaca acggtaaacg     78540
     gtaaacatag agtgcgcgta cgctatcttc gtcgcggaaa tcgcgcgccg cgcgcctgcg     78600
     ttcgcgtgcg tgcacgagtt tttttttttt tcgccctaac gaatgaatga atgcgtgcgt     78660
     gatcgattca cgcgagatct cccgccgtcc cgctcgcgcg cgcctttccc tgccccccgc     78720
     gcgagcgctc gagcgccgcc tcgccctcgc gcgcgctcgg agcgtcgacg cgcgcgcgac     78780
     gcatcgcgcg cgcgtcgagc tgccgcgccg atcccttcgc ccgcggggtg ccctcggggt     78840
     cgcgcatatt cggacattcg gacgatttac gacgcacgcc gcgctcccgc gatggcgtcg     78900
     aagacgtccg cagtatggcg cgcaccgccg cgcgcgtcct cgcgtcgccg acgccgtcgc     78960
     cgcgccgcgc gcgcgcgccg cgcggtgcga cgcgcgccgc gatgtcgtcc tcgacgtcgt     79020
     acgtcccgcg gggcccgatc gagcgcgcgc gcgtcgccgt cacgggcgcc aatcgcggga     79080
     tcgggctcga gctctgtaaa gcgctgctcg cgcgcgaaaa cgtcgtcgag gcggggtgtc     79140
     gacgcgcgag cgacgcactg cgcgcgctcg agcgctcgag cgatggacgg ttgatcgtca     79200
     gcgagggcgt ggacgtcggc gacgacgcgg cgatcgacgc gtgggcgagg gcgatgacga     79260
     cgcggggacg acgactggac gtcgtcgtca acaacgcggg cgtcgtcgga acgaacgggt     79320
     acgacgcgtg ggatttagag acgacgacgg cggaggagat gatgtacgtg tttaaaatta     79380
     attgcgtcgg gcccacgctc gtggttcgag cgctgctgag acacggattg atcggcgcgg     79440
     acgcgaacgc gccgtcgctc gtgggcaacg tgacgtccaa agtcggaagc gtcgaggaca     79500
     acggatcggg tcgaggatac agctatcgcg cgtcgaaatc ggcgttgaac atcgtcacga     79560
     aatctatgtc catcgattta gcgagccgag gcgtgcattt cgcgctttta caccccggct     79620
     gggtgaaaac ggacatgacg gagagcagag gcctcatcga cgccgaagag tcggcgcgcg     79680
     gtctcatccg cgttttgcag ggcgaattcg gcgattgcga gcggttttgg ttcgattaca     79740
     agggcgacaa gattccttgg tagcgcattt cgtgtcatcg acgcacgcgt agactccgaa     79800
     cgcgcccctt tcgcccgccc gaaacgccca aagcgccccg ctcgacatcc acgtggaaag     79860
     cgtcttatcc gcgtcaccgc cgcgaaattc ggtggtcgat cgcgttcgtc acacgcgcgc     79920
     gcgtcgagca cgcgcgattc gcgccgcgag cggcgcgctc ggcgaaagaa atttttgcgc     79980
     gtcgaatcgt cgtccgtcat ggaccgcgtg ccgagcgcgg acgacctcat ggcgacgttt     80040
     ctgtggaacg cgcagcgcgc gagcgcgggg acgccgtcga acgggacgtc cggcgccgcg     80100
     gcgcacggcg cgcgcggcgt gaaccgcacg ccgtcgcagc acgagatgga gagttattac     80160
     aacgccatga tggcgagcgc ggcgcacggc gcgcacgcgg gattcggggc gtacggggcg     80220
     ctggatggat cgatcgcgca cgcgcgagac gccgcggggg gcgcggggag cgcgccggga     80280
     agtcgagagg gcacgccggg aatcccgcgg gtggcgtcga tcgacgtgct gcggaagatg     80340
     atcatgagcg gggggctggg ggggggcgga ggaccgggag gagcgtcgcc ggggtcggcg     80400
     acgccgacga cggcggcggc gttttcggcg ttcgcgagcg gggcgaattt ggacgcgctc     80460
     ggcgcggcgg tggcgatgga acagagcaag gccgacgatg aggggaagaa aacgacgacg     80520
     acgaggtccg gggcgaagcg ctcggggagg aaacccgcgg cgaaggcgcc ggcggcgaag     80580
     aaggcgaagg cgccgccggc gaagaaggcg gcggcggcga cgacgacgcg cggaggaaaa     80640
     gcggcgaagg acgccgtggc gtcgccagca aaggcggcgg cgaaggcgcc cgcggcgaag     80700
     gcgcccgcgg cgaaggcgaa ggcggtggcg gcgaagagcg agccgttgtc ttcggacttg     80760
     gatcacgata gcgacggcga ctctcgcgat ggcgacggca acggcgacat gcgacgccga     80820
     cgccgaatgt tgagcaacag agagagcgcc aggcgcagtc ggcgacgcaa gattgaacac     80880
     gtggccacgc tcgaagggca aatcgctcag ttgacggctg agttgacggc ggcgttgcaa     80940
     cacacgcaag gcgtggagca gcgctaccag gcgctcgtgc gagaaaacca caccattcgc     81000
     gccgagaagg atagactttt acaacttctc cgcgaggccg gtcctccggg aggtggggtg     81060
     acgacgccca agacgggttc cgccatggag cgcaaatcta gtttacagcg aatctcgagc     81120
     aacggagaca tcaagggcga gctcggcaag gggtcgccga ccatcggttt gggcacgggc     81180
     ttcgtgccgt tccgatcgtt acagagttac gaaaacctgc tcttgctcca acagaagtcc     81240
     gagaagcagt gaatccggcg tcgaatccat tgtattgcgc accattcatt catcctagcc     81300
     acgacggtga ctcacgcgcg cgcgcagtcg ccactcttcg acgcgtccac catgtcgccg     81360
     gcgctcgcgc cgttcgccgg cgcgccgttc gcgcgcgcgc gccgtcccgc gccgacgcgt     81420
     cgcgcgtcgc gcgcgcgcgc cagagagagc gacgacgccc gcgcgtcgct gtcgtcgctc     81480
     gacgcgattt tatccaccga cgccgaccgc gcgtcctcga gcgacggcgc gtcggcgcgc     81540
     gacgacgcgc cgagcgacgc cgcgacgccg actcgagtgg tctcgcgcgc ggtcgacgtc     81600
     gcgctcgacg acgacgtcgt cgcgcgggtc gagctcgagg tgcgctcggc gacgtcgcgg     81660
     ttgacgcgcg cgacgatgaa atcgccgctc ggcatcgtct tcgaagacgt cgacggcgac     81720
     atcgcggtgg tcgagtttta cgacgagagc gatctgggac cgcgcgggcg cgggatcagg     81780
     gagggagacg tgttgcgcgc gacgtcggcg atgattccgg agatgcggta tccaaagttg     81840
     aacgtgatag gcggcggcgt cgggcgaccg ggatggcgtc gggtgatgta cacgtgcgcg     81900
     tcgtcgcagg acggtaactt ggacgacgtg acgttcgatc aggcgatgaa agcgatcggg     81960
     tcgaacgcca aggcgggaaa ttacgacgtc gagctcgtgt ttgaacgccg cgcgtgaacg     82020
     ctcgccgcgc gatgacgcgc gcgaataaag acagagagcg caagcaggaa aaagggaccg     82080
     gcgtcgaaac cgaccgcgcg tcctcgcgcg cgccccgtag agccacttta gcgttgtcac     82140
     gaactttcct ttgcgtttcg cgcgatcgcg cgccgtcgcg agcgcgccgt cgcgcgcggc     82200
     ttccgcgcgc gcgcgcggaa ccaggcaccc ccctcgtccc cgagatctcg gccctcgcgt     82260
     gccgcactcg tcgtcgcgcg cgacgacgcg cccgagcgcg cgcgcgcttg gagcgaaaga     82320
     aacaacgtcc cgcgcgtcgt catcgccatg gacttcgacg actggttcgc gaacgacgac     82380
     gagttgcgtc ggatgtccgt cgaggcggat gccgcgcgca cggcgcggga tgacgccgaa     82440
     cgcgcgcgcg gcgcgcgcgc gagcgcgagc gcggagaccg cggtggcgat cgatgacgtc     82500
     gcgcacaccc cggggggcga attcgaggcg atggaacgag aactcgaaca aatcgtcgac     82560
     gaggagcgca gatccggatt cgaaagcgac gacgacgacg acggcggatt cgacgatgat     82620
     ttgatcgact acgatgacga ggacgaggat gaggacgacg acgatgattt cgacgatgcg     82680
     ttcgtcacgg acgagtattc gttttcgagc gactcgcact cctcgatcga tgagacgcag     82740
     gagggtgaag tgcagcaaac gcaagaggcg ttcgagacgg tcgtcccgga gacgcaagta     82800
     ttgatttcgc agcaggcgaa cgatgatgtc gtcatcattc cggacgaaga cgcggacgag     82860
     attccaccgg gcgtgaacga cgcgatcgaa gtgcgcgatg cgaacgcgct gccgactgag     82920
     gatttaatcc ggttgctcaa ggaacgtatg aggtctggcg aagcgaggga gatcgaggcg     82980
     aggttggaga gtgaaggctt cgttcgggcg gatcgcgatg taccccgtgc tacgccagcg     83040
     caaacggagc cgatacgtcg gcgcggacgt ggccccgacc gtagaccacg aaagaggaga     83100
     cgccgcgtcg tcgagcctgg gcaacggacg cttcacgacg ttggcttcgg gacgggcgct     83160
     gaaaacggcg ccgaaagggc tgtcgacgat gacgacggtg acatcgtcgt agaaggtgtg     83220
     tcgcgtcaca tcccacgact cgatcgacct cccgtgccat cgactgttga tgagctttac     83280
     gatgtttggg agcgcacggc gaaggatctc gttccgcgag acgcatctat ttacagtaat     83340
     tttcggtatg cgttcggaga cgaaagcgaa cgcggcgagc gttatcgcga gaaagaaatg     83400
     aaggatatcg gaaatctgct gttcaaatat aaagcggaca aaaagcctgg acagcacgca     83460
     atgctcaaag gccgcgaacg cgagggtaag acgggcgcgt tgttttccat aactctcgca     83520
     gccttactct tgaacatccg cgtcgtcatt ctttgcgcgc ctttgaaggt tgcgccgatc     83580
     tgcgacatgg tacgaaagct cagacgtgct ggtttcgggc gtatgtacga cacgcagcac     83640
     acgctcggac cggtgcaagc caaaagaaat aagatcccca gcgctcaaat gggacaaata     83700
     tacgtcgcct ctctttgtac gttgggagat ttgaaaaagg tgaagaactg gatcaactgt     83760
     cagaaacgag acggtcagtt gacgttgacg ctcatggatg aatgcgacga gctcactcaa     83820
     ggaaaggggc acagtacaat agagattgag cacagagtag acccagacac gtttgcgcag     83880
     tacatccgtc aagaaagacg cggtgaagat tatgaagacg tgctcgatgt accaagcgat     83940
     cgaaaggcga gagggaagaa tttcaaagcg caaatcgcaa aggcatccca atattttcga     84000
     cagcacgtgc atcccgagac gcaagtgatc gcgtgctctg cgacgctgag cggctacgtc     84060
     ttgaatccta ttggcgtctt ccgtaacgat ttgccgacga gtattttcaa agtgtttcca     84120
     aaggatggat actgtggcat cgaaagattc aaaatccccg aaggctgcga gctcgaacac     84180
     gacggcaatt tatccttgga ggctttcagt gagtcgaacg ctgtgggaaa gttactacaa     84240
     cgcttttata cgcgaagaaa cgaatgcgat gggcaacgtc tccaaccttt gccagggagc     84300
     tcagcgaccg aaatcgcact tcgtggtatg ctgtttttat cgtgcacccc gaaggtgaac     84360
     gtgcacggcg gcgtgcatga tctcgcaaaa acggtgacac aaatggttga ttcttggggc     84420
     actggcatca gttcacagaa gactctattt atttgctacg ttggatcgcc gcgggtactt     84480
     ttcgcgggta gttggcagtc gatgcccagt ggatattcgt ttgaagctat ttacaacgaa     84540
     accgcgtctc gtgtgaaaaa agagaaattt gcgaacgttt cccttcgaaa agacgagcca     84600
     ttcagcaaag tttgcacgca cgtcgtcctc atcggctata atctcacgcg tcgcgcgatg     84660
     acggcggcgt tcactccgaa agacgaacct ggagtactgt gcaaaatcca atatggcatc     84720
     atcactgcgc cgaagacaac ggcagtcgat accacgagcc aacgagtgaa