(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_1

ID   PENCW_1; SV 1; linear; genomic DNA; GRV; FUN; 8770 BP.
XX
AC   AM920416_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c01, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920416.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8770
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(<91..183,214..339,769..971,1001..1460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950830"
FT                   /orf_name="Pc01g00010"
FT                   /product="Pc01g00010 protein"
FT                   /protein_id="CAP74090.1"
FT                   /db_xref="UniParc:UPI0001830628"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP5"
FT                   /transl_table=1
FT                   /translation="SDDFDFARHKAYRMADLTQANRSAPHHMLLHLNQWIYYPYRIEAV
FT                   CQLHRVIRMGLEIFAYEIESIVIDTFIHDSPLLRSMICYTSGYWGHARLWLFTSVSVRN
FT                   GLVGPGLVVRINQVDIASSNRTLGSDDALNAHYAQLGTLLPHIQMSPWKIHITIVLNNP
FT                   AVLFSLEKPHLQGGQALIILITEEIIQLSKMGAKVNLQPPTEEDNEHTARTHSLAREAT
FT                   VENSEVNTPPWARTQLRASALRRARANAKQHRKDNFQQSTTGQFTRQLDSALPGPHTKM
FT                   LYDCLKSRRRRY"
FT   CDS_pept        join(1491..1587,1666..1768,2023..2192,2425..2490,2
FT                   560..2747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950831"
FT                   /orf_name="Pc01g00020"
FT                   /product="Putative uncharacterized protein Pc01g00020 "
FT                   /protein_id="CAP74091.1"
FT                   /db_xref="UniParc:UPI0001830629"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP6"
FT                   /transl_table=1
FT                   /translation="MGIFIELAKVIAIRASVASSAKRSSASYFGAHGRESVDGTSEPNG
FT                   RAWKPDIKIVKAVIAFAMATQRRLNVTDDWIASAPLEGHGGVDFQPTFLNRLGISISQH
FT                   DPHSSPTEHLNGTKKVAAQNQDIVQCAVTAAPAPWPTELATVEWYHDDKRGLRIVQKLC
FT                   RWLDLYKHLAYLEHQQEYIILAEYHVFHRKGKTKPNRTCKAVSI"
FT   CDS_pept        join(complement(5970..6141),complement(2787..5701))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950832"
FT                   /orf_name="Pc22g25890"
FT                   /product="Pc01g00030 protein"
FT                   /protein_id="CAP74092.1"
FT                   /db_xref="UniParc:UPI00018306EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP7"
FT                   /transl_table=1
FT                   /translation="MFDVQDLGSTPCLDQIPLDEPISVCGTSPSGAILASTTSVPSQVT
FT                   RYSCIPSPGPRSSPTVRNYQPDLPSKHRFFNMALPELAWLTSGPLPSKPRGGSGPRHQA
FT                   RSADTAEIPGRNESLVDLVPSFQTQKMTAQPIAPQPQPQCQPQPQPSDKQTALPVAISP
FT                   IESKPGPKQDLKPFHRRLLQLAQRPKRKSTSNSRKQKQQLQIEALIREGYLIPAHLPKV
FT                   SKGQKEAKQLKGSLSLSVSRSLSKSKKDVENIGQPWLEAKADDRKRPTEVICRLESLDL
FT                   DNFGSMVDVAVPPASDFDVLVPPPYRSTDSGPSQSSSTMPMSSSMAEANPFNIIKPASS
FT                   LASTSHYYRNVSIDEQVQRPSSSEEPNTRATSQNTKSVSKATSNAPAGANDTASQPRAS
FT                   CDSFRGDQIDQSSVRNVTPSQHTLTLFPDVVPPRKSSMAAWRASEVPRYQTINNVAGFP
FT                   ALPISSSQSGSSDNTTEFSGDSRTSSDVFTDIPASVTEPRCSGPLVHRAASAAAASAEK
FT                   APNEPASPDTVKARPSSFSMNTLKTFPPPAPTRPPPSLPEFERSPSVPPDFPARSIRFV
FT                   RSGPISSTSQTSSEVVPEAQETESVIDSARMLDSCPAAVLGSIEAGGSMADDEQSLYAL
FT                   SISDYYRPTPGVYTARGGASSIRIPRMQELPETRNLVKASEGQPLADYPVLRHGTPTQT
FT                   NAKHALKGLHNNYQVFQKNISFGLPSPPPTAPLPPAPPPQNPPPPPPGCRIGQGNATAP
FT                   HAAEFSPMKSIWVSDGPGFSRNSMVSQNDSSRCSRRNKSSPDSYEESRPESRRESRVSS
FT                   SGDEFFSPAEDFQPSRREPSQHMDLQAVCRGYETADANQTSSRPRLRYPQSTHSMTPQS
FT                   HSNHNLERTLSQSRTSQSTQRSGVSQNSHSPRASPAQIDHYLEGRVANLERQNQIFQAA
FT                   LIVALNATGKDPLESLNLDPNMTPAFQHDPYASNYSSRHSSRWISFSRSSEHSGFKTSS
FT                   SYKDGRANAKQLDNMVEDIESRWMSDKSSLSGARIIRKR"
FT   CDS_pept        join(6300..6388,6507..6578,6764..7037,7227..7325)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672443"
FT                   /orf_name="Pc01g00040"
FT                   /product="Putative uncharacterized protein Pc01g00040 "
FT                   /protein_id="CAP74093.1"
FT                   /db_xref="UniParc:UPI00018306EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP8"
FT                   /transl_table=1
FT                   /translation="MPIAFAPFFLPLMQGGKPSTGTEWKDVSPLQIEAVDHREMSFNSS
FT                   HAQMQLCSFLLQSDKPNLARPERELGLRYGRLRGPVHGRKGHSNIASQSKALNPIQERA
FT                   LRSCVISVHRAYCLSYSDITERAANRLLERAGSDRLVAHNWTSLALCRCWSTAKSWRFV
FT                   NGGENVRNAVQKIS"
FT   sig_peptide     6300..6344
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP8 "
FT   mat_peptide     join(6345..6388,6507..6578,6764..7037,7227..7322)
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP8 "
FT   CDS_pept        join(<7354..7397,7505..7980,8047..8088,8331..8399,
FT                   8475..8611,8670..>8770)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950833"
FT                   /orf_name="Pc01g00050"
FT                   /product="Putative uncharacterized protein Pc01g00050 "
FT                   /protein_id="CAP74094.1"
FT                   /db_xref="UniParc:UPI00018306F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVP9"
FT                   /transl_table=1
FT                   /translation="MDFSFLKRQQLSSPIRSTDTAKDAIPITTIPTTLQIKPSLPEINL
FT                   LDHQISMARGSTMALETTQPRLRESKTQPEMSISELKAERIQAQPSQLKSQKYHPIPSH
FT                   LLLRIAQVLDVYERAETNQAEYTKLSSRHQKCLLWNRCLVDLDPKHPFLYQTPRNIQKV
FT                   AYALDVTETADSVHPCVDYPFGIKFTNAEITYNVAATPKCRSRSDILGLSDLQSPTEAL
FT                   TSTTQGRAESIASRCSVEPQMIFQAAPHQMLLHLSGVCIRPGQSNWGLHANSTSDQKGT
FT                   RDGLQDRI"
XX
SQ   Sequence 8770 BP; 2257 A; 2057 C; 2282 G; 2174 T; 0 other;
     ctctgtggta aaattacttt gattcttgcg ctctttggga tataagagct gaaatagggt        60
     aaggccgagt gactcacaat cgccgcctgt agtgatgact ttgacttcgc aaggcacaaa       120
     gcctaccgca tggctgatct tactcaagcc aatcgttcgg cacctcatca catgcttcta       180
     catgtgggtc ttcggcgtat tgcttggtca tagctgaacc agtggatcta ctatccctat       240
     cggattgagg ctgtatgcca acttcaccga gtgatcagaa tgggactaga aattttcgct       300
     tacgaaatag aatctatagt gattgataca tttatccatg tgggtgagat ggcatgaaaa       360
     tctccgtact acgttggtga gacattgata gacctcgcca cgggccatga ggcccatgga       420
     ttcgcactga gttatttccc ccctgcctat gggcgggcgg gcggttgacc atagccccgt       480
     cccgtgtcat ttaatagtgc tacgtattca ggttatttga gtagaaaggt atacaatgga       540
     tgtgttcagc tataaccaaa cctagtaaaa gcaatggact atcgagtcta agtgaaattg       600
     aaagtgtgat ccgaaatgca tagaaattgc gatgcgtctg cattgcgtgt aaatatatat       660
     atgactacaa aacatgctga acctacaaat ccactcacaa tataatgtct accagtcgca       720
     tcagtaaatt tactacaaac acgacatatt aattatacta catactagga ttcaccttta       780
     ttacgatcaa tgatctgcta tactagtggt tattggggcc atgcccgcct gtggctgttc       840
     accagcgtca gcgtccgcaa tggtctggtc ggacctggac tagttgttcg cattaatcaa       900
     gtcgacattg cctcgtcgaa tcggacgctc ggcagtgatg acgcgctcaa cgctcactac       960
     gcgcagctgg ggtggtgtta aaggctgtct cgtacatcag gacgctgctc cctcacatcc      1020
     agatgtcgcc gtggaaaata cacattacga ttgttctgaa caaccctgcc gtcctgtttt      1080
     ctcttgaaaa accccatctc cagggcggcc aagctctcat catcctgatc actgaagaga      1140
     ttattcagct gtcgaagatg ggcgctaagg tcaacctgca gccgccaacg gaagaggaca      1200
     atgagcatac agcacgaacg catagcctag cacgcgaagc aacagtagag aacagcgaag      1260
     tcaacacccc gccatgggcg cgaacccagc tccgggcgtc ggcgttgcga cgggcacggg      1320
     ccaatgctaa acagcaccgg aaggacaact tccaacagtc gaccacgggc cagtttacac      1380
     gccagctgga ttcagctctc ccaggacctc acacgaagat gctatatgat tgcctgaaat      1440
     cgagaaggcg tcgttactag cccaactccg cacggggcat gccagactca atgggtatct      1500
     tcatcgaatt ggcaaaagtg atagcgattc gtgcgagtgt ggcatcgagc gcgaaacgat      1560
     ccagcgcttc ctacttcggt gcacacggtg ggacgaacag cgtcgagagc tgattgagac      1620
     agcagggcct cattttggca acctaccgcg gacgttaggt ggaaggcaga gagagtgtag      1680
     acgggacaag cgagcccaac ggaagagcat ggaaacccga tatcaagatc gtcaaagctg      1740
     tcatcgcgtt cgctatggcg acgcaacggt tgcttgttgg aggacgaagt tgaatgatgg      1800
     ctgccattac aaaagatcgc gcagtggtca acccaccaaa tgtacatatt caacggagca      1860
     gtacacacta gctagggggc tttttacgac ctaaggtcgt aaaaagcctg aggaatcaat      1920
     aataataata ataatacaac caaagtaaag cgaggctggg aatgctaatt catgactccc      1980
     agtgaataaa tcgtaggacg gtttggtgat tcaatgtgac agtcgactca acgtcacgga      2040
     tgattggata gctagtgcac ctttagaagg ccacggaggg gttgatttcc agccaacgtt      2100
     ccttaaccga ctcggtatca gtatttctca acatgaccct cactcgagtc ccactgagca      2160
     tttaaatggc accaagaaag tcgcagcaca aagtgaggct ttctaaaata taaatcacgg      2220
     tcggttcttt ctctccacag ggttttcttt caattccaag aaagtcaaga cggggatgat      2280
     aaaatatacc tagcaaaagc gagcaagaag cgtcactccg caacaaggga atgctatcta      2340
     tcagtctatc aactatcaat ctatgtatca gtgtattgct ctagcaaatt caaaacctaa      2400
     cttgatgtaa gcaaatcgga aaagatcaag acatcgttca gtgcgcggtg actgctgctc      2460
     ctgctccttg gccaactgag cttgcgacag gtcttgagct ttgctattct gggcatatgt      2520
     ttccagttac aggtgataat gatacttgtg catagatagt ggaatggtac catgacgaca      2580
     agcgaggcct tcgtatagtg cagaagctct gccgttggct tgatctatac aaacacttgg      2640
     cttacttgga gcatcaacag gaatatatca tactcgctga gtatcatgtc tttcacagaa      2700
     aaggcaaaac aaagccgaac agaacttgca aagcagtctc catctgaagc agggaaaaat      2760
     atgaaaaggg atcaaaagat cgttgtttat cgtttgcgga tgattcgagc tccactgaga      2820
     ctggacttgt ccgacatcca tctagactca atgtcctcga ccatgttgtc aagctgcttg      2880
     gcattggctc ggccatcttt gtatgagctt gaggtcttaa acccactgtg ctcactgctt      2940
     cgagaaaagc tgatccagcg ggaggaatga cggcttgagt aattgctggc atagggatca      3000
     tgttggaaag ctggtgtcat gttcgggtca agattgagac tctctagggg gtccttgccg      3060
     gtagcattaa gcgctacaat gagggcggct tgaaaaattt ggttctggcg ctccaggttt      3120
     gcaacgcggc cctcgaggta gtgatctatt tgagccgggg acgcgcgtgg gctatggctg      3180
     ttttgagata ccccggatcg ctgcgtcgat tgagaggttc gtgactggga caaagtcctc      3240
     tcgagattgt ggttgctgtg gctttgtggt gtcatagagt gggtagattg agggtaacga      3300
     agccgcgggc ggctagacgt ctggtttgca tccgctgtct cataccctcg acatactgcc      3360
     tgaaggtcca tgtgttgact gggctcgcgg cgcgagggct ggaagtcttc tgcaggactg      3420
     aaaaactcat cgcctgatga ggaaacgcga gactcacgtc gagactcggg gcggctttct      3480
     tcgtatgaat cgggggagct tttattccga cggctgcatc gggagctgtc gttctgggaa      3540
     accatggagt ttcggctaaa tccaggccca tcagaaaccc atatgctttt catcggtgaa      3600
     aactcagctg catgaggagc agtggcattg ccttggccaa tcctgcaccc aggaggcggg      3660
     ggaggcgggt tctgaggcgg gggagctggt gggagagggg cagtaggcgg gggcgagggc      3720
     agaccaaaag aaatattctt ttggaagact tggtagttgt tatggagccc tttcaaagca      3780
     tgtttggcat tggtttgtgt tggggtaccg tgtcttaaga caggataatc ggccaaaggc      3840
     tgcccctctg aggctttgac tagatttcgt gtctcaggaa gttcttgcat cctagggatg      3900
     cgtatgctag atgcaccccc tctggcagtg tatacccctg gagttggcct ataataatcg      3960
     gagattgaca gagcgtatag gctttgctca tcatcagcca ttgatcctcc agcttcgata      4020
     ctaccaagaa cggctgctgg gcatgagtcg agcatacgag cgctgtcaat aactgactcc      4080
     gtttcttggg cttcaggcac aacctctgaa gaggtctgtg aagtggagga tattggtccg      4140
     gatcgaacaa accgaatgga gcgggcaggg aagtccggag gaacactcgg ggagcgttca      4200
     aactcgggca atgatggcgg gggcctcgta ggcgctggcg gagggaacgt cttcagcgtg      4260
     ttcatggaaa aagaggacgg tcgggccttg actgtatctg gcgaggcagg ctcattgggc      4320
     gctttctccg cagaagctgc agcagctgaa gcggcacggt gtacaagggg accggagcat      4380
     ctcggctctg tcacgctcgc tgggatatct gtaaagacat ctgatgatgt tcgtgagtcg      4440
     cctgagaatt cagttgtgtt gtctgaagac ccggactgtg aactcgatat cggcaatgcc      4500
     gggaatcccg cgacattgtt aattgtctgg taccggggaa cttctgaagc tctccaggca      4560
     gccatgcttg atttgcgagg aggcacaaca tcagggaaga gtgtcagtgt gtgttgtgat      4620
     ggagtcacgt tgcggaccga agattggtct atttggtccc ctctaaagct atcgcaggag      4680
     gctctgggtt gtgatgctgt atcattcgca cccgcaggag cgttactagt ggcctttgaa      4740
     acagatttgg tattctgtga ggtagcacgg gtattaggct cttcggaact tgatggccgt      4800
     tggacctgtt catcgatgga aacatttctg tagtaatggc tggtagatgc tagcgatgaa      4860
     gctggtttga taatattgaa tgggtttgcc tctgccatag agctcgacat tggcattgtc      4920
     gacgaggatt gagagggccc gctatcagtg gatcggtatg gcggtggcac taaaacgtcg      4980
     aaatcggaag cgggtggaac tgcgacgtcg accattgagc caaagttgtc taagtccagg      5040
     gattccaggc gacatattac ttcggttggt cgcttcctgt catcagcttt ggcttccagc      5100
     catggctgtc cgatattttc cacatctttc ttggatttcg aaagggatct ggaaacagaa      5160
     agtgacaggc ttccttttaa ttgctttgcc tccttttgtc ccttggacac ctttggtagg      5220
     tgcgcaggga tcagatatcc ttcccttatc aatgcttcga tctggagctg ctgcttctgt      5280
     tttcttgaat tggatgttga tttccttttt ggccgttggg caagttgcag tagacgacgg      5340
     tgaaatggct tcagatcttg tttcgggccc ggctttgatt ctatgggcga tatagcaacg      5400
     ggaagcgcag tttgtttatc agagggttga ggttgaggtt gacattgagg ttgaggttgt      5460
     ggtgctatgg gttgagctgt cattttttgg gtctgaaagg agggaactaa atccaccaag      5520
     ctttcattcc tgcctggtat ttcagccgta tccgctgagc gagcttgatg ccgcggtcca      5580
     ctcccgccac ggggtttaga aggtagaggg ccggaggtta accacgctaa ttctggtaat      5640
     gccatattga aaaacctgtg tttcgaggga agatcgggtt gataattccg aacagttggg      5700
     cctggtgtga cggcacagac atgcgatgaa tcccaactat gcatagggag acgggacacc      5760
     ggatagtttc gcaatccgac cgctcgcggg cgtcgacatg atattatgtt tccaagcggt      5820
     caacgaagga actggaccta cgttttcaag caagtcagag gaacaagtcg gacggcattt      5880
     caaagagcaa gaacgaaaga cgatctggtg acgaggcaac gatatattaa tagtaatttt      5940
     cttcgccttc tgagctatcg taaccttact tgaccggggt cctggactcg gaatgcagga      6000
     gtacctcgtg acctgggaag gcacagatgt agttgaggct aaaatggcac ccgaaggaga      6060
     ggtcccgcat acagaaatgg gttcgtccaa agggatttga tccaagcaag gtgtggagcc      6120
     tagatcctga acgtcgaaca tgctgtcgat gtatacttcg atcggcatat ggcaagcctc      6180
     tttttagtaa actggataag gtctagcagc tcggtatcga atgccattgt atcacatctt      6240
     gtcacgtcct gtcgcaggga caatgctgct caaccatagg ccaatctgga attcaactca      6300
     tgccgattgc ttttgctcct ttttttctcc ccttaatgca aggggggaaa ccaagtaccg      6360
     gcaccgagtg gaaagacgtc agtcctctgt acgccacact ctatgcgagt atcatagaaa      6420
     aagaaagccc gaaactctgg gacacaaaca tattagcgca tggtccctcc aaatacaaca      6480
     aattcgagct ttcagggatc ctccaggcag atagaggcag ttgatcatcg ggagatgagt      6540
     ttcaatagct cgcacgcaca gatgcaacta tgcagcttgt gaatcactaa agtggcattg      6600
     agcataatcg tgccaagccc accgacacac cacccagtgt tggtgccccc caccgaatag      6660
     caaattttca catttacatc gacttcttac gtattttcat acccacccca caatgtcgga      6720
     acaaattgaa aataccgaga tcaaactttg aaggcagtcg aagcctgctt caaagcgata      6780
     aacccaatct cgccagaccg gagcgagaat tgggacttcg atacgggcgg ctacgcggtc      6840
     ccgtccacgg tcgcaagggg cattccaata ttgctagtca aagcaaggca ttaaacccga      6900
     ttcaagaacg ggcattgaga tcttgcgtta tttctgtaca tagagcctat tgcctctcct      6960
     actcagacat tactgagcgt gctgcaaacc ggcttttaga aagggctggt tctgatcggc      7020
     tggttgctca taattgggta taccgtttta tggaaaggct atccccagat atacgttata      7080
     ttaatccaaa acctactgaa aaatcgagcg atggtagcga gaattttgga gaattatcac      7140
     ttttggttta atagcctttc gaatatacca cccattagta tgacggtata attcgcgcct      7200
     ggaaacattg ctgaaattcc caacagacta gcttggcact atgccggtgc tggtctacgg      7260
     ctaagagttg gcggttcgtc aacggtggtg agaatgtgag gaacgccgtt cagaaaatat      7320
     cctagagcac aaattgactg cttcgcccac gaaatggact tttcgttctt aaaacgccag      7380
     caactctcgt cccctatgta cgtcgatttc agagagccga gacgtggtca gtccgcgacc      7440
     gatatgaacc cttccaacat cgaattcccg gtcactcgcg cgacaacact tcaagcatct      7500
     acagtcgatc cacagacaca gccaaagatg ctatccctat tactaccata ccaactaccc      7560
     tacaaatcaa gccatctctt cctgagataa atttactgga ccatcaaatc tccatggctc      7620
     gcggatctac catggccttg gaaaccaccc agccgcggct aagagaatcc aaaacacaac      7680
     ccgaaatgtc gatttccgag ttgaaggccg aaaggataca ggcacagccc agccagctaa      7740
     agagccaaaa ataccatccg ataccgtccc atctcctact ccgcattgct caggtgctcg      7800
     acgtgtacga acgagcggaa acgaaccaag cggaatatac gaagctatca agtcggcatc      7860
     agaaatgtct cctttggaac agatgtttgg tagacttgga tcccaagcac ccatttctct      7920
     atcaaactcc aagaaatatc cagaaagtcg catatgcctt ggatgtcact gaaactgcag      7980
     gtcagtcaag ccggccctgt gtctctgtct attgatgtca tttcctaaca tatcgcgcgc      8040
     aagcagattc tgtacaccca tgcgtcgact atcctttcgg cattaagtgt atgtttgtca      8100
     aactcaccgc gccctggacg acatctggca tataactgtt caagcagatc ctttgtgaat      8160
     atgagtttta gtctgtaaca acaccaccca gagcctgctg cgttctctcg gcagcggagc      8220
     aagcttgatc gcatgaaccc gggtactacg ccccagaaag caacgatcgg cggtttgggc      8280
     gcagtagtgg atattgatac atgggagacg gctggcgata taaattctag ttaccaacgc      8340
     ggagattact tacaatgttg cggcgactcc caaatgtagg agccgatcgg atattcttgg      8400
     ttggttttct tcgttgcgaa ttcactttca cactcgcgat ggttctagga tatagccatc      8460
     ctacagtaga gtaggcttga gtgacttgca atcgccgact gaagctctga cttcgactac      8520
     gcaaggcaga gcagagtcta tcgcatcacg atgctcagtt gagccacaaa tgatatttca      8580
     agcggctcct catcaaatgc ttctacacct ggtaggtctg atcttgagtg tacgtattgc      8640
     ctattcatag ttgaaccaac ggagggcagt ctggtgtttg cattcgacca ggtcaatcga      8700
     attgggggct gcatgcaaat tcaacgagtg atcagaaggg cactagagat gggttgcaag      8760
     atagaatcaa                                                             8770
//

If you have problems or comments...

PBIL Back to PBIL home page